F479859

General Info

Members Datasets Scaffolds Average Seq Length
766 325 613 219

Family's Representative Sequence

Representative Sequence 3300031728|Ga0316578_10191355|Ga0316578_101913552
Length 260
Sequence MISLTSLIFFAAQPRFLEQVHRTGDHMSIAAETKNRTQWARIARDGLWSNNVVLAQVLALCPLLAVTGTATNGLGMGLATTAVLVASGLLISMLRGLITPEVRIPVFVLIIAVLVTLVDLGLNAWLHDLHKVLGLFIPLIVTNCAILGRAESFASRNRVMPAAFDGLAMGLGFTCVLVVLGAIREIIGSGTLFANAATLLGERMSFMEVTLIPDYRGFLLAILPPGGFLALGFMLAGKRLIDARIAASKRRETGVQAATA

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
4 2506520008 Serratia plymuthica AS12 Isolate Unclassified
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2511231025 Pantoea sp. YR343 Isolate Rhizosphere
7 2511231035 Pantoea sp. GM01 Isolate Rhizosphere
8 2537561728 Pectobacterium wasabiae CFBP 3304 Isolate Rhizoplane
9 2547132181 Kosakonia sacchari SP1 Isolate Stem
10 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
11 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
12 2561511199 Enterobacter sp. R4-368 Isolate Nodule
13 2565956521 Vibrio rhizosphaerae DSM 18581 Isolate Rhizosphere
14 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
15 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
16 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
17 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
18 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
19 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
20 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
21 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
22 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
23 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
24 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
25 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
26 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
27 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
28 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
29 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
30 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
31 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
32 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
33 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
34 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
35 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
36 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
37 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
38 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
39 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
40 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
41 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
42 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
43 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
44 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
45 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
46 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
47 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
48 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
49 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
50 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
51 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
52 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
53 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
54 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
55 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
56 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
57 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
58 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
59 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
60 2636415599 Klebsiella variicola DX120E Isolate Unclassified
61 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
62 2654587920 Serratia plymuthica HRO-C48 Isolate Rhizosphere
63 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
64 2671180115 Cedecea sp. NFIX57 Isolate Rhizoplane
65 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
66 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
67 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
68 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
69 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
70 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
71 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
72 2738541276 Cellvibrio sp. YR554 Isolate Unclassified
73 2751185917 Enterobacter sp. HK169 Isolate Unclassified
74 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
75 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
76 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
77 2775507074 Klebsiella sp. D5A Isolate Unclassified
78 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
79 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
80 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
81 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
82 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
83 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
84 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
85 2821118458 Enterobacter asburiae 609 Isolate Unclassified
86 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
87 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
88 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
89 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
90 2847085930 Erwinia persicina B64 Isolate Bulb
91 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
92 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
93 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
94 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
95 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
96 2865014394 Pantoea sp. R-71966 Isolate Unclassified
97 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
98 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
99 2871282230 Pectobacterium parmentieri SS90 Isolate Stem Tuber
100 2876601092 Pantoea endophytica 596 Isolate Unclassified
101 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
102 2881714928 Pseudidiomarina mangrovi ZQ330 Isolate Rhizosphere
103 2884086401 Kluyvera sp. PO2S7 Isolate Rhizosphere
104 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
105 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
106 2891670763 Buttiauxella sp. B2 Isolate Rhizosphere
107 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
108 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
109 2904504865 Serratia marcescens 1822 Isolate Unclassified
110 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
111 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
112 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
113 2919150387 Rahnella aceris 1817 Isolate Unclassified
114 2919497567 Shewanella putrefaciens 3469 Isolate Unclassified
115 2919688452 Pararheinheimera soli 4138 Isolate Unclassified
116 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
117 2927143783 Rahnella sp. 2050 Isolate Unclassified
118 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
119 2932406140 Serratia sp. 2723 Isolate Rhizosphere
120 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
121 2937539931 Pantoea sp. LS15 Isolate Unclassified
122 2937967321 Serratia sp. YC16 Isolate Unclassified
123 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
124 2939577877 Serratia sp. 509 Isolate Rhizosphere
125 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
126 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
127 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
128 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
129 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
130 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
131 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
132 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
133 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
134 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
135 2978975091 Pantoea anthophila SORGH_AS 797 Isolate Unclassified
136 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
137 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
138 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
139 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
140 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
141 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
142 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
143 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
144 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
145 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
146 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
147 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
148 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
149 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
150 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
151 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
152 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
153 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
154 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
155 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
156 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
157 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
158 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
159 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
160 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
161 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
162 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
163 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
164 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
165 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
166 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
167 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
168 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
169 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
170 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
171 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
172 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
173 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
174 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
175 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
176 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
177 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
178 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
179 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
180 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
181 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
182 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
184 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
185 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
186 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
187 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
188 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
189 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
191 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
192 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
202 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
205 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
206 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
207 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
208 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
211 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
212 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
213 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
214 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
215 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
216 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
217 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
218 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
219 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
220 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
221 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
222 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
223 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
224 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
225 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
229 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
230 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
231 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
232 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
233 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
234 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
235 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
236 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
237 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
238 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
239 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
240 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
241 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
242 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
243 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
244 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
245 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
246 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
247 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
248 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
249 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
250 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
251 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
252 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
253 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
254 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
255 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
256 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
257 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
258 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
259 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
260 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
263 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
266 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
267 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
268 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
269 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
270 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
271 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
274 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
275 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
276 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
277 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
278 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
279 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
280 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
281 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
282 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
283 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
284 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
285 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
286 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
287 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
288 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
289 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
290 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
291 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
292 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
293 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
294 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
295 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
296 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
297 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
298 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
299 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
300 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
301 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
302 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
303 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
304 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
305 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
306 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
307 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
309 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
310 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
311 640753048 Serratia proteamaculans 568 Isolate Endosphere
312 8004592986 Serratia sp. S119 Isolate Unclassified
313 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
314 8016733728 Pantoea sp. SORGH_AS 659 Isolate Unclassified
315 8018221730 Enterobacter sp. CM29 Isolate Unclassified
316 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
317 8019499862 Kluyvera sp. 1366 Isolate Rhizosphere
318 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
319 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
320 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
321 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
322 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
323 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
324 8055693939 Hafnia alvei A23BA Isolate Rhizosphere
325 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.24
Metatranscriptomes 0.78
Isolates 19.97

Biome Distribution

Category Percentage (%)
Aerial Root 0.52
Bulb 0.13
Endosphere 4.18
Nodule 2.61
Rhizoplane 8.36
Rhizosphere 54.44
Stem 0.13
Stem Tuber 0.78
Unclassified 28.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_FSXC12704_b1 2010549000 Bacteria 767
2 SwRhRL2b_contig_1402837 2162886007 Bacteria 1881
3 SwRhRL2b_contig_298608 2162886007 Bacteria 1881
4 SwRhRL2b_contig_3175571 2162886007 Bacteria 2645
5 JGI25162J39368_1003729 3300002737 Bacteria 4103
6 JGI25163J39215_1000150 3300002771 Bacteria 27415
7 JGI25164J39214_1000002 3300002772 Bacteria 406570
8 JGI25152J39213_1000258 3300002773 Bacteria 35248
9 rootH2_10040041 3300003320 Bacteria 15643
10 rootH1_10014039 3300003323 Bacteria 23324
11 rootH1_10020223 3300003323 Bacteria 12809
12 Ga0055538_1000015 3300003751 Bacteria 311166
13 Ga0055539_1000009 3300003752 Bacteria 406566
14 Ga0055533_1000012 3300003756 Bacteria 406566
15 Ga0055525_1000014 3300003759 Bacteria 406566
16 Ga0055541_1000006 3300003841 Bacteria 406566
17 Ga0058692_1000066 3300003856 Bacteria 89302
18 Ga0058692_1000072 3300003856 Bacteria 77728
19 Ga0058692_1000667 3300003856 Bacteria 14152
20 Ga0058692_1000890 3300003856 Bacteria 11762
21 Ga0058692_1002215 3300003856 Bacteria 6622
22 Ga0058692_1002637 3300003856 Bacteria 5907
23 Ga0058692_1004426 3300003856 Bacteria 4165
24 Ga0065704_10000297 3300005289 Bacteria 43486
25 Ga0065704_10001850 3300005289 Bacteria 11098
26 Ga0065704_10002897 3300005289 Bacteria 5039
27 Ga0065704_10004737 3300005289 Bacteria 6086
28 Ga0065704_10082935 3300005289 Bacteria 3532
29 Ga0065704_10142773 3300005289 Bacteria 1502
30 Ga0070658_10176678 3300005327 Bacteria 1796
31 Ga0070659_100187251 3300005366 Bacteria 1700
32 Ga0070665_100017241 3300005548 Bacteria 7248
33 Ga0068857_100000773 3300005577 Bacteria 23816
34 Ga0068851_10314340 3300005834 Bacteria 903
35 Ga0075364_10003017 3300006051 Bacteria 9511
36 Ga0075364_10004940 3300006051 Bacteria 7724
37 Ga0075364_10011406 3300006051 Bacteria 5399
38 Ga0075364_10087685 3300006051 Bacteria 2063
39 Ga0079104_1000083 3300006946 Bacteria 137254
40 Ga0079104_1000218 3300006946 Bacteria 80243
41 Ga0079104_1000292 3300006946 Bacteria 63382
42 Ga0079104_1000716 3300006946 Bacteria 29970
43 Ga0079104_1000733 3300006946 Bacteria 29076
44 Ga0079104_1001649 3300006946 Bacteria 14439
45 Ga0079104_1002113 3300006946 Bacteria 11343
46 Ga0079104_1002597 3300006946 Bacteria 9472
47 Ga0105251_10000002 3300009011 Bacteria 350843
48 Ga0105251_10000189 3300009011 Bacteria 62590
49 Ga0105251_10000304 3300009011 Bacteria 49243
50 Ga0105251_10000462 3300009011 Bacteria 38817
51 Ga0105251_10000668 3300009011 Bacteria 31643
52 Ga0105251_10002952 3300009011 Bacteria 12743
53 Ga0105251_10005550 3300009011 Bacteria 8209
54 Ga0105251_10007017 3300009011 Bacteria 7028
55 Ga0105251_10008865 3300009011 Bacteria 6022
56 Ga0105251_10010847 3300009011 Bacteria 5249
57 Ga0105251_10013045 3300009011 Bacteria 4667
58 Ga0105244_10000014 3300009036 Bacteria 257018
59 Ga0105244_10000015 3300009036 Bacteria 256814
60 Ga0105244_10000645 3300009036 Bacteria 30769
61 Ga0105244_10000960 3300009036 Bacteria 24197
62 Ga0105244_10001340 3300009036 Bacteria 20097
63 Ga0105244_10001722 3300009036 Bacteria 17235
64 Ga0105244_10002696 3300009036 Bacteria 13279
65 Ga0105244_10003108 3300009036 Bacteria 12126
66 Ga0105244_10005769 3300009036 Bacteria 8160
67 Ga0105244_10017463 3300009036 Bacteria 4053
68 Ga0105244_10019647 3300009036 Bacteria 3766
69 Ga0105244_10038334 3300009036 Bacteria 2500
70 Ga0105244_10144342 3300009036 Bacteria 1143
71 Ga0105244_10151582 3300009036 Bacteria 1110
72 Ga0105250_10000002 3300009092 Bacteria 566949
73 Ga0105250_10000113 3300009092 Bacteria 72385
74 Ga0105250_10000619 3300009092 Bacteria 23016
75 Ga0105250_10001565 3300009092 Bacteria 12295
76 Ga0105250_10001871 3300009092 Bacteria 10954
77 Ga0105250_10002837 3300009092 Bacteria 8494
78 Ga0105250_10004884 3300009092 Bacteria 6095
79 Ga0105250_10014876 3300009092 Bacteria 3191
80 Ga0105250_10057509 3300009092 Bacteria 1561
81 Ga0105250_10243731 3300009092 Bacteria 767
82 Ga0105247_10000129 3300009101 Bacteria 73190
83 Ga0105243_10164421 3300009148 Bacteria 1916
84 Ga0105241_10000002 3300009174 Bacteria 869480
85 Ga0105246_10034204 3300011119 Bacteria 3384
86 Ga0157373_10000405 3300013100 Bacteria 34603
87 Ga0157373_10010097 3300013100 Bacteria 6956
88 Ga0157373_10017204 3300013100 Bacteria 5264
89 Ga0157373_10142218 3300013100 Bacteria 1687
90 Ga0157371_10000008 3300013102 Bacteria 393028
91 Ga0157371_10005504 3300013102 Bacteria 10661
92 Ga0157371_10005712 3300013102 Bacteria 10430
93 Ga0157371_10008285 3300013102 Bacteria 8301
94 Ga0157371_10011201 3300013102 Bacteria 6932
95 Ga0157371_10028701 3300013102 Bacteria 4028
96 Ga0157371_10529906 3300013102 Bacteria 872
97 Ga0157370_10000064 3300013104 Bacteria 114340
98 Ga0157370_10003634 3300013104 Bacteria 18031
99 Ga0157370_10756746 3300013104 Bacteria 885
100 Ga0157369_10008888 3300013105 Bacteria 11509
101 Ga0163162_10064916 3300013306 Bacteria 3696
102 Ga0163162_10258306 3300013306 Bacteria 1874
103 Ga0157372_10015540 3300013307 Bacteria 8158
104 Ga0157372_10025375 3300013307 Bacteria 6443
105 Ga0157372_10046939 3300013307 Bacteria 4796
106 Ga0157372_10080621 3300013307 Bacteria 3683
107 Ga0182006_1009989 3300015261 Bacteria 4236
108 Ga0183366_1001 3300015679 Bacteria 2743932
109 Ga0183370_1001 3300015680 Bacteria 2743932
110 Ga0183369_1001 3300015685 Bacteria 2743932
111 Ga0183368_1001 3300015687 Bacteria 2743932
112 Ga0163161_10000001 3300017792 Bacteria 2041488
113 Ga0163161_10121081 3300017792 Bacteria 1966
114 Ga0213876_10000055 3300021384 Bacteria 136037
115 Ga0209760_100051 3300025207 Bacteria 105257
116 Ga0209784_100001 3300025224 Bacteria 3600592
117 Ga0209566_100001 3300025225 Bacteria 3600765
118 Ga0209674_100002 3300025226 Bacteria 3600592
119 Ga0209563_100002 3300025230 Bacteria 2045675
120 Ga0207427_100020 3300025231 Bacteria 507515
121 Ga0209437_100001 3300025233 Bacteria 2045675
122 Ga0209437_100109 3300025233 Bacteria 217031
123 Ga0209437_100111 3300025233 Bacteria 214944
124 Ga0207425_1011769 3300025245 Bacteria 2072
125 Ga0209677_100002 3300025253 Bacteria 2045675
126 Ga0209129_1000004 3300025258 Bacteria 884499
127 Ga0209233_1018034 3300025261 Bacteria 1910
128 Ga0207696_1000001 3300025711 Bacteria 2579611
129 Ga0207696_1000005 3300025711 Bacteria 642078
130 Ga0207696_1000086 3300025711 Bacteria 194626
131 Ga0207696_1000218 3300025711 Bacteria 83242
132 Ga0207696_1000239 3300025711 Bacteria 75936
133 Ga0207696_1000793 3300025711 Bacteria 20640
134 Ga0207696_1001252 3300025711 Bacteria 14282
135 Ga0207696_1010381 3300025711 Bacteria 3416
136 Ga0207696_1011514 3300025711 Bacteria 3179
137 Ga0207696_1037362 3300025711 Bacteria 1438
138 Ga0207696_1041007 3300025711 Bacteria 1354
139 Ga0207655_1000001 3300025728 Bacteria 1866413
140 Ga0207655_1000009 3300025728 Bacteria 664676
141 Ga0207655_1000037 3300025728 Bacteria 354473
142 Ga0207655_1000061 3300025728 Bacteria 258893
143 Ga0207655_1000063 3300025728 Bacteria 257028
144 Ga0207655_1000069 3300025728 Bacteria 239968
145 Ga0207655_1000413 3300025728 Bacteria 58877
146 Ga0207655_1000853 3300025728 Bacteria 32501
147 Ga0207655_1001029 3300025728 Bacteria 28136
148 Ga0207655_1001583 3300025728 Bacteria 20414
149 Ga0207655_1005935 3300025728 Bacteria 8181
150 Ga0207655_1021113 3300025728 Bacteria 3318
151 Ga0207655_1025755 3300025728 Bacteria 2846
152 Ga0207655_1032283 3300025728 Bacteria 2395
153 Ga0207655_1124982 3300025728 Bacteria 846
154 Ga0207713_1000001 3300025735 Bacteria 2295391
155 Ga0207713_1000002 3300025735 Bacteria 1061749
156 Ga0207713_1000003 3300025735 Bacteria 860698
157 Ga0207713_1000008 3300025735 Bacteria 553952
158 Ga0207713_1000016 3300025735 Bacteria 421689
159 Ga0207713_1000029 3300025735 Bacteria 285054
160 Ga0207713_1000916 3300025735 Bacteria 26485
161 Ga0207713_1001124 3300025735 Bacteria 22760
162 Ga0207713_1006299 3300025735 Bacteria 7252
163 Ga0207713_1010784 3300025735 Bacteria 5032
164 Ga0207713_1021254 3300025735 Bacteria 3117
165 Ga0207713_1049805 3300025735 Bacteria 1677
166 Ga0207710_10000113 3300025900 Bacteria 102300
167 Ga0207705_10118526 3300025909 Bacteria 1962
168 Ga0207654_10000005 3300025911 Bacteria 869492
169 Ga0207690_10155154 3300025932 Bacteria 1701
170 Ga0207668_10293539 3300025972 Bacteria 1338
171 Ga0207674_10003836 3300026116 Bacteria 18318
172 Ga0209281_1000001 3300027111 Bacteria 1933496
173 Ga0209281_1000003 3300027111 Bacteria 1260089
174 Ga0209281_1000006 3300027111 Bacteria 1170244
175 Ga0209281_1000130 3300027111 Bacteria 191756
176 Ga0209281_1000181 3300027111 Bacteria 146200
177 Ga0209281_1000287 3300027111 Bacteria 93918
178 Ga0209281_1000414 3300027111 Bacteria 64365
179 Ga0209281_1000494 3300027111 Bacteria 53600
180 Ga0209281_1000638 3300027111 Bacteria 38391
181 Ga0209281_1001677 3300027111 Bacteria 11634
182 Ga0209281_1001997 3300027111 Bacteria 9353
183 Ga0209371_1000001 3300027312 Bacteria 2771503
184 Ga0209371_1000002 3300027312 Bacteria 1551985
185 Ga0209371_1000005 3300027312 Bacteria 1061740
186 Ga0209371_1000041 3300027312 Bacteria 340377
187 Ga0209371_1000109 3300027312 Bacteria 141217
188 Ga0209371_1000124 3300027312 Bacteria 131108
189 Ga0209371_1000183 3300027312 Bacteria 91570
190 Ga0209371_1000212 3300027312 Bacteria 80989
191 Ga0209371_1001290 3300027312 Bacteria 17602
192 Ga0209371_1001786 3300027312 Bacteria 13463
193 Ga0209371_1003820 3300027312 Bacteria 6993
194 Ga0209371_1006367 3300027312 Bacteria 4386
195 Ga0209371_1006940 3300027312 Bacteria 4069
196 Ga0209371_1012808 3300027312 Bacteria 2400
197 Ga0209371_1018953 3300027312 Bacteria 1733
198 Ga0268266_10001737 3300028379 Bacteria 24933
199 Ga0265323_10015730 3300028653 Bacteria 2970
200 Ga0265336_10000183 3300028666 Bacteria 44089
201 Ga0265324_10000011 3300029957 Bacteria 218521
202 Ga0265324_10003277 3300029957 Bacteria 7778
203 Ga0268256_1000001 3300030500 Bacteria 2771065
204 Ga0268256_1000002 3300030500 Bacteria 1535763
205 Ga0268256_1000003 3300030500 Bacteria 1289401
206 Ga0268256_1000006 3300030500 Bacteria 1063991
207 Ga0268256_1000155 3300030500 Bacteria 91570
208 Ga0268256_1000186 3300030500 Bacteria 73618
209 Ga0268256_1001014 3300030500 Bacteria 18957
210 Ga0268256_1001101 3300030500 Bacteria 17602
211 Ga0268256_1001115 3300030500 Bacteria 17475
212 Ga0268256_1006232 3300030500 Bacteria 4475
213 Ga0268256_1006397 3300030500 Bacteria 4386
214 Ga0268256_1006442 3300030500 Bacteria 4363
215 Ga0268256_1006796 3300030500 Bacteria 4191
216 Ga0268256_1007063 3300030500 Bacteria 4069
217 Ga0268256_1009253 3300030500 Bacteria 3294
218 Ga0268256_1014947 3300030500 Bacteria 2283
219 Ga0265328_10007236 3300031239 Bacteria 4639
220 Ga0265325_10000551 3300031241 Bacteria 27189
221 Ga0265331_10000066 3300031250 Bacteria 163571
222 Ga0265331_10014954 3300031250 Bacteria 4115
223 Ga0265331_10054946 3300031250 Bacteria 1895
224 Ga0265331_10107068 3300031250 Bacteria 1284
225 Ga0265327_10000715 3300031251 Bacteria 52402
226 Ga0265327_10000838 3300031251 Bacteria 45953
227 Ga0265327_10002670 3300031251 Bacteria 18329
228 Ga0265327_10003260 3300031251 Bacteria 15736
229 Ga0265327_10016595 3300031251 Bacteria 4666
230 Ga0265327_10025468 3300031251 Bacteria 3448
231 Ga0265316_10002742 3300031344 Bacteria 18045
232 Ga0265316_10008749 3300031344 Bacteria 9360
233 Ga0265316_10057094 3300031344 Bacteria 3046
234 Ga0265316_10423196 3300031344 Bacteria 957
235 Ga0307408_100000408 3300031548 Bacteria 38700
236 Ga0307408_100005509 3300031548 Bacteria 8458
237 Ga0265313_10000787 3300031595 Bacteria 32032
238 Ga0265313_10072398 3300031595 Bacteria 1584
239 Ga0316575_10000393 3300031665 Bacteria 12439
240 Ga0316575_10013020 3300031665 Bacteria 3104
241 Ga0316579_10000105 3300031691 Bacteria 22518
242 Ga0316579_10005815 3300031691 Bacteria 4998
243 Ga0316579_10007172 3300031691 Bacteria 4589
244 Ga0316579_10019973 3300031691 Bacteria 2964
245 Ga0316579_10044866 3300031691 Bacteria 2060
246 Ga0316579_10046289 3300031691 Bacteria 2029
247 Ga0316579_10115763 3300031691 Bacteria 1287
248 Ga0316579_10266856 3300031691 Bacteria 828
249 Ga0265314_10007932 3300031711 Bacteria 9159
250 Ga0316576_10000048 3300031727 Bacteria 37298
251 Ga0316576_10001044 3300031727 Bacteria 14361
252 Ga0316576_10003602 3300031727 Bacteria 9128
253 Ga0316576_10008341 3300031727 Bacteria 6599
254 Ga0316576_10080832 3300031727 Bacteria 2411
255 Ga0316576_10117688 3300031727 Bacteria 1994
256 Ga0316578_10000271 3300031728 Bacteria 15562
257 Ga0316578_10003443 3300031728 Bacteria 7232
258 Ga0316578_10007306 3300031728 Bacteria 5530
259 Ga0316578_10016977 3300031728 Bacteria 3952
260 Ga0316578_10028081 3300031728 Bacteria 3184
261 Ga0316578_10060277 3300031728 Bacteria 2233
262 Ga0316578_10082646 3300031728 Bacteria 1912
263 Ga0316578_10092915 3300031728 Bacteria 1804
264 Ga0316578_10191355 3300031728 Bacteria 1232
265 Ga0316578_10216953 3300031728 Bacteria 1150
266 Ga0316577_10000441 3300031733 Bacteria 16222
267 Ga0316577_10001698 3300031733 Bacteria 10565
268 Ga0316577_10008166 3300031733 Bacteria 5600
269 Ga0316577_10022192 3300031733 Bacteria 3524
270 Ga0316577_10187423 3300031733 Bacteria 1169
271 Ga0307406_10001275 3300031901 Bacteria 14119
272 Ga0316583_10000694 3300032133 Bacteria 10382
273 Ga0316583_10003922 3300032133 Bacteria 5286
274 Ga0316583_10004452 3300032133 Bacteria 4996
275 Ga0316583_10015186 3300032133 Bacteria 2772
276 Ga0316583_10024264 3300032133 Bacteria 2165
277 Ga0316585_10000405 3300032137 Bacteria 9993
278 Ga0316585_10003067 3300032137 Bacteria 4559
279 Ga0316585_10007894 3300032137 Bacteria 3077
280 Ga0316585_10016628 3300032137 Bacteria 2217
281 Ga0316585_10038137 3300032137 Bacteria 1526
282 Ga0316580_10000315 3300032139 Bacteria 10611
283 Ga0316580_10000618 3300032139 Bacteria 8358
284 Ga0316580_10000838 3300032139 Bacteria 7554
285 Ga0316580_10001048 3300032139 Bacteria 6943
286 Ga0316580_10061594 3300032139 Bacteria 1152
287 Ga0316593_10003415 3300032168 Bacteria 3939
288 Ga0316593_10034246 3300032168 Bacteria 1665
289 Ga0316593_10077807 3300032168 Bacteria 1154
290 Ga0316592_1005505 3300033524 Bacteria 2408
291 Ga0316588_1000455 3300033528 Bacteria 5485
292 Ga0316596_1004970 3300033541 Bacteria 3013
293 Ga0373952_0001661 3300035092 Bacteria 4047
294 Ga0316574_0003585 3300035398 Bacteria 8031
295 Ga0316574_0004503 3300035398 Bacteria 7314
296 Ga0316574_0009353 3300035398 Bacteria 5487
297 Ga0316574_0011619 3300035398 Bacteria 5013
298 Ga0316574_0019988 3300035398 Bacteria 3959
299 Ga0316574_0085007 3300035398 Unclassified 2013
300 Ga0316574_0101284 3300035398 Bacteria 1844
301 Ga0316574_0107712 3300035398 Bacteria 1786
302 Ga0316574_0151605 3300035398 Bacteria 1494
303 Ga0316582_0000189 3300036647 Bacteria 19327
304 Ga0316582_0000581 3300036647 Bacteria 14138
305 Ga0316582_0001421 3300036647 Bacteria 10479
306 Ga0316582_0002198 3300036647 Bacteria 9054
307 Ga0316582_0016854 3300036647 Unclassified 4212
308 Ga0316582_0018709 3300036647 Bacteria 4038
309 Ga0316582_0021790 3300036647 Bacteria 3793
310 Ga0316582_0026036 3300036647 Bacteria 3518
311 Ga0316582_0134192 3300036647 Bacteria 1665
312 Ga0316582_0149041 3300036647 Bacteria 1581
313 Ga0316582_0215892 3300036647 Bacteria 1311
314 Ga0316582_0243626 3300036647 Bacteria 1232
315 Ga0316584_0000571 3300036712 Bacteria 19864
316 Ga0316584_0002131 3300036712 Bacteria 12389
317 Ga0316584_0008709 3300036712 Bacteria 7004
318 Ga0316584_0009042 3300036712 Bacteria 6895
319 Ga0316584_0026860 3300036712 Bacteria 4234
320 Ga0316584_0033220 3300036712 Bacteria 3820
321 Ga0316584_0037525 3300036712 Bacteria 3600
322 Ga0316584_0081621 3300036712 Bacteria 2422
323 Ga0316584_0089054 3300036712 Bacteria 2311
324 Ga0316581_0005240 3300037588 Bacteria 3365
325 Ga0316581_0008431 3300037588 Bacteria 2805
326 Ga0400484_32548 3300038725 Bacteria 1648
327 Ga0400484_32683 3300038725 Bacteria 9694
328 Ga0400490_06264 3300038726 Bacteria 6207
329 Ga0400490_07306 3300038726 Bacteria 45209
330 Ga0400490_23381 3300038726 Bacteria 19170
331 Ga0400490_47679 3300038726 Bacteria 119204
332 Ga0400490_50945 3300038726 Bacteria 2259
333 Ga0400491_09168 3300038727 Bacteria 1735
334 Ga0400491_21649 3300038727 Bacteria 2123
335 Ga0400491_25243 3300038727 Bacteria 7700
336 Ga0400485_02459 3300038735 Bacteria 132034
337 Ga0400485_21450 3300038735 Bacteria 28133
338 Ga0400488_06466 3300038741 Bacteria 3634
339 Ga0400488_06713 3300038741 Bacteria 18995
340 Ga0400488_07973 3300038741 Bacteria 8826
341 Ga0400488_17137 3300038741 Bacteria 3585
342 Ga0400488_29568 3300038741 Bacteria 30347
343 Ga0400488_62508 3300038741 Unclassified 4245
344 Ga0400486_01617 3300038742 Bacteria 43468
345 Ga0400486_05108 3300038742 Bacteria 1920
346 Ga0400486_23232 3300038742 Bacteria 285561
347 Ga0400483_022387 3300039062 Unclassified 1743
348 Ga0400483_028427 3300039062 Bacteria 3363
349 Ga0400483_072292 3300039062 Bacteria 1070
350 Ga0400483_109489 3300039062 Bacteria 1282
351 Ga0400483_110186 3300039062 Bacteria 1839
352 Ga0400483_124167 3300039062 Bacteria 3094
353 Ga0400483_161230 3300039062 Bacteria 13981
354 Ga0400483_190389 3300039062 Bacteria 69422
355 Ga0400483_202170 3300039062 Bacteria 2317
356 Ga0400483_211573 3300039062 Bacteria 5280
357 Ga0400483_217826 3300039062 Bacteria 3205
358 Ga0400483_224464 3300039062 Bacteria 121183
359 Ga0400483_238517 3300039062 Bacteria 11347
360 Ga0400483_273045 3300039062 Bacteria 1680
361 Ga0400483_286450 3300039062 Unclassified 2037
362 Ga0400489_08754 3300039093 Bacteria 1541
363 Ga0400489_34915 3300039093 Bacteria 1011
364 Ga0400487_02160 3300039110 Bacteria 4219
365 Ga0400487_05701 3300039110 Bacteria 1092
366 Ga0400487_07449 3300039110 Bacteria 35483
367 Ga0400487_26748 3300039110 Bacteria 1198
368 Ga0400487_50731 3300039110 Bacteria 3830
369 Ga0400487_54381 3300039110 Bacteria 61043
370 Ga0400487_55535 3300039110 Bacteria 11307
371 Ga0400487_60657 3300039110 Bacteria 9507
372 Ga0400487_62881 3300039110 Bacteria 2144
373 Ga0436365_0971002 3300039437 Bacteria 167792
374 Ga0439438_000001 3300041405 Bacteria 1263568
375 Ga0439438_008998 3300041405 Bacteria 3262
376 Ga0439438_010805 3300041405 Bacteria 2871
377 Ga0439447_002338 3300041407 Bacteria 6932
378 Ga0439447_005385 3300041407 Bacteria 4264
379 Ga0439466_0000091 3300041411 Bacteria 35463
380 Ga0451849_0466671 3300041505 Bacteria 974
381 Ga0439432_004000 3300042006 Bacteria 5414
382 Ga0439432_008629 3300042006 Bacteria 3577
383 Ga0439432_008780 3300042006 Bacteria 3538
384 Ga0439432_028315 3300042006 Bacteria 1824
385 Ga0439452_000001 3300042010 Bacteria 1725439
386 Ga0439452_000028 3300042010 Bacteria 204513
387 Ga0439452_000246 3300042010 Bacteria 37436
388 Ga0439452_000493 3300042010 Bacteria 21705
389 Ga0439452_009464 3300042010 Bacteria 2868
390 Ga0439463_017308 3300042016 Bacteria 1787
391 Ga0450900_026429 3300042136 Bacteria 830
392 Ga0450907_000363 3300042146 Bacteria 13987
393 Ga0451577_0177659 3300042876 Bacteria 1919
394 Ga0451577_0212831 3300042876 Bacteria 1746
395 Ga0451577_0230147 3300042876 Bacteria 1676
396 Ga0466981_0000002 3300044669 Bacteria 313036
397 Ga0453683_0083575 3300044673 Bacteria 2001
398 Ga0453684_0000062 3300044712 Bacteria 487590
399 Ga0453684_0000071 3300044712 Bacteria 448904
400 Ga0453684_0000823 3300044712 Bacteria 104784
401 Ga0453684_0003509 3300044712 Bacteria 35177
402 Ga0453684_0008148 3300044712 Bacteria 18913
403 Ga0453684_0020091 3300044712 Bacteria 10110
404 Ga0453684_0024650 3300044712 Bacteria 8778
405 Ga0453684_0112358 3300044712 Bacteria 3307
406 Ga0453684_0322178 3300044712 Bacteria 1750
407 Ga0451576_0001570 3300045051 Bacteria 38410
408 Ga0451576_0059218 3300045051 Bacteria 3999
409 Ga0451576_0062061 3300045051 Bacteria 3897
410 Ga0451576_0094871 3300045051 Bacteria 3103
411 Ga0495617_053718 3300046452 Bacteria 1338
412 Ga0495627_000116 3300046453 Bacteria 99916
413 Ga0495591_000013 3300046458 Bacteria 268106
414 Ga0495591_000100 3300046458 Bacteria 99473
415 Ga0495591_003277 3300046458 Bacteria 8494
416 Ga0495591_005944 3300046458 Bacteria 5512
417 Ga0495638_0001608 3300046460 Bacteria 20176
418 Ga0495650_0000005 3300046471 Bacteria 766553
419 Ga0495650_0000043 3300046471 Bacteria 357197
420 Ga0495650_0000187 3300046471 Bacteria 136554
421 Ga0495605_0040143 3300046474 Bacteria 2340
422 Ga0495584_0035092 3300046491 Bacteria 2535
423 Ga0495607_0033867 3300046501 Bacteria 3105
424 Ga0495606_0008322 3300046507 Bacteria 9040
425 Ga0495616_0026708 3300046513 Bacteria 3069
426 Ga0495632_0233876 3300046519 Bacteria 828
427 Ga0495637_0152849 3300046520 Bacteria 870
428 Ga0495643_0016913 3300046522 Bacteria 4276
429 Ga0495643_0149465 3300046522 Bacteria 1158
430 Ga0495644_0114660 3300046523 Bacteria 1023
431 Ga0495648_0002178 3300046524 Bacteria 18405
432 Ga0495648_0002659 3300046524 Bacteria 16179
433 Ga0495654_0000041 3300046530 Bacteria 174733
434 Ga0495654_0000149 3300046530 Bacteria 72677
435 Ga0495654_0000167 3300046530 Bacteria 64853
436 Ga0495654_0018643 3300046530 Bacteria 3634
437 Ga0495654_0020788 3300046530 Bacteria 3418
438 Ga0495597_0000396 3300046542 Bacteria 37594
439 Ga0495668_0027531 3300046616 Bacteria 3220
440 Ga0495611_0101611 3300046648 Bacteria 1336
441 Ga0495625_0010850 3300046660 Bacteria 7492
442 Ga0495588_0003450 3300046674 Bacteria 6879
443 Ga0495671_0054764 3300046692 Bacteria 1976
444 Ga0495671_0099692 3300046692 Bacteria 1420
445 Ga0495649_0006921 3300046694 Bacteria 7011
446 Ga0495649_0015928 3300046694 Bacteria 4269
447 Ga0495649_0047834 3300046694 Bacteria 2325
448 Ga0495589_0000001 3300046794 Bacteria 888100
449 Ga0495589_0001761 3300046794 Bacteria 12332
450 Ga0495660_0000012 3300046810 Bacteria 350701
451 Ga0495660_0000171 3300046810 Bacteria 70062
452 Ga0495660_0040670 3300046810 Bacteria 2575
453 Ga0495660_0264096 3300046810 Bacteria 793
454 Ga0495672_0000002 3300047320 Bacteria 740116
455 Ga0495672_0000034 3300047320 Bacteria 290832
456 Ga0495672_0000043 3300047320 Bacteria 266893
457 Ga0495683_0018858 3300047323 Bacteria 3562
458 Ga0495679_000005 3300047446 Bacteria 455007
459 Ga0495679_003257 3300047446 Bacteria 7874
460 Ga0495679_006097 3300047446 Bacteria 5248
461 Ga0495679_022732 3300047446 Bacteria 2141
462 Ga0495673_0000070 3300047469 Bacteria 217453
463 Ga0495673_0000167 3300047469 Bacteria 111793
464 Ga0495681_0030657 3300047470 Bacteria 2735
465 Ga0496100_0424959 3300048903 Bacteria 1015
466 Ga0496101_0458047 3300048904 Bacteria 1006
467 Ga0496102_0032824 3300048905 Bacteria 4665
468 Ga0496102_0057959 3300048905 Bacteria 3538
469 Ga0496102_0543018 3300048905 Bacteria 1085
470 Ga0496104_0001633 3300048907 Bacteria 19357
471 Ga0496104_0005483 3300048907 Bacteria 11112
472 Ga0496104_0141705 3300048907 Bacteria 2309
473 Ga0496105_0001541 3300048908 Bacteria 16319
474 Ga0496105_0273848 3300048908 Bacteria 1362
475 Ga0496113_0331182 3300048916 Bacteria 1221
476 Ga0496116_0000001 3300048919 Bacteria 1501681
477 Ga0496116_0000066 3300048919 Bacteria 264035
478 Ga0496116_0000305 3300048919 Bacteria 82397
479 Ga0496116_0000359 3300048919 Bacteria 71572
480 Ga0496116_0000822 3300048919 Bacteria 39198
481 Ga0496116_0012797 3300048919 Bacteria 6817
482 Ga0496116_0015827 3300048919 Bacteria 5938
483 Ga0496116_0016780 3300048919 Bacteria 5714
484 Ga0496116_0064744 3300048919 Bacteria 2348
485 Ga0496116_0074703 3300048919 Bacteria 2130
486 Ga0496116_0145959 3300048919 Bacteria 1322
487 Ga0496116_0145960 3300048919 Bacteria 1322
488 Ga0496117_0000004 3300048920 Bacteria 877131
489 Ga0496117_0000020 3300048920 Bacteria 458405
490 Ga0496117_0001199 3300048920 Bacteria 38983
491 Ga0496117_0007977 3300048920 Bacteria 10168
492 Ga0496117_0011282 3300048920 Bacteria 8013
493 Ga0496117_0011430 3300048920 Bacteria 7953
494 Ga0496117_0015509 3300048920 Bacteria 6490
495 Ga0496117_0015805 3300048920 Bacteria 6404
496 Ga0496117_0015883 3300048920 Bacteria 6379
497 Ga0496117_0057265 3300048920 Bacteria 2708
498 Ga0496117_0131617 3300048920 Bacteria 1515
499 Ga0496118_0000007 3300048921 Bacteria 650986
500 Ga0496118_0000015 3300048921 Bacteria 551359
501 Ga0496118_0000085 3300048921 Bacteria 179731
502 Ga0496118_0005050 3300048921 Bacteria 15219
503 Ga0496118_0007386 3300048921 Bacteria 11666
504 Ga0496118_0019563 3300048921 Bacteria 6046
505 Ga0496118_0022344 3300048921 Bacteria 5534
506 Ga0496118_0035915 3300048921 Bacteria 4015
507 Ga0496118_0048217 3300048921 Bacteria 3293
508 Ga0496118_0052065 3300048921 Bacteria 3126
509 Ga0496118_0140640 3300048921 Bacteria 1530
510 Ga0496119_0000001 3300048922 Bacteria 789520
511 Ga0496119_0000015 3300048922 Bacteria 312979
512 Ga0496119_0000039 3300048922 Bacteria 208631
513 Ga0496119_0000570 3300048922 Bacteria 49795
514 Ga0496119_0001536 3300048922 Bacteria 27581
515 Ga0496119_0004672 3300048922 Bacteria 13500
516 Ga0496119_0006831 3300048922 Bacteria 10462
517 Ga0496119_0009553 3300048922 Bacteria 8301
518 Ga0496119_0017883 3300048922 Bacteria 5309
519 Ga0496119_0026569 3300048922 Bacteria 4010
520 Ga0496119_0035560 3300048922 Bacteria 3261
521 Ga0496119_0042312 3300048922 Bacteria 2889
522 Ga0496119_0046418 3300048922 Bacteria 2713
523 Ga0496119_0104946 3300048922 Bacteria 1579
524 Ga0496120_0000002 3300048923 Bacteria 547999
525 Ga0496120_0000016 3300048923 Bacteria 307608
526 Ga0496120_0000464 3300048923 Bacteria 63910
527 Ga0496120_0000807 3300048923 Bacteria 45013
528 Ga0496120_0000952 3300048923 Bacteria 39508
529 Ga0496120_0000967 3300048923 Bacteria 39152
530 Ga0496120_0001357 3300048923 Bacteria 30064
531 Ga0496120_0001449 3300048923 Bacteria 28369
532 Ga0496120_0003798 3300048923 Bacteria 13313
533 Ga0496120_0006630 3300048923 Bacteria 8829
534 Ga0496120_0023275 3300048923 Bacteria 3879
535 Ga0496120_0042345 3300048923 Bacteria 2660
536 Ga0496120_0085647 3300048923 Bacteria 1695
537 Ga0496120_0109520 3300048923 Bacteria 1445
538 Ga0496121_0002791 3300048924 Bacteria 25878
539 Ga0496121_0004182 3300048924 Bacteria 19708
540 Ga0496121_0005490 3300048924 Bacteria 16237
541 Ga0496121_0007110 3300048924 Bacteria 13586
542 Ga0496121_0009302 3300048924 Bacteria 11332
543 Ga0496121_0011142 3300048924 Bacteria 10027
544 Ga0496121_0018640 3300048924 Bacteria 6986
545 Ga0496121_0023502 3300048924 Bacteria 5934
546 Ga0496121_0034836 3300048924 Bacteria 4522
547 Ga0496122_0000005 3300048925 Bacteria 630659
548 Ga0496122_0000110 3300048925 Bacteria 190142
549 Ga0496122_0000545 3300048925 Bacteria 77927
550 Ga0496122_0000655 3300048925 Bacteria 69852
551 Ga0496122_0003163 3300048925 Bacteria 21971
552 Ga0496122_0003949 3300048925 Bacteria 18950
553 Ga0496122_0005034 3300048925 Bacteria 15989
554 Ga0496122_0020988 3300048925 Bacteria 5868
555 Ga0496122_0033005 3300048925 Bacteria 4266
556 Ga0496122_0057749 3300048925 Bacteria 2878
557 Ga0496122_0067627 3300048925 Bacteria 2571
558 Ga0496122_0076961 3300048925 Bacteria 2345
559 Ga0496123_0000008 3300048926 Bacteria 630628
560 Ga0496123_0000081 3300048926 Bacteria 190142
561 Ga0496123_0000189 3300048926 Bacteria 124719
562 Ga0496123_0000788 3300048926 Bacteria 51218
563 Ga0496123_0003165 3300048926 Bacteria 18795
564 Ga0496123_0004842 3300048926 Bacteria 13867
565 Ga0496123_0006575 3300048926 Bacteria 11232
566 Ga0496123_0049626 3300048926 Bacteria 2811
567 Ga0496123_0054946 3300048926 Bacteria 2617
568 Ga0496123_0077454 3300048926 Bacteria 2042
569 Ga0496123_0105218 3300048926 Bacteria 1629
570 Ga0496123_0117222 3300048926 Bacteria 1506
571 Ga0496124_0000107 3300048927 Bacteria 168020
572 Ga0496124_0000196 3300048927 Bacteria 119375
573 Ga0496124_0000425 3300048927 Bacteria 75572
574 Ga0496124_0000530 3300048927 Bacteria 65033
575 Ga0496124_0001064 3300048927 Bacteria 43365
576 Ga0496124_0003500 3300048927 Bacteria 19129
577 Ga0496124_0005677 3300048927 Bacteria 13914
578 Ga0496124_0010267 3300048927 Bacteria 9508
579 Ga0496124_0014944 3300048927 Bacteria 7473
580 Ga0496124_0015001 3300048927 Bacteria 7458
581 Ga0496124_0015853 3300048927 Bacteria 7198
582 Ga0496124_0020810 3300048927 Bacteria 6054
583 Ga0496124_0026555 3300048927 Bacteria 5218
584 Ga0496124_0029363 3300048927 Bacteria 4901
585 Ga0496124_0031631 3300048927 Bacteria 4682
586 Ga0496124_0032720 3300048927 Bacteria 4586
587 Ga0496124_0062638 3300048927 Bacteria 3111
588 Ga0496124_0088579 3300048927 Bacteria 2529
589 Ga0496124_0245492 3300048927 Bacteria 1328
590 Ga0496125_0000009 3300048928 Bacteria 677678
591 Ga0496125_0000033 3300048928 Bacteria 351850
592 Ga0496125_0002253 3300048928 Bacteria 25624
593 Ga0496125_0006340 3300048928 Bacteria 12837
594 Ga0496125_0011260 3300048928 Bacteria 8964
595 Ga0496125_0015717 3300048928 Bacteria 7299
596 Ga0496125_0042336 3300048928 Bacteria 3880
597 Ga0496125_0146296 3300048928 Bacteria 1632
598 Ga0496126_0001066 3300048929 Bacteria 46225
599 Ga0496126_0001084 3300048929 Bacteria 45796
600 Ga0496126_0003320 3300048929 Bacteria 20471
601 Ga0496126_0047345 3300048929 Bacteria 3936
602 Ga0496126_0055481 3300048929 Bacteria 3585
603 Ga0496126_0059858 3300048929 Bacteria 3428
604 Ga0496126_0275683 3300048929 Bacteria 1394
605 Ga0496126_0620534 3300048929 Bacteria 849
606 Ga0495678_001876 3300049459 Bacteria 15280
607 Ga0495682_0000001 3300049460 Bacteria 1559116
608 Ga0501034_0727250 3300049571 Bacteria 889
609 Ga0501241_010542 3300049758 Unclassified 1679
610 nmdc:mga00v17_18954_c1 3300050491 Bacteria 3918
611 nmdc:mga00v17_76398_c1 3300050491 Bacteria 2084
612 nmdc:mga00v17_9828_c1 3300050491 Bacteria 5197
613 Ga0500621_000003 3300053126 Bacteria 596975

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300031728 Ga0316578_10060277 Ga0316578_100602772 184
2 3300035398 Ga0316574_0101284 Ga0316574_0101284_321_1091 184
3 3300036712 Ga0316584_0033220 Ga0316584_0033220_976_1746 184
4 3300031727 Ga0316576_10117688 Ga0316576_101176883 186
5 3300038725 Ga0400484_32683 Ga0400484_32683_8330_9016 186
6 3300038726 Ga0400490_50945 Ga0400490_50945_522_1208 186
7 3300028666 Ga0265336_10000183 Ga0265336_1000018344 187
8 3300029957 Ga0265324_10000011 Ga0265324_1000001155 187
9 3300031241 Ga0265325_10000551 Ga0265325_100005517 187
10 3300031344 Ga0265316_10423196 Ga0265316_104231962 187
11 3300032133 Ga0316583_10000694 Ga0316583_100006946 188
12 3300038726 Ga0400490_06264 Ga0400490_06264_3981_4667 188
13 3300038727 Ga0400491_21649 Ga0400491_21649_727_1413 188
14 3300042876 Ga0451577_0230147 Ga0451577_0230147_683_1351 189
15 3300031728 Ga0316578_10016977 Ga0316578_100169774 190
16 3300036712 Ga0316584_0081621 Ga0316584_0081621_189_890 190
17 3300039110 Ga0400487_05701 Ga0400487_05701_60_761 190
18 3300044712 Ga0453684_0003509 Ga0453684_0003509_712_1383 190
19 3300038735 Ga0400485_21450 Ga0400485_21450_19377_20078 196
20 3300038742 Ga0400486_01617 Ga0400486_01617_8145_8846 196
21 3300039110 Ga0400487_50731 Ga0400487_50731_1608_2309 196
22 3300009011 Ga0105251_10007017 Ga0105251_100070175 197
23 3300028653 Ga0265323_10015730 Ga0265323_100157306 199
24 3300031344 Ga0265316_10008749 Ga0265316_100087493 199
25 3300031344 Ga0265316_10057094 Ga0265316_100570945 199
26 3300044712 Ga0453684_0020091 Ga0453684_0020091_5063_5737 199
27 3300044712 Ga0453684_0024650 Ga0453684_0024650_2716_3390 199
28 3300003856 Ga0058692_1000066 Ga0058692_100006629 200
29 3300027312 Ga0209371_1000183 Ga0209371_100018364 200
30 3300030500 Ga0268256_1000155 Ga0268256_100015532 200
31 3300031251 Ga0265327_10000838 Ga0265327_1000083822 200
32 3300031251 Ga0265327_10025468 Ga0265327_100254683 200
33 3300031595 Ga0265313_10000787 Ga0265313_1000078722 200
34 3300031595 Ga0265313_10072398 Ga0265313_100723982 200
35 3300042876 Ga0451577_0212831 Ga0451577_0212831_844_1521 200
36 3300044712 Ga0453684_0000071 Ga0453684_0000071_77541_78212 200
37 3300044712 Ga0453684_0000823 Ga0453684_0000823_61003_61677 200
38 3300044712 Ga0453684_0008148 Ga0453684_0008148_16784_17455 200
39 3300044712 Ga0453684_0112358 Ga0453684_0112358_574_1245 200
40 3300045051 Ga0451576_0094871 Ga0451576_0094871_2303_2980 200
41 iso_pu_bacteria 2881714928 2881716566 200
42 iso_pu_bacteria 2919688452 2919688713 200
43 3300025728 Ga0207655_1000009 Ga0207655_1000009395 201
44 3300029957 Ga0265324_10003277 Ga0265324_100032778 201
45 3300031239 Ga0265328_10007236 Ga0265328_100072363 201
46 3300031250 Ga0265331_10000066 Ga0265331_1000006617 201
47 3300031250 Ga0265331_10014954 Ga0265331_100149546 201
48 3300031250 Ga0265331_10054946 Ga0265331_100549463 201
49 3300031250 Ga0265331_10107068 Ga0265331_101070682 201
50 3300031251 Ga0265327_10000715 Ga0265327_100007154 201
51 3300031251 Ga0265327_10016595 Ga0265327_100165953 201
52 3300031711 Ga0265314_10007932 Ga0265314_100079326 201
53 3300042876 Ga0451577_0177659 Ga0451577_0177659_98_772 201
54 3300044673 Ga0453683_0083575 Ga0453683_0083575_253_927 201
55 3300044712 Ga0453684_0000062 Ga0453684_0000062_440303_440977 201
56 3300044712 Ga0453684_0322178 Ga0453684_0322178_703_1377 201
57 3300045051 Ga0451576_0001570 Ga0451576_0001570_29967_30641 201
58 3300045051 Ga0451576_0059218 Ga0451576_0059218_3262_3936 201
59 3300045051 Ga0451576_0062061 Ga0451576_0062061_2720_3394 201
60 iso_pu_bacteria 2565956521 2566034924 201
61 3300009011 Ga0105251_10005550 Ga0105251_100055506 202
62 3300025728 Ga0207655_1025755 Ga0207655_10257553 202
63 3300030500 Ga0268256_1006232 Ga0268256_10062323 202
64 3300031691 Ga0316579_10000105 Ga0316579_1000010514 202
65 3300031691 Ga0316579_10044866 Ga0316579_100448661 202
66 3300031691 Ga0316579_10266856 Ga0316579_102668561 202
67 3300031727 Ga0316576_10000048 Ga0316576_100000487 202
68 3300031727 Ga0316576_10001044 Ga0316576_100010448 202
69 3300031727 Ga0316576_10080832 Ga0316576_100808322 202
70 3300031728 Ga0316578_10000271 Ga0316578_1000027113 202
71 3300031728 Ga0316578_10003443 Ga0316578_100034435 202
72 3300031728 Ga0316578_10028081 Ga0316578_100280815 202
73 3300031728 Ga0316578_10092915 Ga0316578_100929152 202
74 3300031728 Ga0316578_10191355 Ga0316578_101913552 202
75 3300031728 Ga0316578_10216953 Ga0316578_102169531 202
76 3300031733 Ga0316577_10000441 Ga0316577_100004418 202
77 3300031733 Ga0316577_10022192 Ga0316577_100221922 202
78 3300032133 Ga0316583_10015186 Ga0316583_100151863 202
79 3300032133 Ga0316583_10024264 Ga0316583_100242642 202
80 3300032137 Ga0316585_10003067 Ga0316585_100030674 202
81 3300032137 Ga0316585_10007894 Ga0316585_100078944 202
82 3300032139 Ga0316580_10000838 Ga0316580_100008386 202
83 3300032139 Ga0316580_10001048 Ga0316580_100010486 202
84 3300032139 Ga0316580_10061594 Ga0316580_100615942 202
85 3300032168 Ga0316593_10003415 Ga0316593_100034153 202
86 3300033524 Ga0316592_1005505 Ga0316592_10055054 202
87 3300033528 Ga0316588_1000455 Ga0316588_10004554 202
88 3300033541 Ga0316596_1004970 Ga0316596_10049704 202
89 3300035092 Ga0373952_0001661 Ga0373952_0001661_1924_2601 202
90 3300035398 Ga0316574_0003585 Ga0316574_0003585_4800_5504 202
91 3300035398 Ga0316574_0004503 Ga0316574_0004503_5270_5974 202
92 3300035398 Ga0316574_0151605 Ga0316574_0151605_154_837 202
93 3300036647 Ga0316582_0000581 Ga0316582_0000581_3963_4667 202
94 3300036647 Ga0316582_0021790 Ga0316582_0021790_1750_2454 202
95 3300036647 Ga0316582_0134192 Ga0316582_0134192_346_1128 202
96 3300036647 Ga0316582_0149041 Ga0316582_0149041_642_1352 202
97 3300036712 Ga0316584_0008709 Ga0316584_0008709_4800_5504 202
98 3300036712 Ga0316584_0009042 Ga0316584_0009042_5559_6341 202
99 3300036712 Ga0316584_0026860 Ga0316584_0026860_241_951 202
100 iso_pu_bacteria 2919497567 2919499981 202
101 2162886007 SwRhRL2b_contig_3175571 SwRhRL2b_0291.00006820 203
102 3300003320 rootH2_10040041 rootH2_100400416 203
103 3300003856 Ga0058692_1000667 Ga0058692_10006677 203
104 3300003856 Ga0058692_1000890 Ga0058692_10008907 203
105 3300003856 Ga0058692_1002215 Ga0058692_10022153 203
106 3300005289 Ga0065704_10000297 Ga0065704_1000029731 203
107 3300005289 Ga0065704_10001850 Ga0065704_100018503 203
108 3300005289 Ga0065704_10004737 Ga0065704_100047374 203
109 3300005289 Ga0065704_10082935 Ga0065704_100829353 203
110 3300005366 Ga0070659_100187251 Ga0070659_1001872512 203
111 3300005548 Ga0070665_100017241 Ga0070665_1000172412 203
112 3300005577 Ga0068857_100000773 Ga0068857_10000077315 203
113 3300005834 Ga0068851_10314340 Ga0068851_103143402 203
114 3300006051 Ga0075364_10003017 Ga0075364_100030177 203
115 3300006051 Ga0075364_10004940 Ga0075364_100049407 203
116 3300006051 Ga0075364_10011406 Ga0075364_100114064 203
117 3300006946 Ga0079104_1000716 Ga0079104_100071625 203
118 3300006946 Ga0079104_1000733 Ga0079104_10007332 203
119 3300006946 Ga0079104_1002113 Ga0079104_10021131 203
120 3300006946 Ga0079104_1002597 Ga0079104_10025972 203
121 3300009011 Ga0105251_10010847 Ga0105251_100108474 203
122 3300009036 Ga0105244_10002696 Ga0105244_100026962 203
123 3300009036 Ga0105244_10019647 Ga0105244_100196473 203
124 3300009036 Ga0105244_10038334 Ga0105244_100383342 203
125 3300009036 Ga0105244_10144342 Ga0105244_101443422 203
126 3300009036 Ga0105244_10151582 Ga0105244_101515822 203
127 3300009092 Ga0105250_10004884 Ga0105250_100048845 203
128 3300009092 Ga0105250_10243731 Ga0105250_102437311 203
129 3300011119 Ga0105246_10034204 Ga0105246_100342043 203
130 3300013100 Ga0157373_10000405 Ga0157373_1000040523 203
131 3300013102 Ga0157371_10005712 Ga0157371_100057123 203
132 3300013102 Ga0157371_10011201 Ga0157371_100112012 203
133 3300013102 Ga0157371_10529906 Ga0157371_105299061 203
134 3300015679 Ga0183366_1001 Ga0183366_10011148 203
135 3300015680 Ga0183370_1001 Ga0183370_10011148 203
136 3300015685 Ga0183369_1001 Ga0183369_10011148 203
137 3300015687 Ga0183368_1001 Ga0183368_10011148 203
138 3300025711 Ga0207696_1000086 Ga0207696_1000086175 203
139 3300025711 Ga0207696_1037362 Ga0207696_10373622 203
140 3300025711 Ga0207696_1041007 Ga0207696_10410072 203
141 3300025728 Ga0207655_1000001 Ga0207655_10000011209 203
142 3300025728 Ga0207655_1001029 Ga0207655_10010293 203
143 3300025728 Ga0207655_1124982 Ga0207655_11249822 203
144 3300025735 Ga0207713_1000029 Ga0207713_100002931 203
145 3300025735 Ga0207713_1001124 Ga0207713_100112416 203
146 3300025735 Ga0207713_1006299 Ga0207713_10062997 203
147 3300025735 Ga0207713_1010784 Ga0207713_10107843 203
148 3300025735 Ga0207713_1021254 Ga0207713_10212542 203
149 3300025932 Ga0207690_10155154 Ga0207690_101551542 203
150 3300026116 Ga0207674_10003836 Ga0207674_1000383613 203
151 3300027111 Ga0209281_1000006 Ga0209281_10000061074 203
152 3300027111 Ga0209281_1000287 Ga0209281_100028733 203
153 3300027111 Ga0209281_1000414 Ga0209281_100041430 203
154 3300027111 Ga0209281_1000494 Ga0209281_100049445 203
155 3300027111 Ga0209281_1000638 Ga0209281_10006386 203
156 3300027312 Ga0209371_1000001 Ga0209371_10000011071 203
157 3300027312 Ga0209371_1000212 Ga0209371_100021238 203
158 3300027312 Ga0209371_1001290 Ga0209371_100129013 203
159 3300028379 Ga0268266_10001737 Ga0268266_1000173724 203
160 3300030500 Ga0268256_1000001 Ga0268256_10000011569 203
161 3300030500 Ga0268256_1001101 Ga0268256_10011016 203
162 3300030500 Ga0268256_1001115 Ga0268256_100111516 203
163 3300031251 Ga0265327_10002670 Ga0265327_100026702 203
164 3300031251 Ga0265327_10003260 Ga0265327_1000326016 203
165 3300031344 Ga0265316_10002742 Ga0265316_1000274218 203
166 3300031665 Ga0316575_10013020 Ga0316575_100130202 203
167 3300031691 Ga0316579_10007172 Ga0316579_100071722 203
168 3300031733 Ga0316577_10001698 Ga0316577_1000169811 203
169 3300032137 Ga0316585_10000405 Ga0316585_100004054 203
170 3300035398 Ga0316574_0019988 Ga0316574_0019988_1673_2362 203
171 3300036647 Ga0316582_0000189 Ga0316582_0000189_11112_11801 203
172 3300036712 Ga0316584_0002131 Ga0316584_0002131_2306_2995 203
173 3300037588 Ga0316581_0008431 Ga0316581_0008431_989_1678 203
174 3300041405 Ga0439438_010805 Ga0439438_010805_121_807 203
175 3300042010 Ga0439452_000246 Ga0439452_000246_4872_5558 203
176 3300042010 Ga0439452_000493 Ga0439452_000493_16205_16891 203
177 3300042136 Ga0450900_026429 Ga0450900_026429_18_695 203
178 3300044669 Ga0466981_0000002 Ga0466981_0000002_177223_177909 203
179 3300046458 Ga0495591_000100 Ga0495591_000100_66741_67427 203
180 3300046471 Ga0495650_0000005 Ga0495650_0000005_658425_659111 203
181 3300047469 Ga0495673_0000070 Ga0495673_0000070_133362_134048 203
182 3300048904 Ga0496101_0458047 Ga0496101_0458047_34_741 203
183 3300048905 Ga0496102_0543018 Ga0496102_0543018_208_894 203
184 3300048907 Ga0496104_0005483 Ga0496104_0005483_6057_6743 203
185 3300048908 Ga0496105_0273848 Ga0496105_0273848_665_1351 203
186 3300048916 Ga0496113_0331182 Ga0496113_0331182_319_1005 203
187 3300048919 Ga0496116_0000822 Ga0496116_0000822_31801_32487 203
188 3300048919 Ga0496116_0012797 Ga0496116_0012797_5000_5707 203
189 3300048919 Ga0496116_0015827 Ga0496116_0015827_204_890 203
190 3300048919 Ga0496116_0016780 Ga0496116_0016780_3897_4583 203
191 3300048920 Ga0496117_0000020 Ga0496117_0000020_431749_432435 203
192 3300048920 Ga0496117_0011282 Ga0496117_0011282_5290_5976 203
193 3300048920 Ga0496117_0011430 Ga0496117_0011430_2181_2867 203
194 3300048920 Ga0496117_0015883 Ga0496117_0015883_837_1523 203
195 3300048921 Ga0496118_0000015 Ga0496118_0000015_447033_447719 203
196 3300048921 Ga0496118_0019563 Ga0496118_0019563_4143_4829 203
197 3300048921 Ga0496118_0022344 Ga0496118_0022344_3631_4317 203
198 3300048921 Ga0496118_0140640 Ga0496118_0140640_10_696 203
199 3300048922 Ga0496119_0004672 Ga0496119_0004672_11868_12554 203
200 3300048922 Ga0496119_0009553 Ga0496119_0009553_1115_1822 203
201 3300048922 Ga0496119_0035560 Ga0496119_0035560_2161_2847 203
202 3300048923 Ga0496120_0000952 Ga0496120_0000952_29875_30582 203
203 3300048923 Ga0496120_0085647 Ga0496120_0085647_97_783 203
204 3300048923 Ga0496120_0109520 Ga0496120_0109520_125_811 203
205 3300048924 Ga0496121_0002791 Ga0496121_0002791_5115_5801 203
206 3300048924 Ga0496121_0004182 Ga0496121_0004182_2297_2983 203
207 3300048924 Ga0496121_0005490 Ga0496121_0005490_3289_3975 203
208 3300048924 Ga0496121_0007110 Ga0496121_0007110_1416_2102 203
209 3300048924 Ga0496121_0011142 Ga0496121_0011142_4680_5366 203
210 3300048924 Ga0496121_0018640 Ga0496121_0018640_1411_2097 203
211 3300048924 Ga0496121_0023502 Ga0496121_0023502_1527_2213 203
212 3300048924 Ga0496121_0034836 Ga0496121_0034836_1095_1781 203
213 3300048925 Ga0496122_0000005 Ga0496122_0000005_105686_106372 203
214 3300048925 Ga0496122_0003163 Ga0496122_0003163_21222_21908 203
215 3300048925 Ga0496122_0003949 Ga0496122_0003949_4193_4900 203
216 3300048925 Ga0496122_0005034 Ga0496122_0005034_2076_2762 203
217 3300048925 Ga0496122_0020988 Ga0496122_0020988_644_1330 203
218 3300048925 Ga0496122_0076961 Ga0496122_0076961_527_1213 203
219 3300048926 Ga0496123_0000008 Ga0496123_0000008_524257_524943 203
220 3300048926 Ga0496123_0003165 Ga0496123_0003165_16177_16863 203
221 3300048926 Ga0496123_0004842 Ga0496123_0004842_772_1458 203
222 3300048926 Ga0496123_0006575 Ga0496123_0006575_8310_9017 203
223 3300048927 Ga0496124_0001064 Ga0496124_0001064_40465_41151 203
224 3300048927 Ga0496124_0014944 Ga0496124_0014944_2897_3583 203
225 3300048927 Ga0496124_0015853 Ga0496124_0015853_493_1200 203
226 3300048927 Ga0496124_0029363 Ga0496124_0029363_2611_3297 203
227 3300048927 Ga0496124_0031631 Ga0496124_0031631_1592_2278 203
228 3300048927 Ga0496124_0032720 Ga0496124_0032720_1441_2127 203
229 3300048927 Ga0496124_0062638 Ga0496124_0062638_1652_2338 203
230 3300048927 Ga0496124_0245492 Ga0496124_0245492_450_1136 203
231 3300048928 Ga0496125_0002253 Ga0496125_0002253_4802_5488 203
232 3300048928 Ga0496125_0011260 Ga0496125_0011260_2941_3627 203
233 3300048928 Ga0496125_0015717 Ga0496125_0015717_1486_2172 203
234 3300048928 Ga0496125_0146296 Ga0496125_0146296_101_787 203
235 3300048929 Ga0496126_0001084 Ga0496126_0001084_22430_23116 203
236 3300048929 Ga0496126_0003320 Ga0496126_0003320_15417_16103 203
237 3300048929 Ga0496126_0047345 Ga0496126_0047345_82_768 203
238 3300048929 Ga0496126_0055481 Ga0496126_0055481_471_1178 203
239 3300048929 Ga0496126_0620534 Ga0496126_0620534_68_754 203
240 3300050491 nmdc:mga00v17_76398_c1 nmdc:mga00v17_76398_c1_1218_1904 203
241 3300050491 nmdc:mga00v17_9828_c1 nmdc:mga00v17_9828_c1_2862_3569 203
242 iso_pu_bacteria 2585427592 2585834840 203
243 iso_pu_bacteria 2667528173 2671109930 203
244 iso_pu_bacteria 2904474040 2904477238 203
245 iso_pu_bacteria 2904504865 2904508634 203
246 iso_pu_bacteria 2919150387 2919153405 203
247 iso_pu_bacteria 2927143783 2927144031 203
248 3300003856 Ga0058692_1002637 Ga0058692_10026374 204
249 3300027312 Ga0209371_1000002 Ga0209371_1000002223 204
250 3300027312 Ga0209371_1000041 Ga0209371_1000041240 204
251 3300027312 Ga0209371_1000109 Ga0209371_1000109105 204
252 3300027312 Ga0209371_1012808 Ga0209371_10128081 204
253 3300030500 Ga0268256_1000002 Ga0268256_10000021241 204
254 3300030500 Ga0268256_1000003 Ga0268256_10000031064 204
255 3300030500 Ga0268256_1006796 Ga0268256_10067963 204
256 3300038725 Ga0400484_32548 Ga0400484_32548_47_733 204
257 3300038726 Ga0400490_07306 Ga0400490_07306_31857_32543 204
258 3300038727 Ga0400491_09168 Ga0400491_09168_700_1401 204
259 3300038741 Ga0400488_07973 Ga0400488_07973_3199_3885 204
260 3300038741 Ga0400488_17137 Ga0400488_17137_2477_3163 204
261 3300038741 Ga0400488_29568 Ga0400488_29568_5943_6629 204
262 3300038742 Ga0400486_05108 Ga0400486_05108_1186_1887 204
263 3300039062 Ga0400483_028427 Ga0400483_028427_2255_2941 204
264 3300039062 Ga0400483_072292 Ga0400483_072292_291_992 204
265 3300039062 Ga0400483_110186 Ga0400483_110186_876_1577 204
266 3300039062 Ga0400483_161230 Ga0400483_161230_1011_1697 204
267 3300039062 Ga0400483_211573 Ga0400483_211573_3799_4500 204
268 3300039062 Ga0400483_238517 Ga0400483_238517_4568_5254 204
269 3300039062 Ga0400483_273045 Ga0400483_273045_156_842 204
270 3300039110 Ga0400487_60657 Ga0400487_60657_1150_1836 204
271 3300039110 Ga0400487_62881 Ga0400487_62881_1034_1720 204
272 3300048919 Ga0496116_0145959 Ga0496116_0145959_343_1044 204
273 3300048920 Ga0496117_0015805 Ga0496117_0015805_3894_4595 204
274 3300048921 Ga0496118_0052065 Ga0496118_0052065_616_1317 204
275 3300048922 Ga0496119_0000001 Ga0496119_0000001_748956_749657 204
276 3300048923 Ga0496120_0023275 Ga0496120_0023275_1145_1846 204
277 3300048925 Ga0496122_0067627 Ga0496122_0067627_1361_2062 204
278 3300048926 Ga0496123_0105218 Ga0496123_0105218_197_898 204
279 3300048927 Ga0496124_0088579 Ga0496124_0088579_1667_2368 204
280 iso_pu_bacteria 2511231025 2511382810 204
281 iso_pu_bacteria 2511231035 2511437197 204
282 iso_pu_bacteria 2547132416 2548650353 204
283 iso_pu_bacteria 2599185299 2599925536 204
284 iso_pu_bacteria 2602042047 2603642635 204
285 iso_pu_bacteria 2602042067 2603703226 204
286 iso_pu_bacteria 2608642108 2608669359 204
287 iso_pu_bacteria 2648501693 2650898870 204
288 iso_pu_bacteria 2681812866 2681997690 204
289 iso_pu_bacteria 2681812869 2682006783 204
290 iso_pu_bacteria 2684622997 2686353255 204
291 iso_pu_bacteria 2706794495 2707099107 204
292 iso_pu_bacteria 2751185917 2753855768 204
293 iso_pu_bacteria 2765235842 2765588765 204
294 iso_pu_bacteria 2775506706 2775538769 204
295 iso_pu_bacteria 2791354903 2791922432 204
296 iso_pu_bacteria 2808606414 2809123688 204
297 iso_pu_bacteria 2821118458 2821119575 204
298 iso_pu_bacteria 2823373977 2823374555 204
299 iso_pu_bacteria 2844425489 2844427321 204
300 iso_pu_bacteria 2844528606 2844533053 204
301 iso_pu_bacteria 2847085930 2847087764 204
302 iso_pu_bacteria 2847797336 2847799965 204
303 iso_pu_bacteria 2852103415 2852104851 204
304 iso_pu_bacteria 2865014394 2865015184 204
305 iso_pu_bacteria 2876601092 2876604352 204
306 iso_pu_bacteria 2881609920 2881613401 204
307 iso_pu_bacteria 2908669403 2908669989 204
308 iso_pu_bacteria 2923634449 2923634642 204
309 iso_pu_bacteria 2927833300 2927834308 204
310 iso_pu_bacteria 2937539931 2937540352 204
311 iso_pu_bacteria 2939568625 2939568981 204
312 iso_pu_bacteria 2939602548 2939603423 204
313 iso_pu_bacteria 2939607340 2939607643 204
314 iso_pu_bacteria 2939642701 2939643971 204
315 iso_pu_bacteria 2945951305 2945953068 204
316 iso_pu_bacteria 2974310843 2974312313 204
317 iso_pu_bacteria 2978975091 2978975587 204
318 iso_pu_bacteria 2984494565 2984496541 204
319 iso_pu_bacteria 2990261002 2990261961 204
320 iso_pu_bacteria 3000376612 3000378783 204
321 iso_pu_bacteria 8016733728 8016736036 204
322 iso_pu_bacteria 8018221730 8018223313 204
323 iso_pu_bacteria 8018405270 8018408342 204
324 iso_pu_bacteria 8019499862 8019502781 204
325 iso_pu_bacteria 8055087960 8055090966 204
326 iso_pu_bacteria 8055092621 8055094542 204
327 iso_pu_bacteria 8055097453 8055099951 204
328 iso_pu_bacteria 8055693939 8055696174 204
329 3300002773 JGI25152J39213_1000258 JGI25152J39213_100025823 205
330 3300013102 Ga0157371_10028701 Ga0157371_100287014 205
331 3300013307 Ga0157372_10025375 Ga0157372_100253754 205
332 3300025245 Ga0207425_1011769 Ga0207425_10117693 205
333 3300025258 Ga0209129_1000004 Ga0209129_1000004108 205
334 3300027312 Ga0209371_1018953 Ga0209371_10189533 205
335 3300030500 Ga0268256_1014947 Ga0268256_10149472 205
336 3300031691 Ga0316579_10005815 Ga0316579_100058156 205
337 3300031691 Ga0316579_10019973 Ga0316579_100199732 205
338 3300031691 Ga0316579_10115763 Ga0316579_101157633 205
339 3300031727 Ga0316576_10008341 Ga0316576_100083414 205
340 3300031728 Ga0316578_10007306 Ga0316578_100073062 205
341 3300031733 Ga0316577_10008166 Ga0316577_100081665 205
342 3300032137 Ga0316585_10016628 Ga0316585_100166283 205
343 3300032137 Ga0316585_10038137 Ga0316585_100381373 205
344 3300032139 Ga0316580_10000315 Ga0316580_100003157 205
345 3300032139 Ga0316580_10000618 Ga0316580_100006184 205
346 3300032168 Ga0316593_10034246 Ga0316593_100342462 205
347 3300032168 Ga0316593_10077807 Ga0316593_100778071 205
348 3300035398 Ga0316574_0009353 Ga0316574_0009353_290_1003 205
349 3300035398 Ga0316574_0011619 Ga0316574_0011619_2223_2936 205
350 3300035398 Ga0316574_0085007 Ga0316574_0085007_402_1106 205
351 3300036647 Ga0316582_0001421 Ga0316582_0001421_9101_9814 205
352 3300036647 Ga0316582_0018709 Ga0316582_0018709_1985_2698 205
353 3300036712 Ga0316584_0000571 Ga0316584_0000571_11367_12080 205
354 3300036712 Ga0316584_0037525 Ga0316584_0037525_1000_1713 205
355 3300036712 Ga0316584_0089054 Ga0316584_0089054_1367_2080 205
356 3300039062 Ga0400483_202170 Ga0400483_202170_1220_1918 205
357 3300039093 Ga0400489_08754 Ga0400489_08754_362_1066 205
358 3300039093 Ga0400489_34915 Ga0400489_34915_188_886 205
359 3300039110 Ga0400487_07449 Ga0400487_07449_22580_23269 205
360 3300042010 Ga0439452_000028 Ga0439452_000028_163863_164564 205
361 3300042010 Ga0439452_009464 Ga0439452_009464_1170_1856 205
362 3300046530 Ga0495654_0000149 Ga0495654_0000149_19429_20127 205
363 3300046794 Ga0495589_0000001 Ga0495589_0000001_872136_872834 205
364 3300048919 Ga0496116_0145960 Ga0496116_0145960_279_980 205
365 3300048920 Ga0496117_0057265 Ga0496117_0057265_198_899 205
366 3300048921 Ga0496118_0048217 Ga0496118_0048217_783_1484 205
367 3300048926 Ga0496123_0049626 Ga0496123_0049626_1788_2489 205
368 iso_pu_bacteria 2506520007 2506578255 205
369 iso_pu_bacteria 2506520008 2506583393 205
370 iso_pu_bacteria 2508501071 2508852268 205
371 iso_pu_bacteria 2654587920 2656278697 205
372 iso_pu_bacteria 2671180115 2671587584 205
373 iso_pu_bacteria 2687453601 2689444806 205
374 iso_pu_bacteria 2711768156 2712469776 205
375 iso_pu_bacteria 2772190666 2772438853 205
376 iso_pu_bacteria 2806310673 2807179507 205
377 iso_pu_bacteria 2846540461 2846545128 205
378 iso_pu_bacteria 2869551831 2869554213 205
379 iso_pu_bacteria 2888366609 2888368875 205
380 iso_pu_bacteria 2888373701 2888378421 205
381 iso_pu_bacteria 2891670763 2891670996 205
382 iso_pu_bacteria 2932406140 2932408143 205
383 iso_pu_bacteria 2937967321 2937967469 205
384 iso_pu_bacteria 2939577877 2939578600 205
385 iso_pu_bacteria 640753048 640937774 205
386 iso_pu_bacteria 8004592986 8004595761 205
387 iso_pu_bacteria 8015394850 8015398296 205
388 iso_pu_bacteria 8054844752 8054845708 205
389 iso_pu_bacteria 8054849141 8054853074 205
390 3300002737 JGI25162J39368_1003729 JGI25162J39368_10037294 206
391 3300003856 Ga0058692_1000072 Ga0058692_100007267 206
392 3300003856 Ga0058692_1004426 Ga0058692_10044264 206
393 3300006051 Ga0075364_10087685 Ga0075364_100876853 206
394 3300009011 Ga0105251_10002952 Ga0105251_100029524 206
395 3300009011 Ga0105251_10008865 Ga0105251_100088655 206
396 3300009036 Ga0105244_10017463 Ga0105244_100174634 206
397 3300009092 Ga0105250_10057509 Ga0105250_100575092 206
398 3300013100 Ga0157373_10142218 Ga0157373_101422182 206
399 3300013102 Ga0157371_10005504 Ga0157371_100055047 206
400 3300013104 Ga0157370_10000064 Ga0157370_1000006455 206
401 3300013104 Ga0157370_10756746 Ga0157370_107567461 206
402 3300013105 Ga0157369_10008888 Ga0157369_100088887 206
403 3300013306 Ga0163162_10064916 Ga0163162_100649164 206
404 3300013307 Ga0157372_10015540 Ga0157372_100155403 206
405 3300015261 Ga0182006_1009989 Ga0182006_10099894 206
406 3300017792 Ga0163161_10121081 Ga0163161_101210812 206
407 3300025233 Ga0209437_100109 Ga0209437_10010914 206
408 3300025233 Ga0209437_100111 Ga0209437_10011114 206
409 3300025711 Ga0207696_1001252 Ga0207696_100125213 206
410 3300025728 Ga0207655_1001583 Ga0207655_10015832 206
411 3300025728 Ga0207655_1005935 Ga0207655_10059358 206
412 3300025728 Ga0207655_1032283 Ga0207655_10322832 206
413 3300025735 Ga0207713_1000001 Ga0207713_1000001999 206
414 3300025735 Ga0207713_1049805 Ga0207713_10498052 206
415 3300025972 Ga0207668_10293539 Ga0207668_102935392 206
416 3300027312 Ga0209371_1000124 Ga0209371_100012472 206
417 3300027312 Ga0209371_1001786 Ga0209371_10017866 206
418 3300030500 Ga0268256_1000186 Ga0268256_100018613 206
419 3300030500 Ga0268256_1001014 Ga0268256_100101410 206
420 3300030500 Ga0268256_1009253 Ga0268256_10092534 206
421 3300031691 Ga0316579_10046289 Ga0316579_100462893 206
422 3300031733 Ga0316577_10187423 Ga0316577_101874231 206
423 3300032133 Ga0316583_10003922 Ga0316583_100039225 206
424 3300035398 Ga0316574_0107712 Ga0316574_0107712_803_1501 206
425 3300036647 Ga0316582_0016854 Ga0316582_0016854_2608_3306 206
426 3300036647 Ga0316582_0026036 Ga0316582_0026036_2025_2717 206
427 3300037588 Ga0316581_0005240 Ga0316581_0005240_405_1097 206
428 3300038726 Ga0400490_23381 Ga0400490_23381_17087_17794 206
429 3300038727 Ga0400491_25243 Ga0400491_25243_6604_7311 206
430 3300038741 Ga0400488_62508 Ga0400488_62508_584_1276 206
431 3300039062 Ga0400483_022387 Ga0400483_022387_426_1118 206
432 3300039062 Ga0400483_109489 Ga0400483_109489_228_920 206
433 3300039062 Ga0400483_286450 Ga0400483_286450_782_1474 206
434 3300039110 Ga0400487_02160 Ga0400487_02160_2441_3133 206
435 3300039110 Ga0400487_26748 Ga0400487_26748_111_812 206
436 3300041405 Ga0439438_008998 Ga0439438_008998_30_734 206
437 3300041407 Ga0439447_002338 Ga0439447_002338_1852_2556 206
438 3300041411 Ga0439466_0000091 Ga0439466_0000091_12619_13323 206
439 3300042006 Ga0439432_008780 Ga0439432_008780_794_1498 206
440 3300042006 Ga0439432_028315 Ga0439432_028315_187_891 206
441 3300042010 Ga0439452_000001 Ga0439452_000001_718655_719359 206
442 3300042016 Ga0439463_017308 Ga0439463_017308_817_1521 206
443 3300042146 Ga0450907_000363 Ga0450907_000363_9491_10201 206
444 3300046522 Ga0495643_0016913 Ga0495643_0016913_1354_2058 206
445 3300046524 Ga0495648_0002178 Ga0495648_0002178_9719_10423 206
446 3300046810 Ga0495660_0040670 Ga0495660_0040670_75_779 206
447 3300046810 Ga0495660_0264096 Ga0495660_0264096_15_719 206
448 3300047320 Ga0495672_0000043 Ga0495672_0000043_37182_37886 206
449 3300047446 Ga0495679_003257 Ga0495679_003257_6625_7335 206
450 3300048905 Ga0496102_0032824 Ga0496102_0032824_2125_2829 206
451 3300048905 Ga0496102_0057959 Ga0496102_0057959_838_1542 206
452 3300048908 Ga0496105_0001541 Ga0496105_0001541_7988_8692 206
453 3300048919 Ga0496116_0000359 Ga0496116_0000359_58486_59190 206
454 3300048919 Ga0496116_0064744 Ga0496116_0064744_1418_2122 206
455 3300048919 Ga0496116_0074703 Ga0496116_0074703_925_1629 206
456 3300048920 Ga0496117_0000004 Ga0496117_0000004_2236_2940 206
457 3300048920 Ga0496117_0001199 Ga0496117_0001199_10330_11034 206
458 3300048920 Ga0496117_0007977 Ga0496117_0007977_4971_5675 206
459 3300048921 Ga0496118_0000007 Ga0496118_0000007_134073_134777 206
460 3300048921 Ga0496118_0000085 Ga0496118_0000085_66219_66923 206
461 3300048921 Ga0496118_0005050 Ga0496118_0005050_7494_8198 206
462 3300048922 Ga0496119_0000015 Ga0496119_0000015_248860_249564 206
463 3300048922 Ga0496119_0001536 Ga0496119_0001536_12566_13270 206
464 3300048923 Ga0496120_0001449 Ga0496120_0001449_12762_13466 206
465 3300048923 Ga0496120_0003798 Ga0496120_0003798_10281_10985 206
466 3300048924 Ga0496121_0009302 Ga0496121_0009302_10258_10962 206
467 3300048925 Ga0496122_0000655 Ga0496122_0000655_2386_3090 206
468 3300048925 Ga0496122_0057749 Ga0496122_0057749_835_1539 206
469 3300048926 Ga0496123_0000788 Ga0496123_0000788_48129_48833 206
470 3300048926 Ga0496123_0117222 Ga0496123_0117222_601_1305 206
471 3300048927 Ga0496124_0000107 Ga0496124_0000107_640_1344 206
472 3300048927 Ga0496124_0020810 Ga0496124_0020810_3566_4270 206
473 3300048927 Ga0496124_0026555 Ga0496124_0026555_1732_2436 206
474 3300048928 Ga0496125_0006340 Ga0496125_0006340_9761_10465 206
475 3300050491 nmdc:mga00v17_18954_c1 nmdc:mga00v17_18954_c1_2030_2734 206
476 iso_pu_bacteria 2854601825 2854604050 206
477 3300002771 JGI25163J39215_1000150 JGI25163J39215_100015019 207
478 3300002772 JGI25164J39214_1000002 JGI25164J39214_1000002148 207
479 3300003751 Ga0055538_1000015 Ga0055538_1000015123 207
480 3300003752 Ga0055539_1000009 Ga0055539_1000009214 207
481 3300003756 Ga0055533_1000012 Ga0055533_1000012147 207
482 3300003759 Ga0055525_1000014 Ga0055525_1000014214 207
483 3300003841 Ga0055541_1000006 Ga0055541_1000006147 207
484 3300009036 Ga0105244_10001340 Ga0105244_1000134018 207
485 3300009092 Ga0105250_10000002 Ga0105250_1000000252 207
486 3300009092 Ga0105250_10014876 Ga0105250_100148762 207
487 3300013100 Ga0157373_10017204 Ga0157373_100172043 207
488 3300013102 Ga0157371_10000008 Ga0157371_10000008146 207
489 3300013102 Ga0157371_10008285 Ga0157371_100082854 207
490 3300013306 Ga0163162_10258306 Ga0163162_102583063 207
491 3300013307 Ga0157372_10046939 Ga0157372_100469393 207
492 3300025207 Ga0209760_100051 Ga0209760_10005152 207
493 3300025224 Ga0209784_100001 Ga0209784_1000012032 207
494 3300025225 Ga0209566_100001 Ga0209566_1000012032 207
495 3300025226 Ga0209674_100002 Ga0209674_1000022032 207
496 3300025230 Ga0209563_100002 Ga0209563_100002567 207
497 3300025231 Ga0207427_100020 Ga0207427_100020209 207
498 3300025233 Ga0209437_100001 Ga0209437_100001567 207
499 3300025253 Ga0209677_100002 Ga0209677_100002567 207
500 3300025261 Ga0209233_1018034 Ga0209233_10180342 207
501 3300025711 Ga0207696_1000239 Ga0207696_100023963 207
502 3300025711 Ga0207696_1010381 Ga0207696_10103812 207
503 3300025728 Ga0207655_1000413 Ga0207655_100041325 207
504 3300036647 Ga0316582_0002198 Ga0316582_0002198_497_1195 207
505 3300036647 Ga0316582_0243626 Ga0316582_0243626_42_764 207
506 3300038726 Ga0400490_47679 Ga0400490_47679_103975_104685 207
507 3300038735 Ga0400485_02459 Ga0400485_02459_61722_62417 207
508 3300038741 Ga0400488_06466 Ga0400488_06466_1815_2525 207
509 3300038741 Ga0400488_06713 Ga0400488_06713_13315_14010 207
510 3300038742 Ga0400486_23232 Ga0400486_23232_167857_168552 207
511 3300039110 Ga0400487_54381 Ga0400487_54381_25612_26322 207
512 3300039110 Ga0400487_55535 Ga0400487_55535_2384_3079 207
513 3300041405 Ga0439438_000001 Ga0439438_000001_746477_747175 207
514 3300041505 Ga0451849_0466671 Ga0451849_0466671_102_800 207
515 3300042006 Ga0439432_008629 Ga0439432_008629_960_1658 207
516 3300046471 Ga0495650_0000043 Ga0495650_0000043_260061_260759 207
517 3300046519 Ga0495632_0233876 Ga0495632_0233876_113_811 207
518 3300046810 Ga0495660_0000012 Ga0495660_0000012_159517_160215 207
519 3300048907 Ga0496104_0001633 Ga0496104_0001633_7760_8458 207
520 3300048919 Ga0496116_0000066 Ga0496116_0000066_186255_186953 207
521 3300048919 Ga0496116_0000305 Ga0496116_0000305_7607_8305 207
522 3300048921 Ga0496118_0007386 Ga0496118_0007386_1391_2089 207
523 3300048922 Ga0496119_0006831 Ga0496119_0006831_5855_6553 207
524 3300048922 Ga0496119_0104946 Ga0496119_0104946_812_1510 207
525 3300048923 Ga0496120_0000016 Ga0496120_0000016_299326_300024 207
526 3300048923 Ga0496120_0006630 Ga0496120_0006630_1448_2146 207
527 3300048925 Ga0496122_0000110 Ga0496122_0000110_184075_184773 207
528 3300048926 Ga0496123_0000081 Ga0496123_0000081_5370_6068 207
529 3300048927 Ga0496124_0000530 Ga0496124_0000530_25473_26171 207
530 3300048928 Ga0496125_0000033 Ga0496125_0000033_83461_84159 207
531 3300048929 Ga0496126_0001066 Ga0496126_0001066_20164_20862 207
532 3300049571 Ga0501034_0727250 Ga0501034_0727250_56_760 207
533 iso_pu_bacteria 2609459761 2609913432 207
534 iso_pu_bacteria 2884086401 2884088975 207
535 iso_pu_bacteria 2945874760 2945877512 207
536 2162886007 SwRhRL2b_contig_1402837 SwRhRL2b_0815.00004180 208
537 2162886007 SwRhRL2b_contig_298608 SwRhRL2b_0343.00004570 208
538 3300005289 Ga0065704_10002897 Ga0065704_100028974 208
539 3300009011 Ga0105251_10000668 Ga0105251_1000066829 208
540 3300009036 Ga0105244_10000645 Ga0105244_1000064513 208
541 3300009036 Ga0105244_10001722 Ga0105244_100017229 208
542 3300009036 Ga0105244_10005769 Ga0105244_100057694 208
543 3300009092 Ga0105250_10000113 Ga0105250_1000011322 208
544 3300009092 Ga0105250_10001565 Ga0105250_100015653 208
545 3300013104 Ga0157370_10003634 Ga0157370_100036349 208
546 3300013307 Ga0157372_10080621 Ga0157372_100806214 208
547 3300025711 Ga0207696_1000218 Ga0207696_100021831 208
548 3300025711 Ga0207696_1011514 Ga0207696_10115142 208
549 3300025728 Ga0207655_1000037 Ga0207655_1000037265 208
550 3300025728 Ga0207655_1000069 Ga0207655_100006934 208
551 3300025728 Ga0207655_1000853 Ga0207655_10008539 208
552 3300025735 Ga0207713_1000916 Ga0207713_100091624 208
553 3300027111 Ga0209281_1001677 Ga0209281_10016774 208
554 3300027312 Ga0209371_1000005 Ga0209371_100000535 208
555 3300027312 Ga0209371_1003820 Ga0209371_10038205 208
556 3300027312 Ga0209371_1006367 Ga0209371_10063674 208
557 3300030500 Ga0268256_1000006 Ga0268256_10000061020 208
558 3300030500 Ga0268256_1006397 Ga0268256_10063973 208
559 3300030500 Ga0268256_1006442 Ga0268256_10064424 208
560 3300031665 Ga0316575_10000393 Ga0316575_100003933 208
561 3300039062 Ga0400483_124167 Ga0400483_124167_1112_1819 208
562 3300039062 Ga0400483_217826 Ga0400483_217826_1173_1880 208
563 3300041407 Ga0439447_005385 Ga0439447_005385_2034_2729 208
564 3300046452 Ga0495617_053718 Ga0495617_053718_490_1191 208
565 3300046458 Ga0495591_000013 Ga0495591_000013_123511_124218 208
566 3300046458 Ga0495591_003277 Ga0495591_003277_4301_5002 208
567 3300046471 Ga0495650_0000187 Ga0495650_0000187_2232_2933 208
568 3300046474 Ga0495605_0040143 Ga0495605_0040143_736_1437 208
569 3300046491 Ga0495584_0035092 Ga0495584_0035092_386_1087 208
570 3300046501 Ga0495607_0033867 Ga0495607_0033867_1029_1730 208
571 3300046507 Ga0495606_0008322 Ga0495606_0008322_750_1451 208
572 3300046513 Ga0495616_0026708 Ga0495616_0026708_1188_1889 208
573 3300046520 Ga0495637_0152849 Ga0495637_0152849_112_813 208
574 3300046522 Ga0495643_0149465 Ga0495643_0149465_11_712 208
575 3300046523 Ga0495644_0114660 Ga0495644_0114660_247_948 208
576 3300046524 Ga0495648_0002659 Ga0495648_0002659_755_1456 208
577 3300046530 Ga0495654_0000041 Ga0495654_0000041_127464_128171 208
578 3300046530 Ga0495654_0000167 Ga0495654_0000167_28502_29203 208
579 3300046616 Ga0495668_0027531 Ga0495668_0027531_1370_2077 208
580 3300046648 Ga0495611_0101611 Ga0495611_0101611_106_807 208
581 3300046692 Ga0495671_0054764 Ga0495671_0054764_22_723 208
582 3300046692 Ga0495671_0099692 Ga0495671_0099692_647_1348 208
583 3300046694 Ga0495649_0015928 Ga0495649_0015928_881_1582 208
584 3300046794 Ga0495589_0001761 Ga0495589_0001761_7667_8368 208
585 3300046810 Ga0495660_0000171 Ga0495660_0000171_2902_3603 208
586 3300047320 Ga0495672_0000002 Ga0495672_0000002_572574_573275 208
587 3300047323 Ga0495683_0018858 Ga0495683_0018858_2053_2754 208
588 3300047469 Ga0495673_0000167 Ga0495673_0000167_76428_77129 208
589 3300048920 Ga0496117_0131617 Ga0496117_0131617_673_1374 208
590 3300048922 Ga0496119_0000039 Ga0496119_0000039_200312_201013 208
591 3300048922 Ga0496119_0017883 Ga0496119_0017883_4361_5068 208
592 3300048922 Ga0496119_0026569 Ga0496119_0026569_1209_1907 208
593 3300048922 Ga0496119_0042312 Ga0496119_0042312_2104_2802 208
594 3300048923 Ga0496120_0000002 Ga0496120_0000002_539680_540381 208
595 3300048923 Ga0496120_0000464 Ga0496120_0000464_30023_30730 208
596 3300048923 Ga0496120_0000807 Ga0496120_0000807_11022_11720 208
597 3300048923 Ga0496120_0000967 Ga0496120_0000967_5353_6051 208
598 3300048925 Ga0496122_0033005 Ga0496122_0033005_1472_2164 208
599 3300048926 Ga0496123_0054946 Ga0496123_0054946_1218_1910 208
600 3300048926 Ga0496123_0077454 Ga0496123_0077454_341_1033 208
601 3300048927 Ga0496124_0000196 Ga0496124_0000196_14902_15600 208
602 3300048927 Ga0496124_0003500 Ga0496124_0003500_5692_6414 208
603 3300048927 Ga0496124_0010267 Ga0496124_0010267_7571_8263 208
604 3300048927 Ga0496124_0015001 Ga0496124_0015001_6365_7072 208
605 3300048928 Ga0496125_0000009 Ga0496125_0000009_469558_470250 208
606 3300048929 Ga0496126_0275683 Ga0496126_0275683_126_818 208
607 3300049459 Ga0495678_001876 Ga0495678_001876_7046_7747 208
608 3300049460 Ga0495682_0000001 Ga0495682_0000001_1261188_1261889 208
609 3300053126 Ga0500621_000003 Ga0500621_000003_175812_176513 208
610 iso_pu_bacteria 2537561728 2538424812 208
611 iso_pu_bacteria 2547132181 2547695216 208
612 iso_pu_bacteria 2554235234 2555257559 208
613 iso_pu_bacteria 2561511199 2562462921 208
614 iso_pu_bacteria 2599185169 2599409094 208
615 iso_pu_bacteria 2600255254 2601522399 208
616 iso_pu_bacteria 2600255255 2601527426 208
617 iso_pu_bacteria 2600255256 2601532419 208
618 iso_pu_bacteria 2600255257 2601537789 208
619 iso_pu_bacteria 2600255280 2601614256 208
620 iso_pu_bacteria 2600255281 2601618978 208
621 iso_pu_bacteria 2600255287 2601642418 208
622 iso_pu_bacteria 2600255288 2601647265 208
623 iso_pu_bacteria 2600255289 2601652403 208
624 iso_pu_bacteria 2600255290 2601657730 208
625 iso_pu_bacteria 2600255291 2601662240 208
626 iso_pu_bacteria 2600255298 2601695197 208
627 iso_pu_bacteria 2600255299 2601699871 208
628 iso_pu_bacteria 2600255300 2601706249 208
629 iso_pu_bacteria 2600255301 2601710555 208
630 iso_pu_bacteria 2600255302 2601715569 208
631 iso_pu_bacteria 2600255303 2601720223 208
632 iso_pu_bacteria 2600255304 2601725974 208
633 iso_pu_bacteria 2600255305 2601730516 208
634 iso_pu_bacteria 2600255306 2601735532 208
635 iso_pu_bacteria 2600255307 2601740790 208
636 iso_pu_bacteria 2600255309 2601750719 208
637 iso_pu_bacteria 2600255310 2601756555 208
638 iso_pu_bacteria 2600255311 2601762964 208
639 iso_pu_bacteria 2600255392 2602017973 208
640 iso_pu_bacteria 2602042046 2603638139 208
641 iso_pu_bacteria 2602042052 2603659606 208
642 iso_pu_bacteria 2602042053 2603664882 208
643 iso_pu_bacteria 2602042103 2603837906 208
644 iso_pu_bacteria 2602042104 2603842984 208
645 iso_pu_bacteria 2602042105 2603848057 208
646 iso_pu_bacteria 2602042106 2603853128 208
647 iso_pu_bacteria 2602042109 2603866574 208
648 iso_pu_bacteria 2602042110 2603871183 208
649 iso_pu_bacteria 2602042111 2603876097 208
650 iso_pu_bacteria 2603880178 2606048375 208
651 iso_pu_bacteria 2603880184 2606069309 208
652 iso_pu_bacteria 2603880202 2606145118 208
653 iso_pu_bacteria 2603880211 2606175777 208
654 iso_pu_bacteria 2636415599 2637224996 208
655 iso_pu_bacteria 2675903046 2676406236 208
656 iso_pu_bacteria 2775507074 2777024490 208
657 iso_pu_bacteria 2791355010 2792314773 208
658 iso_pu_bacteria 2791355275 2793405711 208
659 iso_pu_bacteria 2811995292 2813729116 208
660 iso_pu_bacteria 2814123068 2814696682 208
661 iso_pu_bacteria 2855195626 2855197307 208
662 iso_pu_bacteria 2858466076 2858468548 208
663 iso_pu_bacteria 2871272651 2871272872 208
664 iso_pu_bacteria 2871282230 2871284105 208
665 iso_pu_bacteria 2900051742 2900051930 208
666 iso_pu_bacteria 2904513164 2904514117 208
667 iso_pu_bacteria 2919108558 2919108755 208
668 iso_pu_bacteria 2935625433 2935626856 208
669 iso_pu_bacteria 2939617950 2939619401 208
670 iso_pu_bacteria 2969079654 2969081986 208
671 iso_pu_bacteria 2971820967 2971823326 208
672 iso_pu_bacteria 2974435778 2974438279 208
673 iso_pu_bacteria 2984559226 2984564420 208
674 iso_pu_bacteria 2984595703 2984597152 208
675 iso_pu_bacteria 8019504834 8019506285 208
676 iso_pu_bacteria 8057304971 8057309393 208
677 3300005289 Ga0065704_10142773 Ga0065704_101427732 209
678 3300006946 Ga0079104_1000218 Ga0079104_100021845 209
679 3300006946 Ga0079104_1000292 Ga0079104_100029258 209
680 3300006946 Ga0079104_1001649 Ga0079104_10016495 209
681 3300009011 Ga0105251_10000002 Ga0105251_10000002296 209
682 3300009011 Ga0105251_10000462 Ga0105251_1000046219 209
683 3300009011 Ga0105251_10013045 Ga0105251_100130454 209
684 3300009036 Ga0105244_10000960 Ga0105244_100009607 209
685 3300009092 Ga0105250_10000619 Ga0105250_1000061922 209
686 3300009092 Ga0105250_10001871 Ga0105250_100018714 209
687 3300009101 Ga0105247_10000129 Ga0105247_1000012929 209
688 3300009174 Ga0105241_10000002 Ga0105241_10000002479 209
689 3300013100 Ga0157373_10010097 Ga0157373_100100976 209
690 3300017792 Ga0163161_10000001 Ga0163161_100000011018 209
691 3300025711 Ga0207696_1000001 Ga0207696_10000011091 209
692 3300025711 Ga0207696_1000793 Ga0207696_10007933 209
693 3300025735 Ga0207713_1000008 Ga0207713_100000850 209
694 3300025735 Ga0207713_1000016 Ga0207713_100001651 209
695 3300025900 Ga0207710_10000113 Ga0207710_1000011367 209
696 3300025911 Ga0207654_10000005 Ga0207654_10000005478 209
697 3300027111 Ga0209281_1000001 Ga0209281_1000001797 209
698 3300027111 Ga0209281_1000003 Ga0209281_1000003226 209
699 3300027111 Ga0209281_1000181 Ga0209281_1000181119 209
700 3300031727 Ga0316576_10003602 Ga0316576_1000360210 209
701 3300031728 Ga0316578_10082646 Ga0316578_100826463 209
702 3300036647 Ga0316582_0215892 Ga0316582_0215892_189_920 209
703 3300042006 Ga0439432_004000 Ga0439432_004000_3971_4669 209
704 3300046453 Ga0495627_000116 Ga0495627_000116_65947_66645 209
705 3300046530 Ga0495654_0018643 Ga0495654_0018643_1144_1833 209
706 3300046530 Ga0495654_0020788 Ga0495654_0020788_1907_2593 209
707 3300046542 Ga0495597_0000396 Ga0495597_0000396_21892_22578 209
708 3300046660 Ga0495625_0010850 Ga0495625_0010850_1639_2325 209
709 3300046674 Ga0495588_0003450 Ga0495588_0003450_4666_5352 209
710 3300047320 Ga0495672_0000034 Ga0495672_0000034_112407_113093 209
711 3300047446 Ga0495679_000005 Ga0495679_000005_156626_157312 209
712 3300047470 Ga0495681_0030657 Ga0495681_0030657_1204_1890 209
713 3300048919 Ga0496116_0000001 Ga0496116_0000001_491846_492544 209
714 3300048920 Ga0496117_0015509 Ga0496117_0015509_1716_2414 209
715 3300048921 Ga0496118_0035915 Ga0496118_0035915_1716_2414 209
716 3300048922 Ga0496119_0046418 Ga0496119_0046418_1647_2345 209
717 3300048923 Ga0496120_0042345 Ga0496120_0042345_1383_2081 209
718 iso_pu_bacteria 2738541276 2738716562 209
719 3300003323 rootH1_10014039 rootH1_1001403912 210
720 3300031548 Ga0307408_100000408 Ga0307408_10000040819 210
721 3300031548 Ga0307408_100005509 Ga0307408_1000055097 210
722 3300031901 Ga0307406_10001275 Ga0307406_1000127511 210
723 3300048903 Ga0496100_0424959 Ga0496100_0424959_228_944 210
724 3300003323 rootH1_10020223 rootH1_100202234 211
725 3300005327 Ga0070658_10176678 Ga0070658_101766782 211
726 3300006946 Ga0079104_1000083 Ga0079104_100008383 211
727 3300009011 Ga0105251_10000189 Ga0105251_1000018940 211
728 3300009011 Ga0105251_10000304 Ga0105251_1000030439 211
729 3300009036 Ga0105244_10000015 Ga0105244_10000015140 211
730 3300009036 Ga0105244_10003108 Ga0105244_100031089 211
731 3300009092 Ga0105250_10002837 Ga0105250_100028374 211
732 3300009148 Ga0105243_10164421 Ga0105243_101644212 211
733 3300021384 Ga0213876_10000055 Ga0213876_1000005570 211
734 3300025711 Ga0207696_1000005 Ga0207696_1000005581 211
735 3300025728 Ga0207655_1000061 Ga0207655_1000061141 211
736 3300025728 Ga0207655_1021113 Ga0207655_10211132 211
737 3300025735 Ga0207713_1000002 Ga0207713_1000002826 211
738 3300025735 Ga0207713_1000003 Ga0207713_1000003163 211
739 3300025909 Ga0207705_10118526 Ga0207705_101185262 211
740 3300027111 Ga0209281_1000130 Ga0209281_100013081 211
741 3300027312 Ga0209371_1006940 Ga0209371_10069404 211
742 3300030500 Ga0268256_1007063 Ga0268256_10070632 211
743 3300032133 Ga0316583_10004452 Ga0316583_100044522 211
744 3300039062 Ga0400483_190389 Ga0400483_190389_40728_41477 211
745 3300039062 Ga0400483_224464 Ga0400483_224464_63799_64548 211
746 3300039437 Ga0436365_0971002 Ga0436365_0971002_93894_94586 211
747 3300048907 Ga0496104_0141705 Ga0496104_0141705_299_1003 211
748 3300048922 Ga0496119_0000570 Ga0496119_0000570_5278_5982 211
749 3300048923 Ga0496120_0001357 Ga0496120_0001357_4275_4979 211
750 3300048925 Ga0496122_0000545 Ga0496122_0000545_72694_73386 211
751 3300048926 Ga0496123_0000189 Ga0496123_0000189_35747_36439 211
752 3300048929 Ga0496126_0059858 Ga0496126_0059858_2425_3129 211
753 3300049758 Ga0501241_010542 Ga0501241_010542_227_967 211
754 2010549000 RicEn_FSXC12704_b1 RicEn_248870 212
755 3300009036 Ga0105244_10000014 Ga0105244_1000001411 212
756 3300025728 Ga0207655_1000063 Ga0207655_100006311 212
757 3300027111 Ga0209281_1001997 Ga0209281_10019977 212
758 3300046458 Ga0495591_005944 Ga0495591_005944_2148_2852 212
759 3300046460 Ga0495638_0001608 Ga0495638_0001608_2336_3040 212
760 3300046694 Ga0495649_0006921 Ga0495649_0006921_1563_2267 212
761 3300046694 Ga0495649_0047834 Ga0495649_0047834_498_1202 212
762 3300047446 Ga0495679_006097 Ga0495679_006097_1689_2393 212
763 3300047446 Ga0495679_022732 Ga0495679_022732_498_1202 212
764 3300048927 Ga0496124_0000425 Ga0496124_0000425_73391_74095 212
765 3300048927 Ga0496124_0005677 Ga0496124_0005677_6546_7247 212
766 3300048928 Ga0496125_0042336 Ga0496125_0042336_2588_3289 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02508

Rnf-Nqr

Rnf-Nqr subunit, membrane protein

39

235

0.99

Feature Viewer

pLDDT pTM Quality
62.98 0.47 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map