F479721

General Info

Members Datasets Scaffolds Average Seq Length
764 402 763 110

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100143208|Ga0075428_1001432082
Length 108
Sequence MTPEQLQSFLALGIGFAVAGVLGTGYQYWTERPASFRLISEAPHLVALAVPFVVFXXXXIIMRNTVRGRRIEGRRFEFVMLATIIAGLWSLMSGSLLMRLIEIVGLFA

Samples

Sample ID Description Type Environment
1 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
5 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
6 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
7 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
21 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
22 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
30 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
51 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
52 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
53 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
54 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
55 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
56 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
57 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
58 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
71 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300012488 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.yng.030610 Metagenome Rhizosphere
84 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
96 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
97 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
101 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
104 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
106 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
107 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
108 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
151 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
152 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
153 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
156 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
157 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
158 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
159 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
160 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
163 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
167 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
168 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
169 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
170 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
171 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
172 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
173 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
174 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
175 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
177 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
179 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
180 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
181 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
182 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
183 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
184 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
185 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
186 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
187 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
188 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
189 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
190 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
191 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
192 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
193 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
202 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
203 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
204 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
205 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
206 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
207 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
208 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
209 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
210 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
211 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
212 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
213 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
214 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
215 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
216 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
217 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
218 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
219 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
222 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
223 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
228 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
229 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
230 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
231 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
232 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
233 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
234 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
235 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
236 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
237 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
238 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
239 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
240 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
241 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
242 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
243 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
244 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
245 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
246 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
247 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
248 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
249 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
250 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
251 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
252 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
253 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
254 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
255 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
256 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
257 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
258 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
259 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
265 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
268 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
269 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
270 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
271 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
272 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
273 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
274 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
275 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
276 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
277 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
278 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
279 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
280 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
281 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
282 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
283 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
284 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
285 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
286 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
287 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
288 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
289 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
290 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
291 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
292 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
293 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
294 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
295 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
296 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
297 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
298 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
299 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
300 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
301 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
302 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
303 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
304 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
305 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
306 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
307 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
308 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
309 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
310 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
311 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
312 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
313 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
314 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
318 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
319 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
320 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
321 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
322 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
323 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
324 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
325 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
326 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
331 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
332 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
333 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
334 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
335 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
336 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
337 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
340 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
341 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
342 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
343 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
344 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
345 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
346 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
347 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
348 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
349 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
350 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
351 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
356 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
357 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
358 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
359 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
360 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
361 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
362 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
363 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
364 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
365 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
366 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
367 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
368 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
369 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
370 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
371 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
372 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
373 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
374 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
375 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
376 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
377 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
378 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
379 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
380 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
381 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
382 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
383 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
384 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
385 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
386 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
387 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
388 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
389 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
390 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
391 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
392 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
393 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
394 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
395 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
396 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
397 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
398 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
399 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
400 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
401 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
402 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.13
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.83
Nodule 0.92
Rhizoplane 5.63
Rhizosphere 70.16
Stem 0
Stem Tuber 0
Unclassified 10.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10011545 3300003215 Bacteria 3894
2 JGI25404J52841_10017661 3300003659 Bacteria 1546
3 Ga0055539_1006952 3300003752 Bacteria 1439
4 Ga0055539_1016086 3300003752 Bacteria 908
5 Ga0055529_1007379 3300003763 Bacteria 1497
6 Ga0055529_1010709 3300003763 Bacteria 1189
7 Ga0055543_1002361 3300004625 Bacteria 6309
8 Ga0065165_1001366 3300005262 Bacteria 26875
9 Ga0070683_100001091 3300005329 Bacteria 20439
10 Ga0070683_100078984 3300005329 Bacteria 3079
11 Ga0070683_100684631 3300005329 Bacteria 982
12 Ga0070690_101116830 3300005330 Bacteria 626
13 Ga0068869_100880982 3300005334 Bacteria 774
14 Ga0070680_100023865 3300005336 Bacteria 4881
15 Ga0070680_100085052 3300005336 Bacteria 2613
16 Ga0070680_100215066 3300005336 Bacteria 1622
17 Ga0070680_101016737 3300005336 Bacteria 716
18 Ga0070682_100083502 3300005337 Bacteria 2073
19 Ga0070660_100212284 3300005339 Bacteria 1572
20 Ga0070689_100854667 3300005340 Bacteria 803
21 Ga0070661_100144372 3300005344 Bacteria 1795
22 Ga0070661_100930286 3300005344 Bacteria 719
23 Ga0070692_10261919 3300005345 Bacteria 1040
24 Ga0070674_100311255 3300005356 Bacteria 1259
25 Ga0070659_100897916 3300005366 Bacteria 774
26 Ga0070659_101815773 3300005366 Bacteria 546
27 Ga0070667_101231163 3300005367 Bacteria 701
28 Ga0070709_10000506 3300005434 Bacteria 23004
29 Ga0070709_10033960 3300005434 Bacteria 3090
30 Ga0070709_10035149 3300005434 Bacteria 3043
31 Ga0070709_10069538 3300005434 Bacteria 2268
32 Ga0070709_10702764 3300005434 Bacteria 787
33 Ga0070714_100081400 3300005435 Bacteria 2819
34 Ga0070714_100085927 3300005435 Bacteria 2748
35 Ga0070714_100222922 3300005435 Bacteria 1734
36 Ga0070714_100421337 3300005435 Bacteria 1265
37 Ga0070714_100903387 3300005435 Bacteria 857
38 Ga0070714_101537560 3300005435 Bacteria 650
39 Ga0070713_100096627 3300005436 Bacteria 2551
40 Ga0070713_101317952 3300005436 Bacteria 700
41 Ga0070713_101599403 3300005436 Bacteria 632
42 Ga0070710_10000386 3300005437 Bacteria 20587
43 Ga0070710_10012971 3300005437 Bacteria 4156
44 Ga0070710_10092974 3300005437 Bacteria 1782
45 Ga0070710_10236766 3300005437 Bacteria 1168
46 Ga0070710_10809886 3300005437 Bacteria 670
47 Ga0070711_100001793 3300005439 Bacteria 11956
48 Ga0070711_100003655 3300005439 Bacteria 8992
49 Ga0070711_100042708 3300005439 Bacteria 3066
50 Ga0070711_100056795 3300005439 Bacteria 2708
51 Ga0070663_100012418 3300005455 Bacteria 5388
52 Ga0070663_100098505 3300005455 Bacteria 2178
53 Ga0070678_100527122 3300005456 Bacteria 1046
54 Ga0070681_10061117 3300005458 Bacteria 3743
55 Ga0070681_10313939 3300005458 Bacteria 1477
56 Ga0068867_100822610 3300005459 Bacteria 830
57 Ga0070706_100180140 3300005467 Bacteria 1973
58 Ga0070707_100156508 3300005468 Bacteria 2220
59 Ga0070698_100051487 3300005471 Bacteria 4194
60 Ga0070679_100063720 3300005530 Bacteria 3674
61 Ga0070679_100717197 3300005530 Bacteria 943
62 Ga0070684_100003496 3300005535 Bacteria 11796
63 Ga0068853_100183234 3300005539 Bacteria 1900
64 Ga0068853_100677614 3300005539 Bacteria 982
65 Ga0070696_100619003 3300005546 Bacteria 875
66 Ga0070696_100880073 3300005546 Bacteria 742
67 Ga0070693_100227443 3300005547 Bacteria 1225
68 Ga0070693_100353269 3300005547 Bacteria 1007
69 Ga0070665_100006302 3300005548 Bacteria 12113
70 Ga0070665_101205470 3300005548 Bacteria 768
71 Ga0068855_100441185 3300005563 Bacteria 1422
72 Ga0068855_100638667 3300005563 Bacteria 1144
73 Ga0068855_102388722 3300005563 Bacteria 528
74 Ga0070664_100279403 3300005564 Bacteria 1505
75 Ga0070664_100619026 3300005564 Bacteria 1005
76 Ga0070664_101137325 3300005564 Bacteria 736
77 Ga0068857_100264617 3300005577 Bacteria 1579
78 Ga0068854_101007940 3300005578 Bacteria 738
79 Ga0068854_101679508 3300005578 Bacteria 580
80 Ga0068854_101696403 3300005578 Bacteria 577
81 Ga0068856_100263678 3300005614 Bacteria 1739
82 Ga0068856_101728778 3300005614 Bacteria 638
83 Ga0070702_101422355 3300005615 Bacteria 568
84 Ga0068852_100005466 3300005616 Bacteria 9090
85 Ga0068852_100751317 3300005616 Bacteria 987
86 Ga0068851_10227274 3300005834 Bacteria 1051
87 Ga0068858_100596856 3300005842 Bacteria 1071
88 Ga0068860_100005261 3300005843 Bacteria 13134
89 Ga0068862_100240875 3300005844 Bacteria 1645
90 Ga0081455_10084249 3300005937 Bacteria 2595
91 Ga0081455_10163243 3300005937 Bacteria 1705
92 Ga0081455_10604115 3300005937 Bacteria 715
93 Ga0081538_10106975 3300005981 Bacteria 1387
94 Ga0081540_1006012 3300005983 Bacteria 8935
95 Ga0081540_1035235 3300005983 Bacteria 2686
96 Ga0081540_1123080 3300005983 Bacteria 1072
97 Ga0081540_1193445 3300005983 Bacteria 747
98 Ga0081539_10159673 3300005985 Bacteria 1076
99 Ga0070717_10505300 3300006028 Bacteria 1093
100 Ga0070717_10536428 3300006028 Bacteria 1059
101 Ga0070717_10936873 3300006028 Bacteria 789
102 Ga0070717_11117202 3300006028 Bacteria 718
103 Ga0075365_10341276 3300006038 Bacteria 1055
104 Ga0075365_10614342 3300006038 Bacteria 769
105 Ga0070715_10033216 3300006163 Bacteria 2107
106 Ga0070715_10156144 3300006163 Bacteria 1123
107 Ga0070715_10320039 3300006163 Bacteria 837
108 Ga0070716_100043612 3300006173 Bacteria 2509
109 Ga0070716_100121674 3300006173 Bacteria 1635
110 Ga0070716_100533944 3300006173 Bacteria 871
111 Ga0070716_100854919 3300006173 Bacteria 709
112 Ga0070716_100988140 3300006173 Bacteria 665
113 Ga0070712_100022303 3300006175 Bacteria 4170
114 Ga0070712_100107729 3300006175 Bacteria 2074
115 Ga0070712_100132676 3300006175 Bacteria 1890
116 Ga0070712_100264784 3300006175 Bacteria 1379
117 Ga0070712_100929321 3300006175 Bacteria 751
118 Ga0075362_10698864 3300006177 Bacteria 529
119 Ga0075367_10383702 3300006178 Bacteria 888
120 Ga0075367_10399631 3300006178 Bacteria 869
121 Ga0075367_10662857 3300006178 Bacteria 663
122 Ga0075369_10102379 3300006186 Bacteria 1286
123 Ga0097621_100108355 3300006237 Bacteria 2345
124 Ga0097621_100118406 3300006237 Bacteria 2245
125 Ga0068871_100603932 3300006358 Bacteria 998
126 Ga0075428_100143208 3300006844 Bacteria 2599
127 Ga0075430_100248516 3300006846 Bacteria 1474
128 Ga0075434_100132227 3300006871 Bacteria 2515
129 Ga0075434_100321514 3300006871 Bacteria 1568
130 Ga0075429_100292881 3300006880 Bacteria 1425
131 Ga0068865_100490091 3300006881 Bacteria 1023
132 Ga0068865_101062033 3300006881 Bacteria 712
133 Ga0075436_100754517 3300006914 Bacteria 723
134 Ga0075436_100953109 3300006914 Bacteria 643
135 Ga0097620_100054666 3300006931 Bacteria 4016
136 Ga0099824_1019902 3300006942 Bacteria 5084
137 Ga0099822_1002329 3300006943 Bacteria 23542
138 Ga0075435_100143718 3300007076 Bacteria 2003
139 Ga0075435_100166504 3300007076 Bacteria 1859
140 Ga0105240_10006604 3300009093 Bacteria 17027
141 Ga0105240_10217193 3300009093 Bacteria 2230
142 Ga0105240_10307893 3300009093 Bacteria 1810
143 Ga0105245_12944567 3300009098 Bacteria 528
144 Ga0105247_10456416 3300009101 Bacteria 922
145 Ga0114129_10467601 3300009147 Bacteria 1652
146 Ga0114129_10881302 3300009147 Bacteria 1135
147 Ga0105241_10031780 3300009174 Bacteria 3953
148 Ga0105237_10003458 3300009545 Bacteria 18745
149 Ga0105237_10041450 3300009545 Bacteria 4643
150 Ga0105237_10338295 3300009545 Bacteria 1510
151 Ga0105237_10610375 3300009545 Bacteria 1098
152 Ga0105237_11261460 3300009545 Bacteria 745
153 Ga0105237_12232160 3300009545 Bacteria 557
154 Ga0105237_12455687 3300009545 Bacteria 531
155 Ga0105238_10049933 3300009551 Bacteria 4212
156 Ga0105238_10166723 3300009551 Bacteria 2178
157 Ga0105238_10264870 3300009551 Bacteria 1699
158 Ga0105238_11785998 3300009551 Bacteria 647
159 Ga0105238_12051923 3300009551 Bacteria 606
160 Ga0105249_10115777 3300009553 Bacteria 2540
161 Ga0099796_10158076 3300010159 Bacteria 897
162 Ga0105239_10120827 3300010375 Bacteria 2909
163 Ga0105239_10377852 3300010375 Bacteria 1602
164 Ga0105239_11194644 3300010375 Bacteria 876
165 Ga0157343_1013597 3300012488 Bacteria 659
166 Ga0157327_1048120 3300012512 Bacteria 597
167 Ga0157370_10768758 3300013104 Bacteria 877
168 Ga0157369_10004472 3300013105 Bacteria 16469
169 Ga0157369_10549868 3300013105 Bacteria 1193
170 Ga0157369_10729172 3300013105 Bacteria 1020
171 Ga0157369_11123904 3300013105 Bacteria 803
172 Ga0157369_11508075 3300013105 Bacteria 684
173 Ga0157378_11242148 3300013297 Bacteria 785
174 Ga0157372_10614691 3300013307 Bacteria 1267
175 Ga0157372_10889415 3300013307 Bacteria 1033
176 Ga0157375_10185912 3300013308 Bacteria 2231
177 Ga0157375_11127150 3300013308 Bacteria 919
178 Ga0163163_10787807 3300014325 Bacteria 1014
179 Ga0182008_10826181 3300014497 Bacteria 540
180 Ga0157379_10339863 3300014968 Bacteria 1373
181 Ga0157379_11408138 3300014968 Bacteria 676
182 Ga0182005_1051209 3300015265 Bacteria 1123
183 Ga0163161_10364831 3300017792 Bacteria 1151
184 Ga0213872_10080135 3300021361 Bacteria 1467
185 Ga0213872_10224289 3300021361 Bacteria 799
186 Ga0213874_10172863 3300021377 Bacteria 765
187 Ga0213871_10025432 3300021441 Bacteria 1507
188 Ga0224712_10240549 3300022467 Bacteria 834
189 Ga0209563_104549 3300025230 Bacteria 2637
190 Ga0209026_1059060 3300025250 Bacteria 540
191 Ga0209677_102314 3300025253 Bacteria 7319
192 Ga0209677_110139 3300025253 Bacteria 1601
193 Ga0209148_1002066 3300025254 Bacteria 7717
194 Ga0209148_1009174 3300025254 Bacteria 1945
195 Ga0209148_1013448 3300025254 Bacteria 1472
196 Ga0209233_1001936 3300025261 Bacteria 7895
197 Ga0209233_1013958 3300025261 Bacteria 2279
198 Ga0209233_1015125 3300025261 Bacteria 2158
199 Ga0209233_1062092 3300025261 Bacteria 718
200 Ga0209455_1003189 3300025272 Bacteria 5939
201 Ga0209455_1006825 3300025272 Bacteria 3320
202 Ga0209455_1008760 3300025272 Bacteria 2717
203 Ga0209455_1031244 3300025272 Bacteria 897
204 Ga0209673_1023353 3300025273 Bacteria 2108
205 Ga0209758_1002828 3300025297 Bacteria 16872
206 Ga0209758_1020210 3300025297 Bacteria 3164
207 Ga0209758_1061540 3300025297 Bacteria 1235
208 Ga0209758_1099613 3300025297 Bacteria 830
209 Ga0207426_1000554 3300025302 Bacteria 51521
210 Ga0207426_1033367 3300025302 Bacteria 1660
211 Ga0207692_10002116 3300025898 Bacteria 7577
212 Ga0207692_10013635 3300025898 Bacteria 3531
213 Ga0207692_10574845 3300025898 Bacteria 722
214 Ga0207642_10528144 3300025899 Bacteria 726
215 Ga0207710_10013025 3300025900 Bacteria 3504
216 Ga0207710_10726406 3300025900 Bacteria 521
217 Ga0207647_10391597 3300025904 Bacteria 784
218 Ga0207685_10835628 3300025905 Bacteria 509
219 Ga0207699_10000315 3300025906 Bacteria 25846
220 Ga0207699_10047534 3300025906 Bacteria 2517
221 Ga0207699_10050684 3300025906 Bacteria 2449
222 Ga0207699_10754081 3300025906 Bacteria 714
223 Ga0207699_10939505 3300025906 Bacteria 638
224 Ga0207705_10020589 3300025909 Bacteria 4710
225 Ga0207684_10220516 3300025910 Bacteria 1637
226 Ga0207684_10666229 3300025910 Bacteria 886
227 Ga0207654_10054065 3300025911 Bacteria 2320
228 Ga0207654_10143564 3300025911 Bacteria 1525
229 Ga0207707_10003003 3300025912 Bacteria 15004
230 Ga0207707_10020269 3300025912 Bacteria 5805
231 Ga0207707_10074848 3300025912 Bacteria 2954
232 Ga0207707_10199116 3300025912 Bacteria 1746
233 Ga0207695_10000159 3300025913 Bacteria 201367
234 Ga0207695_10040323 3300025913 Bacteria 5009
235 Ga0207695_10223000 3300025913 Bacteria 1792
236 Ga0207695_10381071 3300025913 Bacteria 1296
237 Ga0207695_10997380 3300025913 Bacteria 717
238 Ga0207671_10009635 3300025914 Bacteria 8051
239 Ga0207671_10208772 3300025914 Bacteria 1527
240 Ga0207671_10291144 3300025914 Bacteria 1289
241 Ga0207671_10987300 3300025914 Bacteria 664
242 Ga0207693_10067578 3300025915 Bacteria 2799
243 Ga0207693_10072343 3300025915 Bacteria 2700
244 Ga0207693_10084853 3300025915 Bacteria 2481
245 Ga0207693_10099613 3300025915 Bacteria 2279
246 Ga0207693_10126813 3300025915 Bacteria 2006
247 Ga0207693_10224084 3300025915 Bacteria 1477
248 Ga0207693_11265116 3300025915 Bacteria 553
249 Ga0207663_10007711 3300025916 Bacteria 5601
250 Ga0207663_10015284 3300025916 Bacteria 4232
251 Ga0207663_10089834 3300025916 Bacteria 2035
252 Ga0207660_10014029 3300025917 Bacteria 5260
253 Ga0207660_10059946 3300025917 Bacteria 2734
254 Ga0207660_10074564 3300025917 Bacteria 2477
255 Ga0207657_11506585 3300025919 Bacteria 503
256 Ga0207649_10151666 3300025920 Bacteria 1597
257 Ga0207649_10297216 3300025920 Bacteria 1179
258 Ga0207652_10024806 3300025921 Bacteria 4977
259 Ga0207652_10063173 3300025921 Bacteria 3202
260 Ga0207652_10116314 3300025921 Bacteria 2375
261 Ga0207652_10393946 3300025921 Bacteria 1250
262 Ga0207646_10353045 3300025922 Bacteria 1329
263 Ga0207694_10155708 3300025924 Bacteria 1843
264 Ga0207694_10275885 3300025924 Bacteria 1380
265 Ga0207650_10864416 3300025925 Bacteria 767
266 Ga0207687_10607471 3300025927 Bacteria 922
267 Ga0207700_10164850 3300025928 Bacteria 1843
268 Ga0207700_10231114 3300025928 Bacteria 1572
269 Ga0207700_10878256 3300025928 Bacteria 802
270 Ga0207664_10147379 3300025929 Bacteria 1997
271 Ga0207664_10238564 3300025929 Bacteria 1583
272 Ga0207664_10635689 3300025929 Bacteria 959
273 Ga0207664_10826379 3300025929 Bacteria 833
274 Ga0207664_10975661 3300025929 Bacteria 760
275 Ga0207664_11455069 3300025929 Bacteria 606
276 Ga0207690_11349026 3300025932 Bacteria 596
277 Ga0207690_11735886 3300025932 Bacteria 521
278 Ga0207670_10105640 3300025936 Bacteria 2019
279 Ga0207669_10167327 3300025937 Bacteria 1561
280 Ga0207669_11589605 3300025937 Bacteria 558
281 Ga0207665_10002700 3300025939 Bacteria 11896
282 Ga0207665_10142314 3300025939 Bacteria 1711
283 Ga0207665_10191929 3300025939 Bacteria 1484
284 Ga0207665_10218457 3300025939 Bacteria 1396
285 Ga0207665_10237345 3300025939 Bacteria 1342
286 Ga0207665_11696075 3300025939 Bacteria 500
287 Ga0207691_10298091 3300025940 Bacteria 1385
288 Ga0207689_11337832 3300025942 Bacteria 601
289 Ga0207661_10001748 3300025944 Bacteria 14867
290 Ga0207661_10021847 3300025944 Bacteria 4803
291 Ga0207661_10274622 3300025944 Bacteria 1505
292 Ga0207679_11721239 3300025945 Bacteria 574
293 Ga0207667_10193301 3300025949 Bacteria 2088
294 Ga0207667_10750511 3300025949 Bacteria 975
295 Ga0207667_10760537 3300025949 Bacteria 968
296 Ga0207712_10650275 3300025961 Bacteria 916
297 Ga0207668_11021776 3300025972 Bacteria 739
298 Ga0207677_10145640 3300026023 Bacteria 1820
299 Ga0207677_11995219 3300026023 Bacteria 539
300 Ga0207703_10708173 3300026035 Bacteria 958
301 Ga0207703_10875174 3300026035 Bacteria 860
302 Ga0207639_10326674 3300026041 Bacteria 1363
303 Ga0207639_10869378 3300026041 Bacteria 842
304 Ga0207678_10014792 3300026067 Bacteria 6866
305 Ga0207678_10126136 3300026067 Bacteria 2183
306 Ga0207678_10418597 3300026067 Bacteria 1162
307 Ga0207702_10050876 3300026078 Bacteria 3499
308 Ga0207702_11290538 3300026078 Bacteria 724
309 Ga0207674_10398814 3300026116 Bacteria 1329
310 Ga0207698_10150554 3300026142 Bacteria 2019
311 Ga0207698_10724329 3300026142 Bacteria 991
312 Ga0209589_1000009 3300027357 Bacteria 252104
313 Ga0209489_100010 3300027361 Bacteria 252139
314 Ga0209700_100017 3300027363 Bacteria 252104
315 Ga0268266_10006118 3300028379 Bacteria 11082
316 Ga0268266_11043437 3300028379 Bacteria 791
317 Ga0268264_10000035 3300028381 Bacteria 398196
318 Ga0268264_10801658 3300028381 Bacteria 941
319 Ga0265337_1032248 3300028556 Bacteria 1551
320 Ga0265326_10007542 3300028558 Bacteria 3329
321 Ga0265319_1115109 3300028563 Bacteria 839
322 Ga0265334_10018041 3300028573 Bacteria 2909
323 Ga0265323_10004134 3300028653 Bacteria 6290
324 Ga0265336_10003438 3300028666 Bacteria 6205
325 Ga0307517_10225678 3300028786 Bacteria 1132
326 Ga0265338_10000090 3300028800 Bacteria 171540
327 Ga0265324_10005221 3300029957 Bacteria 5654
328 Ga0265340_10087780 3300031247 Bacteria 1457
329 Ga0265339_10001632 3300031249 Bacteria 16566
330 Ga0307509_10605296 3300031507 Bacteria 768
331 Ga0307508_10329636 3300031616 Bacteria 1118
332 Ga0265314_10036825 3300031711 Bacteria 3551
333 Ga0265342_10061309 3300031712 Bacteria 2216
334 Ga0307507_10285270 3300033179 Bacteria 1028
335 Ga0307510_10070936 3300033180 Bacteria 3474
336 Ga0307510_10202152 3300033180 Bacteria 1520
337 Ga0315911_1000009 3300033442 Bacteria 379354
338 Ga0316215_1007334 3300033544 Bacteria 1074
339 Ga0373926_0038808 3300035083 Bacteria 1697
340 Ga0373923_0090288 3300035111 Bacteria 1339
341 Ga0373932_0209457 3300035112 Bacteria 696
342 Ga0373936_0007135 3300035113 Bacteria 4205
343 Ga0373945_0007221 3300035116 Bacteria 3596
344 Ga0373945_0118007 3300035116 Bacteria 1053
345 Ga0373953_0013490 3300035117 Bacteria 2920
346 Ga0373956_0039292 3300035119 Bacteria 2097
347 Ga0373957_0132180 3300035120 Bacteria 1016
348 Ga0373943_0532355 3300035170 Bacteria 688
349 Ga0373946_0345176 3300035171 Bacteria 743
350 Ga0373955_0217394 3300035172 Bacteria 1140
351 Ga0373924_0063175 3300035410 Bacteria 1552
352 Ga0373931_0860646 3300035691 Bacteria 607
353 Ga0373935_0085127 3300035692 Bacteria 2060
354 Ga0373927_0012627 3300035695 Bacteria 5619
355 Ga0373927_0353439 3300035695 Bacteria 968
356 Ga0373947_0020630 3300035725 Bacteria 3806
357 Ga0373947_0391807 3300035725 Bacteria 936
358 Ga0373925_0043727 3300037068 Bacteria 3325
359 Ga0373925_0401018 3300037068 Bacteria 1119
360 Ga0373925_0449481 3300037068 Bacteria 1055
361 Ga0395899_0203494 3300037312 Bacteria 1379
362 Ga0395900_0541449 3300037418 Bacteria 1110
363 Ga0395900_0760752 3300037418 Bacteria 899
364 Ga0395900_0991803 3300037418 Bacteria 760
365 Ga0395898_0077763 3300037466 Bacteria 3203
366 Ga0395898_0355839 3300037466 Bacteria 1396
367 Ga0395898_1029848 3300037466 Bacteria 758
368 Ga0436364_0461816 3300037853 Bacteria 740
369 Ga0436364_0650502 3300037853 Bacteria 1701
370 Ga0436364_0800350 3300037853 Bacteria 663
371 Ga0436364_1168969 3300037853 Bacteria 1322
372 Ga0436364_1279372 3300037853 Bacteria 942
373 Ga0436364_1328722 3300037853 Bacteria 928
374 Ga0395901_0318003 3300038443 Bacteria 1611
375 Ga0395901_0614328 3300038443 Bacteria 1095
376 Ga0395901_1078275 3300038443 Bacteria 775
377 Ga0436365_0399803 3300039437 Bacteria 2427
378 Ga0436365_1147338 3300039437 Bacteria 2447
379 Ga0436365_1192934 3300039437 Bacteria 1238
380 Ga0436365_1417659 3300039437 Bacteria 6023
381 Ga0436365_1465938 3300039437 Bacteria 822
382 Ga0436365_1574863 3300039437 Bacteria 6668
383 Ga0436365_1588282 3300039437 Bacteria 3274
384 Ga0436365_1719944 3300039437 Bacteria 1071
385 Ga0436360_0439815 3300039438 Bacteria 2074
386 Ga0436361_0005730 3300039447 Bacteria 1990
387 Ga0436361_0408062 3300039447 Bacteria 558
388 Ga0436361_0588307 3300039447 Bacteria 1427
389 Ga0436361_0964350 3300039447 Bacteria 3819
390 Ga0436363_0001281 3300039450 Bacteria 582
391 Ga0436363_1185918 3300039450 Unclassified 674
392 Ga0436363_1197593 3300039450 Bacteria 11839
393 Ga0436363_1289621 3300039450 Bacteria 646
394 Ga0436363_1695442 3300039450 Bacteria 2056
395 Ga0436362_0091420 3300039453 Bacteria 1862
396 Ga0436362_1228228 3300039453 Bacteria 598
397 Ga0439465_0264497 3300041413 Bacteria 638
398 Ga0451787_178466 3300041441 Bacteria 701
399 Ga0451789_0659761 3300041443 Bacteria 1070
400 Ga0451793_0151842 3300041452 Bacteria 1156
401 Ga0451797_0192916 3300041453 Bacteria 659
402 Ga0451795_1541843 3300041456 Bacteria 894
403 Ga0451798_1159997 3300041458 Bacteria 536
404 Ga0451800_1491777 3300041459 Bacteria 911
405 Ga0451807_0643386 3300041486 Bacteria 689
406 Ga0451833_1389546 3300041491 Bacteria 1234
407 Ga0451841_1189247 3300041498 Bacteria 1223
408 Ga0451845_0793463 3300041501 Bacteria 736
409 Ga0451849_0537052 3300041505 Bacteria 1098
410 Ga0451849_0800258 3300041505 Bacteria 568
411 Ga0451843_1451183 3300041509 Bacteria 1094
412 Ga0451853_0006967 3300041512 Bacteria 581
413 Ga0451853_1536047 3300041512 Bacteria 608
414 Ga0439458_0055385 3300042157 Bacteria 984
415 Ga0466969_0051428 3300044656 Bacteria 2028
416 Ga0466969_0090071 3300044656 Bacteria 1455
417 Ga0466969_0309918 3300044656 Bacteria 714
418 Ga0466972_0324608 3300044658 Bacteria 719
419 Ga0466965_0192725 3300044683 Bacteria 1079
420 Ga0466966_0000148 3300044684 Bacteria 44828
421 Ga0466966_0363017 3300044684 Bacteria 870
422 Ga0466961_0000045 3300044693 Bacteria 75331
423 Ga0466963_0508604 3300044694 Bacteria 850
424 Ga0466964_0320659 3300044706 Bacteria 787
425 Ga0466968_0144115 3300044735 Bacteria 1091
426 Ga0466968_0270953 3300044735 Bacteria 810
427 Ga0466968_0512168 3300044735 Bacteria 599
428 Ga0466970_0041917 3300044765 Bacteria 2434
429 Ga0466957_0046207 3300044842 Bacteria 2643
430 Ga0466957_0171848 3300044842 Bacteria 1412
431 Ga0466957_0806972 3300044842 Bacteria 667
432 Ga0466960_0005902 3300044901 Bacteria 4881
433 Ga0466959_0026243 3300045049 Bacteria 4318
434 Ga0466959_0034824 3300045049 Bacteria 3725
435 Ga0466959_0063524 3300045049 Bacteria 2681
436 Ga0466959_0753137 3300045049 Bacteria 652
437 Ga0466959_0978703 3300045049 Bacteria 564
438 Ga0466958_0025670 3300045836 Bacteria 3476
439 Ga0466958_0263577 3300045836 Bacteria 1103
440 Ga0466967_0056127 3300045976 Bacteria 3472
441 Ga0466967_0120706 3300045976 Bacteria 2421
442 Ga0466967_0158785 3300045976 Bacteria 2121
443 Ga0466967_0160607 3300045976 Bacteria 2109
444 Ga0466967_1183710 3300045976 Bacteria 761
445 Ga0466967_1346367 3300045976 Bacteria 711
446 Ga0466967_2088119 3300045976 Bacteria 563
447 Ga0495592_0027692 3300046454 Bacteria 4294
448 Ga0495592_0047449 3300046454 Bacteria 3199
449 Ga0495592_0211247 3300046454 Bacteria 1303
450 Ga0495603_0042719 3300046455 Bacteria 2709
451 Ga0495603_0218121 3300046455 Bacteria 1101
452 Ga0495590_0103066 3300046457 Bacteria 1015
453 Ga0495590_0219190 3300046457 Bacteria 702
454 Ga0495629_0014231 3300046459 Bacteria 5729
455 Ga0495629_0031428 3300046459 Bacteria 3760
456 Ga0495638_0001332 3300046460 Bacteria 22704
457 Ga0495651_0002756 3300046462 Bacteria 13630
458 Ga0495651_0036781 3300046462 Bacteria 3812
459 Ga0495651_0199678 3300046462 Bacteria 1400
460 Ga0495650_0250062 3300046471 Bacteria 603
461 Ga0495580_0007799 3300046472 Bacteria 8574
462 Ga0495582_0059188 3300046473 Bacteria 2114
463 Ga0495582_0272627 3300046473 Bacteria 971
464 Ga0495605_0045599 3300046474 Bacteria 2160
465 Ga0495605_0115806 3300046474 Bacteria 1219
466 Ga0495605_0428220 3300046474 Bacteria 547
467 Ga0495639_0012455 3300046475 Bacteria 3668
468 Ga0495662_0098590 3300046476 Bacteria 1429
469 Ga0495664_0012323 3300046477 Bacteria 4842
470 Ga0495664_0021463 3300046477 Bacteria 3730
471 Ga0495664_0304939 3300046477 Bacteria 961
472 Ga0495584_0382422 3300046491 Bacteria 715
473 Ga0495585_0078413 3300046492 Bacteria 1792
474 Ga0495594_0088179 3300046499 Bacteria 1737
475 Ga0495596_0136349 3300046500 Bacteria 953
476 Ga0495583_0029576 3300046506 Bacteria 2679
477 Ga0495606_0008196 3300046507 Bacteria 9142
478 Ga0495606_0032829 3300046507 Bacteria 3590
479 Ga0495606_0090975 3300046507 Bacteria 1877
480 Ga0495606_0294454 3300046507 Bacteria 882
481 Ga0495606_0364071 3300046507 Bacteria 763
482 Ga0495606_0519846 3300046507 Bacteria 597
483 Ga0495608_0136828 3300046511 Bacteria 1565
484 Ga0495610_0257502 3300046512 Bacteria 688
485 Ga0495618_0018494 3300046514 Bacteria 4278
486 Ga0495618_0450357 3300046514 Bacteria 781
487 Ga0495620_0182866 3300046515 Bacteria 810
488 Ga0495628_0037662 3300046516 Bacteria 3877
489 Ga0495630_0033529 3300046517 Bacteria 3830
490 Ga0495631_0258479 3300046518 Bacteria 742
491 Ga0495632_0033460 3300046519 Bacteria 2639
492 Ga0495632_0435819 3300046519 Bacteria 570
493 Ga0495643_0353690 3300046522 Bacteria 657
494 Ga0495648_0245506 3300046524 Bacteria 867
495 Ga0495666_0216549 3300046526 Bacteria 878
496 Ga0495652_0141107 3300046529 Bacteria 1894
497 Ga0495652_0187304 3300046529 Bacteria 1582
498 Ga0495652_0374054 3300046529 Bacteria 1015
499 Ga0495665_0055978 3300046531 Bacteria 2082
500 Ga0495665_0400982 3300046531 Bacteria 696
501 Ga0495640_0035956 3300046533 Bacteria 3503
502 Ga0495640_0143754 3300046533 Bacteria 1536
503 Ga0495587_0041125 3300046536 Bacteria 2759
504 Ga0495587_0214770 3300046536 Bacteria 1086
505 Ga0495587_0346918 3300046536 Bacteria 828
506 Ga0495609_0114897 3300046538 Bacteria 1160
507 Ga0495645_0012247 3300046543 Bacteria 6040
508 Ga0495645_0048010 3300046543 Bacteria 3110
509 Ga0495645_0097139 3300046543 Bacteria 2098
510 Ga0495622_0014348 3300046557 Bacteria 3679
511 Ga0495622_0049773 3300046557 Bacteria 1945
512 Ga0495667_0011129 3300046559 Bacteria 6088
513 Ga0495667_0170560 3300046559 Bacteria 1398
514 Ga0495656_0617645 3300046615 Bacteria 581
515 Ga0495668_0169718 3300046616 Bacteria 1195
516 Ga0495668_0231377 3300046616 Bacteria 1012
517 Ga0495668_0272419 3300046616 Bacteria 927
518 Ga0495668_0444825 3300046616 Bacteria 713
519 Ga0495668_0715531 3300046616 Bacteria 554
520 Ga0495634_0018388 3300046642 Bacteria 4976
521 Ga0495634_0110688 3300046642 Bacteria 1766
522 Ga0495634_0207216 3300046642 Bacteria 1215
523 Ga0495611_0343166 3300046648 Bacteria 686
524 Ga0495611_0368552 3300046648 Bacteria 658
525 Ga0495625_0216740 3300046660 Bacteria 1256
526 Ga0495635_0002298 3300046663 Bacteria 12991
527 Ga0495635_0013798 3300046663 Bacteria 5652
528 Ga0495635_0029275 3300046663 Bacteria 3829
529 Ga0495661_0145996 3300046665 Bacteria 1282
530 Ga0495588_0060545 3300046674 Bacteria 1960
531 Ga0495588_0268211 3300046674 Bacteria 899
532 Ga0495588_0281054 3300046674 Bacteria 877
533 Ga0495657_0022916 3300046675 Bacteria 4469
534 Ga0495657_0167099 3300046675 Bacteria 1357
535 Ga0495599_0032251 3300046678 Bacteria 3289
536 Ga0495599_0108663 3300046678 Bacteria 1728
537 Ga0495599_0129163 3300046678 Bacteria 1570
538 Ga0495623_0023052 3300046679 Bacteria 4018
539 Ga0495623_0279055 3300046679 Bacteria 930
540 Ga0495623_0422635 3300046679 Bacteria 714
541 Ga0495623_0458024 3300046679 Bacteria 678
542 Ga0495646_0174087 3300046680 Bacteria 1184
543 Ga0495646_0462732 3300046680 Bacteria 654
544 Ga0495646_0573629 3300046680 Bacteria 575
545 Ga0495647_0009374 3300046681 Bacteria 3315
546 Ga0495613_0067020 3300046689 Bacteria 2620
547 Ga0495613_0198088 3300046689 Bacteria 1417
548 Ga0495624_0131750 3300046690 Bacteria 1533
549 Ga0495624_0253329 3300046690 Bacteria 1064
550 Ga0495624_0458513 3300046690 Bacteria 763
551 Ga0495649_0293063 3300046694 Bacteria 830
552 Ga0495649_0408977 3300046694 Bacteria 680
553 Ga0495589_0577925 3300046794 Bacteria 512
554 Ga0495600_0003039 3300046809 Bacteria 9798
555 Ga0495600_0024800 3300046809 Bacteria 3861
556 Ga0495581_0007776 3300047315 Bacteria 6205
557 Ga0495581_0080484 3300047315 Bacteria 1886
558 Ga0495581_0319226 3300047315 Bacteria 908
559 Ga0495604_0014335 3300047317 Bacteria 6322
560 Ga0495604_0019497 3300047317 Bacteria 5428
561 Ga0495674_0052668 3300047319 Bacteria 3580
562 Ga0495674_0073484 3300047319 Bacteria 2947
563 Ga0495674_0929769 3300047319 Bacteria 670
564 Ga0495672_0012285 3300047320 Bacteria 5988
565 Ga0495676_0085046 3300047321 Bacteria 2384
566 Ga0495676_0095867 3300047321 Bacteria 2207
567 Ga0495676_0255984 3300047321 Bacteria 1192
568 Ga0495680_0007085 3300047322 Bacteria 10329
569 Ga0495683_0239028 3300047323 Bacteria 802
570 Ga0495683_0457668 3300047323 Bacteria 523
571 Ga0495675_0072238 3300047444 Bacteria 2177
572 Ga0495675_0146152 3300047444 Bacteria 1463
573 Ga0495681_0150735 3300047470 Bacteria 976
574 Ga0495684_0036735 3300047471 Bacteria 3755
575 Ga0495684_0071406 3300047471 Bacteria 2638
576 Ga0495686_0231638 3300047472 Bacteria 1046
577 Ga0495686_0420691 3300047472 Bacteria 714
578 Ga0495686_0560167 3300047472 Bacteria 596
579 Ga0495593_0013204 3300047673 Bacteria 4715
580 Ga0495602_0015884 3300048088 Bacteria 7584
581 Ga0495602_0034597 3300048088 Bacteria 4725
582 Ga0495614_0039759 3300048089 Bacteria 2019
583 Ga0495614_0244400 3300048089 Bacteria 820
584 Ga0495614_0293709 3300048089 Bacteria 750
585 Ga0495626_0140350 3300048091 Bacteria 1025
586 Ga0496100_1161820 3300048903 Bacteria 609
587 Ga0496101_0052301 3300048904 Bacteria 2945
588 Ga0496101_0064292 3300048904 Bacteria 2672
589 Ga0496101_0081153 3300048904 Bacteria 2398
590 Ga0496102_0147670 3300048905 Bacteria 2207
591 Ga0496102_0357400 3300048905 Bacteria 1375
592 Ga0496102_0655760 3300048905 Bacteria 973
593 Ga0496102_1264348 3300048905 Bacteria 657
594 Ga0496103_0620992 3300048906 Bacteria 688
595 Ga0496104_0049423 3300048907 Bacteria 3966
596 Ga0496104_0141371 3300048907 Bacteria 2312
597 Ga0496105_0139527 3300048908 Bacteria 1996
598 Ga0496105_0222692 3300048908 Bacteria 1535
599 Ga0496106_0171154 3300048909 Bacteria 1721
600 Ga0496107_0095167 3300048910 Bacteria 2179
601 Ga0496107_1161031 3300048910 Bacteria 556
602 Ga0496108_0310517 3300048911 Bacteria 1374
603 Ga0496109_0067095 3300048912 Bacteria 3286
604 Ga0496109_0992796 3300048912 Bacteria 777
605 Ga0496109_1278036 3300048912 Bacteria 670
606 Ga0496110_0244427 3300048913 Bacteria 1633
607 Ga0496112_0137081 3300048915 Bacteria 2417
608 Ga0496112_0786888 3300048915 Bacteria 876
609 Ga0496112_1395113 3300048915 Bacteria 615
610 Ga0496113_0028986 3300048916 Bacteria 3990
611 Ga0496113_1421190 3300048916 Bacteria 537
612 Ga0496114_0193028 3300048917 Bacteria 1782
613 Ga0496114_0216090 3300048917 Bacteria 1682
614 Ga0496114_0348196 3300048917 Bacteria 1310
615 Ga0496114_0527651 3300048917 Bacteria 1044
616 Ga0496114_1326720 3300048917 Bacteria 606
617 Ga0496115_0039815 3300048918 Bacteria 3734
618 Ga0496115_0054012 3300048918 Bacteria 3225
619 Ga0496115_0456518 3300048918 Bacteria 1031
620 Ga0496115_0957754 3300048918 Bacteria 657
621 Ga0496117_0527390 3300048920 Bacteria 567
622 Ga0496118_0017685 3300048921 Bacteria 6473
623 Ga0496118_0080594 3300048921 Bacteria 2290
624 Ga0496118_0119897 3300048921 Bacteria 1718
625 Ga0496118_0216743 3300048921 Bacteria 1118
626 Ga0496118_0402353 3300048921 Bacteria 711
627 Ga0496118_0417420 3300048921 Bacteria 691
628 Ga0496118_0557337 3300048921 Bacteria 557
629 Ga0496119_0056800 3300048922 Bacteria 2369
630 Ga0496119_0078070 3300048922 Bacteria 1916
631 Ga0496119_0096146 3300048922 Bacteria 1672
632 Ga0496120_0012481 3300048923 Bacteria 5782
633 Ga0496120_0071732 3300048923 Bacteria 1901
634 Ga0496121_0011029 3300048924 Bacteria 10085
635 Ga0496121_0027200 3300048924 Bacteria 5359
636 Ga0496121_0041977 3300048924 Bacteria 3987
637 Ga0496121_0070640 3300048924 Bacteria 2811
638 Ga0496121_0088016 3300048924 Bacteria 2436
639 Ga0496121_0106840 3300048924 Bacteria 2145
640 Ga0496121_0125596 3300048924 Bacteria 1929
641 Ga0496121_0162284 3300048924 Bacteria 1633
642 Ga0496121_0257056 3300048924 Unclassified 1208
643 Ga0496121_0270203 3300048924 Bacteria 1169
644 Ga0496121_0369381 3300048924 Bacteria 949
645 Ga0496121_0497139 3300048924 Bacteria 775
646 Ga0496121_0889166 3300048924 Bacteria 514
647 Ga0496124_0121600 3300048927 Bacteria 2085
648 Ga0496125_0020779 3300048928 Bacteria 6152
649 Ga0496125_0139007 3300048928 Bacteria 1692
650 Ga0496125_0414100 3300048928 Bacteria 783
651 Ga0496125_0511366 3300048928 Bacteria 673
652 Ga0496126_0006044 3300048929 Bacteria 13590
653 Ga0496126_0010346 3300048929 Bacteria 9790
654 Ga0496126_0012447 3300048929 Bacteria 8712
655 Ga0496126_0033259 3300048929 Bacteria 4851
656 Ga0496126_0033486 3300048929 Bacteria 4833
657 Ga0496126_0034403 3300048929 Bacteria 4759
658 Ga0496126_0040294 3300048929 Bacteria 4330
659 Ga0496126_0049559 3300048929 Bacteria 3833
660 Ga0496126_0129637 3300048929 Bacteria 2180
661 Ga0496126_0170867 3300048929 Bacteria 1852
662 Ga0496126_0258403 3300048929 Bacteria 1449
663 Ga0496126_0264308 3300048929 Bacteria 1430
664 Ga0496126_0812435 3300048929 Bacteria 716
665 Ga0495682_0061224 3300049460 Bacteria 1359
666 Ga0495682_0172501 3300049460 Bacteria 769
667 Ga0501038_1141649 3300049574 Bacteria 568
668 Ga0501042_0194997 3300049578 Bacteria 1461
669 Ga0501046_0021119 3300049580 Bacteria 5376
670 Ga0501047_0031979 3300049581 Bacteria 5077
671 Ga0501047_0116330 3300049581 Bacteria 2556
672 Ga0501069_0685407 3300049585 Bacteria 618
673 Ga0501070_0105780 3300049586 Bacteria 2326
674 Ga0501072_0528042 3300049588 Bacteria 933
675 Ga0501073_0015955 3300049589 Bacteria 5444
676 Ga0501074_0203836 3300049590 Bacteria 1409
677 Ga0501074_0280050 3300049590 Bacteria 1186
678 Ga0501075_0632536 3300049591 Bacteria 816
679 Ga0501079_0474412 3300049741 Bacteria 983
680 Ga0501080_0041543 3300049742 Bacteria 4284
681 Ga0501044_0087765 3300049823 Bacteria 3141
682 nmdc:mga03n38_742784_c1 3300050490 Bacteria 568
683 nmdc:mga0yw44_1155299_c1 3300050492 Bacteria 523
684 nmdc:mga0yw44_744273_c1 3300050492 Bacteria 666
685 nmdc:mga0yw44_92596_c1 3300050492 Bacteria 1913
686 nmdc:mga0k408_852420_c1 3300050493 Bacteria 530
687 nmdc:mga06z11_259770_c1 3300050494 Bacteria 1024
688 nmdc:mga06z11_451687_c1 3300050494 Bacteria 776
689 nmdc:mga06z11_507109_c1 3300050494 Bacteria 731
690 nmdc:mga07m45_436820_c1 3300050496 Bacteria 759
691 nmdc:mga05p37_868371_c1 3300050507 Bacteria 977
692 nmdc:mga05p37_951465_c1 3300050507 Bacteria 919
693 nmdc:mga09592_970432_c1 3300050508 Bacteria 712
694 nmdc:mga0qj67_29991_c1 3300050509 Bacteria 4229
695 nmdc:mga0qj67_682466_c1 3300050509 Bacteria 818
696 nmdc:mga06r32_474004_c1 3300050510 Bacteria 1230
697 nmdc:mga0n895_1429636_c1 3300050512 Bacteria 659
698 nmdc:mga0n895_19638_c1 3300050512 Bacteria 6283
699 nmdc:mga0n895_538749_c1 3300050512 Bacteria 1174
700 nmdc:mga0rr50_192567_c1 3300050513 Bacteria 1672
701 nmdc:mga08x19_361605_c1 3300050514 Bacteria 1014
702 nmdc:mga08x19_863764_c1 3300050514 Bacteria 643
703 nmdc:mga0sz30_66336_c1 3300050516 Bacteria 1548
704 Ga0495601_0016093 3300053077 Bacteria 4527
705 Ga0495601_0031359 3300053077 Bacteria 3303
706 Ga0495612_0008064 3300053078 Bacteria 4286
707 Ga0495612_0009799 3300053078 Bacteria 3881
708 Ga0495619_0736266 3300053085 Bacteria 669
709 Ga0500578_0090652 3300053086 Bacteria 1940
710 Ga0500643_000107 3300053087 Bacteria 87031
711 Ga0500644_0422921 3300053088 Bacteria 582
712 Ga0500647_0062748 3300053091 Bacteria 1788
713 Ga0500647_0212007 3300053091 Bacteria 872
714 Ga0500583_0086346 3300053092 Bacteria 1522
715 Ga0500651_0355034 3300053093 Bacteria 831
716 Ga0500566_0000020 3300053094 Bacteria 83462
717 Ga0500566_0000060 3300053094 Bacteria 52549
718 Ga0500640_000957 3300053095 Bacteria 8166
719 Ga0500641_0017005 3300053096 Bacteria 2713
720 Ga0500650_0176256 3300053098 Bacteria 981
721 Ga0500555_001044 3300053103 Bacteria 9342
722 Ga0500557_000044 3300053105 Bacteria 62934
723 Ga0500562_012892 3300053108 Bacteria 2128
724 Ga0500569_050689 3300053109 Bacteria 1252
725 Ga0500572_000882 3300053111 Bacteria 9311
726 Ga0500591_032819 3300053115 Bacteria 2499
727 Ga0500592_034349 3300053116 Bacteria 818
728 Ga0500594_0283166 3300053118 Bacteria 554
729 Ga0500597_423676 3300053120 Bacteria 501
730 Ga0500608_013703 3300053122 Bacteria 3600
731 Ga0500614_003566 3300053123 Bacteria 3343
732 Ga0500621_009720 3300053126 Bacteria 3291
733 Ga0500642_0000331 3300053130 Bacteria 16256
734 Ga0500642_0081674 3300053130 Bacteria 1485
735 Ga0500642_0107400 3300053130 Bacteria 1302
736 Ga0500655_026577 3300053133 Bacteria 1102
737 Ga0500658_0045241 3300053134 Bacteria 1779
738 Ga0500559_0003043 3300053136 Bacteria 8381
739 Ga0500568_0297792 3300053139 Bacteria 585
740 Ga0500590_163355 3300053148 Bacteria 989
741 Ga0500603_002834 3300053150 Bacteria 3759
742 Ga0500604_0075476 3300053151 Bacteria 1082
743 Ga0500622_0228238 3300053156 Bacteria 830
744 Ga0500627_0044839 3300053158 Bacteria 1911
745 Ga0500630_001295 3300053159 Bacteria 11762
746 Ga0500634_0212888 3300053161 Bacteria 837
747 Ga0500638_114977 3300053162 Bacteria 1238
748 Ga0500639_000111 3300053163 Bacteria 38862
749 Ga0500636_0423586 3300053177 Bacteria 610
750 Ga0500637_0334705 3300053178 Bacteria 812
751 Ga0500637_0487462 3300053178 Bacteria 615
752 Ga0500611_018768 3300053727 Bacteria 1281
753 Ga0500645_025821 3300053730 Bacteria 1790
754 Ga0500609_005383 3300053731 Bacteria 1750
755 Ga0500656_030098 3300053732 Bacteria 718
756 Ga0500596_000483 3300053735 Bacteria 7448
757 Ga0500599_001356 3300053736 Bacteria 2797
758 Ga0500601_006752 3300053737 Bacteria 1267
759 Ga0500601_012566 3300053737 Bacteria 956
760 Ga0501084_0598187 3300054114 Bacteria 932
761 Ga0500661_025822 3300055283 Bacteria 1039
762 Ga0500661_035515 3300055283 Bacteria 881
763 Ga0501082_0544926 3300060353 Bacteria 1015

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050509 nmdc:mga0qj67_29991_c1 nmdc:mga0qj67_29991_c1_3288_3587 98
2 3300050510 nmdc:mga06r32_474004_c1 nmdc:mga06r32_474004_c1_326_625 98
3 3300050509 nmdc:mga0qj67_682466_c1 nmdc:mga0qj67_682466_c1_50_382 101
4 3300006844 Ga0075428_100143208 Ga0075428_1001432082 107
5 3300006880 Ga0075429_100292881 Ga0075429_1002928813 107
6 3300009147 Ga0114129_10467601 Ga0114129_104676012 107
7 3300037853 Ga0436364_1328722 Ga0436364_1328722_587_910 107
8 3300050507 nmdc:mga05p37_868371_c1 nmdc:mga05p37_868371_c1_35_361 107
9 3300050508 nmdc:mga09592_970432_c1 nmdc:mga09592_970432_c1_15_341 107
10 3300050512 nmdc:mga0n895_1429636_c1 nmdc:mga0n895_1429636_c1_183_509 107
11 3300022467 Ga0224712_10240549 Ga0224712_102405492 108
12 3300026035 Ga0207703_10875174 Ga0207703_108751742 108
13 3300037418 Ga0395900_0541449 Ga0395900_0541449_662_988 108
14 3300038443 Ga0395901_1078275 Ga0395901_1078275_109_435 108
15 3300045976 Ga0466967_0160607 Ga0466967_0160607_143_469 108
16 3300048929 Ga0496126_0010346 Ga0496126_0010346_9309_9635 108
17 3300049581 Ga0501047_0116330 Ga0501047_0116330_684_1010 108
18 3300003215 JGI25153J46596_10011545 JGI25153J46596_100115454 109
19 3300003659 JGI25404J52841_10017661 JGI25404J52841_100176612 109
20 3300003752 Ga0055539_1006952 Ga0055539_10069522 109
21 3300003752 Ga0055539_1016086 Ga0055539_10160862 109
22 3300003763 Ga0055529_1007379 Ga0055529_10073792 109
23 3300003763 Ga0055529_1010709 Ga0055529_10107092 109
24 3300004625 Ga0055543_1002361 Ga0055543_10023616 109
25 3300005262 Ga0065165_1001366 Ga0065165_100136613 109
26 3300005329 Ga0070683_100001091 Ga0070683_1000010917 109
27 3300005329 Ga0070683_100078984 Ga0070683_1000789845 109
28 3300005329 Ga0070683_100684631 Ga0070683_1006846312 109
29 3300005330 Ga0070690_101116830 Ga0070690_1011168301 109
30 3300005334 Ga0068869_100880982 Ga0068869_1008809821 109
31 3300005336 Ga0070680_100023865 Ga0070680_10002386510 109
32 3300005336 Ga0070680_100085052 Ga0070680_1000850522 109
33 3300005336 Ga0070680_100215066 Ga0070680_1002150662 109
34 3300005336 Ga0070680_101016737 Ga0070680_1010167371 109
35 3300005337 Ga0070682_100083502 Ga0070682_1000835022 109
36 3300005339 Ga0070660_100212284 Ga0070660_1002122844 109
37 3300005340 Ga0070689_100854667 Ga0070689_1008546672 109
38 3300005344 Ga0070661_100144372 Ga0070661_1001443721 109
39 3300005344 Ga0070661_100930286 Ga0070661_1009302861 109
40 3300005345 Ga0070692_10261919 Ga0070692_102619192 109
41 3300005356 Ga0070674_100311255 Ga0070674_1003112553 109
42 3300005366 Ga0070659_100897916 Ga0070659_1008979162 109
43 3300005366 Ga0070659_101815773 Ga0070659_1018157731 109
44 3300005367 Ga0070667_101231163 Ga0070667_1012311631 109
45 3300005434 Ga0070709_10000506 Ga0070709_1000050620 109
46 3300005434 Ga0070709_10033960 Ga0070709_100339604 109
47 3300005434 Ga0070709_10035149 Ga0070709_100351493 109
48 3300005434 Ga0070709_10069538 Ga0070709_100695381 109
49 3300005434 Ga0070709_10702764 Ga0070709_107027642 109
50 3300005435 Ga0070714_100081400 Ga0070714_1000814003 109
51 3300005435 Ga0070714_100085927 Ga0070714_1000859272 109
52 3300005435 Ga0070714_100222922 Ga0070714_1002229222 109
53 3300005435 Ga0070714_100421337 Ga0070714_1004213372 109
54 3300005435 Ga0070714_100903387 Ga0070714_1009033872 109
55 3300005435 Ga0070714_101537560 Ga0070714_1015375601 109
56 3300005436 Ga0070713_100096627 Ga0070713_1000966273 109
57 3300005436 Ga0070713_101317952 Ga0070713_1013179521 109
58 3300005436 Ga0070713_101599403 Ga0070713_1015994031 109
59 3300005437 Ga0070710_10000386 Ga0070710_100003867 109
60 3300005437 Ga0070710_10012971 Ga0070710_100129716 109
61 3300005437 Ga0070710_10092974 Ga0070710_100929742 109
62 3300005437 Ga0070710_10236766 Ga0070710_102367662 109
63 3300005437 Ga0070710_10809886 Ga0070710_108098861 109
64 3300005439 Ga0070711_100001793 Ga0070711_1000017939 109
65 3300005439 Ga0070711_100003655 Ga0070711_10000365511 109
66 3300005439 Ga0070711_100042708 Ga0070711_1000427084 109
67 3300005439 Ga0070711_100056795 Ga0070711_1000567953 109
68 3300005455 Ga0070663_100012418 Ga0070663_1000124188 109
69 3300005455 Ga0070663_100098505 Ga0070663_1000985053 109
70 3300005456 Ga0070678_100527122 Ga0070678_1005271222 109
71 3300005458 Ga0070681_10061117 Ga0070681_100611174 109
72 3300005458 Ga0070681_10313939 Ga0070681_103139392 109
73 3300005459 Ga0068867_100822610 Ga0068867_1008226102 109
74 3300005467 Ga0070706_100180140 Ga0070706_1001801401 109
75 3300005468 Ga0070707_100156508 Ga0070707_1001565082 109
76 3300005471 Ga0070698_100051487 Ga0070698_1000514874 109
77 3300005530 Ga0070679_100063720 Ga0070679_1000637202 109
78 3300005530 Ga0070679_100717197 Ga0070679_1007171972 109
79 3300005535 Ga0070684_100003496 Ga0070684_1000034968 109
80 3300005539 Ga0068853_100183234 Ga0068853_1001832342 109
81 3300005539 Ga0068853_100677614 Ga0068853_1006776142 109
82 3300005546 Ga0070696_100619003 Ga0070696_1006190032 109
83 3300005546 Ga0070696_100880073 Ga0070696_1008800731 109
84 3300005547 Ga0070693_100227443 Ga0070693_1002274431 109
85 3300005547 Ga0070693_100353269 Ga0070693_1003532692 109
86 3300005548 Ga0070665_100006302 Ga0070665_10000630210 109
87 3300005548 Ga0070665_101205470 Ga0070665_1012054701 109
88 3300005563 Ga0068855_100441185 Ga0068855_1004411852 109
89 3300005563 Ga0068855_100638667 Ga0068855_1006386672 109
90 3300005563 Ga0068855_102388722 Ga0068855_1023887221 109
91 3300005564 Ga0070664_100279403 Ga0070664_1002794032 109
92 3300005564 Ga0070664_100619026 Ga0070664_1006190262 109
93 3300005564 Ga0070664_101137325 Ga0070664_1011373251 109
94 3300005577 Ga0068857_100264617 Ga0068857_1002646172 109
95 3300005578 Ga0068854_101007940 Ga0068854_1010079401 109
96 3300005578 Ga0068854_101679508 Ga0068854_1016795082 109
97 3300005578 Ga0068854_101696403 Ga0068854_1016964032 109
98 3300005614 Ga0068856_100263678 Ga0068856_1002636782 109
99 3300005614 Ga0068856_101728778 Ga0068856_1017287782 109
100 3300005615 Ga0070702_101422355 Ga0070702_1014223551 109
101 3300005616 Ga0068852_100005466 Ga0068852_1000054669 109
102 3300005616 Ga0068852_100751317 Ga0068852_1007513171 109
103 3300005834 Ga0068851_10227274 Ga0068851_102272742 109
104 3300005842 Ga0068858_100596856 Ga0068858_1005968562 109
105 3300005843 Ga0068860_100005261 Ga0068860_10000526118 109
106 3300005844 Ga0068862_100240875 Ga0068862_1002408753 109
107 3300005937 Ga0081455_10084249 Ga0081455_100842495 109
108 3300005937 Ga0081455_10163243 Ga0081455_101632432 109
109 3300005937 Ga0081455_10604115 Ga0081455_106041151 109
110 3300005981 Ga0081538_10106975 Ga0081538_101069752 109
111 3300005983 Ga0081540_1006012 Ga0081540_10060128 109
112 3300005983 Ga0081540_1035235 Ga0081540_10352356 109
113 3300005983 Ga0081540_1123080 Ga0081540_11230801 109
114 3300005983 Ga0081540_1193445 Ga0081540_11934452 109
115 3300005985 Ga0081539_10159673 Ga0081539_101596732 109
116 3300006028 Ga0070717_10505300 Ga0070717_105053002 109
117 3300006028 Ga0070717_10536428 Ga0070717_105364281 109
118 3300006028 Ga0070717_10936873 Ga0070717_109368732 109
119 3300006028 Ga0070717_11117202 Ga0070717_111172021 109
120 3300006038 Ga0075365_10341276 Ga0075365_103412762 109
121 3300006038 Ga0075365_10614342 Ga0075365_106143422 109
122 3300006163 Ga0070715_10033216 Ga0070715_100332161 109
123 3300006163 Ga0070715_10156144 Ga0070715_101561441 109
124 3300006163 Ga0070715_10320039 Ga0070715_103200392 109
125 3300006173 Ga0070716_100043612 Ga0070716_1000436122 109
126 3300006173 Ga0070716_100121674 Ga0070716_1001216742 109
127 3300006173 Ga0070716_100533944 Ga0070716_1005339442 109
128 3300006173 Ga0070716_100854919 Ga0070716_1008549191 109
129 3300006173 Ga0070716_100988140 Ga0070716_1009881401 109
130 3300006175 Ga0070712_100022303 Ga0070712_1000223035 109
131 3300006175 Ga0070712_100107729 Ga0070712_1001077293 109
132 3300006175 Ga0070712_100132676 Ga0070712_1001326763 109
133 3300006175 Ga0070712_100264784 Ga0070712_1002647842 109
134 3300006175 Ga0070712_100929321 Ga0070712_1009293212 109
135 3300006177 Ga0075362_10698864 Ga0075362_106988641 109
136 3300006178 Ga0075367_10383702 Ga0075367_103837022 109
137 3300006178 Ga0075367_10399631 Ga0075367_103996312 109
138 3300006178 Ga0075367_10662857 Ga0075367_106628572 109
139 3300006186 Ga0075369_10102379 Ga0075369_101023792 109
140 3300006237 Ga0097621_100108355 Ga0097621_1001083553 109
141 3300006237 Ga0097621_100118406 Ga0097621_1001184064 109
142 3300006358 Ga0068871_100603932 Ga0068871_1006039322 109
143 3300006846 Ga0075430_100248516 Ga0075430_1002485162 109
144 3300006871 Ga0075434_100132227 Ga0075434_1001322274 109
145 3300006871 Ga0075434_100321514 Ga0075434_1003215142 109
146 3300006881 Ga0068865_100490091 Ga0068865_1004900912 109
147 3300006881 Ga0068865_101062033 Ga0068865_1010620332 109
148 3300006914 Ga0075436_100754517 Ga0075436_1007545172 109
149 3300006914 Ga0075436_100953109 Ga0075436_1009531092 109
150 3300006931 Ga0097620_100054666 Ga0097620_1000546668 109
151 3300006942 Ga0099824_1019902 Ga0099824_10199023 109
152 3300006943 Ga0099822_1002329 Ga0099822_100232917 109
153 3300007076 Ga0075435_100143718 Ga0075435_1001437183 109
154 3300007076 Ga0075435_100166504 Ga0075435_1001665043 109
155 3300009093 Ga0105240_10006604 Ga0105240_1000660410 109
156 3300009093 Ga0105240_10217193 Ga0105240_102171933 109
157 3300009093 Ga0105240_10307893 Ga0105240_103078932 109
158 3300009098 Ga0105245_12944567 Ga0105245_129445671 109
159 3300009101 Ga0105247_10456416 Ga0105247_104564162 109
160 3300009147 Ga0114129_10881302 Ga0114129_108813022 109
161 3300009174 Ga0105241_10031780 Ga0105241_100317805 109
162 3300009545 Ga0105237_10003458 Ga0105237_1000345813 109
163 3300009545 Ga0105237_10041450 Ga0105237_100414502 109
164 3300009545 Ga0105237_10338295 Ga0105237_103382952 109
165 3300009545 Ga0105237_10610375 Ga0105237_106103752 109
166 3300009545 Ga0105237_11261460 Ga0105237_112614601 109
167 3300009545 Ga0105237_12232160 Ga0105237_122321602 109
168 3300009545 Ga0105237_12455687 Ga0105237_124556871 109
169 3300009551 Ga0105238_10049933 Ga0105238_100499333 109
170 3300009551 Ga0105238_10166723 Ga0105238_101667233 109
171 3300009551 Ga0105238_10264870 Ga0105238_102648701 109
172 3300009551 Ga0105238_11785998 Ga0105238_117859981 109
173 3300009551 Ga0105238_12051923 Ga0105238_120519232 109
174 3300009553 Ga0105249_10115777 Ga0105249_101157773 109
175 3300010159 Ga0099796_10158076 Ga0099796_101580762 109
176 3300010375 Ga0105239_10120827 Ga0105239_101208273 109
177 3300010375 Ga0105239_10377852 Ga0105239_103778522 109
178 3300010375 Ga0105239_11194644 Ga0105239_111946442 109
179 3300012488 Ga0157343_1013597 Ga0157343_10135972 109
180 3300012512 Ga0157327_1048120 Ga0157327_10481201 109
181 3300013104 Ga0157370_10768758 Ga0157370_107687581 109
182 3300013105 Ga0157369_10004472 Ga0157369_1000447212 109
183 3300013105 Ga0157369_10549868 Ga0157369_105498682 109
184 3300013105 Ga0157369_10729172 Ga0157369_107291722 109
185 3300013105 Ga0157369_11123904 Ga0157369_111239042 109
186 3300013105 Ga0157369_11508075 Ga0157369_115080751 109
187 3300013297 Ga0157378_11242148 Ga0157378_112421482 109
188 3300013307 Ga0157372_10614691 Ga0157372_106146912 109
189 3300013307 Ga0157372_10889415 Ga0157372_108894152 109
190 3300013308 Ga0157375_10185912 Ga0157375_101859124 109
191 3300013308 Ga0157375_11127150 Ga0157375_111271501 109
192 3300014325 Ga0163163_10787807 Ga0163163_107878072 109
193 3300014497 Ga0182008_10826181 Ga0182008_108261811 109
194 3300014968 Ga0157379_10339863 Ga0157379_103398632 109
195 3300014968 Ga0157379_11408138 Ga0157379_114081382 109
196 3300015265 Ga0182005_1051209 Ga0182005_10512092 109
197 3300017792 Ga0163161_10364831 Ga0163161_103648311 109
198 3300021361 Ga0213872_10080135 Ga0213872_100801352 109
199 3300021361 Ga0213872_10224289 Ga0213872_102242892 109
200 3300021377 Ga0213874_10172863 Ga0213874_101728631 109
201 3300021441 Ga0213871_10025432 Ga0213871_100254321 109
202 3300025230 Ga0209563_104549 Ga0209563_1045493 109
203 3300025250 Ga0209026_1059060 Ga0209026_10590601 109
204 3300025253 Ga0209677_102314 Ga0209677_1023147 109
205 3300025253 Ga0209677_110139 Ga0209677_1101392 109
206 3300025254 Ga0209148_1002066 Ga0209148_10020665 109
207 3300025254 Ga0209148_1009174 Ga0209148_10091744 109
208 3300025254 Ga0209148_1013448 Ga0209148_10134482 109
209 3300025261 Ga0209233_1001936 Ga0209233_10019366 109
210 3300025261 Ga0209233_1013958 Ga0209233_10139583 109
211 3300025261 Ga0209233_1015125 Ga0209233_10151254 109
212 3300025261 Ga0209233_1062092 Ga0209233_10620921 109
213 3300025272 Ga0209455_1003189 Ga0209455_10031895 109
214 3300025272 Ga0209455_1006825 Ga0209455_10068252 109
215 3300025272 Ga0209455_1008760 Ga0209455_10087603 109
216 3300025272 Ga0209455_1031244 Ga0209455_10312442 109
217 3300025273 Ga0209673_1023353 Ga0209673_10233535 109
218 3300025297 Ga0209758_1002828 Ga0209758_10028286 109
219 3300025297 Ga0209758_1020210 Ga0209758_10202103 109
220 3300025297 Ga0209758_1061540 Ga0209758_10615401 109
221 3300025297 Ga0209758_1099613 Ga0209758_10996132 109
222 3300025302 Ga0207426_1000554 Ga0207426_100055453 109
223 3300025302 Ga0207426_1033367 Ga0207426_10333673 109
224 3300025898 Ga0207692_10002116 Ga0207692_100021166 109
225 3300025898 Ga0207692_10013635 Ga0207692_100136351 109
226 3300025898 Ga0207692_10574845 Ga0207692_105748451 109
227 3300025899 Ga0207642_10528144 Ga0207642_105281442 109
228 3300025900 Ga0207710_10013025 Ga0207710_100130251 109
229 3300025900 Ga0207710_10726406 Ga0207710_107264061 109
230 3300025904 Ga0207647_10391597 Ga0207647_103915971 109
231 3300025905 Ga0207685_10835628 Ga0207685_108356281 109
232 3300025906 Ga0207699_10000315 Ga0207699_1000031521 109
233 3300025906 Ga0207699_10047534 Ga0207699_100475341 109
234 3300025906 Ga0207699_10050684 Ga0207699_100506842 109
235 3300025906 Ga0207699_10754081 Ga0207699_107540812 109
236 3300025906 Ga0207699_10939505 Ga0207699_109395052 109
237 3300025909 Ga0207705_10020589 Ga0207705_100205892 109
238 3300025910 Ga0207684_10220516 Ga0207684_102205162 109
239 3300025910 Ga0207684_10666229 Ga0207684_106662291 109
240 3300025911 Ga0207654_10054065 Ga0207654_100540652 109
241 3300025911 Ga0207654_10143564 Ga0207654_101435642 109
242 3300025912 Ga0207707_10003003 Ga0207707_100030034 109
243 3300025912 Ga0207707_10020269 Ga0207707_100202692 109
244 3300025912 Ga0207707_10074848 Ga0207707_100748484 109
245 3300025912 Ga0207707_10199116 Ga0207707_101991161 109
246 3300025913 Ga0207695_10000159 Ga0207695_100001591 109
247 3300025913 Ga0207695_10040323 Ga0207695_100403234 109
248 3300025913 Ga0207695_10223000 Ga0207695_102230001 109
249 3300025913 Ga0207695_10381071 Ga0207695_103810712 109
250 3300025913 Ga0207695_10997380 Ga0207695_109973801 109
251 3300025914 Ga0207671_10009635 Ga0207671_100096359 109
252 3300025914 Ga0207671_10208772 Ga0207671_102087723 109
253 3300025914 Ga0207671_10291144 Ga0207671_102911442 109
254 3300025914 Ga0207671_10987300 Ga0207671_109873001 109
255 3300025915 Ga0207693_10067578 Ga0207693_100675782 109
256 3300025915 Ga0207693_10072343 Ga0207693_100723434 109
257 3300025915 Ga0207693_10084853 Ga0207693_100848534 109
258 3300025915 Ga0207693_10099613 Ga0207693_100996132 109
259 3300025915 Ga0207693_10126813 Ga0207693_101268132 109
260 3300025915 Ga0207693_10224084 Ga0207693_102240843 109
261 3300025915 Ga0207693_11265116 Ga0207693_112651162 109
262 3300025916 Ga0207663_10007711 Ga0207663_100077114 109
263 3300025916 Ga0207663_10015284 Ga0207663_100152843 109
264 3300025916 Ga0207663_10089834 Ga0207663_100898344 109
265 3300025917 Ga0207660_10014029 Ga0207660_100140293 109
266 3300025917 Ga0207660_10059946 Ga0207660_100599464 109
267 3300025917 Ga0207660_10074564 Ga0207660_100745643 109
268 3300025919 Ga0207657_11506585 Ga0207657_115065851 109
269 3300025920 Ga0207649_10151666 Ga0207649_101516662 109
270 3300025920 Ga0207649_10297216 Ga0207649_102972161 109
271 3300025921 Ga0207652_10024806 Ga0207652_100248063 109
272 3300025921 Ga0207652_10063173 Ga0207652_100631733 109
273 3300025921 Ga0207652_10116314 Ga0207652_101163145 109
274 3300025921 Ga0207652_10393946 Ga0207652_103939462 109
275 3300025922 Ga0207646_10353045 Ga0207646_103530453 109
276 3300025924 Ga0207694_10155708 Ga0207694_101557082 109
277 3300025924 Ga0207694_10275885 Ga0207694_102758851 109
278 3300025925 Ga0207650_10864416 Ga0207650_108644162 109
279 3300025927 Ga0207687_10607471 Ga0207687_106074711 109
280 3300025928 Ga0207700_10164850 Ga0207700_101648502 109
281 3300025928 Ga0207700_10231114 Ga0207700_102311141 109
282 3300025928 Ga0207700_10878256 Ga0207700_108782562 109
283 3300025929 Ga0207664_10147379 Ga0207664_101473794 109
284 3300025929 Ga0207664_10238564 Ga0207664_102385642 109
285 3300025929 Ga0207664_10635689 Ga0207664_106356891 109
286 3300025929 Ga0207664_10826379 Ga0207664_108263792 109
287 3300025929 Ga0207664_10975661 Ga0207664_109756611 109
288 3300025929 Ga0207664_11455069 Ga0207664_114550691 109
289 3300025932 Ga0207690_11349026 Ga0207690_113490261 109
290 3300025932 Ga0207690_11735886 Ga0207690_117358861 109
291 3300025936 Ga0207670_10105640 Ga0207670_101056401 109
292 3300025937 Ga0207669_10167327 Ga0207669_101673272 109
293 3300025937 Ga0207669_11589605 Ga0207669_115896051 109
294 3300025939 Ga0207665_10002700 Ga0207665_100027009 109
295 3300025939 Ga0207665_10142314 Ga0207665_101423143 109
296 3300025939 Ga0207665_10191929 Ga0207665_101919292 109
297 3300025939 Ga0207665_10218457 Ga0207665_102184572 109
298 3300025939 Ga0207665_10237345 Ga0207665_102373452 109
299 3300025939 Ga0207665_11696075 Ga0207665_116960751 109
300 3300025940 Ga0207691_10298091 Ga0207691_102980912 109
301 3300025942 Ga0207689_11337832 Ga0207689_113378321 109
302 3300025944 Ga0207661_10001748 Ga0207661_1000174813 109
303 3300025944 Ga0207661_10021847 Ga0207661_100218475 109
304 3300025944 Ga0207661_10274622 Ga0207661_102746224 109
305 3300025945 Ga0207679_11721239 Ga0207679_117212392 109
306 3300025949 Ga0207667_10193301 Ga0207667_101933012 109
307 3300025949 Ga0207667_10750511 Ga0207667_107505111 109
308 3300025949 Ga0207667_10760537 Ga0207667_107605372 109
309 3300025961 Ga0207712_10650275 Ga0207712_106502752 109
310 3300025972 Ga0207668_11021776 Ga0207668_110217762 109
311 3300026023 Ga0207677_10145640 Ga0207677_101456402 109
312 3300026023 Ga0207677_11995219 Ga0207677_119952191 109
313 3300026035 Ga0207703_10708173 Ga0207703_107081731 109
314 3300026041 Ga0207639_10326674 Ga0207639_103266743 109
315 3300026041 Ga0207639_10869378 Ga0207639_108693782 109
316 3300026067 Ga0207678_10014792 Ga0207678_100147928 109
317 3300026067 Ga0207678_10126136 Ga0207678_101261361 109
318 3300026067 Ga0207678_10418597 Ga0207678_104185972 109
319 3300026078 Ga0207702_10050876 Ga0207702_100508764 109
320 3300026078 Ga0207702_11290538 Ga0207702_112905381 109
321 3300026116 Ga0207674_10398814 Ga0207674_103988142 109
322 3300026142 Ga0207698_10150554 Ga0207698_101505543 109
323 3300026142 Ga0207698_10724329 Ga0207698_107243292 109
324 3300027357 Ga0209589_1000009 Ga0209589_1000009226 109
325 3300027361 Ga0209489_100010 Ga0209489_10001044 109
326 3300027363 Ga0209700_100017 Ga0209700_10001744 109
327 3300028379 Ga0268266_10006118 Ga0268266_100061186 109
328 3300028379 Ga0268266_11043437 Ga0268266_110434372 109
329 3300028381 Ga0268264_10000035 Ga0268264_10000035238 109
330 3300028381 Ga0268264_10801658 Ga0268264_108016582 109
331 3300028556 Ga0265337_1032248 Ga0265337_10322484 109
332 3300028558 Ga0265326_10007542 Ga0265326_100075422 109
333 3300028563 Ga0265319_1115109 Ga0265319_11151091 109
334 3300028573 Ga0265334_10018041 Ga0265334_100180414 109
335 3300028653 Ga0265323_10004134 Ga0265323_100041347 109
336 3300028666 Ga0265336_10003438 Ga0265336_100034386 109
337 3300028786 Ga0307517_10225678 Ga0307517_102256781 109
338 3300028800 Ga0265338_10000090 Ga0265338_1000009058 109
339 3300029957 Ga0265324_10005221 Ga0265324_100052216 109
340 3300031247 Ga0265340_10087780 Ga0265340_100877802 109
341 3300031249 Ga0265339_10001632 Ga0265339_1000163214 109
342 3300031507 Ga0307509_10605296 Ga0307509_106052962 109
343 3300031616 Ga0307508_10329636 Ga0307508_103296362 109
344 3300031711 Ga0265314_10036825 Ga0265314_100368254 109
345 3300031712 Ga0265342_10061309 Ga0265342_100613092 109
346 3300033179 Ga0307507_10285270 Ga0307507_102852702 109
347 3300033180 Ga0307510_10070936 Ga0307510_100709364 109
348 3300033180 Ga0307510_10202152 Ga0307510_102021522 109
349 3300033442 Ga0315911_1000009 Ga0315911_1000009348 109
350 3300033544 Ga0316215_1007334 Ga0316215_10073341 109
351 3300035083 Ga0373926_0038808 Ga0373926_0038808_223_552 109
352 3300035111 Ga0373923_0090288 Ga0373923_0090288_175_504 109
353 3300035112 Ga0373932_0209457 Ga0373932_0209457_30_359 109
354 3300035113 Ga0373936_0007135 Ga0373936_0007135_1153_1482 109
355 3300035116 Ga0373945_0007221 Ga0373945_0007221_1969_2298 109
356 3300035116 Ga0373945_0118007 Ga0373945_0118007_561_890 109
357 3300035117 Ga0373953_0013490 Ga0373953_0013490_1448_1777 109
358 3300035119 Ga0373956_0039292 Ga0373956_0039292_1701_2030 109
359 3300035120 Ga0373957_0132180 Ga0373957_0132180_600_929 109
360 3300035170 Ga0373943_0532355 Ga0373943_0532355_165_494 109
361 3300035171 Ga0373946_0345176 Ga0373946_0345176_161_490 109
362 3300035172 Ga0373955_0217394 Ga0373955_0217394_770_1099 109
363 3300035410 Ga0373924_0063175 Ga0373924_0063175_388_717 109
364 3300035691 Ga0373931_0860646 Ga0373931_0860646_99_428 109
365 3300035692 Ga0373935_0085127 Ga0373935_0085127_1550_1879 109
366 3300035695 Ga0373927_0012627 Ga0373927_0012627_4933_5262 109
367 3300035695 Ga0373927_0353439 Ga0373927_0353439_523_852 109
368 3300035725 Ga0373947_0020630 Ga0373947_0020630_620_949 109
369 3300035725 Ga0373947_0391807 Ga0373947_0391807_306_635 109
370 3300037068 Ga0373925_0043727 Ga0373925_0043727_1257_1586 109
371 3300037068 Ga0373925_0401018 Ga0373925_0401018_222_551 109
372 3300037068 Ga0373925_0449481 Ga0373925_0449481_182_511 109
373 3300037312 Ga0395899_0203494 Ga0395899_0203494_944_1273 109
374 3300037418 Ga0395900_0760752 Ga0395900_0760752_320_649 109
375 3300037418 Ga0395900_0991803 Ga0395900_0991803_281_610 109
376 3300037466 Ga0395898_0077763 Ga0395898_0077763_639_968 109
377 3300037466 Ga0395898_0355839 Ga0395898_0355839_990_1319 109
378 3300037466 Ga0395898_1029848 Ga0395898_1029848_301_696 109
379 3300037853 Ga0436364_0461816 Ga0436364_0461816_387_716 109
380 3300037853 Ga0436364_0650502 Ga0436364_0650502_1246_1575 109
381 3300037853 Ga0436364_0800350 Ga0436364_0800350_46_375 109
382 3300037853 Ga0436364_1168969 Ga0436364_1168969_125_454 109
383 3300037853 Ga0436364_1279372 Ga0436364_1279372_579_908 109
384 3300038443 Ga0395901_0318003 Ga0395901_0318003_667_996 109
385 3300038443 Ga0395901_0614328 Ga0395901_0614328_619_948 109
386 3300039437 Ga0436365_0399803 Ga0436365_0399803_511_909 109
387 3300039437 Ga0436365_1147338 Ga0436365_1147338_1681_2010 109
388 3300039437 Ga0436365_1192934 Ga0436365_1192934_180_509 109
389 3300039437 Ga0436365_1417659 Ga0436365_1417659_3794_4123 109
390 3300039437 Ga0436365_1465938 Ga0436365_1465938_305_637 109
391 3300039437 Ga0436365_1574863 Ga0436365_1574863_79_408 109
392 3300039437 Ga0436365_1588282 Ga0436365_1588282_71_400 109
393 3300039437 Ga0436365_1719944 Ga0436365_1719944_311_640 109
394 3300039438 Ga0436360_0439815 Ga0436360_0439815_1179_1508 109
395 3300039447 Ga0436361_0005730 Ga0436361_0005730_1402_1731 109
396 3300039447 Ga0436361_0408062 Ga0436361_0408062_153_482 109
397 3300039447 Ga0436361_0588307 Ga0436361_0588307_237_566 109
398 3300039447 Ga0436361_0964350 Ga0436361_0964350_2406_2735 109
399 3300039450 Ga0436363_0001281 Ga0436363_0001281_27_428 109
400 3300039450 Ga0436363_1185918 Ga0436363_1185918_241_579 109
401 3300039450 Ga0436363_1197593 Ga0436363_1197593_4083_4412 109
402 3300039450 Ga0436363_1289621 Ga0436363_1289621_74_463 109
403 3300039450 Ga0436363_1695442 Ga0436363_1695442_1134_1463 109
404 3300039453 Ga0436362_0091420 Ga0436362_0091420_499_828 109
405 3300039453 Ga0436362_1228228 Ga0436362_1228228_158_487 109
406 3300041413 Ga0439465_0264497 Ga0439465_0264497_192_521 109
407 3300041441 Ga0451787_178466 Ga0451787_178466_332_661 109
408 3300041443 Ga0451789_0659761 Ga0451789_0659761_432_761 109
409 3300041452 Ga0451793_0151842 Ga0451793_0151842_561_890 109
410 3300041453 Ga0451797_0192916 Ga0451797_0192916_38_367 109
411 3300041456 Ga0451795_1541843 Ga0451795_1541843_306_635 109
412 3300041458 Ga0451798_1159997 Ga0451798_1159997_119_448 109
413 3300041459 Ga0451800_1491777 Ga0451800_1491777_295_624 109
414 3300041486 Ga0451807_0643386 Ga0451807_0643386_10_339 109
415 3300041491 Ga0451833_1389546 Ga0451833_1389546_332_661 109
416 3300041498 Ga0451841_1189247 Ga0451841_1189247_251_580 109
417 3300041501 Ga0451845_0793463 Ga0451845_0793463_241_570 109
418 3300041505 Ga0451849_0537052 Ga0451849_0537052_702_1031 109
419 3300041505 Ga0451849_0800258 Ga0451849_0800258_149_478 109
420 3300041509 Ga0451843_1451183 Ga0451843_1451183_381_710 109
421 3300041512 Ga0451853_0006967 Ga0451853_0006967_36_365 109
422 3300041512 Ga0451853_1536047 Ga0451853_1536047_136_465 109
423 3300042157 Ga0439458_0055385 Ga0439458_0055385_178_507 109
424 3300044656 Ga0466969_0051428 Ga0466969_0051428_1055_1384 109
425 3300044656 Ga0466969_0090071 Ga0466969_0090071_652_981 109
426 3300044656 Ga0466969_0309918 Ga0466969_0309918_192_521 109
427 3300044658 Ga0466972_0324608 Ga0466972_0324608_35_364 109
428 3300044683 Ga0466965_0192725 Ga0466965_0192725_365_694 109
429 3300044684 Ga0466966_0000148 Ga0466966_0000148_1714_2043 109
430 3300044684 Ga0466966_0363017 Ga0466966_0363017_514_843 109
431 3300044693 Ga0466961_0000045 Ga0466961_0000045_33056_33385 109
432 3300044694 Ga0466963_0508604 Ga0466963_0508604_197_592 109
433 3300044706 Ga0466964_0320659 Ga0466964_0320659_12_341 109
434 3300044735 Ga0466968_0144115 Ga0466968_0144115_263_592 109
435 3300044735 Ga0466968_0270953 Ga0466968_0270953_456_785 109
436 3300044735 Ga0466968_0512168 Ga0466968_0512168_27_356 109
437 3300044765 Ga0466970_0041917 Ga0466970_0041917_665_994 109
438 3300044842 Ga0466957_0046207 Ga0466957_0046207_183_512 109
439 3300044842 Ga0466957_0171848 Ga0466957_0171848_918_1247 109
440 3300044842 Ga0466957_0806972 Ga0466957_0806972_132_461 109
441 3300044901 Ga0466960_0005902 Ga0466960_0005902_396_725 109
442 3300045049 Ga0466959_0026243 Ga0466959_0026243_1889_2218 109
443 3300045049 Ga0466959_0034824 Ga0466959_0034824_349_678 109
444 3300045049 Ga0466959_0063524 Ga0466959_0063524_565_894 109
445 3300045049 Ga0466959_0753137 Ga0466959_0753137_39_368 109
446 3300045049 Ga0466959_0978703 Ga0466959_0978703_82_411 109
447 3300045836 Ga0466958_0025670 Ga0466958_0025670_3127_3456 109
448 3300045836 Ga0466958_0263577 Ga0466958_0263577_757_1086 109
449 3300045976 Ga0466967_0056127 Ga0466967_0056127_1966_2295 109
450 3300045976 Ga0466967_0120706 Ga0466967_0120706_364_693 109
451 3300045976 Ga0466967_0158785 Ga0466967_0158785_763_1092 109
452 3300045976 Ga0466967_1183710 Ga0466967_1183710_313_642 109
453 3300045976 Ga0466967_1346367 Ga0466967_1346367_347_676 109
454 3300045976 Ga0466967_2088119 Ga0466967_2088119_172_501 109
455 3300046454 Ga0495592_0027692 Ga0495592_0027692_1050_1379 109
456 3300046454 Ga0495592_0047449 Ga0495592_0047449_625_954 109
457 3300046454 Ga0495592_0211247 Ga0495592_0211247_468_797 109
458 3300046455 Ga0495603_0042719 Ga0495603_0042719_2206_2535 109
459 3300046455 Ga0495603_0218121 Ga0495603_0218121_611_940 109
460 3300046457 Ga0495590_0103066 Ga0495590_0103066_345_674 109
461 3300046457 Ga0495590_0219190 Ga0495590_0219190_343_672 109
462 3300046459 Ga0495629_0014231 Ga0495629_0014231_4516_4845 109
463 3300046459 Ga0495629_0031428 Ga0495629_0031428_2446_2775 109
464 3300046460 Ga0495638_0001332 Ga0495638_0001332_295_624 109
465 3300046462 Ga0495651_0002756 Ga0495651_0002756_10254_10583 109
466 3300046462 Ga0495651_0036781 Ga0495651_0036781_448_777 109
467 3300046462 Ga0495651_0199678 Ga0495651_0199678_373_702 109
468 3300046471 Ga0495650_0250062 Ga0495650_0250062_165_494 109
469 3300046472 Ga0495580_0007799 Ga0495580_0007799_2424_2753 109
470 3300046473 Ga0495582_0059188 Ga0495582_0059188_489_818 109
471 3300046473 Ga0495582_0272627 Ga0495582_0272627_358_687 109
472 3300046474 Ga0495605_0045599 Ga0495605_0045599_1484_1813 109
473 3300046474 Ga0495605_0115806 Ga0495605_0115806_422_751 109
474 3300046474 Ga0495605_0428220 Ga0495605_0428220_37_366 109
475 3300046475 Ga0495639_0012455 Ga0495639_0012455_513_842 109
476 3300046476 Ga0495662_0098590 Ga0495662_0098590_186_515 109
477 3300046477 Ga0495664_0012323 Ga0495664_0012323_2352_2681 109
478 3300046477 Ga0495664_0021463 Ga0495664_0021463_603_932 109
479 3300046477 Ga0495664_0304939 Ga0495664_0304939_433_762 109
480 3300046491 Ga0495584_0382422 Ga0495584_0382422_114_443 109
481 3300046492 Ga0495585_0078413 Ga0495585_0078413_962_1291 109
482 3300046499 Ga0495594_0088179 Ga0495594_0088179_146_475 109
483 3300046500 Ga0495596_0136349 Ga0495596_0136349_320_649 109
484 3300046506 Ga0495583_0029576 Ga0495583_0029576_461_790 109
485 3300046507 Ga0495606_0008196 Ga0495606_0008196_6333_6662 109
486 3300046507 Ga0495606_0032829 Ga0495606_0032829_3083_3412 109
487 3300046507 Ga0495606_0090975 Ga0495606_0090975_949_1278 109
488 3300046507 Ga0495606_0294454 Ga0495606_0294454_299_628 109
489 3300046507 Ga0495606_0364071 Ga0495606_0364071_192_521 109
490 3300046507 Ga0495606_0519846 Ga0495606_0519846_207_536 109
491 3300046511 Ga0495608_0136828 Ga0495608_0136828_366_695 109
492 3300046512 Ga0495610_0257502 Ga0495610_0257502_99_428 109
493 3300046514 Ga0495618_0018494 Ga0495618_0018494_187_516 109
494 3300046514 Ga0495618_0450357 Ga0495618_0450357_243_572 109
495 3300046515 Ga0495620_0182866 Ga0495620_0182866_351_680 109
496 3300046516 Ga0495628_0037662 Ga0495628_0037662_290_619 109
497 3300046517 Ga0495630_0033529 Ga0495630_0033529_1280_1609 109
498 3300046518 Ga0495631_0258479 Ga0495631_0258479_244_573 109
499 3300046519 Ga0495632_0033460 Ga0495632_0033460_1303_1632 109
500 3300046519 Ga0495632_0435819 Ga0495632_0435819_53_382 109
501 3300046522 Ga0495643_0353690 Ga0495643_0353690_218_547 109
502 3300046524 Ga0495648_0245506 Ga0495648_0245506_120_449 109
503 3300046526 Ga0495666_0216549 Ga0495666_0216549_268_597 109
504 3300046529 Ga0495652_0141107 Ga0495652_0141107_692_1021 109
505 3300046529 Ga0495652_0187304 Ga0495652_0187304_553_882 109
506 3300046529 Ga0495652_0374054 Ga0495652_0374054_522_851 109
507 3300046531 Ga0495665_0055978 Ga0495665_0055978_919_1248 109
508 3300046531 Ga0495665_0400982 Ga0495665_0400982_158_487 109
509 3300046533 Ga0495640_0035956 Ga0495640_0035956_222_551 109
510 3300046533 Ga0495640_0143754 Ga0495640_0143754_1124_1453 109
511 3300046536 Ga0495587_0041125 Ga0495587_0041125_1173_1502 109
512 3300046536 Ga0495587_0214770 Ga0495587_0214770_431_760 109
513 3300046536 Ga0495587_0346918 Ga0495587_0346918_131_460 109
514 3300046538 Ga0495609_0114897 Ga0495609_0114897_505_834 109
515 3300046543 Ga0495645_0012247 Ga0495645_0012247_4312_4641 109
516 3300046543 Ga0495645_0048010 Ga0495645_0048010_435_764 109
517 3300046543 Ga0495645_0097139 Ga0495645_0097139_56_385 109
518 3300046557 Ga0495622_0014348 Ga0495622_0014348_456_785 109
519 3300046557 Ga0495622_0049773 Ga0495622_0049773_1037_1366 109
520 3300046559 Ga0495667_0011129 Ga0495667_0011129_1114_1443 109
521 3300046559 Ga0495667_0170560 Ga0495667_0170560_557_886 109
522 3300046615 Ga0495656_0617645 Ga0495656_0617645_167_496 109
523 3300046616 Ga0495668_0169718 Ga0495668_0169718_251_580 109
524 3300046616 Ga0495668_0231377 Ga0495668_0231377_34_363 109
525 3300046616 Ga0495668_0272419 Ga0495668_0272419_367_696 109
526 3300046616 Ga0495668_0444825 Ga0495668_0444825_352_681 109
527 3300046616 Ga0495668_0715531 Ga0495668_0715531_21_350 109
528 3300046642 Ga0495634_0018388 Ga0495634_0018388_3345_3674 109
529 3300046642 Ga0495634_0110688 Ga0495634_0110688_766_1095 109
530 3300046642 Ga0495634_0207216 Ga0495634_0207216_407_736 109
531 3300046648 Ga0495611_0343166 Ga0495611_0343166_212_541 109
532 3300046648 Ga0495611_0368552 Ga0495611_0368552_77_406 109
533 3300046660 Ga0495625_0216740 Ga0495625_0216740_324_653 109
534 3300046663 Ga0495635_0002298 Ga0495635_0002298_7250_7579 109
535 3300046663 Ga0495635_0013798 Ga0495635_0013798_1446_1775 109
536 3300046663 Ga0495635_0029275 Ga0495635_0029275_966_1295 109
537 3300046665 Ga0495661_0145996 Ga0495661_0145996_553_882 109
538 3300046674 Ga0495588_0060545 Ga0495588_0060545_792_1121 109
539 3300046674 Ga0495588_0268211 Ga0495588_0268211_334_663 109
540 3300046674 Ga0495588_0281054 Ga0495588_0281054_333_662 109
541 3300046675 Ga0495657_0022916 Ga0495657_0022916_3367_3696 109
542 3300046675 Ga0495657_0167099 Ga0495657_0167099_830_1159 109
543 3300046678 Ga0495599_0032251 Ga0495599_0032251_1266_1595 109
544 3300046678 Ga0495599_0108663 Ga0495599_0108663_324_653 109
545 3300046678 Ga0495599_0129163 Ga0495599_0129163_821_1150 109
546 3300046679 Ga0495623_0023052 Ga0495623_0023052_908_1237 109
547 3300046679 Ga0495623_0279055 Ga0495623_0279055_517_846 109
548 3300046679 Ga0495623_0422635 Ga0495623_0422635_162_491 109
549 3300046679 Ga0495623_0458024 Ga0495623_0458024_197_526 109
550 3300046680 Ga0495646_0174087 Ga0495646_0174087_50_379 109
551 3300046680 Ga0495646_0462732 Ga0495646_0462732_161_490 109
552 3300046680 Ga0495646_0573629 Ga0495646_0573629_191_520 109
553 3300046681 Ga0495647_0009374 Ga0495647_0009374_159_488 109
554 3300046689 Ga0495613_0067020 Ga0495613_0067020_786_1115 109
555 3300046689 Ga0495613_0198088 Ga0495613_0198088_164_493 109
556 3300046690 Ga0495624_0131750 Ga0495624_0131750_1011_1340 109
557 3300046690 Ga0495624_0253329 Ga0495624_0253329_164_493 109
558 3300046690 Ga0495624_0458513 Ga0495624_0458513_180_509 109
559 3300046694 Ga0495649_0293063 Ga0495649_0293063_141_470 109
560 3300046694 Ga0495649_0408977 Ga0495649_0408977_196_525 109
561 3300046794 Ga0495589_0577925 Ga0495589_0577925_157_486 109
562 3300046809 Ga0495600_0003039 Ga0495600_0003039_7848_8177 109
563 3300046809 Ga0495600_0024800 Ga0495600_0024800_1673_2002 109
564 3300047315 Ga0495581_0007776 Ga0495581_0007776_2839_3168 109
565 3300047315 Ga0495581_0080484 Ga0495581_0080484_231_560 109
566 3300047315 Ga0495581_0319226 Ga0495581_0319226_228_557 109
567 3300047317 Ga0495604_0014335 Ga0495604_0014335_1349_1678 109
568 3300047317 Ga0495604_0019497 Ga0495604_0019497_649_978 109
569 3300047319 Ga0495674_0052668 Ga0495674_0052668_919_1248 109
570 3300047319 Ga0495674_0073484 Ga0495674_0073484_1711_2040 109
571 3300047319 Ga0495674_0929769 Ga0495674_0929769_10_339 109
572 3300047320 Ga0495672_0012285 Ga0495672_0012285_5358_5687 109
573 3300047321 Ga0495676_0085046 Ga0495676_0085046_53_382 109
574 3300047321 Ga0495676_0095867 Ga0495676_0095867_1463_1792 109
575 3300047321 Ga0495676_0255984 Ga0495676_0255984_191_520 109
576 3300047322 Ga0495680_0007085 Ga0495680_0007085_833_1162 109
577 3300047323 Ga0495683_0239028 Ga0495683_0239028_383_712 109
578 3300047323 Ga0495683_0457668 Ga0495683_0457668_61_390 109
579 3300047444 Ga0495675_0072238 Ga0495675_0072238_1250_1579 109
580 3300047444 Ga0495675_0146152 Ga0495675_0146152_1101_1430 109
581 3300047470 Ga0495681_0150735 Ga0495681_0150735_454_783 109
582 3300047471 Ga0495684_0036735 Ga0495684_0036735_1257_1586 109
583 3300047471 Ga0495684_0071406 Ga0495684_0071406_1490_1819 109
584 3300047472 Ga0495686_0231638 Ga0495686_0231638_382_711 109
585 3300047472 Ga0495686_0420691 Ga0495686_0420691_327_656 109
586 3300047472 Ga0495686_0560167 Ga0495686_0560167_112_441 109
587 3300047673 Ga0495593_0013204 Ga0495593_0013204_3480_3809 109
588 3300048088 Ga0495602_0015884 Ga0495602_0015884_587_916 109
589 3300048088 Ga0495602_0034597 Ga0495602_0034597_3294_3623 109
590 3300048089 Ga0495614_0039759 Ga0495614_0039759_744_1073 109
591 3300048089 Ga0495614_0244400 Ga0495614_0244400_335_664 109
592 3300048089 Ga0495614_0293709 Ga0495614_0293709_149_478 109
593 3300048091 Ga0495626_0140350 Ga0495626_0140350_641_970 109
594 3300048903 Ga0496100_1161820 Ga0496100_1161820_57_386 109
595 3300048904 Ga0496101_0052301 Ga0496101_0052301_304_633 109
596 3300048904 Ga0496101_0064292 Ga0496101_0064292_2317_2646 109
597 3300048904 Ga0496101_0081153 Ga0496101_0081153_740_1069 109
598 3300048905 Ga0496102_0147670 Ga0496102_0147670_1830_2159 109
599 3300048905 Ga0496102_0357400 Ga0496102_0357400_906_1235 109
600 3300048905 Ga0496102_0655760 Ga0496102_0655760_463_864 109
601 3300048905 Ga0496102_1264348 Ga0496102_1264348_262_591 109
602 3300048906 Ga0496103_0620992 Ga0496103_0620992_314_643 109
603 3300048907 Ga0496104_0049423 Ga0496104_0049423_1471_1800 109
604 3300048907 Ga0496104_0141371 Ga0496104_0141371_1842_2171 109
605 3300048908 Ga0496105_0139527 Ga0496105_0139527_672_1001 109
606 3300048908 Ga0496105_0222692 Ga0496105_0222692_661_990 109
607 3300048909 Ga0496106_0171154 Ga0496106_0171154_1205_1534 109
608 3300048910 Ga0496107_0095167 Ga0496107_0095167_20_349 109
609 3300048910 Ga0496107_1161031 Ga0496107_1161031_115_516 109
610 3300048911 Ga0496108_0310517 Ga0496108_0310517_1012_1341 109
611 3300048912 Ga0496109_0067095 Ga0496109_0067095_1624_1953 109
612 3300048912 Ga0496109_0992796 Ga0496109_0992796_22_351 109
613 3300048912 Ga0496109_1278036 Ga0496109_1278036_162_491 109
614 3300048913 Ga0496110_0244427 Ga0496110_0244427_221_550 109
615 3300048915 Ga0496112_0137081 Ga0496112_0137081_29_358 109
616 3300048915 Ga0496112_0786888 Ga0496112_0786888_333_662 109
617 3300048915 Ga0496112_1395113 Ga0496112_1395113_116_445 109
618 3300048916 Ga0496113_0028986 Ga0496113_0028986_441_770 109
619 3300048916 Ga0496113_1421190 Ga0496113_1421190_141_470 109
620 3300048917 Ga0496114_0193028 Ga0496114_0193028_113_442 109
621 3300048917 Ga0496114_0216090 Ga0496114_0216090_838_1167 109
622 3300048917 Ga0496114_0348196 Ga0496114_0348196_557_886 109
623 3300048917 Ga0496114_0527651 Ga0496114_0527651_324_665 109
624 3300048917 Ga0496114_1326720 Ga0496114_1326720_221_550 109
625 3300048918 Ga0496115_0039815 Ga0496115_0039815_858_1187 109
626 3300048918 Ga0496115_0054012 Ga0496115_0054012_2557_2886 109
627 3300048918 Ga0496115_0456518 Ga0496115_0456518_420_749 109
628 3300048918 Ga0496115_0957754 Ga0496115_0957754_283_612 109
629 3300048920 Ga0496117_0527390 Ga0496117_0527390_178_522 109
630 3300048921 Ga0496118_0017685 Ga0496118_0017685_493_822 109
631 3300048921 Ga0496118_0080594 Ga0496118_0080594_166_495 109
632 3300048921 Ga0496118_0119897 Ga0496118_0119897_113_442 109
633 3300048921 Ga0496118_0216743 Ga0496118_0216743_397_726 109
634 3300048921 Ga0496118_0402353 Ga0496118_0402353_85_414 109
635 3300048921 Ga0496118_0417420 Ga0496118_0417420_175_504 109
636 3300048921 Ga0496118_0557337 Ga0496118_0557337_181_510 109
637 3300048922 Ga0496119_0056800 Ga0496119_0056800_1495_1824 109
638 3300048922 Ga0496119_0078070 Ga0496119_0078070_842_1171 109
639 3300048922 Ga0496119_0096146 Ga0496119_0096146_95_424 109
640 3300048923 Ga0496120_0012481 Ga0496120_0012481_1745_2074 109
641 3300048923 Ga0496120_0071732 Ga0496120_0071732_176_505 109
642 3300048924 Ga0496121_0011029 Ga0496121_0011029_5098_5427 109
643 3300048924 Ga0496121_0027200 Ga0496121_0027200_262_591 109
644 3300048924 Ga0496121_0041977 Ga0496121_0041977_2106_2435 109
645 3300048924 Ga0496121_0070640 Ga0496121_0070640_2130_2459 109
646 3300048924 Ga0496121_0088016 Ga0496121_0088016_377_706 109
647 3300048924 Ga0496121_0106840 Ga0496121_0106840_1426_1755 109
648 3300048924 Ga0496121_0125596 Ga0496121_0125596_704_1033 109
649 3300048924 Ga0496121_0162284 Ga0496121_0162284_870_1199 109
650 3300048924 Ga0496121_0257056 Ga0496121_0257056_617_946 109
651 3300048924 Ga0496121_0270203 Ga0496121_0270203_351_680 109
652 3300048924 Ga0496121_0369381 Ga0496121_0369381_248_577 109
653 3300048924 Ga0496121_0497139 Ga0496121_0497139_112_441 109
654 3300048924 Ga0496121_0889166 Ga0496121_0889166_159_488 109
655 3300048927 Ga0496124_0121600 Ga0496124_0121600_1038_1367 109
656 3300048928 Ga0496125_0020779 Ga0496125_0020779_901_1230 109
657 3300048928 Ga0496125_0139007 Ga0496125_0139007_125_454 109
658 3300048928 Ga0496125_0414100 Ga0496125_0414100_413_742 109
659 3300048928 Ga0496125_0511366 Ga0496125_0511366_159_488 109
660 3300048929 Ga0496126_0006044 Ga0496126_0006044_5794_6123 109
661 3300048929 Ga0496126_0012447 Ga0496126_0012447_421_750 109
662 3300048929 Ga0496126_0033259 Ga0496126_0033259_1843_2172 109
663 3300048929 Ga0496126_0033486 Ga0496126_0033486_4422_4751 109
664 3300048929 Ga0496126_0034403 Ga0496126_0034403_1033_1362 109
665 3300048929 Ga0496126_0040294 Ga0496126_0040294_3083_3412 109
666 3300048929 Ga0496126_0049559 Ga0496126_0049559_463_792 109
667 3300048929 Ga0496126_0129637 Ga0496126_0129637_1742_2071 109
668 3300048929 Ga0496126_0170867 Ga0496126_0170867_566_895 109
669 3300048929 Ga0496126_0258403 Ga0496126_0258403_688_1017 109
670 3300048929 Ga0496126_0264308 Ga0496126_0264308_803_1144 109
671 3300048929 Ga0496126_0812435 Ga0496126_0812435_324_653 109
672 3300049460 Ga0495682_0061224 Ga0495682_0061224_91_420 109
673 3300049460 Ga0495682_0172501 Ga0495682_0172501_127_456 109
674 3300049574 Ga0501038_1141649 Ga0501038_1141649_117_509 109
675 3300049578 Ga0501042_0194997 Ga0501042_0194997_953_1285 109
676 3300049580 Ga0501046_0021119 Ga0501046_0021119_975_1367 109
677 3300049581 Ga0501047_0031979 Ga0501047_0031979_119_511 109
678 3300049585 Ga0501069_0685407 Ga0501069_0685407_247_576 109
679 3300049586 Ga0501070_0105780 Ga0501070_0105780_43_435 109
680 3300049588 Ga0501072_0528042 Ga0501072_0528042_357_719 109
681 3300049589 Ga0501073_0015955 Ga0501073_0015955_3582_3974 109
682 3300049590 Ga0501074_0203836 Ga0501074_0203836_271_663 109
683 3300049590 Ga0501074_0280050 Ga0501074_0280050_680_1042 109
684 3300049591 Ga0501075_0632536 Ga0501075_0632536_355_687 109
685 3300049741 Ga0501079_0474412 Ga0501079_0474412_155_487 109
686 3300049742 Ga0501080_0041543 Ga0501080_0041543_982_1374 109
687 3300049823 Ga0501044_0087765 Ga0501044_0087765_1055_1447 109
688 3300050490 nmdc:mga03n38_742784_c1 nmdc:mga03n38_742784_c1_174_503 109
689 3300050492 nmdc:mga0yw44_1155299_c1 nmdc:mga0yw44_1155299_c1_126_455 109
690 3300050492 nmdc:mga0yw44_744273_c1 nmdc:mga0yw44_744273_c1_305_634 109
691 3300050492 nmdc:mga0yw44_92596_c1 nmdc:mga0yw44_92596_c1_861_1190 109
692 3300050493 nmdc:mga0k408_852420_c1 nmdc:mga0k408_852420_c1_63_392 109
693 3300050494 nmdc:mga06z11_259770_c1 nmdc:mga06z11_259770_c1_543_872 109
694 3300050494 nmdc:mga06z11_451687_c1 nmdc:mga06z11_451687_c1_260_589 109
695 3300050494 nmdc:mga06z11_507109_c1 nmdc:mga06z11_507109_c1_386_715 109
696 3300050496 nmdc:mga07m45_436820_c1 nmdc:mga07m45_436820_c1_113_442 109
697 3300050507 nmdc:mga05p37_951465_c1 nmdc:mga05p37_951465_c1_480_809 109
698 3300050512 nmdc:mga0n895_19638_c1 nmdc:mga0n895_19638_c1_1162_1491 109
699 3300050512 nmdc:mga0n895_538749_c1 nmdc:mga0n895_538749_c1_357_686 109
700 3300050513 nmdc:mga0rr50_192567_c1 nmdc:mga0rr50_192567_c1_334_663 109
701 3300050514 nmdc:mga08x19_361605_c1 nmdc:mga08x19_361605_c1_613_942 109
702 3300050514 nmdc:mga08x19_863764_c1 nmdc:mga08x19_863764_c1_176_505 109
703 3300050516 nmdc:mga0sz30_66336_c1 nmdc:mga0sz30_66336_c1_644_973 109
704 3300053077 Ga0495601_0016093 Ga0495601_0016093_763_1092 109
705 3300053077 Ga0495601_0031359 Ga0495601_0031359_1580_1909 109
706 3300053078 Ga0495612_0008064 Ga0495612_0008064_2263_2592 109
707 3300053078 Ga0495612_0009799 Ga0495612_0009799_470_799 109
708 3300053085 Ga0495619_0736266 Ga0495619_0736266_193_522 109
709 3300053086 Ga0500578_0090652 Ga0500578_0090652_1296_1625 109
710 3300053087 Ga0500643_000107 Ga0500643_000107_59833_60162 109
711 3300053088 Ga0500644_0422921 Ga0500644_0422921_60_389 109
712 3300053091 Ga0500647_0062748 Ga0500647_0062748_1296_1640 109
713 3300053091 Ga0500647_0212007 Ga0500647_0212007_454_783 109
714 3300053092 Ga0500583_0086346 Ga0500583_0086346_408_737 109
715 3300053093 Ga0500651_0355034 Ga0500651_0355034_229_558 109
716 3300053094 Ga0500566_0000020 Ga0500566_0000020_51060_51404 109
717 3300053094 Ga0500566_0000060 Ga0500566_0000060_8974_9303 109
718 3300053095 Ga0500640_000957 Ga0500640_000957_6582_6926 109
719 3300053096 Ga0500641_0017005 Ga0500641_0017005_745_1074 109
720 3300053098 Ga0500650_0176256 Ga0500650_0176256_508_837 109
721 3300053103 Ga0500555_001044 Ga0500555_001044_4809_5138 109
722 3300053105 Ga0500557_000044 Ga0500557_000044_26139_26468 109
723 3300053108 Ga0500562_012892 Ga0500562_012892_628_957 109
724 3300053109 Ga0500569_050689 Ga0500569_050689_67_396 109
725 3300053111 Ga0500572_000882 Ga0500572_000882_2382_2726 109
726 3300053115 Ga0500591_032819 Ga0500591_032819_1416_1760 109
727 3300053116 Ga0500592_034349 Ga0500592_034349_281_610 109
728 3300053118 Ga0500594_0283166 Ga0500594_0283166_35_364 109
729 3300053120 Ga0500597_423676 Ga0500597_423676_162_491 109
730 3300053122 Ga0500608_013703 Ga0500608_013703_232_576 109
731 3300053123 Ga0500614_003566 Ga0500614_003566_2425_2769 109
732 3300053126 Ga0500621_009720 Ga0500621_009720_1648_1977 109
733 3300053130 Ga0500642_0000331 Ga0500642_0000331_14236_14565 109
734 3300053130 Ga0500642_0081674 Ga0500642_0081674_366_695 109
735 3300053130 Ga0500642_0107400 Ga0500642_0107400_22_351 109
736 3300053133 Ga0500655_026577 Ga0500655_026577_103_432 109
737 3300053134 Ga0500658_0045241 Ga0500658_0045241_917_1246 109
738 3300053136 Ga0500559_0003043 Ga0500559_0003043_1221_1565 109
739 3300053139 Ga0500568_0297792 Ga0500568_0297792_180_509 109
740 3300053148 Ga0500590_163355 Ga0500590_163355_457_801 109
741 3300053150 Ga0500603_002834 Ga0500603_002834_1229_1573 109
742 3300053151 Ga0500604_0075476 Ga0500604_0075476_145_474 109
743 3300053156 Ga0500622_0228238 Ga0500622_0228238_147_476 109
744 3300053158 Ga0500627_0044839 Ga0500627_0044839_1461_1790 109
745 3300053159 Ga0500630_001295 Ga0500630_001295_9015_9359 109
746 3300053161 Ga0500634_0212888 Ga0500634_0212888_73_402 109
747 3300053162 Ga0500638_114977 Ga0500638_114977_575_919 109
748 3300053163 Ga0500639_000111 Ga0500639_000111_33700_34044 109
749 3300053177 Ga0500636_0423586 Ga0500636_0423586_161_490 109
750 3300053178 Ga0500637_0334705 Ga0500637_0334705_379_708 109
751 3300053178 Ga0500637_0487462 Ga0500637_0487462_166_495 109
752 3300053727 Ga0500611_018768 Ga0500611_018768_705_1034 109
753 3300053730 Ga0500645_025821 Ga0500645_025821_1125_1454 109
754 3300053731 Ga0500609_005383 Ga0500609_005383_1226_1555 109
755 3300053732 Ga0500656_030098 Ga0500656_030098_265_594 109
756 3300053735 Ga0500596_000483 Ga0500596_000483_2372_2716 109
757 3300053736 Ga0500599_001356 Ga0500599_001356_1972_2301 109
758 3300053737 Ga0500601_006752 Ga0500601_006752_907_1251 109
759 3300053737 Ga0500601_012566 Ga0500601_012566_112_441 109
760 3300054114 Ga0501084_0598187 Ga0501084_0598187_370_702 109
761 3300055283 Ga0500661_025822 Ga0500661_025822_42_386 109
762 3300055283 Ga0500661_035515 Ga0500661_035515_373_702 109
763 3300060353 Ga0501082_0544926 Ga0501082_0544926_112_444 109
764 iso_pu_bacteria 2524023228 2524537707 109

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22258

DUF6949

Family of unknown function (DUF6949)

6

104

0.97

Feature Viewer

pLDDT pTM Quality
70.04 0.38 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map