F479721
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 764 | 402 | 763 | 110 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100143208|Ga0075428_1001432082 |
| Length | 108 |
| Sequence | MTPEQLQSFLALGIGFAVAGVLGTGYQYWTERPASFRLISEAPHLVALAVPFVVFXXXXIIMRNTVRGRRIEGRRFEFVMLATIIAGLWSLMSGSLLMRLIEIVGLFA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 2 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 6 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 12 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 15 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 17 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 28 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 29 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 46 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 47 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 48 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 49 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 50 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 52 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 53 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 55 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 56 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 59 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 60 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 66 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 67 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 68 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 69 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 71 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 82 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300012488 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 | Metagenome | Rhizosphere |
| 84 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 85 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 92 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 94 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 96 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 97 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 98 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 100 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 101 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 151 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 152 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 153 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 156 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 157 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 158 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 159 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 160 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 162 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 163 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 164 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 167 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 168 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 169 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 170 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 171 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 172 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 173 | 3300033544 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 | Metagenome | Unclassified |
| 174 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 175 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 177 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 182 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 183 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 184 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 185 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 186 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 187 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 188 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 189 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 197 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 198 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 199 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 200 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 201 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 202 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 203 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 204 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 205 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 206 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 208 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 209 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 211 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 212 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 213 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 214 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 215 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 216 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 217 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 218 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 219 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 222 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 223 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 224 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 225 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 226 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 227 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 228 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 229 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 230 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 231 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 303 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 304 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 305 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 306 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 307 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 308 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 309 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 310 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 311 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 312 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 313 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 314 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 315 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 316 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 317 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 318 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 319 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 320 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 321 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 322 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 323 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 324 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 325 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 330 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 331 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 332 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 340 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 341 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 342 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 343 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 344 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 345 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 351 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 352 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 356 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 357 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 358 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 359 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 360 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 361 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 362 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 363 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 364 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 365 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 366 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 367 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 368 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 369 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 370 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 371 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 372 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 373 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 374 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 375 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 376 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 377 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 378 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 379 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 380 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 381 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 382 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 383 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 384 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 385 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 386 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 387 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 388 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 389 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 390 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 391 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 392 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 393 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 394 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 395 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 396 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 397 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 398 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 399 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 400 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 402 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.13 |
| Isolates | 0.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.83 |
| Nodule | 0.92 |
| Rhizoplane | 5.63 |
| Rhizosphere | 70.16 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 10.47 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10011545 | 3300003215 | Bacteria | 3894 |
| 2 | JGI25404J52841_10017661 | 3300003659 | Bacteria | 1546 |
| 3 | Ga0055539_1006952 | 3300003752 | Bacteria | 1439 |
| 4 | Ga0055539_1016086 | 3300003752 | Bacteria | 908 |
| 5 | Ga0055529_1007379 | 3300003763 | Bacteria | 1497 |
| 6 | Ga0055529_1010709 | 3300003763 | Bacteria | 1189 |
| 7 | Ga0055543_1002361 | 3300004625 | Bacteria | 6309 |
| 8 | Ga0065165_1001366 | 3300005262 | Bacteria | 26875 |
| 9 | Ga0070683_100001091 | 3300005329 | Bacteria | 20439 |
| 10 | Ga0070683_100078984 | 3300005329 | Bacteria | 3079 |
| 11 | Ga0070683_100684631 | 3300005329 | Bacteria | 982 |
| 12 | Ga0070690_101116830 | 3300005330 | Bacteria | 626 |
| 13 | Ga0068869_100880982 | 3300005334 | Bacteria | 774 |
| 14 | Ga0070680_100023865 | 3300005336 | Bacteria | 4881 |
| 15 | Ga0070680_100085052 | 3300005336 | Bacteria | 2613 |
| 16 | Ga0070680_100215066 | 3300005336 | Bacteria | 1622 |
| 17 | Ga0070680_101016737 | 3300005336 | Bacteria | 716 |
| 18 | Ga0070682_100083502 | 3300005337 | Bacteria | 2073 |
| 19 | Ga0070660_100212284 | 3300005339 | Bacteria | 1572 |
| 20 | Ga0070689_100854667 | 3300005340 | Bacteria | 803 |
| 21 | Ga0070661_100144372 | 3300005344 | Bacteria | 1795 |
| 22 | Ga0070661_100930286 | 3300005344 | Bacteria | 719 |
| 23 | Ga0070692_10261919 | 3300005345 | Bacteria | 1040 |
| 24 | Ga0070674_100311255 | 3300005356 | Bacteria | 1259 |
| 25 | Ga0070659_100897916 | 3300005366 | Bacteria | 774 |
| 26 | Ga0070659_101815773 | 3300005366 | Bacteria | 546 |
| 27 | Ga0070667_101231163 | 3300005367 | Bacteria | 701 |
| 28 | Ga0070709_10000506 | 3300005434 | Bacteria | 23004 |
| 29 | Ga0070709_10033960 | 3300005434 | Bacteria | 3090 |
| 30 | Ga0070709_10035149 | 3300005434 | Bacteria | 3043 |
| 31 | Ga0070709_10069538 | 3300005434 | Bacteria | 2268 |
| 32 | Ga0070709_10702764 | 3300005434 | Bacteria | 787 |
| 33 | Ga0070714_100081400 | 3300005435 | Bacteria | 2819 |
| 34 | Ga0070714_100085927 | 3300005435 | Bacteria | 2748 |
| 35 | Ga0070714_100222922 | 3300005435 | Bacteria | 1734 |
| 36 | Ga0070714_100421337 | 3300005435 | Bacteria | 1265 |
| 37 | Ga0070714_100903387 | 3300005435 | Bacteria | 857 |
| 38 | Ga0070714_101537560 | 3300005435 | Bacteria | 650 |
| 39 | Ga0070713_100096627 | 3300005436 | Bacteria | 2551 |
| 40 | Ga0070713_101317952 | 3300005436 | Bacteria | 700 |
| 41 | Ga0070713_101599403 | 3300005436 | Bacteria | 632 |
| 42 | Ga0070710_10000386 | 3300005437 | Bacteria | 20587 |
| 43 | Ga0070710_10012971 | 3300005437 | Bacteria | 4156 |
| 44 | Ga0070710_10092974 | 3300005437 | Bacteria | 1782 |
| 45 | Ga0070710_10236766 | 3300005437 | Bacteria | 1168 |
| 46 | Ga0070710_10809886 | 3300005437 | Bacteria | 670 |
| 47 | Ga0070711_100001793 | 3300005439 | Bacteria | 11956 |
| 48 | Ga0070711_100003655 | 3300005439 | Bacteria | 8992 |
| 49 | Ga0070711_100042708 | 3300005439 | Bacteria | 3066 |
| 50 | Ga0070711_100056795 | 3300005439 | Bacteria | 2708 |
| 51 | Ga0070663_100012418 | 3300005455 | Bacteria | 5388 |
| 52 | Ga0070663_100098505 | 3300005455 | Bacteria | 2178 |
| 53 | Ga0070678_100527122 | 3300005456 | Bacteria | 1046 |
| 54 | Ga0070681_10061117 | 3300005458 | Bacteria | 3743 |
| 55 | Ga0070681_10313939 | 3300005458 | Bacteria | 1477 |
| 56 | Ga0068867_100822610 | 3300005459 | Bacteria | 830 |
| 57 | Ga0070706_100180140 | 3300005467 | Bacteria | 1973 |
| 58 | Ga0070707_100156508 | 3300005468 | Bacteria | 2220 |
| 59 | Ga0070698_100051487 | 3300005471 | Bacteria | 4194 |
| 60 | Ga0070679_100063720 | 3300005530 | Bacteria | 3674 |
| 61 | Ga0070679_100717197 | 3300005530 | Bacteria | 943 |
| 62 | Ga0070684_100003496 | 3300005535 | Bacteria | 11796 |
| 63 | Ga0068853_100183234 | 3300005539 | Bacteria | 1900 |
| 64 | Ga0068853_100677614 | 3300005539 | Bacteria | 982 |
| 65 | Ga0070696_100619003 | 3300005546 | Bacteria | 875 |
| 66 | Ga0070696_100880073 | 3300005546 | Bacteria | 742 |
| 67 | Ga0070693_100227443 | 3300005547 | Bacteria | 1225 |
| 68 | Ga0070693_100353269 | 3300005547 | Bacteria | 1007 |
| 69 | Ga0070665_100006302 | 3300005548 | Bacteria | 12113 |
| 70 | Ga0070665_101205470 | 3300005548 | Bacteria | 768 |
| 71 | Ga0068855_100441185 | 3300005563 | Bacteria | 1422 |
| 72 | Ga0068855_100638667 | 3300005563 | Bacteria | 1144 |
| 73 | Ga0068855_102388722 | 3300005563 | Bacteria | 528 |
| 74 | Ga0070664_100279403 | 3300005564 | Bacteria | 1505 |
| 75 | Ga0070664_100619026 | 3300005564 | Bacteria | 1005 |
| 76 | Ga0070664_101137325 | 3300005564 | Bacteria | 736 |
| 77 | Ga0068857_100264617 | 3300005577 | Bacteria | 1579 |
| 78 | Ga0068854_101007940 | 3300005578 | Bacteria | 738 |
| 79 | Ga0068854_101679508 | 3300005578 | Bacteria | 580 |
| 80 | Ga0068854_101696403 | 3300005578 | Bacteria | 577 |
| 81 | Ga0068856_100263678 | 3300005614 | Bacteria | 1739 |
| 82 | Ga0068856_101728778 | 3300005614 | Bacteria | 638 |
| 83 | Ga0070702_101422355 | 3300005615 | Bacteria | 568 |
| 84 | Ga0068852_100005466 | 3300005616 | Bacteria | 9090 |
| 85 | Ga0068852_100751317 | 3300005616 | Bacteria | 987 |
| 86 | Ga0068851_10227274 | 3300005834 | Bacteria | 1051 |
| 87 | Ga0068858_100596856 | 3300005842 | Bacteria | 1071 |
| 88 | Ga0068860_100005261 | 3300005843 | Bacteria | 13134 |
| 89 | Ga0068862_100240875 | 3300005844 | Bacteria | 1645 |
| 90 | Ga0081455_10084249 | 3300005937 | Bacteria | 2595 |
| 91 | Ga0081455_10163243 | 3300005937 | Bacteria | 1705 |
| 92 | Ga0081455_10604115 | 3300005937 | Bacteria | 715 |
| 93 | Ga0081538_10106975 | 3300005981 | Bacteria | 1387 |
| 94 | Ga0081540_1006012 | 3300005983 | Bacteria | 8935 |
| 95 | Ga0081540_1035235 | 3300005983 | Bacteria | 2686 |
| 96 | Ga0081540_1123080 | 3300005983 | Bacteria | 1072 |
| 97 | Ga0081540_1193445 | 3300005983 | Bacteria | 747 |
| 98 | Ga0081539_10159673 | 3300005985 | Bacteria | 1076 |
| 99 | Ga0070717_10505300 | 3300006028 | Bacteria | 1093 |
| 100 | Ga0070717_10536428 | 3300006028 | Bacteria | 1059 |
| 101 | Ga0070717_10936873 | 3300006028 | Bacteria | 789 |
| 102 | Ga0070717_11117202 | 3300006028 | Bacteria | 718 |
| 103 | Ga0075365_10341276 | 3300006038 | Bacteria | 1055 |
| 104 | Ga0075365_10614342 | 3300006038 | Bacteria | 769 |
| 105 | Ga0070715_10033216 | 3300006163 | Bacteria | 2107 |
| 106 | Ga0070715_10156144 | 3300006163 | Bacteria | 1123 |
| 107 | Ga0070715_10320039 | 3300006163 | Bacteria | 837 |
| 108 | Ga0070716_100043612 | 3300006173 | Bacteria | 2509 |
| 109 | Ga0070716_100121674 | 3300006173 | Bacteria | 1635 |
| 110 | Ga0070716_100533944 | 3300006173 | Bacteria | 871 |
| 111 | Ga0070716_100854919 | 3300006173 | Bacteria | 709 |
| 112 | Ga0070716_100988140 | 3300006173 | Bacteria | 665 |
| 113 | Ga0070712_100022303 | 3300006175 | Bacteria | 4170 |
| 114 | Ga0070712_100107729 | 3300006175 | Bacteria | 2074 |
| 115 | Ga0070712_100132676 | 3300006175 | Bacteria | 1890 |
| 116 | Ga0070712_100264784 | 3300006175 | Bacteria | 1379 |
| 117 | Ga0070712_100929321 | 3300006175 | Bacteria | 751 |
| 118 | Ga0075362_10698864 | 3300006177 | Bacteria | 529 |
| 119 | Ga0075367_10383702 | 3300006178 | Bacteria | 888 |
| 120 | Ga0075367_10399631 | 3300006178 | Bacteria | 869 |
| 121 | Ga0075367_10662857 | 3300006178 | Bacteria | 663 |
| 122 | Ga0075369_10102379 | 3300006186 | Bacteria | 1286 |
| 123 | Ga0097621_100108355 | 3300006237 | Bacteria | 2345 |
| 124 | Ga0097621_100118406 | 3300006237 | Bacteria | 2245 |
| 125 | Ga0068871_100603932 | 3300006358 | Bacteria | 998 |
| 126 | Ga0075428_100143208 | 3300006844 | Bacteria | 2599 |
| 127 | Ga0075430_100248516 | 3300006846 | Bacteria | 1474 |
| 128 | Ga0075434_100132227 | 3300006871 | Bacteria | 2515 |
| 129 | Ga0075434_100321514 | 3300006871 | Bacteria | 1568 |
| 130 | Ga0075429_100292881 | 3300006880 | Bacteria | 1425 |
| 131 | Ga0068865_100490091 | 3300006881 | Bacteria | 1023 |
| 132 | Ga0068865_101062033 | 3300006881 | Bacteria | 712 |
| 133 | Ga0075436_100754517 | 3300006914 | Bacteria | 723 |
| 134 | Ga0075436_100953109 | 3300006914 | Bacteria | 643 |
| 135 | Ga0097620_100054666 | 3300006931 | Bacteria | 4016 |
| 136 | Ga0099824_1019902 | 3300006942 | Bacteria | 5084 |
| 137 | Ga0099822_1002329 | 3300006943 | Bacteria | 23542 |
| 138 | Ga0075435_100143718 | 3300007076 | Bacteria | 2003 |
| 139 | Ga0075435_100166504 | 3300007076 | Bacteria | 1859 |
| 140 | Ga0105240_10006604 | 3300009093 | Bacteria | 17027 |
| 141 | Ga0105240_10217193 | 3300009093 | Bacteria | 2230 |
| 142 | Ga0105240_10307893 | 3300009093 | Bacteria | 1810 |
| 143 | Ga0105245_12944567 | 3300009098 | Bacteria | 528 |
| 144 | Ga0105247_10456416 | 3300009101 | Bacteria | 922 |
| 145 | Ga0114129_10467601 | 3300009147 | Bacteria | 1652 |
| 146 | Ga0114129_10881302 | 3300009147 | Bacteria | 1135 |
| 147 | Ga0105241_10031780 | 3300009174 | Bacteria | 3953 |
| 148 | Ga0105237_10003458 | 3300009545 | Bacteria | 18745 |
| 149 | Ga0105237_10041450 | 3300009545 | Bacteria | 4643 |
| 150 | Ga0105237_10338295 | 3300009545 | Bacteria | 1510 |
| 151 | Ga0105237_10610375 | 3300009545 | Bacteria | 1098 |
| 152 | Ga0105237_11261460 | 3300009545 | Bacteria | 745 |
| 153 | Ga0105237_12232160 | 3300009545 | Bacteria | 557 |
| 154 | Ga0105237_12455687 | 3300009545 | Bacteria | 531 |
| 155 | Ga0105238_10049933 | 3300009551 | Bacteria | 4212 |
| 156 | Ga0105238_10166723 | 3300009551 | Bacteria | 2178 |
| 157 | Ga0105238_10264870 | 3300009551 | Bacteria | 1699 |
| 158 | Ga0105238_11785998 | 3300009551 | Bacteria | 647 |
| 159 | Ga0105238_12051923 | 3300009551 | Bacteria | 606 |
| 160 | Ga0105249_10115777 | 3300009553 | Bacteria | 2540 |
| 161 | Ga0099796_10158076 | 3300010159 | Bacteria | 897 |
| 162 | Ga0105239_10120827 | 3300010375 | Bacteria | 2909 |
| 163 | Ga0105239_10377852 | 3300010375 | Bacteria | 1602 |
| 164 | Ga0105239_11194644 | 3300010375 | Bacteria | 876 |
| 165 | Ga0157343_1013597 | 3300012488 | Bacteria | 659 |
| 166 | Ga0157327_1048120 | 3300012512 | Bacteria | 597 |
| 167 | Ga0157370_10768758 | 3300013104 | Bacteria | 877 |
| 168 | Ga0157369_10004472 | 3300013105 | Bacteria | 16469 |
| 169 | Ga0157369_10549868 | 3300013105 | Bacteria | 1193 |
| 170 | Ga0157369_10729172 | 3300013105 | Bacteria | 1020 |
| 171 | Ga0157369_11123904 | 3300013105 | Bacteria | 803 |
| 172 | Ga0157369_11508075 | 3300013105 | Bacteria | 684 |
| 173 | Ga0157378_11242148 | 3300013297 | Bacteria | 785 |
| 174 | Ga0157372_10614691 | 3300013307 | Bacteria | 1267 |
| 175 | Ga0157372_10889415 | 3300013307 | Bacteria | 1033 |
| 176 | Ga0157375_10185912 | 3300013308 | Bacteria | 2231 |
| 177 | Ga0157375_11127150 | 3300013308 | Bacteria | 919 |
| 178 | Ga0163163_10787807 | 3300014325 | Bacteria | 1014 |
| 179 | Ga0182008_10826181 | 3300014497 | Bacteria | 540 |
| 180 | Ga0157379_10339863 | 3300014968 | Bacteria | 1373 |
| 181 | Ga0157379_11408138 | 3300014968 | Bacteria | 676 |
| 182 | Ga0182005_1051209 | 3300015265 | Bacteria | 1123 |
| 183 | Ga0163161_10364831 | 3300017792 | Bacteria | 1151 |
| 184 | Ga0213872_10080135 | 3300021361 | Bacteria | 1467 |
| 185 | Ga0213872_10224289 | 3300021361 | Bacteria | 799 |
| 186 | Ga0213874_10172863 | 3300021377 | Bacteria | 765 |
| 187 | Ga0213871_10025432 | 3300021441 | Bacteria | 1507 |
| 188 | Ga0224712_10240549 | 3300022467 | Bacteria | 834 |
| 189 | Ga0209563_104549 | 3300025230 | Bacteria | 2637 |
| 190 | Ga0209026_1059060 | 3300025250 | Bacteria | 540 |
| 191 | Ga0209677_102314 | 3300025253 | Bacteria | 7319 |
| 192 | Ga0209677_110139 | 3300025253 | Bacteria | 1601 |
| 193 | Ga0209148_1002066 | 3300025254 | Bacteria | 7717 |
| 194 | Ga0209148_1009174 | 3300025254 | Bacteria | 1945 |
| 195 | Ga0209148_1013448 | 3300025254 | Bacteria | 1472 |
| 196 | Ga0209233_1001936 | 3300025261 | Bacteria | 7895 |
| 197 | Ga0209233_1013958 | 3300025261 | Bacteria | 2279 |
| 198 | Ga0209233_1015125 | 3300025261 | Bacteria | 2158 |
| 199 | Ga0209233_1062092 | 3300025261 | Bacteria | 718 |
| 200 | Ga0209455_1003189 | 3300025272 | Bacteria | 5939 |
| 201 | Ga0209455_1006825 | 3300025272 | Bacteria | 3320 |
| 202 | Ga0209455_1008760 | 3300025272 | Bacteria | 2717 |
| 203 | Ga0209455_1031244 | 3300025272 | Bacteria | 897 |
| 204 | Ga0209673_1023353 | 3300025273 | Bacteria | 2108 |
| 205 | Ga0209758_1002828 | 3300025297 | Bacteria | 16872 |
| 206 | Ga0209758_1020210 | 3300025297 | Bacteria | 3164 |
| 207 | Ga0209758_1061540 | 3300025297 | Bacteria | 1235 |
| 208 | Ga0209758_1099613 | 3300025297 | Bacteria | 830 |
| 209 | Ga0207426_1000554 | 3300025302 | Bacteria | 51521 |
| 210 | Ga0207426_1033367 | 3300025302 | Bacteria | 1660 |
| 211 | Ga0207692_10002116 | 3300025898 | Bacteria | 7577 |
| 212 | Ga0207692_10013635 | 3300025898 | Bacteria | 3531 |
| 213 | Ga0207692_10574845 | 3300025898 | Bacteria | 722 |
| 214 | Ga0207642_10528144 | 3300025899 | Bacteria | 726 |
| 215 | Ga0207710_10013025 | 3300025900 | Bacteria | 3504 |
| 216 | Ga0207710_10726406 | 3300025900 | Bacteria | 521 |
| 217 | Ga0207647_10391597 | 3300025904 | Bacteria | 784 |
| 218 | Ga0207685_10835628 | 3300025905 | Bacteria | 509 |
| 219 | Ga0207699_10000315 | 3300025906 | Bacteria | 25846 |
| 220 | Ga0207699_10047534 | 3300025906 | Bacteria | 2517 |
| 221 | Ga0207699_10050684 | 3300025906 | Bacteria | 2449 |
| 222 | Ga0207699_10754081 | 3300025906 | Bacteria | 714 |
| 223 | Ga0207699_10939505 | 3300025906 | Bacteria | 638 |
| 224 | Ga0207705_10020589 | 3300025909 | Bacteria | 4710 |
| 225 | Ga0207684_10220516 | 3300025910 | Bacteria | 1637 |
| 226 | Ga0207684_10666229 | 3300025910 | Bacteria | 886 |
| 227 | Ga0207654_10054065 | 3300025911 | Bacteria | 2320 |
| 228 | Ga0207654_10143564 | 3300025911 | Bacteria | 1525 |
| 229 | Ga0207707_10003003 | 3300025912 | Bacteria | 15004 |
| 230 | Ga0207707_10020269 | 3300025912 | Bacteria | 5805 |
| 231 | Ga0207707_10074848 | 3300025912 | Bacteria | 2954 |
| 232 | Ga0207707_10199116 | 3300025912 | Bacteria | 1746 |
| 233 | Ga0207695_10000159 | 3300025913 | Bacteria | 201367 |
| 234 | Ga0207695_10040323 | 3300025913 | Bacteria | 5009 |
| 235 | Ga0207695_10223000 | 3300025913 | Bacteria | 1792 |
| 236 | Ga0207695_10381071 | 3300025913 | Bacteria | 1296 |
| 237 | Ga0207695_10997380 | 3300025913 | Bacteria | 717 |
| 238 | Ga0207671_10009635 | 3300025914 | Bacteria | 8051 |
| 239 | Ga0207671_10208772 | 3300025914 | Bacteria | 1527 |
| 240 | Ga0207671_10291144 | 3300025914 | Bacteria | 1289 |
| 241 | Ga0207671_10987300 | 3300025914 | Bacteria | 664 |
| 242 | Ga0207693_10067578 | 3300025915 | Bacteria | 2799 |
| 243 | Ga0207693_10072343 | 3300025915 | Bacteria | 2700 |
| 244 | Ga0207693_10084853 | 3300025915 | Bacteria | 2481 |
| 245 | Ga0207693_10099613 | 3300025915 | Bacteria | 2279 |
| 246 | Ga0207693_10126813 | 3300025915 | Bacteria | 2006 |
| 247 | Ga0207693_10224084 | 3300025915 | Bacteria | 1477 |
| 248 | Ga0207693_11265116 | 3300025915 | Bacteria | 553 |
| 249 | Ga0207663_10007711 | 3300025916 | Bacteria | 5601 |
| 250 | Ga0207663_10015284 | 3300025916 | Bacteria | 4232 |
| 251 | Ga0207663_10089834 | 3300025916 | Bacteria | 2035 |
| 252 | Ga0207660_10014029 | 3300025917 | Bacteria | 5260 |
| 253 | Ga0207660_10059946 | 3300025917 | Bacteria | 2734 |
| 254 | Ga0207660_10074564 | 3300025917 | Bacteria | 2477 |
| 255 | Ga0207657_11506585 | 3300025919 | Bacteria | 503 |
| 256 | Ga0207649_10151666 | 3300025920 | Bacteria | 1597 |
| 257 | Ga0207649_10297216 | 3300025920 | Bacteria | 1179 |
| 258 | Ga0207652_10024806 | 3300025921 | Bacteria | 4977 |
| 259 | Ga0207652_10063173 | 3300025921 | Bacteria | 3202 |
| 260 | Ga0207652_10116314 | 3300025921 | Bacteria | 2375 |
| 261 | Ga0207652_10393946 | 3300025921 | Bacteria | 1250 |
| 262 | Ga0207646_10353045 | 3300025922 | Bacteria | 1329 |
| 263 | Ga0207694_10155708 | 3300025924 | Bacteria | 1843 |
| 264 | Ga0207694_10275885 | 3300025924 | Bacteria | 1380 |
| 265 | Ga0207650_10864416 | 3300025925 | Bacteria | 767 |
| 266 | Ga0207687_10607471 | 3300025927 | Bacteria | 922 |
| 267 | Ga0207700_10164850 | 3300025928 | Bacteria | 1843 |
| 268 | Ga0207700_10231114 | 3300025928 | Bacteria | 1572 |
| 269 | Ga0207700_10878256 | 3300025928 | Bacteria | 802 |
| 270 | Ga0207664_10147379 | 3300025929 | Bacteria | 1997 |
| 271 | Ga0207664_10238564 | 3300025929 | Bacteria | 1583 |
| 272 | Ga0207664_10635689 | 3300025929 | Bacteria | 959 |
| 273 | Ga0207664_10826379 | 3300025929 | Bacteria | 833 |
| 274 | Ga0207664_10975661 | 3300025929 | Bacteria | 760 |
| 275 | Ga0207664_11455069 | 3300025929 | Bacteria | 606 |
| 276 | Ga0207690_11349026 | 3300025932 | Bacteria | 596 |
| 277 | Ga0207690_11735886 | 3300025932 | Bacteria | 521 |
| 278 | Ga0207670_10105640 | 3300025936 | Bacteria | 2019 |
| 279 | Ga0207669_10167327 | 3300025937 | Bacteria | 1561 |
| 280 | Ga0207669_11589605 | 3300025937 | Bacteria | 558 |
| 281 | Ga0207665_10002700 | 3300025939 | Bacteria | 11896 |
| 282 | Ga0207665_10142314 | 3300025939 | Bacteria | 1711 |
| 283 | Ga0207665_10191929 | 3300025939 | Bacteria | 1484 |
| 284 | Ga0207665_10218457 | 3300025939 | Bacteria | 1396 |
| 285 | Ga0207665_10237345 | 3300025939 | Bacteria | 1342 |
| 286 | Ga0207665_11696075 | 3300025939 | Bacteria | 500 |
| 287 | Ga0207691_10298091 | 3300025940 | Bacteria | 1385 |
| 288 | Ga0207689_11337832 | 3300025942 | Bacteria | 601 |
| 289 | Ga0207661_10001748 | 3300025944 | Bacteria | 14867 |
| 290 | Ga0207661_10021847 | 3300025944 | Bacteria | 4803 |
| 291 | Ga0207661_10274622 | 3300025944 | Bacteria | 1505 |
| 292 | Ga0207679_11721239 | 3300025945 | Bacteria | 574 |
| 293 | Ga0207667_10193301 | 3300025949 | Bacteria | 2088 |
| 294 | Ga0207667_10750511 | 3300025949 | Bacteria | 975 |
| 295 | Ga0207667_10760537 | 3300025949 | Bacteria | 968 |
| 296 | Ga0207712_10650275 | 3300025961 | Bacteria | 916 |
| 297 | Ga0207668_11021776 | 3300025972 | Bacteria | 739 |
| 298 | Ga0207677_10145640 | 3300026023 | Bacteria | 1820 |
| 299 | Ga0207677_11995219 | 3300026023 | Bacteria | 539 |
| 300 | Ga0207703_10708173 | 3300026035 | Bacteria | 958 |
| 301 | Ga0207703_10875174 | 3300026035 | Bacteria | 860 |
| 302 | Ga0207639_10326674 | 3300026041 | Bacteria | 1363 |
| 303 | Ga0207639_10869378 | 3300026041 | Bacteria | 842 |
| 304 | Ga0207678_10014792 | 3300026067 | Bacteria | 6866 |
| 305 | Ga0207678_10126136 | 3300026067 | Bacteria | 2183 |
| 306 | Ga0207678_10418597 | 3300026067 | Bacteria | 1162 |
| 307 | Ga0207702_10050876 | 3300026078 | Bacteria | 3499 |
| 308 | Ga0207702_11290538 | 3300026078 | Bacteria | 724 |
| 309 | Ga0207674_10398814 | 3300026116 | Bacteria | 1329 |
| 310 | Ga0207698_10150554 | 3300026142 | Bacteria | 2019 |
| 311 | Ga0207698_10724329 | 3300026142 | Bacteria | 991 |
| 312 | Ga0209589_1000009 | 3300027357 | Bacteria | 252104 |
| 313 | Ga0209489_100010 | 3300027361 | Bacteria | 252139 |
| 314 | Ga0209700_100017 | 3300027363 | Bacteria | 252104 |
| 315 | Ga0268266_10006118 | 3300028379 | Bacteria | 11082 |
| 316 | Ga0268266_11043437 | 3300028379 | Bacteria | 791 |
| 317 | Ga0268264_10000035 | 3300028381 | Bacteria | 398196 |
| 318 | Ga0268264_10801658 | 3300028381 | Bacteria | 941 |
| 319 | Ga0265337_1032248 | 3300028556 | Bacteria | 1551 |
| 320 | Ga0265326_10007542 | 3300028558 | Bacteria | 3329 |
| 321 | Ga0265319_1115109 | 3300028563 | Bacteria | 839 |
| 322 | Ga0265334_10018041 | 3300028573 | Bacteria | 2909 |
| 323 | Ga0265323_10004134 | 3300028653 | Bacteria | 6290 |
| 324 | Ga0265336_10003438 | 3300028666 | Bacteria | 6205 |
| 325 | Ga0307517_10225678 | 3300028786 | Bacteria | 1132 |
| 326 | Ga0265338_10000090 | 3300028800 | Bacteria | 171540 |
| 327 | Ga0265324_10005221 | 3300029957 | Bacteria | 5654 |
| 328 | Ga0265340_10087780 | 3300031247 | Bacteria | 1457 |
| 329 | Ga0265339_10001632 | 3300031249 | Bacteria | 16566 |
| 330 | Ga0307509_10605296 | 3300031507 | Bacteria | 768 |
| 331 | Ga0307508_10329636 | 3300031616 | Bacteria | 1118 |
| 332 | Ga0265314_10036825 | 3300031711 | Bacteria | 3551 |
| 333 | Ga0265342_10061309 | 3300031712 | Bacteria | 2216 |
| 334 | Ga0307507_10285270 | 3300033179 | Bacteria | 1028 |
| 335 | Ga0307510_10070936 | 3300033180 | Bacteria | 3474 |
| 336 | Ga0307510_10202152 | 3300033180 | Bacteria | 1520 |
| 337 | Ga0315911_1000009 | 3300033442 | Bacteria | 379354 |
| 338 | Ga0316215_1007334 | 3300033544 | Bacteria | 1074 |
| 339 | Ga0373926_0038808 | 3300035083 | Bacteria | 1697 |
| 340 | Ga0373923_0090288 | 3300035111 | Bacteria | 1339 |
| 341 | Ga0373932_0209457 | 3300035112 | Bacteria | 696 |
| 342 | Ga0373936_0007135 | 3300035113 | Bacteria | 4205 |
| 343 | Ga0373945_0007221 | 3300035116 | Bacteria | 3596 |
| 344 | Ga0373945_0118007 | 3300035116 | Bacteria | 1053 |
| 345 | Ga0373953_0013490 | 3300035117 | Bacteria | 2920 |
| 346 | Ga0373956_0039292 | 3300035119 | Bacteria | 2097 |
| 347 | Ga0373957_0132180 | 3300035120 | Bacteria | 1016 |
| 348 | Ga0373943_0532355 | 3300035170 | Bacteria | 688 |
| 349 | Ga0373946_0345176 | 3300035171 | Bacteria | 743 |
| 350 | Ga0373955_0217394 | 3300035172 | Bacteria | 1140 |
| 351 | Ga0373924_0063175 | 3300035410 | Bacteria | 1552 |
| 352 | Ga0373931_0860646 | 3300035691 | Bacteria | 607 |
| 353 | Ga0373935_0085127 | 3300035692 | Bacteria | 2060 |
| 354 | Ga0373927_0012627 | 3300035695 | Bacteria | 5619 |
| 355 | Ga0373927_0353439 | 3300035695 | Bacteria | 968 |
| 356 | Ga0373947_0020630 | 3300035725 | Bacteria | 3806 |
| 357 | Ga0373947_0391807 | 3300035725 | Bacteria | 936 |
| 358 | Ga0373925_0043727 | 3300037068 | Bacteria | 3325 |
| 359 | Ga0373925_0401018 | 3300037068 | Bacteria | 1119 |
| 360 | Ga0373925_0449481 | 3300037068 | Bacteria | 1055 |
| 361 | Ga0395899_0203494 | 3300037312 | Bacteria | 1379 |
| 362 | Ga0395900_0541449 | 3300037418 | Bacteria | 1110 |
| 363 | Ga0395900_0760752 | 3300037418 | Bacteria | 899 |
| 364 | Ga0395900_0991803 | 3300037418 | Bacteria | 760 |
| 365 | Ga0395898_0077763 | 3300037466 | Bacteria | 3203 |
| 366 | Ga0395898_0355839 | 3300037466 | Bacteria | 1396 |
| 367 | Ga0395898_1029848 | 3300037466 | Bacteria | 758 |
| 368 | Ga0436364_0461816 | 3300037853 | Bacteria | 740 |
| 369 | Ga0436364_0650502 | 3300037853 | Bacteria | 1701 |
| 370 | Ga0436364_0800350 | 3300037853 | Bacteria | 663 |
| 371 | Ga0436364_1168969 | 3300037853 | Bacteria | 1322 |
| 372 | Ga0436364_1279372 | 3300037853 | Bacteria | 942 |
| 373 | Ga0436364_1328722 | 3300037853 | Bacteria | 928 |
| 374 | Ga0395901_0318003 | 3300038443 | Bacteria | 1611 |
| 375 | Ga0395901_0614328 | 3300038443 | Bacteria | 1095 |
| 376 | Ga0395901_1078275 | 3300038443 | Bacteria | 775 |
| 377 | Ga0436365_0399803 | 3300039437 | Bacteria | 2427 |
| 378 | Ga0436365_1147338 | 3300039437 | Bacteria | 2447 |
| 379 | Ga0436365_1192934 | 3300039437 | Bacteria | 1238 |
| 380 | Ga0436365_1417659 | 3300039437 | Bacteria | 6023 |
| 381 | Ga0436365_1465938 | 3300039437 | Bacteria | 822 |
| 382 | Ga0436365_1574863 | 3300039437 | Bacteria | 6668 |
| 383 | Ga0436365_1588282 | 3300039437 | Bacteria | 3274 |
| 384 | Ga0436365_1719944 | 3300039437 | Bacteria | 1071 |
| 385 | Ga0436360_0439815 | 3300039438 | Bacteria | 2074 |
| 386 | Ga0436361_0005730 | 3300039447 | Bacteria | 1990 |
| 387 | Ga0436361_0408062 | 3300039447 | Bacteria | 558 |
| 388 | Ga0436361_0588307 | 3300039447 | Bacteria | 1427 |
| 389 | Ga0436361_0964350 | 3300039447 | Bacteria | 3819 |
| 390 | Ga0436363_0001281 | 3300039450 | Bacteria | 582 |
| 391 | Ga0436363_1185918 | 3300039450 | Unclassified | 674 |
| 392 | Ga0436363_1197593 | 3300039450 | Bacteria | 11839 |
| 393 | Ga0436363_1289621 | 3300039450 | Bacteria | 646 |
| 394 | Ga0436363_1695442 | 3300039450 | Bacteria | 2056 |
| 395 | Ga0436362_0091420 | 3300039453 | Bacteria | 1862 |
| 396 | Ga0436362_1228228 | 3300039453 | Bacteria | 598 |
| 397 | Ga0439465_0264497 | 3300041413 | Bacteria | 638 |
| 398 | Ga0451787_178466 | 3300041441 | Bacteria | 701 |
| 399 | Ga0451789_0659761 | 3300041443 | Bacteria | 1070 |
| 400 | Ga0451793_0151842 | 3300041452 | Bacteria | 1156 |
| 401 | Ga0451797_0192916 | 3300041453 | Bacteria | 659 |
| 402 | Ga0451795_1541843 | 3300041456 | Bacteria | 894 |
| 403 | Ga0451798_1159997 | 3300041458 | Bacteria | 536 |
| 404 | Ga0451800_1491777 | 3300041459 | Bacteria | 911 |
| 405 | Ga0451807_0643386 | 3300041486 | Bacteria | 689 |
| 406 | Ga0451833_1389546 | 3300041491 | Bacteria | 1234 |
| 407 | Ga0451841_1189247 | 3300041498 | Bacteria | 1223 |
| 408 | Ga0451845_0793463 | 3300041501 | Bacteria | 736 |
| 409 | Ga0451849_0537052 | 3300041505 | Bacteria | 1098 |
| 410 | Ga0451849_0800258 | 3300041505 | Bacteria | 568 |
| 411 | Ga0451843_1451183 | 3300041509 | Bacteria | 1094 |
| 412 | Ga0451853_0006967 | 3300041512 | Bacteria | 581 |
| 413 | Ga0451853_1536047 | 3300041512 | Bacteria | 608 |
| 414 | Ga0439458_0055385 | 3300042157 | Bacteria | 984 |
| 415 | Ga0466969_0051428 | 3300044656 | Bacteria | 2028 |
| 416 | Ga0466969_0090071 | 3300044656 | Bacteria | 1455 |
| 417 | Ga0466969_0309918 | 3300044656 | Bacteria | 714 |
| 418 | Ga0466972_0324608 | 3300044658 | Bacteria | 719 |
| 419 | Ga0466965_0192725 | 3300044683 | Bacteria | 1079 |
| 420 | Ga0466966_0000148 | 3300044684 | Bacteria | 44828 |
| 421 | Ga0466966_0363017 | 3300044684 | Bacteria | 870 |
| 422 | Ga0466961_0000045 | 3300044693 | Bacteria | 75331 |
| 423 | Ga0466963_0508604 | 3300044694 | Bacteria | 850 |
| 424 | Ga0466964_0320659 | 3300044706 | Bacteria | 787 |
| 425 | Ga0466968_0144115 | 3300044735 | Bacteria | 1091 |
| 426 | Ga0466968_0270953 | 3300044735 | Bacteria | 810 |
| 427 | Ga0466968_0512168 | 3300044735 | Bacteria | 599 |
| 428 | Ga0466970_0041917 | 3300044765 | Bacteria | 2434 |
| 429 | Ga0466957_0046207 | 3300044842 | Bacteria | 2643 |
| 430 | Ga0466957_0171848 | 3300044842 | Bacteria | 1412 |
| 431 | Ga0466957_0806972 | 3300044842 | Bacteria | 667 |
| 432 | Ga0466960_0005902 | 3300044901 | Bacteria | 4881 |
| 433 | Ga0466959_0026243 | 3300045049 | Bacteria | 4318 |
| 434 | Ga0466959_0034824 | 3300045049 | Bacteria | 3725 |
| 435 | Ga0466959_0063524 | 3300045049 | Bacteria | 2681 |
| 436 | Ga0466959_0753137 | 3300045049 | Bacteria | 652 |
| 437 | Ga0466959_0978703 | 3300045049 | Bacteria | 564 |
| 438 | Ga0466958_0025670 | 3300045836 | Bacteria | 3476 |
| 439 | Ga0466958_0263577 | 3300045836 | Bacteria | 1103 |
| 440 | Ga0466967_0056127 | 3300045976 | Bacteria | 3472 |
| 441 | Ga0466967_0120706 | 3300045976 | Bacteria | 2421 |
| 442 | Ga0466967_0158785 | 3300045976 | Bacteria | 2121 |
| 443 | Ga0466967_0160607 | 3300045976 | Bacteria | 2109 |
| 444 | Ga0466967_1183710 | 3300045976 | Bacteria | 761 |
| 445 | Ga0466967_1346367 | 3300045976 | Bacteria | 711 |
| 446 | Ga0466967_2088119 | 3300045976 | Bacteria | 563 |
| 447 | Ga0495592_0027692 | 3300046454 | Bacteria | 4294 |
| 448 | Ga0495592_0047449 | 3300046454 | Bacteria | 3199 |
| 449 | Ga0495592_0211247 | 3300046454 | Bacteria | 1303 |
| 450 | Ga0495603_0042719 | 3300046455 | Bacteria | 2709 |
| 451 | Ga0495603_0218121 | 3300046455 | Bacteria | 1101 |
| 452 | Ga0495590_0103066 | 3300046457 | Bacteria | 1015 |
| 453 | Ga0495590_0219190 | 3300046457 | Bacteria | 702 |
| 454 | Ga0495629_0014231 | 3300046459 | Bacteria | 5729 |
| 455 | Ga0495629_0031428 | 3300046459 | Bacteria | 3760 |
| 456 | Ga0495638_0001332 | 3300046460 | Bacteria | 22704 |
| 457 | Ga0495651_0002756 | 3300046462 | Bacteria | 13630 |
| 458 | Ga0495651_0036781 | 3300046462 | Bacteria | 3812 |
| 459 | Ga0495651_0199678 | 3300046462 | Bacteria | 1400 |
| 460 | Ga0495650_0250062 | 3300046471 | Bacteria | 603 |
| 461 | Ga0495580_0007799 | 3300046472 | Bacteria | 8574 |
| 462 | Ga0495582_0059188 | 3300046473 | Bacteria | 2114 |
| 463 | Ga0495582_0272627 | 3300046473 | Bacteria | 971 |
| 464 | Ga0495605_0045599 | 3300046474 | Bacteria | 2160 |
| 465 | Ga0495605_0115806 | 3300046474 | Bacteria | 1219 |
| 466 | Ga0495605_0428220 | 3300046474 | Bacteria | 547 |
| 467 | Ga0495639_0012455 | 3300046475 | Bacteria | 3668 |
| 468 | Ga0495662_0098590 | 3300046476 | Bacteria | 1429 |
| 469 | Ga0495664_0012323 | 3300046477 | Bacteria | 4842 |
| 470 | Ga0495664_0021463 | 3300046477 | Bacteria | 3730 |
| 471 | Ga0495664_0304939 | 3300046477 | Bacteria | 961 |
| 472 | Ga0495584_0382422 | 3300046491 | Bacteria | 715 |
| 473 | Ga0495585_0078413 | 3300046492 | Bacteria | 1792 |
| 474 | Ga0495594_0088179 | 3300046499 | Bacteria | 1737 |
| 475 | Ga0495596_0136349 | 3300046500 | Bacteria | 953 |
| 476 | Ga0495583_0029576 | 3300046506 | Bacteria | 2679 |
| 477 | Ga0495606_0008196 | 3300046507 | Bacteria | 9142 |
| 478 | Ga0495606_0032829 | 3300046507 | Bacteria | 3590 |
| 479 | Ga0495606_0090975 | 3300046507 | Bacteria | 1877 |
| 480 | Ga0495606_0294454 | 3300046507 | Bacteria | 882 |
| 481 | Ga0495606_0364071 | 3300046507 | Bacteria | 763 |
| 482 | Ga0495606_0519846 | 3300046507 | Bacteria | 597 |
| 483 | Ga0495608_0136828 | 3300046511 | Bacteria | 1565 |
| 484 | Ga0495610_0257502 | 3300046512 | Bacteria | 688 |
| 485 | Ga0495618_0018494 | 3300046514 | Bacteria | 4278 |
| 486 | Ga0495618_0450357 | 3300046514 | Bacteria | 781 |
| 487 | Ga0495620_0182866 | 3300046515 | Bacteria | 810 |
| 488 | Ga0495628_0037662 | 3300046516 | Bacteria | 3877 |
| 489 | Ga0495630_0033529 | 3300046517 | Bacteria | 3830 |
| 490 | Ga0495631_0258479 | 3300046518 | Bacteria | 742 |
| 491 | Ga0495632_0033460 | 3300046519 | Bacteria | 2639 |
| 492 | Ga0495632_0435819 | 3300046519 | Bacteria | 570 |
| 493 | Ga0495643_0353690 | 3300046522 | Bacteria | 657 |
| 494 | Ga0495648_0245506 | 3300046524 | Bacteria | 867 |
| 495 | Ga0495666_0216549 | 3300046526 | Bacteria | 878 |
| 496 | Ga0495652_0141107 | 3300046529 | Bacteria | 1894 |
| 497 | Ga0495652_0187304 | 3300046529 | Bacteria | 1582 |
| 498 | Ga0495652_0374054 | 3300046529 | Bacteria | 1015 |
| 499 | Ga0495665_0055978 | 3300046531 | Bacteria | 2082 |
| 500 | Ga0495665_0400982 | 3300046531 | Bacteria | 696 |
| 501 | Ga0495640_0035956 | 3300046533 | Bacteria | 3503 |
| 502 | Ga0495640_0143754 | 3300046533 | Bacteria | 1536 |
| 503 | Ga0495587_0041125 | 3300046536 | Bacteria | 2759 |
| 504 | Ga0495587_0214770 | 3300046536 | Bacteria | 1086 |
| 505 | Ga0495587_0346918 | 3300046536 | Bacteria | 828 |
| 506 | Ga0495609_0114897 | 3300046538 | Bacteria | 1160 |
| 507 | Ga0495645_0012247 | 3300046543 | Bacteria | 6040 |
| 508 | Ga0495645_0048010 | 3300046543 | Bacteria | 3110 |
| 509 | Ga0495645_0097139 | 3300046543 | Bacteria | 2098 |
| 510 | Ga0495622_0014348 | 3300046557 | Bacteria | 3679 |
| 511 | Ga0495622_0049773 | 3300046557 | Bacteria | 1945 |
| 512 | Ga0495667_0011129 | 3300046559 | Bacteria | 6088 |
| 513 | Ga0495667_0170560 | 3300046559 | Bacteria | 1398 |
| 514 | Ga0495656_0617645 | 3300046615 | Bacteria | 581 |
| 515 | Ga0495668_0169718 | 3300046616 | Bacteria | 1195 |
| 516 | Ga0495668_0231377 | 3300046616 | Bacteria | 1012 |
| 517 | Ga0495668_0272419 | 3300046616 | Bacteria | 927 |
| 518 | Ga0495668_0444825 | 3300046616 | Bacteria | 713 |
| 519 | Ga0495668_0715531 | 3300046616 | Bacteria | 554 |
| 520 | Ga0495634_0018388 | 3300046642 | Bacteria | 4976 |
| 521 | Ga0495634_0110688 | 3300046642 | Bacteria | 1766 |
| 522 | Ga0495634_0207216 | 3300046642 | Bacteria | 1215 |
| 523 | Ga0495611_0343166 | 3300046648 | Bacteria | 686 |
| 524 | Ga0495611_0368552 | 3300046648 | Bacteria | 658 |
| 525 | Ga0495625_0216740 | 3300046660 | Bacteria | 1256 |
| 526 | Ga0495635_0002298 | 3300046663 | Bacteria | 12991 |
| 527 | Ga0495635_0013798 | 3300046663 | Bacteria | 5652 |
| 528 | Ga0495635_0029275 | 3300046663 | Bacteria | 3829 |
| 529 | Ga0495661_0145996 | 3300046665 | Bacteria | 1282 |
| 530 | Ga0495588_0060545 | 3300046674 | Bacteria | 1960 |
| 531 | Ga0495588_0268211 | 3300046674 | Bacteria | 899 |
| 532 | Ga0495588_0281054 | 3300046674 | Bacteria | 877 |
| 533 | Ga0495657_0022916 | 3300046675 | Bacteria | 4469 |
| 534 | Ga0495657_0167099 | 3300046675 | Bacteria | 1357 |
| 535 | Ga0495599_0032251 | 3300046678 | Bacteria | 3289 |
| 536 | Ga0495599_0108663 | 3300046678 | Bacteria | 1728 |
| 537 | Ga0495599_0129163 | 3300046678 | Bacteria | 1570 |
| 538 | Ga0495623_0023052 | 3300046679 | Bacteria | 4018 |
| 539 | Ga0495623_0279055 | 3300046679 | Bacteria | 930 |
| 540 | Ga0495623_0422635 | 3300046679 | Bacteria | 714 |
| 541 | Ga0495623_0458024 | 3300046679 | Bacteria | 678 |
| 542 | Ga0495646_0174087 | 3300046680 | Bacteria | 1184 |
| 543 | Ga0495646_0462732 | 3300046680 | Bacteria | 654 |
| 544 | Ga0495646_0573629 | 3300046680 | Bacteria | 575 |
| 545 | Ga0495647_0009374 | 3300046681 | Bacteria | 3315 |
| 546 | Ga0495613_0067020 | 3300046689 | Bacteria | 2620 |
| 547 | Ga0495613_0198088 | 3300046689 | Bacteria | 1417 |
| 548 | Ga0495624_0131750 | 3300046690 | Bacteria | 1533 |
| 549 | Ga0495624_0253329 | 3300046690 | Bacteria | 1064 |
| 550 | Ga0495624_0458513 | 3300046690 | Bacteria | 763 |
| 551 | Ga0495649_0293063 | 3300046694 | Bacteria | 830 |
| 552 | Ga0495649_0408977 | 3300046694 | Bacteria | 680 |
| 553 | Ga0495589_0577925 | 3300046794 | Bacteria | 512 |
| 554 | Ga0495600_0003039 | 3300046809 | Bacteria | 9798 |
| 555 | Ga0495600_0024800 | 3300046809 | Bacteria | 3861 |
| 556 | Ga0495581_0007776 | 3300047315 | Bacteria | 6205 |
| 557 | Ga0495581_0080484 | 3300047315 | Bacteria | 1886 |
| 558 | Ga0495581_0319226 | 3300047315 | Bacteria | 908 |
| 559 | Ga0495604_0014335 | 3300047317 | Bacteria | 6322 |
| 560 | Ga0495604_0019497 | 3300047317 | Bacteria | 5428 |
| 561 | Ga0495674_0052668 | 3300047319 | Bacteria | 3580 |
| 562 | Ga0495674_0073484 | 3300047319 | Bacteria | 2947 |
| 563 | Ga0495674_0929769 | 3300047319 | Bacteria | 670 |
| 564 | Ga0495672_0012285 | 3300047320 | Bacteria | 5988 |
| 565 | Ga0495676_0085046 | 3300047321 | Bacteria | 2384 |
| 566 | Ga0495676_0095867 | 3300047321 | Bacteria | 2207 |
| 567 | Ga0495676_0255984 | 3300047321 | Bacteria | 1192 |
| 568 | Ga0495680_0007085 | 3300047322 | Bacteria | 10329 |
| 569 | Ga0495683_0239028 | 3300047323 | Bacteria | 802 |
| 570 | Ga0495683_0457668 | 3300047323 | Bacteria | 523 |
| 571 | Ga0495675_0072238 | 3300047444 | Bacteria | 2177 |
| 572 | Ga0495675_0146152 | 3300047444 | Bacteria | 1463 |
| 573 | Ga0495681_0150735 | 3300047470 | Bacteria | 976 |
| 574 | Ga0495684_0036735 | 3300047471 | Bacteria | 3755 |
| 575 | Ga0495684_0071406 | 3300047471 | Bacteria | 2638 |
| 576 | Ga0495686_0231638 | 3300047472 | Bacteria | 1046 |
| 577 | Ga0495686_0420691 | 3300047472 | Bacteria | 714 |
| 578 | Ga0495686_0560167 | 3300047472 | Bacteria | 596 |
| 579 | Ga0495593_0013204 | 3300047673 | Bacteria | 4715 |
| 580 | Ga0495602_0015884 | 3300048088 | Bacteria | 7584 |
| 581 | Ga0495602_0034597 | 3300048088 | Bacteria | 4725 |
| 582 | Ga0495614_0039759 | 3300048089 | Bacteria | 2019 |
| 583 | Ga0495614_0244400 | 3300048089 | Bacteria | 820 |
| 584 | Ga0495614_0293709 | 3300048089 | Bacteria | 750 |
| 585 | Ga0495626_0140350 | 3300048091 | Bacteria | 1025 |
| 586 | Ga0496100_1161820 | 3300048903 | Bacteria | 609 |
| 587 | Ga0496101_0052301 | 3300048904 | Bacteria | 2945 |
| 588 | Ga0496101_0064292 | 3300048904 | Bacteria | 2672 |
| 589 | Ga0496101_0081153 | 3300048904 | Bacteria | 2398 |
| 590 | Ga0496102_0147670 | 3300048905 | Bacteria | 2207 |
| 591 | Ga0496102_0357400 | 3300048905 | Bacteria | 1375 |
| 592 | Ga0496102_0655760 | 3300048905 | Bacteria | 973 |
| 593 | Ga0496102_1264348 | 3300048905 | Bacteria | 657 |
| 594 | Ga0496103_0620992 | 3300048906 | Bacteria | 688 |
| 595 | Ga0496104_0049423 | 3300048907 | Bacteria | 3966 |
| 596 | Ga0496104_0141371 | 3300048907 | Bacteria | 2312 |
| 597 | Ga0496105_0139527 | 3300048908 | Bacteria | 1996 |
| 598 | Ga0496105_0222692 | 3300048908 | Bacteria | 1535 |
| 599 | Ga0496106_0171154 | 3300048909 | Bacteria | 1721 |
| 600 | Ga0496107_0095167 | 3300048910 | Bacteria | 2179 |
| 601 | Ga0496107_1161031 | 3300048910 | Bacteria | 556 |
| 602 | Ga0496108_0310517 | 3300048911 | Bacteria | 1374 |
| 603 | Ga0496109_0067095 | 3300048912 | Bacteria | 3286 |
| 604 | Ga0496109_0992796 | 3300048912 | Bacteria | 777 |
| 605 | Ga0496109_1278036 | 3300048912 | Bacteria | 670 |
| 606 | Ga0496110_0244427 | 3300048913 | Bacteria | 1633 |
| 607 | Ga0496112_0137081 | 3300048915 | Bacteria | 2417 |
| 608 | Ga0496112_0786888 | 3300048915 | Bacteria | 876 |
| 609 | Ga0496112_1395113 | 3300048915 | Bacteria | 615 |
| 610 | Ga0496113_0028986 | 3300048916 | Bacteria | 3990 |
| 611 | Ga0496113_1421190 | 3300048916 | Bacteria | 537 |
| 612 | Ga0496114_0193028 | 3300048917 | Bacteria | 1782 |
| 613 | Ga0496114_0216090 | 3300048917 | Bacteria | 1682 |
| 614 | Ga0496114_0348196 | 3300048917 | Bacteria | 1310 |
| 615 | Ga0496114_0527651 | 3300048917 | Bacteria | 1044 |
| 616 | Ga0496114_1326720 | 3300048917 | Bacteria | 606 |
| 617 | Ga0496115_0039815 | 3300048918 | Bacteria | 3734 |
| 618 | Ga0496115_0054012 | 3300048918 | Bacteria | 3225 |
| 619 | Ga0496115_0456518 | 3300048918 | Bacteria | 1031 |
| 620 | Ga0496115_0957754 | 3300048918 | Bacteria | 657 |
| 621 | Ga0496117_0527390 | 3300048920 | Bacteria | 567 |
| 622 | Ga0496118_0017685 | 3300048921 | Bacteria | 6473 |
| 623 | Ga0496118_0080594 | 3300048921 | Bacteria | 2290 |
| 624 | Ga0496118_0119897 | 3300048921 | Bacteria | 1718 |
| 625 | Ga0496118_0216743 | 3300048921 | Bacteria | 1118 |
| 626 | Ga0496118_0402353 | 3300048921 | Bacteria | 711 |
| 627 | Ga0496118_0417420 | 3300048921 | Bacteria | 691 |
| 628 | Ga0496118_0557337 | 3300048921 | Bacteria | 557 |
| 629 | Ga0496119_0056800 | 3300048922 | Bacteria | 2369 |
| 630 | Ga0496119_0078070 | 3300048922 | Bacteria | 1916 |
| 631 | Ga0496119_0096146 | 3300048922 | Bacteria | 1672 |
| 632 | Ga0496120_0012481 | 3300048923 | Bacteria | 5782 |
| 633 | Ga0496120_0071732 | 3300048923 | Bacteria | 1901 |
| 634 | Ga0496121_0011029 | 3300048924 | Bacteria | 10085 |
| 635 | Ga0496121_0027200 | 3300048924 | Bacteria | 5359 |
| 636 | Ga0496121_0041977 | 3300048924 | Bacteria | 3987 |
| 637 | Ga0496121_0070640 | 3300048924 | Bacteria | 2811 |
| 638 | Ga0496121_0088016 | 3300048924 | Bacteria | 2436 |
| 639 | Ga0496121_0106840 | 3300048924 | Bacteria | 2145 |
| 640 | Ga0496121_0125596 | 3300048924 | Bacteria | 1929 |
| 641 | Ga0496121_0162284 | 3300048924 | Bacteria | 1633 |
| 642 | Ga0496121_0257056 | 3300048924 | Unclassified | 1208 |
| 643 | Ga0496121_0270203 | 3300048924 | Bacteria | 1169 |
| 644 | Ga0496121_0369381 | 3300048924 | Bacteria | 949 |
| 645 | Ga0496121_0497139 | 3300048924 | Bacteria | 775 |
| 646 | Ga0496121_0889166 | 3300048924 | Bacteria | 514 |
| 647 | Ga0496124_0121600 | 3300048927 | Bacteria | 2085 |
| 648 | Ga0496125_0020779 | 3300048928 | Bacteria | 6152 |
| 649 | Ga0496125_0139007 | 3300048928 | Bacteria | 1692 |
| 650 | Ga0496125_0414100 | 3300048928 | Bacteria | 783 |
| 651 | Ga0496125_0511366 | 3300048928 | Bacteria | 673 |
| 652 | Ga0496126_0006044 | 3300048929 | Bacteria | 13590 |
| 653 | Ga0496126_0010346 | 3300048929 | Bacteria | 9790 |
| 654 | Ga0496126_0012447 | 3300048929 | Bacteria | 8712 |
| 655 | Ga0496126_0033259 | 3300048929 | Bacteria | 4851 |
| 656 | Ga0496126_0033486 | 3300048929 | Bacteria | 4833 |
| 657 | Ga0496126_0034403 | 3300048929 | Bacteria | 4759 |
| 658 | Ga0496126_0040294 | 3300048929 | Bacteria | 4330 |
| 659 | Ga0496126_0049559 | 3300048929 | Bacteria | 3833 |
| 660 | Ga0496126_0129637 | 3300048929 | Bacteria | 2180 |
| 661 | Ga0496126_0170867 | 3300048929 | Bacteria | 1852 |
| 662 | Ga0496126_0258403 | 3300048929 | Bacteria | 1449 |
| 663 | Ga0496126_0264308 | 3300048929 | Bacteria | 1430 |
| 664 | Ga0496126_0812435 | 3300048929 | Bacteria | 716 |
| 665 | Ga0495682_0061224 | 3300049460 | Bacteria | 1359 |
| 666 | Ga0495682_0172501 | 3300049460 | Bacteria | 769 |
| 667 | Ga0501038_1141649 | 3300049574 | Bacteria | 568 |
| 668 | Ga0501042_0194997 | 3300049578 | Bacteria | 1461 |
| 669 | Ga0501046_0021119 | 3300049580 | Bacteria | 5376 |
| 670 | Ga0501047_0031979 | 3300049581 | Bacteria | 5077 |
| 671 | Ga0501047_0116330 | 3300049581 | Bacteria | 2556 |
| 672 | Ga0501069_0685407 | 3300049585 | Bacteria | 618 |
| 673 | Ga0501070_0105780 | 3300049586 | Bacteria | 2326 |
| 674 | Ga0501072_0528042 | 3300049588 | Bacteria | 933 |
| 675 | Ga0501073_0015955 | 3300049589 | Bacteria | 5444 |
| 676 | Ga0501074_0203836 | 3300049590 | Bacteria | 1409 |
| 677 | Ga0501074_0280050 | 3300049590 | Bacteria | 1186 |
| 678 | Ga0501075_0632536 | 3300049591 | Bacteria | 816 |
| 679 | Ga0501079_0474412 | 3300049741 | Bacteria | 983 |
| 680 | Ga0501080_0041543 | 3300049742 | Bacteria | 4284 |
| 681 | Ga0501044_0087765 | 3300049823 | Bacteria | 3141 |
| 682 | nmdc:mga03n38_742784_c1 | 3300050490 | Bacteria | 568 |
| 683 | nmdc:mga0yw44_1155299_c1 | 3300050492 | Bacteria | 523 |
| 684 | nmdc:mga0yw44_744273_c1 | 3300050492 | Bacteria | 666 |
| 685 | nmdc:mga0yw44_92596_c1 | 3300050492 | Bacteria | 1913 |
| 686 | nmdc:mga0k408_852420_c1 | 3300050493 | Bacteria | 530 |
| 687 | nmdc:mga06z11_259770_c1 | 3300050494 | Bacteria | 1024 |
| 688 | nmdc:mga06z11_451687_c1 | 3300050494 | Bacteria | 776 |
| 689 | nmdc:mga06z11_507109_c1 | 3300050494 | Bacteria | 731 |
| 690 | nmdc:mga07m45_436820_c1 | 3300050496 | Bacteria | 759 |
| 691 | nmdc:mga05p37_868371_c1 | 3300050507 | Bacteria | 977 |
| 692 | nmdc:mga05p37_951465_c1 | 3300050507 | Bacteria | 919 |
| 693 | nmdc:mga09592_970432_c1 | 3300050508 | Bacteria | 712 |
| 694 | nmdc:mga0qj67_29991_c1 | 3300050509 | Bacteria | 4229 |
| 695 | nmdc:mga0qj67_682466_c1 | 3300050509 | Bacteria | 818 |
| 696 | nmdc:mga06r32_474004_c1 | 3300050510 | Bacteria | 1230 |
| 697 | nmdc:mga0n895_1429636_c1 | 3300050512 | Bacteria | 659 |
| 698 | nmdc:mga0n895_19638_c1 | 3300050512 | Bacteria | 6283 |
| 699 | nmdc:mga0n895_538749_c1 | 3300050512 | Bacteria | 1174 |
| 700 | nmdc:mga0rr50_192567_c1 | 3300050513 | Bacteria | 1672 |
| 701 | nmdc:mga08x19_361605_c1 | 3300050514 | Bacteria | 1014 |
| 702 | nmdc:mga08x19_863764_c1 | 3300050514 | Bacteria | 643 |
| 703 | nmdc:mga0sz30_66336_c1 | 3300050516 | Bacteria | 1548 |
| 704 | Ga0495601_0016093 | 3300053077 | Bacteria | 4527 |
| 705 | Ga0495601_0031359 | 3300053077 | Bacteria | 3303 |
| 706 | Ga0495612_0008064 | 3300053078 | Bacteria | 4286 |
| 707 | Ga0495612_0009799 | 3300053078 | Bacteria | 3881 |
| 708 | Ga0495619_0736266 | 3300053085 | Bacteria | 669 |
| 709 | Ga0500578_0090652 | 3300053086 | Bacteria | 1940 |
| 710 | Ga0500643_000107 | 3300053087 | Bacteria | 87031 |
| 711 | Ga0500644_0422921 | 3300053088 | Bacteria | 582 |
| 712 | Ga0500647_0062748 | 3300053091 | Bacteria | 1788 |
| 713 | Ga0500647_0212007 | 3300053091 | Bacteria | 872 |
| 714 | Ga0500583_0086346 | 3300053092 | Bacteria | 1522 |
| 715 | Ga0500651_0355034 | 3300053093 | Bacteria | 831 |
| 716 | Ga0500566_0000020 | 3300053094 | Bacteria | 83462 |
| 717 | Ga0500566_0000060 | 3300053094 | Bacteria | 52549 |
| 718 | Ga0500640_000957 | 3300053095 | Bacteria | 8166 |
| 719 | Ga0500641_0017005 | 3300053096 | Bacteria | 2713 |
| 720 | Ga0500650_0176256 | 3300053098 | Bacteria | 981 |
| 721 | Ga0500555_001044 | 3300053103 | Bacteria | 9342 |
| 722 | Ga0500557_000044 | 3300053105 | Bacteria | 62934 |
| 723 | Ga0500562_012892 | 3300053108 | Bacteria | 2128 |
| 724 | Ga0500569_050689 | 3300053109 | Bacteria | 1252 |
| 725 | Ga0500572_000882 | 3300053111 | Bacteria | 9311 |
| 726 | Ga0500591_032819 | 3300053115 | Bacteria | 2499 |
| 727 | Ga0500592_034349 | 3300053116 | Bacteria | 818 |
| 728 | Ga0500594_0283166 | 3300053118 | Bacteria | 554 |
| 729 | Ga0500597_423676 | 3300053120 | Bacteria | 501 |
| 730 | Ga0500608_013703 | 3300053122 | Bacteria | 3600 |
| 731 | Ga0500614_003566 | 3300053123 | Bacteria | 3343 |
| 732 | Ga0500621_009720 | 3300053126 | Bacteria | 3291 |
| 733 | Ga0500642_0000331 | 3300053130 | Bacteria | 16256 |
| 734 | Ga0500642_0081674 | 3300053130 | Bacteria | 1485 |
| 735 | Ga0500642_0107400 | 3300053130 | Bacteria | 1302 |
| 736 | Ga0500655_026577 | 3300053133 | Bacteria | 1102 |
| 737 | Ga0500658_0045241 | 3300053134 | Bacteria | 1779 |
| 738 | Ga0500559_0003043 | 3300053136 | Bacteria | 8381 |
| 739 | Ga0500568_0297792 | 3300053139 | Bacteria | 585 |
| 740 | Ga0500590_163355 | 3300053148 | Bacteria | 989 |
| 741 | Ga0500603_002834 | 3300053150 | Bacteria | 3759 |
| 742 | Ga0500604_0075476 | 3300053151 | Bacteria | 1082 |
| 743 | Ga0500622_0228238 | 3300053156 | Bacteria | 830 |
| 744 | Ga0500627_0044839 | 3300053158 | Bacteria | 1911 |
| 745 | Ga0500630_001295 | 3300053159 | Bacteria | 11762 |
| 746 | Ga0500634_0212888 | 3300053161 | Bacteria | 837 |
| 747 | Ga0500638_114977 | 3300053162 | Bacteria | 1238 |
| 748 | Ga0500639_000111 | 3300053163 | Bacteria | 38862 |
| 749 | Ga0500636_0423586 | 3300053177 | Bacteria | 610 |
| 750 | Ga0500637_0334705 | 3300053178 | Bacteria | 812 |
| 751 | Ga0500637_0487462 | 3300053178 | Bacteria | 615 |
| 752 | Ga0500611_018768 | 3300053727 | Bacteria | 1281 |
| 753 | Ga0500645_025821 | 3300053730 | Bacteria | 1790 |
| 754 | Ga0500609_005383 | 3300053731 | Bacteria | 1750 |
| 755 | Ga0500656_030098 | 3300053732 | Bacteria | 718 |
| 756 | Ga0500596_000483 | 3300053735 | Bacteria | 7448 |
| 757 | Ga0500599_001356 | 3300053736 | Bacteria | 2797 |
| 758 | Ga0500601_006752 | 3300053737 | Bacteria | 1267 |
| 759 | Ga0500601_012566 | 3300053737 | Bacteria | 956 |
| 760 | Ga0501084_0598187 | 3300054114 | Bacteria | 932 |
| 761 | Ga0500661_025822 | 3300055283 | Bacteria | 1039 |
| 762 | Ga0500661_035515 | 3300055283 | Bacteria | 881 |
| 763 | Ga0501082_0544926 | 3300060353 | Bacteria | 1015 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300050509 | nmdc:mga0qj67_29991_c1 | nmdc:mga0qj67_29991_c1_3288_3587 | 98 |
| 2 | 3300050510 | nmdc:mga06r32_474004_c1 | nmdc:mga06r32_474004_c1_326_625 | 98 |
| 3 | 3300050509 | nmdc:mga0qj67_682466_c1 | nmdc:mga0qj67_682466_c1_50_382 | 101 |
| 4 | 3300006844 | Ga0075428_100143208 | Ga0075428_1001432082 | 107 |
| 5 | 3300006880 | Ga0075429_100292881 | Ga0075429_1002928813 | 107 |
| 6 | 3300009147 | Ga0114129_10467601 | Ga0114129_104676012 | 107 |
| 7 | 3300037853 | Ga0436364_1328722 | Ga0436364_1328722_587_910 | 107 |
| 8 | 3300050507 | nmdc:mga05p37_868371_c1 | nmdc:mga05p37_868371_c1_35_361 | 107 |
| 9 | 3300050508 | nmdc:mga09592_970432_c1 | nmdc:mga09592_970432_c1_15_341 | 107 |
| 10 | 3300050512 | nmdc:mga0n895_1429636_c1 | nmdc:mga0n895_1429636_c1_183_509 | 107 |
| 11 | 3300022467 | Ga0224712_10240549 | Ga0224712_102405492 | 108 |
| 12 | 3300026035 | Ga0207703_10875174 | Ga0207703_108751742 | 108 |
| 13 | 3300037418 | Ga0395900_0541449 | Ga0395900_0541449_662_988 | 108 |
| 14 | 3300038443 | Ga0395901_1078275 | Ga0395901_1078275_109_435 | 108 |
| 15 | 3300045976 | Ga0466967_0160607 | Ga0466967_0160607_143_469 | 108 |
| 16 | 3300048929 | Ga0496126_0010346 | Ga0496126_0010346_9309_9635 | 108 |
| 17 | 3300049581 | Ga0501047_0116330 | Ga0501047_0116330_684_1010 | 108 |
| 18 | 3300003215 | JGI25153J46596_10011545 | JGI25153J46596_100115454 | 109 |
| 19 | 3300003659 | JGI25404J52841_10017661 | JGI25404J52841_100176612 | 109 |
| 20 | 3300003752 | Ga0055539_1006952 | Ga0055539_10069522 | 109 |
| 21 | 3300003752 | Ga0055539_1016086 | Ga0055539_10160862 | 109 |
| 22 | 3300003763 | Ga0055529_1007379 | Ga0055529_10073792 | 109 |
| 23 | 3300003763 | Ga0055529_1010709 | Ga0055529_10107092 | 109 |
| 24 | 3300004625 | Ga0055543_1002361 | Ga0055543_10023616 | 109 |
| 25 | 3300005262 | Ga0065165_1001366 | Ga0065165_100136613 | 109 |
| 26 | 3300005329 | Ga0070683_100001091 | Ga0070683_1000010917 | 109 |
| 27 | 3300005329 | Ga0070683_100078984 | Ga0070683_1000789845 | 109 |
| 28 | 3300005329 | Ga0070683_100684631 | Ga0070683_1006846312 | 109 |
| 29 | 3300005330 | Ga0070690_101116830 | Ga0070690_1011168301 | 109 |
| 30 | 3300005334 | Ga0068869_100880982 | Ga0068869_1008809821 | 109 |
| 31 | 3300005336 | Ga0070680_100023865 | Ga0070680_10002386510 | 109 |
| 32 | 3300005336 | Ga0070680_100085052 | Ga0070680_1000850522 | 109 |
| 33 | 3300005336 | Ga0070680_100215066 | Ga0070680_1002150662 | 109 |
| 34 | 3300005336 | Ga0070680_101016737 | Ga0070680_1010167371 | 109 |
| 35 | 3300005337 | Ga0070682_100083502 | Ga0070682_1000835022 | 109 |
| 36 | 3300005339 | Ga0070660_100212284 | Ga0070660_1002122844 | 109 |
| 37 | 3300005340 | Ga0070689_100854667 | Ga0070689_1008546672 | 109 |
| 38 | 3300005344 | Ga0070661_100144372 | Ga0070661_1001443721 | 109 |
| 39 | 3300005344 | Ga0070661_100930286 | Ga0070661_1009302861 | 109 |
| 40 | 3300005345 | Ga0070692_10261919 | Ga0070692_102619192 | 109 |
| 41 | 3300005356 | Ga0070674_100311255 | Ga0070674_1003112553 | 109 |
| 42 | 3300005366 | Ga0070659_100897916 | Ga0070659_1008979162 | 109 |
| 43 | 3300005366 | Ga0070659_101815773 | Ga0070659_1018157731 | 109 |
| 44 | 3300005367 | Ga0070667_101231163 | Ga0070667_1012311631 | 109 |
| 45 | 3300005434 | Ga0070709_10000506 | Ga0070709_1000050620 | 109 |
| 46 | 3300005434 | Ga0070709_10033960 | Ga0070709_100339604 | 109 |
| 47 | 3300005434 | Ga0070709_10035149 | Ga0070709_100351493 | 109 |
| 48 | 3300005434 | Ga0070709_10069538 | Ga0070709_100695381 | 109 |
| 49 | 3300005434 | Ga0070709_10702764 | Ga0070709_107027642 | 109 |
| 50 | 3300005435 | Ga0070714_100081400 | Ga0070714_1000814003 | 109 |
| 51 | 3300005435 | Ga0070714_100085927 | Ga0070714_1000859272 | 109 |
| 52 | 3300005435 | Ga0070714_100222922 | Ga0070714_1002229222 | 109 |
| 53 | 3300005435 | Ga0070714_100421337 | Ga0070714_1004213372 | 109 |
| 54 | 3300005435 | Ga0070714_100903387 | Ga0070714_1009033872 | 109 |
| 55 | 3300005435 | Ga0070714_101537560 | Ga0070714_1015375601 | 109 |
| 56 | 3300005436 | Ga0070713_100096627 | Ga0070713_1000966273 | 109 |
| 57 | 3300005436 | Ga0070713_101317952 | Ga0070713_1013179521 | 109 |
| 58 | 3300005436 | Ga0070713_101599403 | Ga0070713_1015994031 | 109 |
| 59 | 3300005437 | Ga0070710_10000386 | Ga0070710_100003867 | 109 |
| 60 | 3300005437 | Ga0070710_10012971 | Ga0070710_100129716 | 109 |
| 61 | 3300005437 | Ga0070710_10092974 | Ga0070710_100929742 | 109 |
| 62 | 3300005437 | Ga0070710_10236766 | Ga0070710_102367662 | 109 |
| 63 | 3300005437 | Ga0070710_10809886 | Ga0070710_108098861 | 109 |
| 64 | 3300005439 | Ga0070711_100001793 | Ga0070711_1000017939 | 109 |
| 65 | 3300005439 | Ga0070711_100003655 | Ga0070711_10000365511 | 109 |
| 66 | 3300005439 | Ga0070711_100042708 | Ga0070711_1000427084 | 109 |
| 67 | 3300005439 | Ga0070711_100056795 | Ga0070711_1000567953 | 109 |
| 68 | 3300005455 | Ga0070663_100012418 | Ga0070663_1000124188 | 109 |
| 69 | 3300005455 | Ga0070663_100098505 | Ga0070663_1000985053 | 109 |
| 70 | 3300005456 | Ga0070678_100527122 | Ga0070678_1005271222 | 109 |
| 71 | 3300005458 | Ga0070681_10061117 | Ga0070681_100611174 | 109 |
| 72 | 3300005458 | Ga0070681_10313939 | Ga0070681_103139392 | 109 |
| 73 | 3300005459 | Ga0068867_100822610 | Ga0068867_1008226102 | 109 |
| 74 | 3300005467 | Ga0070706_100180140 | Ga0070706_1001801401 | 109 |
| 75 | 3300005468 | Ga0070707_100156508 | Ga0070707_1001565082 | 109 |
| 76 | 3300005471 | Ga0070698_100051487 | Ga0070698_1000514874 | 109 |
| 77 | 3300005530 | Ga0070679_100063720 | Ga0070679_1000637202 | 109 |
| 78 | 3300005530 | Ga0070679_100717197 | Ga0070679_1007171972 | 109 |
| 79 | 3300005535 | Ga0070684_100003496 | Ga0070684_1000034968 | 109 |
| 80 | 3300005539 | Ga0068853_100183234 | Ga0068853_1001832342 | 109 |
| 81 | 3300005539 | Ga0068853_100677614 | Ga0068853_1006776142 | 109 |
| 82 | 3300005546 | Ga0070696_100619003 | Ga0070696_1006190032 | 109 |
| 83 | 3300005546 | Ga0070696_100880073 | Ga0070696_1008800731 | 109 |
| 84 | 3300005547 | Ga0070693_100227443 | Ga0070693_1002274431 | 109 |
| 85 | 3300005547 | Ga0070693_100353269 | Ga0070693_1003532692 | 109 |
| 86 | 3300005548 | Ga0070665_100006302 | Ga0070665_10000630210 | 109 |
| 87 | 3300005548 | Ga0070665_101205470 | Ga0070665_1012054701 | 109 |
| 88 | 3300005563 | Ga0068855_100441185 | Ga0068855_1004411852 | 109 |
| 89 | 3300005563 | Ga0068855_100638667 | Ga0068855_1006386672 | 109 |
| 90 | 3300005563 | Ga0068855_102388722 | Ga0068855_1023887221 | 109 |
| 91 | 3300005564 | Ga0070664_100279403 | Ga0070664_1002794032 | 109 |
| 92 | 3300005564 | Ga0070664_100619026 | Ga0070664_1006190262 | 109 |
| 93 | 3300005564 | Ga0070664_101137325 | Ga0070664_1011373251 | 109 |
| 94 | 3300005577 | Ga0068857_100264617 | Ga0068857_1002646172 | 109 |
| 95 | 3300005578 | Ga0068854_101007940 | Ga0068854_1010079401 | 109 |
| 96 | 3300005578 | Ga0068854_101679508 | Ga0068854_1016795082 | 109 |
| 97 | 3300005578 | Ga0068854_101696403 | Ga0068854_1016964032 | 109 |
| 98 | 3300005614 | Ga0068856_100263678 | Ga0068856_1002636782 | 109 |
| 99 | 3300005614 | Ga0068856_101728778 | Ga0068856_1017287782 | 109 |
| 100 | 3300005615 | Ga0070702_101422355 | Ga0070702_1014223551 | 109 |
| 101 | 3300005616 | Ga0068852_100005466 | Ga0068852_1000054669 | 109 |
| 102 | 3300005616 | Ga0068852_100751317 | Ga0068852_1007513171 | 109 |
| 103 | 3300005834 | Ga0068851_10227274 | Ga0068851_102272742 | 109 |
| 104 | 3300005842 | Ga0068858_100596856 | Ga0068858_1005968562 | 109 |
| 105 | 3300005843 | Ga0068860_100005261 | Ga0068860_10000526118 | 109 |
| 106 | 3300005844 | Ga0068862_100240875 | Ga0068862_1002408753 | 109 |
| 107 | 3300005937 | Ga0081455_10084249 | Ga0081455_100842495 | 109 |
| 108 | 3300005937 | Ga0081455_10163243 | Ga0081455_101632432 | 109 |
| 109 | 3300005937 | Ga0081455_10604115 | Ga0081455_106041151 | 109 |
| 110 | 3300005981 | Ga0081538_10106975 | Ga0081538_101069752 | 109 |
| 111 | 3300005983 | Ga0081540_1006012 | Ga0081540_10060128 | 109 |
| 112 | 3300005983 | Ga0081540_1035235 | Ga0081540_10352356 | 109 |
| 113 | 3300005983 | Ga0081540_1123080 | Ga0081540_11230801 | 109 |
| 114 | 3300005983 | Ga0081540_1193445 | Ga0081540_11934452 | 109 |
| 115 | 3300005985 | Ga0081539_10159673 | Ga0081539_101596732 | 109 |
| 116 | 3300006028 | Ga0070717_10505300 | Ga0070717_105053002 | 109 |
| 117 | 3300006028 | Ga0070717_10536428 | Ga0070717_105364281 | 109 |
| 118 | 3300006028 | Ga0070717_10936873 | Ga0070717_109368732 | 109 |
| 119 | 3300006028 | Ga0070717_11117202 | Ga0070717_111172021 | 109 |
| 120 | 3300006038 | Ga0075365_10341276 | Ga0075365_103412762 | 109 |
| 121 | 3300006038 | Ga0075365_10614342 | Ga0075365_106143422 | 109 |
| 122 | 3300006163 | Ga0070715_10033216 | Ga0070715_100332161 | 109 |
| 123 | 3300006163 | Ga0070715_10156144 | Ga0070715_101561441 | 109 |
| 124 | 3300006163 | Ga0070715_10320039 | Ga0070715_103200392 | 109 |
| 125 | 3300006173 | Ga0070716_100043612 | Ga0070716_1000436122 | 109 |
| 126 | 3300006173 | Ga0070716_100121674 | Ga0070716_1001216742 | 109 |
| 127 | 3300006173 | Ga0070716_100533944 | Ga0070716_1005339442 | 109 |
| 128 | 3300006173 | Ga0070716_100854919 | Ga0070716_1008549191 | 109 |
| 129 | 3300006173 | Ga0070716_100988140 | Ga0070716_1009881401 | 109 |
| 130 | 3300006175 | Ga0070712_100022303 | Ga0070712_1000223035 | 109 |
| 131 | 3300006175 | Ga0070712_100107729 | Ga0070712_1001077293 | 109 |
| 132 | 3300006175 | Ga0070712_100132676 | Ga0070712_1001326763 | 109 |
| 133 | 3300006175 | Ga0070712_100264784 | Ga0070712_1002647842 | 109 |
| 134 | 3300006175 | Ga0070712_100929321 | Ga0070712_1009293212 | 109 |
| 135 | 3300006177 | Ga0075362_10698864 | Ga0075362_106988641 | 109 |
| 136 | 3300006178 | Ga0075367_10383702 | Ga0075367_103837022 | 109 |
| 137 | 3300006178 | Ga0075367_10399631 | Ga0075367_103996312 | 109 |
| 138 | 3300006178 | Ga0075367_10662857 | Ga0075367_106628572 | 109 |
| 139 | 3300006186 | Ga0075369_10102379 | Ga0075369_101023792 | 109 |
| 140 | 3300006237 | Ga0097621_100108355 | Ga0097621_1001083553 | 109 |
| 141 | 3300006237 | Ga0097621_100118406 | Ga0097621_1001184064 | 109 |
| 142 | 3300006358 | Ga0068871_100603932 | Ga0068871_1006039322 | 109 |
| 143 | 3300006846 | Ga0075430_100248516 | Ga0075430_1002485162 | 109 |
| 144 | 3300006871 | Ga0075434_100132227 | Ga0075434_1001322274 | 109 |
| 145 | 3300006871 | Ga0075434_100321514 | Ga0075434_1003215142 | 109 |
| 146 | 3300006881 | Ga0068865_100490091 | Ga0068865_1004900912 | 109 |
| 147 | 3300006881 | Ga0068865_101062033 | Ga0068865_1010620332 | 109 |
| 148 | 3300006914 | Ga0075436_100754517 | Ga0075436_1007545172 | 109 |
| 149 | 3300006914 | Ga0075436_100953109 | Ga0075436_1009531092 | 109 |
| 150 | 3300006931 | Ga0097620_100054666 | Ga0097620_1000546668 | 109 |
| 151 | 3300006942 | Ga0099824_1019902 | Ga0099824_10199023 | 109 |
| 152 | 3300006943 | Ga0099822_1002329 | Ga0099822_100232917 | 109 |
| 153 | 3300007076 | Ga0075435_100143718 | Ga0075435_1001437183 | 109 |
| 154 | 3300007076 | Ga0075435_100166504 | Ga0075435_1001665043 | 109 |
| 155 | 3300009093 | Ga0105240_10006604 | Ga0105240_1000660410 | 109 |
| 156 | 3300009093 | Ga0105240_10217193 | Ga0105240_102171933 | 109 |
| 157 | 3300009093 | Ga0105240_10307893 | Ga0105240_103078932 | 109 |
| 158 | 3300009098 | Ga0105245_12944567 | Ga0105245_129445671 | 109 |
| 159 | 3300009101 | Ga0105247_10456416 | Ga0105247_104564162 | 109 |
| 160 | 3300009147 | Ga0114129_10881302 | Ga0114129_108813022 | 109 |
| 161 | 3300009174 | Ga0105241_10031780 | Ga0105241_100317805 | 109 |
| 162 | 3300009545 | Ga0105237_10003458 | Ga0105237_1000345813 | 109 |
| 163 | 3300009545 | Ga0105237_10041450 | Ga0105237_100414502 | 109 |
| 164 | 3300009545 | Ga0105237_10338295 | Ga0105237_103382952 | 109 |
| 165 | 3300009545 | Ga0105237_10610375 | Ga0105237_106103752 | 109 |
| 166 | 3300009545 | Ga0105237_11261460 | Ga0105237_112614601 | 109 |
| 167 | 3300009545 | Ga0105237_12232160 | Ga0105237_122321602 | 109 |
| 168 | 3300009545 | Ga0105237_12455687 | Ga0105237_124556871 | 109 |
| 169 | 3300009551 | Ga0105238_10049933 | Ga0105238_100499333 | 109 |
| 170 | 3300009551 | Ga0105238_10166723 | Ga0105238_101667233 | 109 |
| 171 | 3300009551 | Ga0105238_10264870 | Ga0105238_102648701 | 109 |
| 172 | 3300009551 | Ga0105238_11785998 | Ga0105238_117859981 | 109 |
| 173 | 3300009551 | Ga0105238_12051923 | Ga0105238_120519232 | 109 |
| 174 | 3300009553 | Ga0105249_10115777 | Ga0105249_101157773 | 109 |
| 175 | 3300010159 | Ga0099796_10158076 | Ga0099796_101580762 | 109 |
| 176 | 3300010375 | Ga0105239_10120827 | Ga0105239_101208273 | 109 |
| 177 | 3300010375 | Ga0105239_10377852 | Ga0105239_103778522 | 109 |
| 178 | 3300010375 | Ga0105239_11194644 | Ga0105239_111946442 | 109 |
| 179 | 3300012488 | Ga0157343_1013597 | Ga0157343_10135972 | 109 |
| 180 | 3300012512 | Ga0157327_1048120 | Ga0157327_10481201 | 109 |
| 181 | 3300013104 | Ga0157370_10768758 | Ga0157370_107687581 | 109 |
| 182 | 3300013105 | Ga0157369_10004472 | Ga0157369_1000447212 | 109 |
| 183 | 3300013105 | Ga0157369_10549868 | Ga0157369_105498682 | 109 |
| 184 | 3300013105 | Ga0157369_10729172 | Ga0157369_107291722 | 109 |
| 185 | 3300013105 | Ga0157369_11123904 | Ga0157369_111239042 | 109 |
| 186 | 3300013105 | Ga0157369_11508075 | Ga0157369_115080751 | 109 |
| 187 | 3300013297 | Ga0157378_11242148 | Ga0157378_112421482 | 109 |
| 188 | 3300013307 | Ga0157372_10614691 | Ga0157372_106146912 | 109 |
| 189 | 3300013307 | Ga0157372_10889415 | Ga0157372_108894152 | 109 |
| 190 | 3300013308 | Ga0157375_10185912 | Ga0157375_101859124 | 109 |
| 191 | 3300013308 | Ga0157375_11127150 | Ga0157375_111271501 | 109 |
| 192 | 3300014325 | Ga0163163_10787807 | Ga0163163_107878072 | 109 |
| 193 | 3300014497 | Ga0182008_10826181 | Ga0182008_108261811 | 109 |
| 194 | 3300014968 | Ga0157379_10339863 | Ga0157379_103398632 | 109 |
| 195 | 3300014968 | Ga0157379_11408138 | Ga0157379_114081382 | 109 |
| 196 | 3300015265 | Ga0182005_1051209 | Ga0182005_10512092 | 109 |
| 197 | 3300017792 | Ga0163161_10364831 | Ga0163161_103648311 | 109 |
| 198 | 3300021361 | Ga0213872_10080135 | Ga0213872_100801352 | 109 |
| 199 | 3300021361 | Ga0213872_10224289 | Ga0213872_102242892 | 109 |
| 200 | 3300021377 | Ga0213874_10172863 | Ga0213874_101728631 | 109 |
| 201 | 3300021441 | Ga0213871_10025432 | Ga0213871_100254321 | 109 |
| 202 | 3300025230 | Ga0209563_104549 | Ga0209563_1045493 | 109 |
| 203 | 3300025250 | Ga0209026_1059060 | Ga0209026_10590601 | 109 |
| 204 | 3300025253 | Ga0209677_102314 | Ga0209677_1023147 | 109 |
| 205 | 3300025253 | Ga0209677_110139 | Ga0209677_1101392 | 109 |
| 206 | 3300025254 | Ga0209148_1002066 | Ga0209148_10020665 | 109 |
| 207 | 3300025254 | Ga0209148_1009174 | Ga0209148_10091744 | 109 |
| 208 | 3300025254 | Ga0209148_1013448 | Ga0209148_10134482 | 109 |
| 209 | 3300025261 | Ga0209233_1001936 | Ga0209233_10019366 | 109 |
| 210 | 3300025261 | Ga0209233_1013958 | Ga0209233_10139583 | 109 |
| 211 | 3300025261 | Ga0209233_1015125 | Ga0209233_10151254 | 109 |
| 212 | 3300025261 | Ga0209233_1062092 | Ga0209233_10620921 | 109 |
| 213 | 3300025272 | Ga0209455_1003189 | Ga0209455_10031895 | 109 |
| 214 | 3300025272 | Ga0209455_1006825 | Ga0209455_10068252 | 109 |
| 215 | 3300025272 | Ga0209455_1008760 | Ga0209455_10087603 | 109 |
| 216 | 3300025272 | Ga0209455_1031244 | Ga0209455_10312442 | 109 |
| 217 | 3300025273 | Ga0209673_1023353 | Ga0209673_10233535 | 109 |
| 218 | 3300025297 | Ga0209758_1002828 | Ga0209758_10028286 | 109 |
| 219 | 3300025297 | Ga0209758_1020210 | Ga0209758_10202103 | 109 |
| 220 | 3300025297 | Ga0209758_1061540 | Ga0209758_10615401 | 109 |
| 221 | 3300025297 | Ga0209758_1099613 | Ga0209758_10996132 | 109 |
| 222 | 3300025302 | Ga0207426_1000554 | Ga0207426_100055453 | 109 |
| 223 | 3300025302 | Ga0207426_1033367 | Ga0207426_10333673 | 109 |
| 224 | 3300025898 | Ga0207692_10002116 | Ga0207692_100021166 | 109 |
| 225 | 3300025898 | Ga0207692_10013635 | Ga0207692_100136351 | 109 |
| 226 | 3300025898 | Ga0207692_10574845 | Ga0207692_105748451 | 109 |
| 227 | 3300025899 | Ga0207642_10528144 | Ga0207642_105281442 | 109 |
| 228 | 3300025900 | Ga0207710_10013025 | Ga0207710_100130251 | 109 |
| 229 | 3300025900 | Ga0207710_10726406 | Ga0207710_107264061 | 109 |
| 230 | 3300025904 | Ga0207647_10391597 | Ga0207647_103915971 | 109 |
| 231 | 3300025905 | Ga0207685_10835628 | Ga0207685_108356281 | 109 |
| 232 | 3300025906 | Ga0207699_10000315 | Ga0207699_1000031521 | 109 |
| 233 | 3300025906 | Ga0207699_10047534 | Ga0207699_100475341 | 109 |
| 234 | 3300025906 | Ga0207699_10050684 | Ga0207699_100506842 | 109 |
| 235 | 3300025906 | Ga0207699_10754081 | Ga0207699_107540812 | 109 |
| 236 | 3300025906 | Ga0207699_10939505 | Ga0207699_109395052 | 109 |
| 237 | 3300025909 | Ga0207705_10020589 | Ga0207705_100205892 | 109 |
| 238 | 3300025910 | Ga0207684_10220516 | Ga0207684_102205162 | 109 |
| 239 | 3300025910 | Ga0207684_10666229 | Ga0207684_106662291 | 109 |
| 240 | 3300025911 | Ga0207654_10054065 | Ga0207654_100540652 | 109 |
| 241 | 3300025911 | Ga0207654_10143564 | Ga0207654_101435642 | 109 |
| 242 | 3300025912 | Ga0207707_10003003 | Ga0207707_100030034 | 109 |
| 243 | 3300025912 | Ga0207707_10020269 | Ga0207707_100202692 | 109 |
| 244 | 3300025912 | Ga0207707_10074848 | Ga0207707_100748484 | 109 |
| 245 | 3300025912 | Ga0207707_10199116 | Ga0207707_101991161 | 109 |
| 246 | 3300025913 | Ga0207695_10000159 | Ga0207695_100001591 | 109 |
| 247 | 3300025913 | Ga0207695_10040323 | Ga0207695_100403234 | 109 |
| 248 | 3300025913 | Ga0207695_10223000 | Ga0207695_102230001 | 109 |
| 249 | 3300025913 | Ga0207695_10381071 | Ga0207695_103810712 | 109 |
| 250 | 3300025913 | Ga0207695_10997380 | Ga0207695_109973801 | 109 |
| 251 | 3300025914 | Ga0207671_10009635 | Ga0207671_100096359 | 109 |
| 252 | 3300025914 | Ga0207671_10208772 | Ga0207671_102087723 | 109 |
| 253 | 3300025914 | Ga0207671_10291144 | Ga0207671_102911442 | 109 |
| 254 | 3300025914 | Ga0207671_10987300 | Ga0207671_109873001 | 109 |
| 255 | 3300025915 | Ga0207693_10067578 | Ga0207693_100675782 | 109 |
| 256 | 3300025915 | Ga0207693_10072343 | Ga0207693_100723434 | 109 |
| 257 | 3300025915 | Ga0207693_10084853 | Ga0207693_100848534 | 109 |
| 258 | 3300025915 | Ga0207693_10099613 | Ga0207693_100996132 | 109 |
| 259 | 3300025915 | Ga0207693_10126813 | Ga0207693_101268132 | 109 |
| 260 | 3300025915 | Ga0207693_10224084 | Ga0207693_102240843 | 109 |
| 261 | 3300025915 | Ga0207693_11265116 | Ga0207693_112651162 | 109 |
| 262 | 3300025916 | Ga0207663_10007711 | Ga0207663_100077114 | 109 |
| 263 | 3300025916 | Ga0207663_10015284 | Ga0207663_100152843 | 109 |
| 264 | 3300025916 | Ga0207663_10089834 | Ga0207663_100898344 | 109 |
| 265 | 3300025917 | Ga0207660_10014029 | Ga0207660_100140293 | 109 |
| 266 | 3300025917 | Ga0207660_10059946 | Ga0207660_100599464 | 109 |
| 267 | 3300025917 | Ga0207660_10074564 | Ga0207660_100745643 | 109 |
| 268 | 3300025919 | Ga0207657_11506585 | Ga0207657_115065851 | 109 |
| 269 | 3300025920 | Ga0207649_10151666 | Ga0207649_101516662 | 109 |
| 270 | 3300025920 | Ga0207649_10297216 | Ga0207649_102972161 | 109 |
| 271 | 3300025921 | Ga0207652_10024806 | Ga0207652_100248063 | 109 |
| 272 | 3300025921 | Ga0207652_10063173 | Ga0207652_100631733 | 109 |
| 273 | 3300025921 | Ga0207652_10116314 | Ga0207652_101163145 | 109 |
| 274 | 3300025921 | Ga0207652_10393946 | Ga0207652_103939462 | 109 |
| 275 | 3300025922 | Ga0207646_10353045 | Ga0207646_103530453 | 109 |
| 276 | 3300025924 | Ga0207694_10155708 | Ga0207694_101557082 | 109 |
| 277 | 3300025924 | Ga0207694_10275885 | Ga0207694_102758851 | 109 |
| 278 | 3300025925 | Ga0207650_10864416 | Ga0207650_108644162 | 109 |
| 279 | 3300025927 | Ga0207687_10607471 | Ga0207687_106074711 | 109 |
| 280 | 3300025928 | Ga0207700_10164850 | Ga0207700_101648502 | 109 |
| 281 | 3300025928 | Ga0207700_10231114 | Ga0207700_102311141 | 109 |
| 282 | 3300025928 | Ga0207700_10878256 | Ga0207700_108782562 | 109 |
| 283 | 3300025929 | Ga0207664_10147379 | Ga0207664_101473794 | 109 |
| 284 | 3300025929 | Ga0207664_10238564 | Ga0207664_102385642 | 109 |
| 285 | 3300025929 | Ga0207664_10635689 | Ga0207664_106356891 | 109 |
| 286 | 3300025929 | Ga0207664_10826379 | Ga0207664_108263792 | 109 |
| 287 | 3300025929 | Ga0207664_10975661 | Ga0207664_109756611 | 109 |
| 288 | 3300025929 | Ga0207664_11455069 | Ga0207664_114550691 | 109 |
| 289 | 3300025932 | Ga0207690_11349026 | Ga0207690_113490261 | 109 |
| 290 | 3300025932 | Ga0207690_11735886 | Ga0207690_117358861 | 109 |
| 291 | 3300025936 | Ga0207670_10105640 | Ga0207670_101056401 | 109 |
| 292 | 3300025937 | Ga0207669_10167327 | Ga0207669_101673272 | 109 |
| 293 | 3300025937 | Ga0207669_11589605 | Ga0207669_115896051 | 109 |
| 294 | 3300025939 | Ga0207665_10002700 | Ga0207665_100027009 | 109 |
| 295 | 3300025939 | Ga0207665_10142314 | Ga0207665_101423143 | 109 |
| 296 | 3300025939 | Ga0207665_10191929 | Ga0207665_101919292 | 109 |
| 297 | 3300025939 | Ga0207665_10218457 | Ga0207665_102184572 | 109 |
| 298 | 3300025939 | Ga0207665_10237345 | Ga0207665_102373452 | 109 |
| 299 | 3300025939 | Ga0207665_11696075 | Ga0207665_116960751 | 109 |
| 300 | 3300025940 | Ga0207691_10298091 | Ga0207691_102980912 | 109 |
| 301 | 3300025942 | Ga0207689_11337832 | Ga0207689_113378321 | 109 |
| 302 | 3300025944 | Ga0207661_10001748 | Ga0207661_1000174813 | 109 |
| 303 | 3300025944 | Ga0207661_10021847 | Ga0207661_100218475 | 109 |
| 304 | 3300025944 | Ga0207661_10274622 | Ga0207661_102746224 | 109 |
| 305 | 3300025945 | Ga0207679_11721239 | Ga0207679_117212392 | 109 |
| 306 | 3300025949 | Ga0207667_10193301 | Ga0207667_101933012 | 109 |
| 307 | 3300025949 | Ga0207667_10750511 | Ga0207667_107505111 | 109 |
| 308 | 3300025949 | Ga0207667_10760537 | Ga0207667_107605372 | 109 |
| 309 | 3300025961 | Ga0207712_10650275 | Ga0207712_106502752 | 109 |
| 310 | 3300025972 | Ga0207668_11021776 | Ga0207668_110217762 | 109 |
| 311 | 3300026023 | Ga0207677_10145640 | Ga0207677_101456402 | 109 |
| 312 | 3300026023 | Ga0207677_11995219 | Ga0207677_119952191 | 109 |
| 313 | 3300026035 | Ga0207703_10708173 | Ga0207703_107081731 | 109 |
| 314 | 3300026041 | Ga0207639_10326674 | Ga0207639_103266743 | 109 |
| 315 | 3300026041 | Ga0207639_10869378 | Ga0207639_108693782 | 109 |
| 316 | 3300026067 | Ga0207678_10014792 | Ga0207678_100147928 | 109 |
| 317 | 3300026067 | Ga0207678_10126136 | Ga0207678_101261361 | 109 |
| 318 | 3300026067 | Ga0207678_10418597 | Ga0207678_104185972 | 109 |
| 319 | 3300026078 | Ga0207702_10050876 | Ga0207702_100508764 | 109 |
| 320 | 3300026078 | Ga0207702_11290538 | Ga0207702_112905381 | 109 |
| 321 | 3300026116 | Ga0207674_10398814 | Ga0207674_103988142 | 109 |
| 322 | 3300026142 | Ga0207698_10150554 | Ga0207698_101505543 | 109 |
| 323 | 3300026142 | Ga0207698_10724329 | Ga0207698_107243292 | 109 |
| 324 | 3300027357 | Ga0209589_1000009 | Ga0209589_1000009226 | 109 |
| 325 | 3300027361 | Ga0209489_100010 | Ga0209489_10001044 | 109 |
| 326 | 3300027363 | Ga0209700_100017 | Ga0209700_10001744 | 109 |
| 327 | 3300028379 | Ga0268266_10006118 | Ga0268266_100061186 | 109 |
| 328 | 3300028379 | Ga0268266_11043437 | Ga0268266_110434372 | 109 |
| 329 | 3300028381 | Ga0268264_10000035 | Ga0268264_10000035238 | 109 |
| 330 | 3300028381 | Ga0268264_10801658 | Ga0268264_108016582 | 109 |
| 331 | 3300028556 | Ga0265337_1032248 | Ga0265337_10322484 | 109 |
| 332 | 3300028558 | Ga0265326_10007542 | Ga0265326_100075422 | 109 |
| 333 | 3300028563 | Ga0265319_1115109 | Ga0265319_11151091 | 109 |
| 334 | 3300028573 | Ga0265334_10018041 | Ga0265334_100180414 | 109 |
| 335 | 3300028653 | Ga0265323_10004134 | Ga0265323_100041347 | 109 |
| 336 | 3300028666 | Ga0265336_10003438 | Ga0265336_100034386 | 109 |
| 337 | 3300028786 | Ga0307517_10225678 | Ga0307517_102256781 | 109 |
| 338 | 3300028800 | Ga0265338_10000090 | Ga0265338_1000009058 | 109 |
| 339 | 3300029957 | Ga0265324_10005221 | Ga0265324_100052216 | 109 |
| 340 | 3300031247 | Ga0265340_10087780 | Ga0265340_100877802 | 109 |
| 341 | 3300031249 | Ga0265339_10001632 | Ga0265339_1000163214 | 109 |
| 342 | 3300031507 | Ga0307509_10605296 | Ga0307509_106052962 | 109 |
| 343 | 3300031616 | Ga0307508_10329636 | Ga0307508_103296362 | 109 |
| 344 | 3300031711 | Ga0265314_10036825 | Ga0265314_100368254 | 109 |
| 345 | 3300031712 | Ga0265342_10061309 | Ga0265342_100613092 | 109 |
| 346 | 3300033179 | Ga0307507_10285270 | Ga0307507_102852702 | 109 |
| 347 | 3300033180 | Ga0307510_10070936 | Ga0307510_100709364 | 109 |
| 348 | 3300033180 | Ga0307510_10202152 | Ga0307510_102021522 | 109 |
| 349 | 3300033442 | Ga0315911_1000009 | Ga0315911_1000009348 | 109 |
| 350 | 3300033544 | Ga0316215_1007334 | Ga0316215_10073341 | 109 |
| 351 | 3300035083 | Ga0373926_0038808 | Ga0373926_0038808_223_552 | 109 |
| 352 | 3300035111 | Ga0373923_0090288 | Ga0373923_0090288_175_504 | 109 |
| 353 | 3300035112 | Ga0373932_0209457 | Ga0373932_0209457_30_359 | 109 |
| 354 | 3300035113 | Ga0373936_0007135 | Ga0373936_0007135_1153_1482 | 109 |
| 355 | 3300035116 | Ga0373945_0007221 | Ga0373945_0007221_1969_2298 | 109 |
| 356 | 3300035116 | Ga0373945_0118007 | Ga0373945_0118007_561_890 | 109 |
| 357 | 3300035117 | Ga0373953_0013490 | Ga0373953_0013490_1448_1777 | 109 |
| 358 | 3300035119 | Ga0373956_0039292 | Ga0373956_0039292_1701_2030 | 109 |
| 359 | 3300035120 | Ga0373957_0132180 | Ga0373957_0132180_600_929 | 109 |
| 360 | 3300035170 | Ga0373943_0532355 | Ga0373943_0532355_165_494 | 109 |
| 361 | 3300035171 | Ga0373946_0345176 | Ga0373946_0345176_161_490 | 109 |
| 362 | 3300035172 | Ga0373955_0217394 | Ga0373955_0217394_770_1099 | 109 |
| 363 | 3300035410 | Ga0373924_0063175 | Ga0373924_0063175_388_717 | 109 |
| 364 | 3300035691 | Ga0373931_0860646 | Ga0373931_0860646_99_428 | 109 |
| 365 | 3300035692 | Ga0373935_0085127 | Ga0373935_0085127_1550_1879 | 109 |
| 366 | 3300035695 | Ga0373927_0012627 | Ga0373927_0012627_4933_5262 | 109 |
| 367 | 3300035695 | Ga0373927_0353439 | Ga0373927_0353439_523_852 | 109 |
| 368 | 3300035725 | Ga0373947_0020630 | Ga0373947_0020630_620_949 | 109 |
| 369 | 3300035725 | Ga0373947_0391807 | Ga0373947_0391807_306_635 | 109 |
| 370 | 3300037068 | Ga0373925_0043727 | Ga0373925_0043727_1257_1586 | 109 |
| 371 | 3300037068 | Ga0373925_0401018 | Ga0373925_0401018_222_551 | 109 |
| 372 | 3300037068 | Ga0373925_0449481 | Ga0373925_0449481_182_511 | 109 |
| 373 | 3300037312 | Ga0395899_0203494 | Ga0395899_0203494_944_1273 | 109 |
| 374 | 3300037418 | Ga0395900_0760752 | Ga0395900_0760752_320_649 | 109 |
| 375 | 3300037418 | Ga0395900_0991803 | Ga0395900_0991803_281_610 | 109 |
| 376 | 3300037466 | Ga0395898_0077763 | Ga0395898_0077763_639_968 | 109 |
| 377 | 3300037466 | Ga0395898_0355839 | Ga0395898_0355839_990_1319 | 109 |
| 378 | 3300037466 | Ga0395898_1029848 | Ga0395898_1029848_301_696 | 109 |
| 379 | 3300037853 | Ga0436364_0461816 | Ga0436364_0461816_387_716 | 109 |
| 380 | 3300037853 | Ga0436364_0650502 | Ga0436364_0650502_1246_1575 | 109 |
| 381 | 3300037853 | Ga0436364_0800350 | Ga0436364_0800350_46_375 | 109 |
| 382 | 3300037853 | Ga0436364_1168969 | Ga0436364_1168969_125_454 | 109 |
| 383 | 3300037853 | Ga0436364_1279372 | Ga0436364_1279372_579_908 | 109 |
| 384 | 3300038443 | Ga0395901_0318003 | Ga0395901_0318003_667_996 | 109 |
| 385 | 3300038443 | Ga0395901_0614328 | Ga0395901_0614328_619_948 | 109 |
| 386 | 3300039437 | Ga0436365_0399803 | Ga0436365_0399803_511_909 | 109 |
| 387 | 3300039437 | Ga0436365_1147338 | Ga0436365_1147338_1681_2010 | 109 |
| 388 | 3300039437 | Ga0436365_1192934 | Ga0436365_1192934_180_509 | 109 |
| 389 | 3300039437 | Ga0436365_1417659 | Ga0436365_1417659_3794_4123 | 109 |
| 390 | 3300039437 | Ga0436365_1465938 | Ga0436365_1465938_305_637 | 109 |
| 391 | 3300039437 | Ga0436365_1574863 | Ga0436365_1574863_79_408 | 109 |
| 392 | 3300039437 | Ga0436365_1588282 | Ga0436365_1588282_71_400 | 109 |
| 393 | 3300039437 | Ga0436365_1719944 | Ga0436365_1719944_311_640 | 109 |
| 394 | 3300039438 | Ga0436360_0439815 | Ga0436360_0439815_1179_1508 | 109 |
| 395 | 3300039447 | Ga0436361_0005730 | Ga0436361_0005730_1402_1731 | 109 |
| 396 | 3300039447 | Ga0436361_0408062 | Ga0436361_0408062_153_482 | 109 |
| 397 | 3300039447 | Ga0436361_0588307 | Ga0436361_0588307_237_566 | 109 |
| 398 | 3300039447 | Ga0436361_0964350 | Ga0436361_0964350_2406_2735 | 109 |
| 399 | 3300039450 | Ga0436363_0001281 | Ga0436363_0001281_27_428 | 109 |
| 400 | 3300039450 | Ga0436363_1185918 | Ga0436363_1185918_241_579 | 109 |
| 401 | 3300039450 | Ga0436363_1197593 | Ga0436363_1197593_4083_4412 | 109 |
| 402 | 3300039450 | Ga0436363_1289621 | Ga0436363_1289621_74_463 | 109 |
| 403 | 3300039450 | Ga0436363_1695442 | Ga0436363_1695442_1134_1463 | 109 |
| 404 | 3300039453 | Ga0436362_0091420 | Ga0436362_0091420_499_828 | 109 |
| 405 | 3300039453 | Ga0436362_1228228 | Ga0436362_1228228_158_487 | 109 |
| 406 | 3300041413 | Ga0439465_0264497 | Ga0439465_0264497_192_521 | 109 |
| 407 | 3300041441 | Ga0451787_178466 | Ga0451787_178466_332_661 | 109 |
| 408 | 3300041443 | Ga0451789_0659761 | Ga0451789_0659761_432_761 | 109 |
| 409 | 3300041452 | Ga0451793_0151842 | Ga0451793_0151842_561_890 | 109 |
| 410 | 3300041453 | Ga0451797_0192916 | Ga0451797_0192916_38_367 | 109 |
| 411 | 3300041456 | Ga0451795_1541843 | Ga0451795_1541843_306_635 | 109 |
| 412 | 3300041458 | Ga0451798_1159997 | Ga0451798_1159997_119_448 | 109 |
| 413 | 3300041459 | Ga0451800_1491777 | Ga0451800_1491777_295_624 | 109 |
| 414 | 3300041486 | Ga0451807_0643386 | Ga0451807_0643386_10_339 | 109 |
| 415 | 3300041491 | Ga0451833_1389546 | Ga0451833_1389546_332_661 | 109 |
| 416 | 3300041498 | Ga0451841_1189247 | Ga0451841_1189247_251_580 | 109 |
| 417 | 3300041501 | Ga0451845_0793463 | Ga0451845_0793463_241_570 | 109 |
| 418 | 3300041505 | Ga0451849_0537052 | Ga0451849_0537052_702_1031 | 109 |
| 419 | 3300041505 | Ga0451849_0800258 | Ga0451849_0800258_149_478 | 109 |
| 420 | 3300041509 | Ga0451843_1451183 | Ga0451843_1451183_381_710 | 109 |
| 421 | 3300041512 | Ga0451853_0006967 | Ga0451853_0006967_36_365 | 109 |
| 422 | 3300041512 | Ga0451853_1536047 | Ga0451853_1536047_136_465 | 109 |
| 423 | 3300042157 | Ga0439458_0055385 | Ga0439458_0055385_178_507 | 109 |
| 424 | 3300044656 | Ga0466969_0051428 | Ga0466969_0051428_1055_1384 | 109 |
| 425 | 3300044656 | Ga0466969_0090071 | Ga0466969_0090071_652_981 | 109 |
| 426 | 3300044656 | Ga0466969_0309918 | Ga0466969_0309918_192_521 | 109 |
| 427 | 3300044658 | Ga0466972_0324608 | Ga0466972_0324608_35_364 | 109 |
| 428 | 3300044683 | Ga0466965_0192725 | Ga0466965_0192725_365_694 | 109 |
| 429 | 3300044684 | Ga0466966_0000148 | Ga0466966_0000148_1714_2043 | 109 |
| 430 | 3300044684 | Ga0466966_0363017 | Ga0466966_0363017_514_843 | 109 |
| 431 | 3300044693 | Ga0466961_0000045 | Ga0466961_0000045_33056_33385 | 109 |
| 432 | 3300044694 | Ga0466963_0508604 | Ga0466963_0508604_197_592 | 109 |
| 433 | 3300044706 | Ga0466964_0320659 | Ga0466964_0320659_12_341 | 109 |
| 434 | 3300044735 | Ga0466968_0144115 | Ga0466968_0144115_263_592 | 109 |
| 435 | 3300044735 | Ga0466968_0270953 | Ga0466968_0270953_456_785 | 109 |
| 436 | 3300044735 | Ga0466968_0512168 | Ga0466968_0512168_27_356 | 109 |
| 437 | 3300044765 | Ga0466970_0041917 | Ga0466970_0041917_665_994 | 109 |
| 438 | 3300044842 | Ga0466957_0046207 | Ga0466957_0046207_183_512 | 109 |
| 439 | 3300044842 | Ga0466957_0171848 | Ga0466957_0171848_918_1247 | 109 |
| 440 | 3300044842 | Ga0466957_0806972 | Ga0466957_0806972_132_461 | 109 |
| 441 | 3300044901 | Ga0466960_0005902 | Ga0466960_0005902_396_725 | 109 |
| 442 | 3300045049 | Ga0466959_0026243 | Ga0466959_0026243_1889_2218 | 109 |
| 443 | 3300045049 | Ga0466959_0034824 | Ga0466959_0034824_349_678 | 109 |
| 444 | 3300045049 | Ga0466959_0063524 | Ga0466959_0063524_565_894 | 109 |
| 445 | 3300045049 | Ga0466959_0753137 | Ga0466959_0753137_39_368 | 109 |
| 446 | 3300045049 | Ga0466959_0978703 | Ga0466959_0978703_82_411 | 109 |
| 447 | 3300045836 | Ga0466958_0025670 | Ga0466958_0025670_3127_3456 | 109 |
| 448 | 3300045836 | Ga0466958_0263577 | Ga0466958_0263577_757_1086 | 109 |
| 449 | 3300045976 | Ga0466967_0056127 | Ga0466967_0056127_1966_2295 | 109 |
| 450 | 3300045976 | Ga0466967_0120706 | Ga0466967_0120706_364_693 | 109 |
| 451 | 3300045976 | Ga0466967_0158785 | Ga0466967_0158785_763_1092 | 109 |
| 452 | 3300045976 | Ga0466967_1183710 | Ga0466967_1183710_313_642 | 109 |
| 453 | 3300045976 | Ga0466967_1346367 | Ga0466967_1346367_347_676 | 109 |
| 454 | 3300045976 | Ga0466967_2088119 | Ga0466967_2088119_172_501 | 109 |
| 455 | 3300046454 | Ga0495592_0027692 | Ga0495592_0027692_1050_1379 | 109 |
| 456 | 3300046454 | Ga0495592_0047449 | Ga0495592_0047449_625_954 | 109 |
| 457 | 3300046454 | Ga0495592_0211247 | Ga0495592_0211247_468_797 | 109 |
| 458 | 3300046455 | Ga0495603_0042719 | Ga0495603_0042719_2206_2535 | 109 |
| 459 | 3300046455 | Ga0495603_0218121 | Ga0495603_0218121_611_940 | 109 |
| 460 | 3300046457 | Ga0495590_0103066 | Ga0495590_0103066_345_674 | 109 |
| 461 | 3300046457 | Ga0495590_0219190 | Ga0495590_0219190_343_672 | 109 |
| 462 | 3300046459 | Ga0495629_0014231 | Ga0495629_0014231_4516_4845 | 109 |
| 463 | 3300046459 | Ga0495629_0031428 | Ga0495629_0031428_2446_2775 | 109 |
| 464 | 3300046460 | Ga0495638_0001332 | Ga0495638_0001332_295_624 | 109 |
| 465 | 3300046462 | Ga0495651_0002756 | Ga0495651_0002756_10254_10583 | 109 |
| 466 | 3300046462 | Ga0495651_0036781 | Ga0495651_0036781_448_777 | 109 |
| 467 | 3300046462 | Ga0495651_0199678 | Ga0495651_0199678_373_702 | 109 |
| 468 | 3300046471 | Ga0495650_0250062 | Ga0495650_0250062_165_494 | 109 |
| 469 | 3300046472 | Ga0495580_0007799 | Ga0495580_0007799_2424_2753 | 109 |
| 470 | 3300046473 | Ga0495582_0059188 | Ga0495582_0059188_489_818 | 109 |
| 471 | 3300046473 | Ga0495582_0272627 | Ga0495582_0272627_358_687 | 109 |
| 472 | 3300046474 | Ga0495605_0045599 | Ga0495605_0045599_1484_1813 | 109 |
| 473 | 3300046474 | Ga0495605_0115806 | Ga0495605_0115806_422_751 | 109 |
| 474 | 3300046474 | Ga0495605_0428220 | Ga0495605_0428220_37_366 | 109 |
| 475 | 3300046475 | Ga0495639_0012455 | Ga0495639_0012455_513_842 | 109 |
| 476 | 3300046476 | Ga0495662_0098590 | Ga0495662_0098590_186_515 | 109 |
| 477 | 3300046477 | Ga0495664_0012323 | Ga0495664_0012323_2352_2681 | 109 |
| 478 | 3300046477 | Ga0495664_0021463 | Ga0495664_0021463_603_932 | 109 |
| 479 | 3300046477 | Ga0495664_0304939 | Ga0495664_0304939_433_762 | 109 |
| 480 | 3300046491 | Ga0495584_0382422 | Ga0495584_0382422_114_443 | 109 |
| 481 | 3300046492 | Ga0495585_0078413 | Ga0495585_0078413_962_1291 | 109 |
| 482 | 3300046499 | Ga0495594_0088179 | Ga0495594_0088179_146_475 | 109 |
| 483 | 3300046500 | Ga0495596_0136349 | Ga0495596_0136349_320_649 | 109 |
| 484 | 3300046506 | Ga0495583_0029576 | Ga0495583_0029576_461_790 | 109 |
| 485 | 3300046507 | Ga0495606_0008196 | Ga0495606_0008196_6333_6662 | 109 |
| 486 | 3300046507 | Ga0495606_0032829 | Ga0495606_0032829_3083_3412 | 109 |
| 487 | 3300046507 | Ga0495606_0090975 | Ga0495606_0090975_949_1278 | 109 |
| 488 | 3300046507 | Ga0495606_0294454 | Ga0495606_0294454_299_628 | 109 |
| 489 | 3300046507 | Ga0495606_0364071 | Ga0495606_0364071_192_521 | 109 |
| 490 | 3300046507 | Ga0495606_0519846 | Ga0495606_0519846_207_536 | 109 |
| 491 | 3300046511 | Ga0495608_0136828 | Ga0495608_0136828_366_695 | 109 |
| 492 | 3300046512 | Ga0495610_0257502 | Ga0495610_0257502_99_428 | 109 |
| 493 | 3300046514 | Ga0495618_0018494 | Ga0495618_0018494_187_516 | 109 |
| 494 | 3300046514 | Ga0495618_0450357 | Ga0495618_0450357_243_572 | 109 |
| 495 | 3300046515 | Ga0495620_0182866 | Ga0495620_0182866_351_680 | 109 |
| 496 | 3300046516 | Ga0495628_0037662 | Ga0495628_0037662_290_619 | 109 |
| 497 | 3300046517 | Ga0495630_0033529 | Ga0495630_0033529_1280_1609 | 109 |
| 498 | 3300046518 | Ga0495631_0258479 | Ga0495631_0258479_244_573 | 109 |
| 499 | 3300046519 | Ga0495632_0033460 | Ga0495632_0033460_1303_1632 | 109 |
| 500 | 3300046519 | Ga0495632_0435819 | Ga0495632_0435819_53_382 | 109 |
| 501 | 3300046522 | Ga0495643_0353690 | Ga0495643_0353690_218_547 | 109 |
| 502 | 3300046524 | Ga0495648_0245506 | Ga0495648_0245506_120_449 | 109 |
| 503 | 3300046526 | Ga0495666_0216549 | Ga0495666_0216549_268_597 | 109 |
| 504 | 3300046529 | Ga0495652_0141107 | Ga0495652_0141107_692_1021 | 109 |
| 505 | 3300046529 | Ga0495652_0187304 | Ga0495652_0187304_553_882 | 109 |
| 506 | 3300046529 | Ga0495652_0374054 | Ga0495652_0374054_522_851 | 109 |
| 507 | 3300046531 | Ga0495665_0055978 | Ga0495665_0055978_919_1248 | 109 |
| 508 | 3300046531 | Ga0495665_0400982 | Ga0495665_0400982_158_487 | 109 |
| 509 | 3300046533 | Ga0495640_0035956 | Ga0495640_0035956_222_551 | 109 |
| 510 | 3300046533 | Ga0495640_0143754 | Ga0495640_0143754_1124_1453 | 109 |
| 511 | 3300046536 | Ga0495587_0041125 | Ga0495587_0041125_1173_1502 | 109 |
| 512 | 3300046536 | Ga0495587_0214770 | Ga0495587_0214770_431_760 | 109 |
| 513 | 3300046536 | Ga0495587_0346918 | Ga0495587_0346918_131_460 | 109 |
| 514 | 3300046538 | Ga0495609_0114897 | Ga0495609_0114897_505_834 | 109 |
| 515 | 3300046543 | Ga0495645_0012247 | Ga0495645_0012247_4312_4641 | 109 |
| 516 | 3300046543 | Ga0495645_0048010 | Ga0495645_0048010_435_764 | 109 |
| 517 | 3300046543 | Ga0495645_0097139 | Ga0495645_0097139_56_385 | 109 |
| 518 | 3300046557 | Ga0495622_0014348 | Ga0495622_0014348_456_785 | 109 |
| 519 | 3300046557 | Ga0495622_0049773 | Ga0495622_0049773_1037_1366 | 109 |
| 520 | 3300046559 | Ga0495667_0011129 | Ga0495667_0011129_1114_1443 | 109 |
| 521 | 3300046559 | Ga0495667_0170560 | Ga0495667_0170560_557_886 | 109 |
| 522 | 3300046615 | Ga0495656_0617645 | Ga0495656_0617645_167_496 | 109 |
| 523 | 3300046616 | Ga0495668_0169718 | Ga0495668_0169718_251_580 | 109 |
| 524 | 3300046616 | Ga0495668_0231377 | Ga0495668_0231377_34_363 | 109 |
| 525 | 3300046616 | Ga0495668_0272419 | Ga0495668_0272419_367_696 | 109 |
| 526 | 3300046616 | Ga0495668_0444825 | Ga0495668_0444825_352_681 | 109 |
| 527 | 3300046616 | Ga0495668_0715531 | Ga0495668_0715531_21_350 | 109 |
| 528 | 3300046642 | Ga0495634_0018388 | Ga0495634_0018388_3345_3674 | 109 |
| 529 | 3300046642 | Ga0495634_0110688 | Ga0495634_0110688_766_1095 | 109 |
| 530 | 3300046642 | Ga0495634_0207216 | Ga0495634_0207216_407_736 | 109 |
| 531 | 3300046648 | Ga0495611_0343166 | Ga0495611_0343166_212_541 | 109 |
| 532 | 3300046648 | Ga0495611_0368552 | Ga0495611_0368552_77_406 | 109 |
| 533 | 3300046660 | Ga0495625_0216740 | Ga0495625_0216740_324_653 | 109 |
| 534 | 3300046663 | Ga0495635_0002298 | Ga0495635_0002298_7250_7579 | 109 |
| 535 | 3300046663 | Ga0495635_0013798 | Ga0495635_0013798_1446_1775 | 109 |
| 536 | 3300046663 | Ga0495635_0029275 | Ga0495635_0029275_966_1295 | 109 |
| 537 | 3300046665 | Ga0495661_0145996 | Ga0495661_0145996_553_882 | 109 |
| 538 | 3300046674 | Ga0495588_0060545 | Ga0495588_0060545_792_1121 | 109 |
| 539 | 3300046674 | Ga0495588_0268211 | Ga0495588_0268211_334_663 | 109 |
| 540 | 3300046674 | Ga0495588_0281054 | Ga0495588_0281054_333_662 | 109 |
| 541 | 3300046675 | Ga0495657_0022916 | Ga0495657_0022916_3367_3696 | 109 |
| 542 | 3300046675 | Ga0495657_0167099 | Ga0495657_0167099_830_1159 | 109 |
| 543 | 3300046678 | Ga0495599_0032251 | Ga0495599_0032251_1266_1595 | 109 |
| 544 | 3300046678 | Ga0495599_0108663 | Ga0495599_0108663_324_653 | 109 |
| 545 | 3300046678 | Ga0495599_0129163 | Ga0495599_0129163_821_1150 | 109 |
| 546 | 3300046679 | Ga0495623_0023052 | Ga0495623_0023052_908_1237 | 109 |
| 547 | 3300046679 | Ga0495623_0279055 | Ga0495623_0279055_517_846 | 109 |
| 548 | 3300046679 | Ga0495623_0422635 | Ga0495623_0422635_162_491 | 109 |
| 549 | 3300046679 | Ga0495623_0458024 | Ga0495623_0458024_197_526 | 109 |
| 550 | 3300046680 | Ga0495646_0174087 | Ga0495646_0174087_50_379 | 109 |
| 551 | 3300046680 | Ga0495646_0462732 | Ga0495646_0462732_161_490 | 109 |
| 552 | 3300046680 | Ga0495646_0573629 | Ga0495646_0573629_191_520 | 109 |
| 553 | 3300046681 | Ga0495647_0009374 | Ga0495647_0009374_159_488 | 109 |
| 554 | 3300046689 | Ga0495613_0067020 | Ga0495613_0067020_786_1115 | 109 |
| 555 | 3300046689 | Ga0495613_0198088 | Ga0495613_0198088_164_493 | 109 |
| 556 | 3300046690 | Ga0495624_0131750 | Ga0495624_0131750_1011_1340 | 109 |
| 557 | 3300046690 | Ga0495624_0253329 | Ga0495624_0253329_164_493 | 109 |
| 558 | 3300046690 | Ga0495624_0458513 | Ga0495624_0458513_180_509 | 109 |
| 559 | 3300046694 | Ga0495649_0293063 | Ga0495649_0293063_141_470 | 109 |
| 560 | 3300046694 | Ga0495649_0408977 | Ga0495649_0408977_196_525 | 109 |
| 561 | 3300046794 | Ga0495589_0577925 | Ga0495589_0577925_157_486 | 109 |
| 562 | 3300046809 | Ga0495600_0003039 | Ga0495600_0003039_7848_8177 | 109 |
| 563 | 3300046809 | Ga0495600_0024800 | Ga0495600_0024800_1673_2002 | 109 |
| 564 | 3300047315 | Ga0495581_0007776 | Ga0495581_0007776_2839_3168 | 109 |
| 565 | 3300047315 | Ga0495581_0080484 | Ga0495581_0080484_231_560 | 109 |
| 566 | 3300047315 | Ga0495581_0319226 | Ga0495581_0319226_228_557 | 109 |
| 567 | 3300047317 | Ga0495604_0014335 | Ga0495604_0014335_1349_1678 | 109 |
| 568 | 3300047317 | Ga0495604_0019497 | Ga0495604_0019497_649_978 | 109 |
| 569 | 3300047319 | Ga0495674_0052668 | Ga0495674_0052668_919_1248 | 109 |
| 570 | 3300047319 | Ga0495674_0073484 | Ga0495674_0073484_1711_2040 | 109 |
| 571 | 3300047319 | Ga0495674_0929769 | Ga0495674_0929769_10_339 | 109 |
| 572 | 3300047320 | Ga0495672_0012285 | Ga0495672_0012285_5358_5687 | 109 |
| 573 | 3300047321 | Ga0495676_0085046 | Ga0495676_0085046_53_382 | 109 |
| 574 | 3300047321 | Ga0495676_0095867 | Ga0495676_0095867_1463_1792 | 109 |
| 575 | 3300047321 | Ga0495676_0255984 | Ga0495676_0255984_191_520 | 109 |
| 576 | 3300047322 | Ga0495680_0007085 | Ga0495680_0007085_833_1162 | 109 |
| 577 | 3300047323 | Ga0495683_0239028 | Ga0495683_0239028_383_712 | 109 |
| 578 | 3300047323 | Ga0495683_0457668 | Ga0495683_0457668_61_390 | 109 |
| 579 | 3300047444 | Ga0495675_0072238 | Ga0495675_0072238_1250_1579 | 109 |
| 580 | 3300047444 | Ga0495675_0146152 | Ga0495675_0146152_1101_1430 | 109 |
| 581 | 3300047470 | Ga0495681_0150735 | Ga0495681_0150735_454_783 | 109 |
| 582 | 3300047471 | Ga0495684_0036735 | Ga0495684_0036735_1257_1586 | 109 |
| 583 | 3300047471 | Ga0495684_0071406 | Ga0495684_0071406_1490_1819 | 109 |
| 584 | 3300047472 | Ga0495686_0231638 | Ga0495686_0231638_382_711 | 109 |
| 585 | 3300047472 | Ga0495686_0420691 | Ga0495686_0420691_327_656 | 109 |
| 586 | 3300047472 | Ga0495686_0560167 | Ga0495686_0560167_112_441 | 109 |
| 587 | 3300047673 | Ga0495593_0013204 | Ga0495593_0013204_3480_3809 | 109 |
| 588 | 3300048088 | Ga0495602_0015884 | Ga0495602_0015884_587_916 | 109 |
| 589 | 3300048088 | Ga0495602_0034597 | Ga0495602_0034597_3294_3623 | 109 |
| 590 | 3300048089 | Ga0495614_0039759 | Ga0495614_0039759_744_1073 | 109 |
| 591 | 3300048089 | Ga0495614_0244400 | Ga0495614_0244400_335_664 | 109 |
| 592 | 3300048089 | Ga0495614_0293709 | Ga0495614_0293709_149_478 | 109 |
| 593 | 3300048091 | Ga0495626_0140350 | Ga0495626_0140350_641_970 | 109 |
| 594 | 3300048903 | Ga0496100_1161820 | Ga0496100_1161820_57_386 | 109 |
| 595 | 3300048904 | Ga0496101_0052301 | Ga0496101_0052301_304_633 | 109 |
| 596 | 3300048904 | Ga0496101_0064292 | Ga0496101_0064292_2317_2646 | 109 |
| 597 | 3300048904 | Ga0496101_0081153 | Ga0496101_0081153_740_1069 | 109 |
| 598 | 3300048905 | Ga0496102_0147670 | Ga0496102_0147670_1830_2159 | 109 |
| 599 | 3300048905 | Ga0496102_0357400 | Ga0496102_0357400_906_1235 | 109 |
| 600 | 3300048905 | Ga0496102_0655760 | Ga0496102_0655760_463_864 | 109 |
| 601 | 3300048905 | Ga0496102_1264348 | Ga0496102_1264348_262_591 | 109 |
| 602 | 3300048906 | Ga0496103_0620992 | Ga0496103_0620992_314_643 | 109 |
| 603 | 3300048907 | Ga0496104_0049423 | Ga0496104_0049423_1471_1800 | 109 |
| 604 | 3300048907 | Ga0496104_0141371 | Ga0496104_0141371_1842_2171 | 109 |
| 605 | 3300048908 | Ga0496105_0139527 | Ga0496105_0139527_672_1001 | 109 |
| 606 | 3300048908 | Ga0496105_0222692 | Ga0496105_0222692_661_990 | 109 |
| 607 | 3300048909 | Ga0496106_0171154 | Ga0496106_0171154_1205_1534 | 109 |
| 608 | 3300048910 | Ga0496107_0095167 | Ga0496107_0095167_20_349 | 109 |
| 609 | 3300048910 | Ga0496107_1161031 | Ga0496107_1161031_115_516 | 109 |
| 610 | 3300048911 | Ga0496108_0310517 | Ga0496108_0310517_1012_1341 | 109 |
| 611 | 3300048912 | Ga0496109_0067095 | Ga0496109_0067095_1624_1953 | 109 |
| 612 | 3300048912 | Ga0496109_0992796 | Ga0496109_0992796_22_351 | 109 |
| 613 | 3300048912 | Ga0496109_1278036 | Ga0496109_1278036_162_491 | 109 |
| 614 | 3300048913 | Ga0496110_0244427 | Ga0496110_0244427_221_550 | 109 |
| 615 | 3300048915 | Ga0496112_0137081 | Ga0496112_0137081_29_358 | 109 |
| 616 | 3300048915 | Ga0496112_0786888 | Ga0496112_0786888_333_662 | 109 |
| 617 | 3300048915 | Ga0496112_1395113 | Ga0496112_1395113_116_445 | 109 |
| 618 | 3300048916 | Ga0496113_0028986 | Ga0496113_0028986_441_770 | 109 |
| 619 | 3300048916 | Ga0496113_1421190 | Ga0496113_1421190_141_470 | 109 |
| 620 | 3300048917 | Ga0496114_0193028 | Ga0496114_0193028_113_442 | 109 |
| 621 | 3300048917 | Ga0496114_0216090 | Ga0496114_0216090_838_1167 | 109 |
| 622 | 3300048917 | Ga0496114_0348196 | Ga0496114_0348196_557_886 | 109 |
| 623 | 3300048917 | Ga0496114_0527651 | Ga0496114_0527651_324_665 | 109 |
| 624 | 3300048917 | Ga0496114_1326720 | Ga0496114_1326720_221_550 | 109 |
| 625 | 3300048918 | Ga0496115_0039815 | Ga0496115_0039815_858_1187 | 109 |
| 626 | 3300048918 | Ga0496115_0054012 | Ga0496115_0054012_2557_2886 | 109 |
| 627 | 3300048918 | Ga0496115_0456518 | Ga0496115_0456518_420_749 | 109 |
| 628 | 3300048918 | Ga0496115_0957754 | Ga0496115_0957754_283_612 | 109 |
| 629 | 3300048920 | Ga0496117_0527390 | Ga0496117_0527390_178_522 | 109 |
| 630 | 3300048921 | Ga0496118_0017685 | Ga0496118_0017685_493_822 | 109 |
| 631 | 3300048921 | Ga0496118_0080594 | Ga0496118_0080594_166_495 | 109 |
| 632 | 3300048921 | Ga0496118_0119897 | Ga0496118_0119897_113_442 | 109 |
| 633 | 3300048921 | Ga0496118_0216743 | Ga0496118_0216743_397_726 | 109 |
| 634 | 3300048921 | Ga0496118_0402353 | Ga0496118_0402353_85_414 | 109 |
| 635 | 3300048921 | Ga0496118_0417420 | Ga0496118_0417420_175_504 | 109 |
| 636 | 3300048921 | Ga0496118_0557337 | Ga0496118_0557337_181_510 | 109 |
| 637 | 3300048922 | Ga0496119_0056800 | Ga0496119_0056800_1495_1824 | 109 |
| 638 | 3300048922 | Ga0496119_0078070 | Ga0496119_0078070_842_1171 | 109 |
| 639 | 3300048922 | Ga0496119_0096146 | Ga0496119_0096146_95_424 | 109 |
| 640 | 3300048923 | Ga0496120_0012481 | Ga0496120_0012481_1745_2074 | 109 |
| 641 | 3300048923 | Ga0496120_0071732 | Ga0496120_0071732_176_505 | 109 |
| 642 | 3300048924 | Ga0496121_0011029 | Ga0496121_0011029_5098_5427 | 109 |
| 643 | 3300048924 | Ga0496121_0027200 | Ga0496121_0027200_262_591 | 109 |
| 644 | 3300048924 | Ga0496121_0041977 | Ga0496121_0041977_2106_2435 | 109 |
| 645 | 3300048924 | Ga0496121_0070640 | Ga0496121_0070640_2130_2459 | 109 |
| 646 | 3300048924 | Ga0496121_0088016 | Ga0496121_0088016_377_706 | 109 |
| 647 | 3300048924 | Ga0496121_0106840 | Ga0496121_0106840_1426_1755 | 109 |
| 648 | 3300048924 | Ga0496121_0125596 | Ga0496121_0125596_704_1033 | 109 |
| 649 | 3300048924 | Ga0496121_0162284 | Ga0496121_0162284_870_1199 | 109 |
| 650 | 3300048924 | Ga0496121_0257056 | Ga0496121_0257056_617_946 | 109 |
| 651 | 3300048924 | Ga0496121_0270203 | Ga0496121_0270203_351_680 | 109 |
| 652 | 3300048924 | Ga0496121_0369381 | Ga0496121_0369381_248_577 | 109 |
| 653 | 3300048924 | Ga0496121_0497139 | Ga0496121_0497139_112_441 | 109 |
| 654 | 3300048924 | Ga0496121_0889166 | Ga0496121_0889166_159_488 | 109 |
| 655 | 3300048927 | Ga0496124_0121600 | Ga0496124_0121600_1038_1367 | 109 |
| 656 | 3300048928 | Ga0496125_0020779 | Ga0496125_0020779_901_1230 | 109 |
| 657 | 3300048928 | Ga0496125_0139007 | Ga0496125_0139007_125_454 | 109 |
| 658 | 3300048928 | Ga0496125_0414100 | Ga0496125_0414100_413_742 | 109 |
| 659 | 3300048928 | Ga0496125_0511366 | Ga0496125_0511366_159_488 | 109 |
| 660 | 3300048929 | Ga0496126_0006044 | Ga0496126_0006044_5794_6123 | 109 |
| 661 | 3300048929 | Ga0496126_0012447 | Ga0496126_0012447_421_750 | 109 |
| 662 | 3300048929 | Ga0496126_0033259 | Ga0496126_0033259_1843_2172 | 109 |
| 663 | 3300048929 | Ga0496126_0033486 | Ga0496126_0033486_4422_4751 | 109 |
| 664 | 3300048929 | Ga0496126_0034403 | Ga0496126_0034403_1033_1362 | 109 |
| 665 | 3300048929 | Ga0496126_0040294 | Ga0496126_0040294_3083_3412 | 109 |
| 666 | 3300048929 | Ga0496126_0049559 | Ga0496126_0049559_463_792 | 109 |
| 667 | 3300048929 | Ga0496126_0129637 | Ga0496126_0129637_1742_2071 | 109 |
| 668 | 3300048929 | Ga0496126_0170867 | Ga0496126_0170867_566_895 | 109 |
| 669 | 3300048929 | Ga0496126_0258403 | Ga0496126_0258403_688_1017 | 109 |
| 670 | 3300048929 | Ga0496126_0264308 | Ga0496126_0264308_803_1144 | 109 |
| 671 | 3300048929 | Ga0496126_0812435 | Ga0496126_0812435_324_653 | 109 |
| 672 | 3300049460 | Ga0495682_0061224 | Ga0495682_0061224_91_420 | 109 |
| 673 | 3300049460 | Ga0495682_0172501 | Ga0495682_0172501_127_456 | 109 |
| 674 | 3300049574 | Ga0501038_1141649 | Ga0501038_1141649_117_509 | 109 |
| 675 | 3300049578 | Ga0501042_0194997 | Ga0501042_0194997_953_1285 | 109 |
| 676 | 3300049580 | Ga0501046_0021119 | Ga0501046_0021119_975_1367 | 109 |
| 677 | 3300049581 | Ga0501047_0031979 | Ga0501047_0031979_119_511 | 109 |
| 678 | 3300049585 | Ga0501069_0685407 | Ga0501069_0685407_247_576 | 109 |
| 679 | 3300049586 | Ga0501070_0105780 | Ga0501070_0105780_43_435 | 109 |
| 680 | 3300049588 | Ga0501072_0528042 | Ga0501072_0528042_357_719 | 109 |
| 681 | 3300049589 | Ga0501073_0015955 | Ga0501073_0015955_3582_3974 | 109 |
| 682 | 3300049590 | Ga0501074_0203836 | Ga0501074_0203836_271_663 | 109 |
| 683 | 3300049590 | Ga0501074_0280050 | Ga0501074_0280050_680_1042 | 109 |
| 684 | 3300049591 | Ga0501075_0632536 | Ga0501075_0632536_355_687 | 109 |
| 685 | 3300049741 | Ga0501079_0474412 | Ga0501079_0474412_155_487 | 109 |
| 686 | 3300049742 | Ga0501080_0041543 | Ga0501080_0041543_982_1374 | 109 |
| 687 | 3300049823 | Ga0501044_0087765 | Ga0501044_0087765_1055_1447 | 109 |
| 688 | 3300050490 | nmdc:mga03n38_742784_c1 | nmdc:mga03n38_742784_c1_174_503 | 109 |
| 689 | 3300050492 | nmdc:mga0yw44_1155299_c1 | nmdc:mga0yw44_1155299_c1_126_455 | 109 |
| 690 | 3300050492 | nmdc:mga0yw44_744273_c1 | nmdc:mga0yw44_744273_c1_305_634 | 109 |
| 691 | 3300050492 | nmdc:mga0yw44_92596_c1 | nmdc:mga0yw44_92596_c1_861_1190 | 109 |
| 692 | 3300050493 | nmdc:mga0k408_852420_c1 | nmdc:mga0k408_852420_c1_63_392 | 109 |
| 693 | 3300050494 | nmdc:mga06z11_259770_c1 | nmdc:mga06z11_259770_c1_543_872 | 109 |
| 694 | 3300050494 | nmdc:mga06z11_451687_c1 | nmdc:mga06z11_451687_c1_260_589 | 109 |
| 695 | 3300050494 | nmdc:mga06z11_507109_c1 | nmdc:mga06z11_507109_c1_386_715 | 109 |
| 696 | 3300050496 | nmdc:mga07m45_436820_c1 | nmdc:mga07m45_436820_c1_113_442 | 109 |
| 697 | 3300050507 | nmdc:mga05p37_951465_c1 | nmdc:mga05p37_951465_c1_480_809 | 109 |
| 698 | 3300050512 | nmdc:mga0n895_19638_c1 | nmdc:mga0n895_19638_c1_1162_1491 | 109 |
| 699 | 3300050512 | nmdc:mga0n895_538749_c1 | nmdc:mga0n895_538749_c1_357_686 | 109 |
| 700 | 3300050513 | nmdc:mga0rr50_192567_c1 | nmdc:mga0rr50_192567_c1_334_663 | 109 |
| 701 | 3300050514 | nmdc:mga08x19_361605_c1 | nmdc:mga08x19_361605_c1_613_942 | 109 |
| 702 | 3300050514 | nmdc:mga08x19_863764_c1 | nmdc:mga08x19_863764_c1_176_505 | 109 |
| 703 | 3300050516 | nmdc:mga0sz30_66336_c1 | nmdc:mga0sz30_66336_c1_644_973 | 109 |
| 704 | 3300053077 | Ga0495601_0016093 | Ga0495601_0016093_763_1092 | 109 |
| 705 | 3300053077 | Ga0495601_0031359 | Ga0495601_0031359_1580_1909 | 109 |
| 706 | 3300053078 | Ga0495612_0008064 | Ga0495612_0008064_2263_2592 | 109 |
| 707 | 3300053078 | Ga0495612_0009799 | Ga0495612_0009799_470_799 | 109 |
| 708 | 3300053085 | Ga0495619_0736266 | Ga0495619_0736266_193_522 | 109 |
| 709 | 3300053086 | Ga0500578_0090652 | Ga0500578_0090652_1296_1625 | 109 |
| 710 | 3300053087 | Ga0500643_000107 | Ga0500643_000107_59833_60162 | 109 |
| 711 | 3300053088 | Ga0500644_0422921 | Ga0500644_0422921_60_389 | 109 |
| 712 | 3300053091 | Ga0500647_0062748 | Ga0500647_0062748_1296_1640 | 109 |
| 713 | 3300053091 | Ga0500647_0212007 | Ga0500647_0212007_454_783 | 109 |
| 714 | 3300053092 | Ga0500583_0086346 | Ga0500583_0086346_408_737 | 109 |
| 715 | 3300053093 | Ga0500651_0355034 | Ga0500651_0355034_229_558 | 109 |
| 716 | 3300053094 | Ga0500566_0000020 | Ga0500566_0000020_51060_51404 | 109 |
| 717 | 3300053094 | Ga0500566_0000060 | Ga0500566_0000060_8974_9303 | 109 |
| 718 | 3300053095 | Ga0500640_000957 | Ga0500640_000957_6582_6926 | 109 |
| 719 | 3300053096 | Ga0500641_0017005 | Ga0500641_0017005_745_1074 | 109 |
| 720 | 3300053098 | Ga0500650_0176256 | Ga0500650_0176256_508_837 | 109 |
| 721 | 3300053103 | Ga0500555_001044 | Ga0500555_001044_4809_5138 | 109 |
| 722 | 3300053105 | Ga0500557_000044 | Ga0500557_000044_26139_26468 | 109 |
| 723 | 3300053108 | Ga0500562_012892 | Ga0500562_012892_628_957 | 109 |
| 724 | 3300053109 | Ga0500569_050689 | Ga0500569_050689_67_396 | 109 |
| 725 | 3300053111 | Ga0500572_000882 | Ga0500572_000882_2382_2726 | 109 |
| 726 | 3300053115 | Ga0500591_032819 | Ga0500591_032819_1416_1760 | 109 |
| 727 | 3300053116 | Ga0500592_034349 | Ga0500592_034349_281_610 | 109 |
| 728 | 3300053118 | Ga0500594_0283166 | Ga0500594_0283166_35_364 | 109 |
| 729 | 3300053120 | Ga0500597_423676 | Ga0500597_423676_162_491 | 109 |
| 730 | 3300053122 | Ga0500608_013703 | Ga0500608_013703_232_576 | 109 |
| 731 | 3300053123 | Ga0500614_003566 | Ga0500614_003566_2425_2769 | 109 |
| 732 | 3300053126 | Ga0500621_009720 | Ga0500621_009720_1648_1977 | 109 |
| 733 | 3300053130 | Ga0500642_0000331 | Ga0500642_0000331_14236_14565 | 109 |
| 734 | 3300053130 | Ga0500642_0081674 | Ga0500642_0081674_366_695 | 109 |
| 735 | 3300053130 | Ga0500642_0107400 | Ga0500642_0107400_22_351 | 109 |
| 736 | 3300053133 | Ga0500655_026577 | Ga0500655_026577_103_432 | 109 |
| 737 | 3300053134 | Ga0500658_0045241 | Ga0500658_0045241_917_1246 | 109 |
| 738 | 3300053136 | Ga0500559_0003043 | Ga0500559_0003043_1221_1565 | 109 |
| 739 | 3300053139 | Ga0500568_0297792 | Ga0500568_0297792_180_509 | 109 |
| 740 | 3300053148 | Ga0500590_163355 | Ga0500590_163355_457_801 | 109 |
| 741 | 3300053150 | Ga0500603_002834 | Ga0500603_002834_1229_1573 | 109 |
| 742 | 3300053151 | Ga0500604_0075476 | Ga0500604_0075476_145_474 | 109 |
| 743 | 3300053156 | Ga0500622_0228238 | Ga0500622_0228238_147_476 | 109 |
| 744 | 3300053158 | Ga0500627_0044839 | Ga0500627_0044839_1461_1790 | 109 |
| 745 | 3300053159 | Ga0500630_001295 | Ga0500630_001295_9015_9359 | 109 |
| 746 | 3300053161 | Ga0500634_0212888 | Ga0500634_0212888_73_402 | 109 |
| 747 | 3300053162 | Ga0500638_114977 | Ga0500638_114977_575_919 | 109 |
| 748 | 3300053163 | Ga0500639_000111 | Ga0500639_000111_33700_34044 | 109 |
| 749 | 3300053177 | Ga0500636_0423586 | Ga0500636_0423586_161_490 | 109 |
| 750 | 3300053178 | Ga0500637_0334705 | Ga0500637_0334705_379_708 | 109 |
| 751 | 3300053178 | Ga0500637_0487462 | Ga0500637_0487462_166_495 | 109 |
| 752 | 3300053727 | Ga0500611_018768 | Ga0500611_018768_705_1034 | 109 |
| 753 | 3300053730 | Ga0500645_025821 | Ga0500645_025821_1125_1454 | 109 |
| 754 | 3300053731 | Ga0500609_005383 | Ga0500609_005383_1226_1555 | 109 |
| 755 | 3300053732 | Ga0500656_030098 | Ga0500656_030098_265_594 | 109 |
| 756 | 3300053735 | Ga0500596_000483 | Ga0500596_000483_2372_2716 | 109 |
| 757 | 3300053736 | Ga0500599_001356 | Ga0500599_001356_1972_2301 | 109 |
| 758 | 3300053737 | Ga0500601_006752 | Ga0500601_006752_907_1251 | 109 |
| 759 | 3300053737 | Ga0500601_012566 | Ga0500601_012566_112_441 | 109 |
| 760 | 3300054114 | Ga0501084_0598187 | Ga0501084_0598187_370_702 | 109 |
| 761 | 3300055283 | Ga0500661_025822 | Ga0500661_025822_42_386 | 109 |
| 762 | 3300055283 | Ga0500661_035515 | Ga0500661_035515_373_702 | 109 |
| 763 | 3300060353 | Ga0501082_0544926 | Ga0501082_0544926_112_444 | 109 |
| 764 | iso_pu_bacteria | 2524023228 | 2524537707 | 109 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar