F479652

General Info

Members Datasets Scaffolds Average Seq Length
762 423 1524 256

Family's Representative Sequence

Representative Sequence 3300046474|Ga0495605_0005220|Ga0495605_0005220_6177_7037
Length 286
Sequence MARARKARVDAIQTLRLRFVSSQVNRAMIQIDALPAFTDNYIWLLQDNASQRCAVVDPGDAAPVLAWLGNHPGWELSDILITHHHADHTGGVAELKDVTGARVYGPANEKIPARDVALSDHDEVTVLGLTFAVHAVPGHTLGHIAFYHADPQTPLLFSGDTLFAAGCGRLFEGTPQQMHHSLSRLAELPDSTEVYCAHEYTLSNLRFAVAVEPENPDVTGRFEQVTRWREENRISLPSTLGLERKTNPFLRASQPSVKQKADERTGIDNASPVAVFAALRAWKDKF

Samples

Sample ID Description Type Environment
1 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
5 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
6 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
9 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
84 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
90 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
91 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
92 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
93 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
94 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
95 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
96 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
97 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
98 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
99 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
100 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
101 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
105 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
106 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
107 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
108 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
109 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
110 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
187 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
207 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
208 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
215 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
216 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
217 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
225 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
226 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
227 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
228 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
229 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
230 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
231 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
232 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
233 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
234 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
235 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
236 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
237 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
238 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
239 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
240 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
241 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
242 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
243 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
244 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
245 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
246 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
247 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
248 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
249 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
250 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
251 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
252 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
253 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
254 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
255 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
256 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
259 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
260 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
261 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
262 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
263 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
264 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
265 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
266 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
267 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
268 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
269 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
270 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
271 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
272 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
273 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
274 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
275 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
276 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
277 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
278 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
279 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
280 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
281 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
282 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
283 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
284 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
285 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
291 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
292 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
293 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
294 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
295 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
299 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
300 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
301 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
310 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
311 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
314 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
315 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
323 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
324 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
325 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
326 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
327 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
328 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
329 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
330 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
331 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
332 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
333 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
334 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
335 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
336 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
337 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
338 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
339 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
340 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
341 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
342 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
343 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
344 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
345 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
346 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
347 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
348 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
349 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
350 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
351 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
352 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
353 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
354 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
355 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
356 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
357 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
358 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
359 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
363 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
364 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
366 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
371 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
372 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
373 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
374 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
375 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
376 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
377 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
378 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
382 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
383 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
384 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
385 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
386 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
387 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
388 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
389 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
390 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
391 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
392 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
393 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
394 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
395 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
396 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
399 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
400 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
401 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
402 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
403 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
404 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
405 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
406 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
407 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
408 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
409 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
410 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
411 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
412 2643221547 Pseudolabrys sp. Root1462 Isolate Unclassified
413 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
414 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
415 2808606373 Pseudomonas sp. SLBN-2 Isolate Unclassified
416 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
417 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
418 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
419 639633007 Azoarcus olearius BH72 Isolate Unclassified
420 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
421 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
422 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
423 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0
Isolates 2.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.1
Nodule 0.13
Rhizoplane 7.35
Rhizosphere 84.12
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495605_0005220 3300046474 Bacteria 7574
2 ARcpr5oldR_c000003 3300000041 Bacteria 66110
3 JGI24737J22298_10015463 3300001990 Bacteria 2471
4 JGI24750J21931_1006487 3300002070 Unclassified 1457
5 JGI24748J21848_1009726 3300002074 Bacteria 1132
6 JGI24749J21850_1003317 3300002076 Bacteria 2252
7 JGI24744J21845_10006329 3300002077 Bacteria 2457
8 JGI24034J26672_10006151 3300002239 Unclassified 1729
9 JGI24751J29686_10032542 3300002459 Bacteria 1081
10 JGI25406J46586_10009370 3300003203 Bacteria 4386
11 rootH2_10033197 3300003320 Bacteria 1243
12 JGI25405J52794_10009620 3300003911 Bacteria 1827
13 Ga0065715_10133753 3300005293 Bacteria 1959
14 Ga0070676_10201211 3300005328 Bacteria 1306
15 Ga0070683_100169528 3300005329 Bacteria 2072
16 Ga0070683_100218824 3300005329 Bacteria 1810
17 Ga0070690_100102767 3300005330 Bacteria 1897
18 Ga0070670_100072579 3300005331 Bacteria 2956
19 Ga0068869_100044006 3300005334 Bacteria 3209
20 Ga0070666_10071842 3300005335 Bacteria 2356
21 Ga0070666_10128256 3300005335 Bacteria 1761
22 Ga0070682_100111667 3300005337 Bacteria 1823
23 Ga0068868_100015678 3300005338 Bacteria 5613
24 Ga0068868_100183339 3300005338 Bacteria 1738
25 Ga0070660_100136728 3300005339 Bacteria 1964
26 Ga0070689_100043592 3300005340 Bacteria 3449
27 Ga0070689_100045057 3300005340 Bacteria 3395
28 Ga0070687_100008447 3300005343 Bacteria 4364
29 Ga0070661_100130876 3300005344 Bacteria 1884
30 Ga0070692_10058532 3300005345 Bacteria 2024
31 Ga0070668_100074626 3300005347 Bacteria 2646
32 Ga0070668_100334685 3300005347 Bacteria 1278
33 Ga0070669_100063974 3300005353 Bacteria 2708
34 Ga0070675_100097771 3300005354 Bacteria 2468
35 Ga0070671_100053045 3300005355 Bacteria 3371
36 Ga0070671_100272852 3300005355 Bacteria 1438
37 Ga0070673_100030888 3300005364 Bacteria 4015
38 Ga0070673_100190059 3300005364 Bacteria 1763
39 Ga0070673_100281199 3300005364 Bacteria 1460
40 Ga0070688_100061016 3300005365 Bacteria 2383
41 Ga0070667_100123438 3300005367 Unclassified 2255
42 Ga0070709_10005703 3300005434 Bacteria 6751
43 Ga0070714_100038644 3300005435 Bacteria 4013
44 Ga0070714_100070037 3300005435 Bacteria 3031
45 Ga0070713_100031487 3300005436 Bacteria 4225
46 Ga0070713_100036813 3300005436 Bacteria 3952
47 Ga0070713_100046041 3300005436 Bacteria 3577
48 Ga0070713_100085727 3300005436 Bacteria 2699
49 Ga0070710_10017460 3300005437 Bacteria 3672
50 Ga0070710_10066008 3300005437 Bacteria 2074
51 Ga0070701_10014910 3300005438 Bacteria 3574
52 Ga0070711_100106712 3300005439 Bacteria 2048
53 Ga0070705_100037320 3300005440 Bacteria 2740
54 Ga0070700_100022256 3300005441 Bacteria 3693
55 Ga0070694_100027173 3300005444 Bacteria 3715
56 Ga0070694_100040704 3300005444 Bacteria 3098
57 Ga0070708_100100104 3300005445 Bacteria 2652
58 Ga0070663_100143269 3300005455 Bacteria 1826
59 Ga0070678_100198194 3300005456 Bacteria 1655
60 Ga0070662_100072029 3300005457 Bacteria 2550
61 Ga0068867_100022429 3300005459 Bacteria 4514
62 Ga0068867_100259258 3300005459 Bacteria 1417
63 Ga0070707_100480028 3300005468 Bacteria 1205
64 Ga0070699_100233512 3300005518 Bacteria 1640
65 Ga0070679_100156263 3300005530 Bacteria 2255
66 Ga0070684_100132242 3300005535 Bacteria 2251
67 Ga0070684_100213939 3300005535 Bacteria 1757
68 Ga0070697_100162344 3300005536 Bacteria 1888
69 Ga0068853_100050697 3300005539 Bacteria 3572
70 Ga0070672_100011738 3300005543 Bacteria 6119
71 Ga0070672_100314561 3300005543 Bacteria 1330
72 Ga0070686_100001748 3300005544 Bacteria 12159
73 Ga0070686_100492498 3300005544 Bacteria 950
74 Ga0070695_100034822 3300005545 Bacteria 3160
75 Ga0070696_100378380 3300005546 Bacteria 1103
76 Ga0070696_100440052 3300005546 Bacteria 1027
77 Ga0070693_100047379 3300005547 Bacteria 2445
78 Ga0070665_100306073 3300005548 Bacteria 1592
79 Ga0070704_100201982 3300005549 Bacteria 1605
80 Ga0070704_100456758 3300005549 Bacteria 1101
81 Ga0070664_100103995 3300005564 Bacteria 2472
82 Ga0070664_100104119 3300005564 Bacteria 2471
83 Ga0070664_100464967 3300005564 Bacteria 1163
84 Ga0068857_100136104 3300005577 Unclassified 2218
85 Ga0068856_100049701 3300005614 Bacteria 4133
86 Ga0068856_100232999 3300005614 Bacteria 1857
87 Ga0068856_100986655 3300005614 Unclassified 861
88 Ga0068856_101083367 3300005614 Bacteria 819
89 Ga0070702_100034657 3300005615 Bacteria 2783
90 Ga0068852_100043438 3300005616 Bacteria 3812
91 Ga0068859_100053285 3300005617 Bacteria 4068
92 Ga0068864_100010442 3300005618 Bacteria 7672
93 Ga0068866_10007121 3300005718 Bacteria 4676
94 Ga0068861_100004420 3300005719 Bacteria 9427
95 Ga0068851_10046938 3300005834 Bacteria 2186
96 Ga0068870_10046057 3300005840 Bacteria 2286
97 Ga0068863_100008750 3300005841 Bacteria 9887
98 Ga0068858_100011142 3300005842 Bacteria 8501
99 Ga0068860_100001139 3300005843 Bacteria 29182
100 Ga0068860_100101189 3300005843 Bacteria 2749
101 Ga0068860_100157270 3300005843 Bacteria 2191
102 Ga0068862_100021236 3300005844 Bacteria 5426
103 Ga0081455_10000002 3300005937 Bacteria 460472
104 Ga0081455_10001309 3300005937 Bacteria 30858
105 Ga0081455_10006726 3300005937 Bacteria 12279
106 Ga0081455_10242890 3300005937 Bacteria 1322
107 Ga0081540_1000453 3300005983 Bacteria 40674
108 Ga0075365_10191195 3300006038 Bacteria 1433
109 Ga0075432_10001901 3300006058 Bacteria 6923
110 Ga0075432_10008898 3300006058 Bacteria 3424
111 Ga0075432_10089055 3300006058 Bacteria 1128
112 Ga0070715_10000833 3300006163 Bacteria 8462
113 Ga0070715_10029582 3300006163 Bacteria 2207
114 Ga0070715_10076239 3300006163 Bacteria 1511
115 Ga0070716_100042013 3300006173 Bacteria 2550
116 Ga0070716_100163856 3300006173 Bacteria 1444
117 Ga0070712_100045567 3300006175 Bacteria 3028
118 Ga0075362_10091621 3300006177 Bacteria 1411
119 Ga0075367_10100904 3300006178 Bacteria 1764
120 Ga0097621_100012522 3300006237 Bacteria 6292
121 Ga0075370_10050181 3300006353 Bacteria 2367
122 Ga0068871_100079564 3300006358 Bacteria 2712
123 Ga0075428_100003527 3300006844 Bacteria 17133
124 Ga0075430_100001061 3300006846 Bacteria 21766
125 Ga0075430_100103691 3300006846 Bacteria 2374
126 Ga0075431_100000856 3300006847 Bacteria 26728
127 Ga0075433_10007007 3300006852 Bacteria 8933
128 Ga0075434_100000346 3300006871 Bacteria 33425
129 Ga0075434_100026369 3300006871 Bacteria 5692
130 Ga0075434_100032144 3300006871 Bacteria 5174
131 Ga0075434_100085463 3300006871 Bacteria 3154
132 Ga0075434_101066358 3300006871 Bacteria 821
133 Ga0075429_100001137 3300006880 Bacteria 21442
134 Ga0068865_100063989 3300006881 Bacteria 2587
135 Ga0075436_100161659 3300006914 Bacteria 1579
136 Ga0075436_100406642 3300006914 Bacteria 987
137 Ga0097620_100053284 3300006931 Bacteria 4068
138 Ga0075435_100013552 3300007076 Bacteria 6070
139 Ga0075435_100044490 3300007076 Bacteria 3556
140 Ga0099794_10028464 3300007265 Bacteria 2599
141 Ga0105251_10000031 3300009011 Bacteria 124114
142 Ga0105251_10002680 3300009011 Bacteria 13704
143 Ga0105251_10105748 3300009011 Bacteria 1285
144 Ga0105244_10004782 3300009036 Bacteria 9204
145 Ga0105244_10007437 3300009036 Bacteria 6964
146 Ga0105244_10010191 3300009036 Bacteria 5709
147 Ga0105244_10016606 3300009036 Bacteria 4188
148 Ga0105244_10050294 3300009036 Bacteria 2126
149 Ga0105250_10004002 3300009092 Bacteria 6875
150 Ga0111539_10000817 3300009094 Bacteria 40427
151 Ga0111539_10005785 3300009094 Bacteria 15980
152 Ga0111539_10569597 3300009094 Bacteria 1319
153 Ga0105245_10241485 3300009098 Bacteria 1751
154 Ga0105247_10019119 3300009101 Bacteria 4114
155 Ga0105247_10043079 3300009101 Bacteria 2765
156 Ga0114129_10003018 3300009147 Bacteria 23603
157 Ga0114129_10008639 3300009147 Bacteria 14523
158 Ga0114129_10023661 3300009147 Bacteria 8707
159 Ga0105243_10013709 3300009148 Bacteria 6133
160 Ga0105243_10016313 3300009148 Bacteria 5619
161 Ga0105241_10206472 3300009174 Bacteria 1644
162 Ga0105241_10387420 3300009174 Bacteria 1223
163 Ga0105242_10231832 3300009176 Bacteria 1655
164 Ga0105248_10028045 3300009177 Bacteria 6271
165 Ga0105248_10310008 3300009177 Bacteria 1777
166 Ga0105237_10036095 3300009545 Bacteria 5001
167 Ga0105249_10166469 3300009553 Bacteria 2134
168 Ga0105249_10217576 3300009553 Bacteria 1878
169 Ga0105239_10056939 3300010375 Bacteria 4288
170 Ga0105246_10042656 3300011119 Bacteria 3073
171 Ga0157373_10004460 3300013100 Bacteria 10534
172 Ga0157371_10000189 3300013102 Bacteria 91155
173 Ga0157370_10516436 3300013104 Bacteria 1097
174 Ga0157369_10135512 3300013105 Bacteria 2607
175 Ga0157369_10329581 3300013105 Bacteria 1586
176 Ga0157378_10019124 3300013297 Bacteria 6018
177 Ga0157378_10204621 3300013297 Bacteria 1869
178 Ga0157378_10348996 3300013297 Bacteria 1445
179 Ga0163162_10379223 3300013306 Bacteria 1547
180 Ga0157372_10004286 3300013307 Bacteria 15246
181 Ga0157375_10034125 3300013308 Bacteria 4844
182 Ga0157375_10319626 3300013308 Bacteria 1717
183 Ga0163163_10031916 3300014325 Bacteria 5087
184 Ga0163163_10124212 3300014325 Bacteria 2617
185 Ga0157380_10065566 3300014326 Bacteria 2919
186 Ga0182008_10034213 3300014497 Bacteria 2548
187 Ga0182008_10086317 3300014497 Bacteria 1545
188 Ga0157377_10006176 3300014745 Bacteria 5693
189 Ga0157379_10026571 3300014968 Bacteria 5152
190 Ga0157379_10031339 3300014968 Bacteria 4736
191 Ga0213872_10018011 3300021361 Bacteria 3258
192 Ga0213876_10059084 3300021384 Bacteria 2024
193 Ga0209759_1021388 3300025256 Bacteria 1474
194 Ga0209676_1000474 3300025292 Bacteria 66391
195 Ga0207656_10038776 3300025321 Bacteria 2012
196 Ga0207696_1000081 3300025711 Bacteria 198887
197 Ga0207655_1000019 3300025728 Bacteria 536324
198 Ga0207655_1001391 3300025728 Bacteria 22593
199 Ga0207655_1001782 3300025728 Bacteria 18729
200 Ga0207655_1002911 3300025728 Bacteria 13184
201 Ga0207655_1037802 3300025728 Bacteria 2120
202 Ga0207713_1000042 3300025735 Bacteria 242199
203 Ga0207713_1002568 3300025735 Bacteria 13108
204 Ga0207713_1002736 3300025735 Bacteria 12563
205 Ga0207713_1024799 3300025735 Bacteria 2784
206 Ga0207692_10022738 3300025898 Bacteria 2889
207 Ga0207692_10219567 3300025898 Bacteria 1126
208 Ga0207642_10002854 3300025899 Bacteria 5393
209 Ga0207710_10002503 3300025900 Bacteria 8502
210 Ga0207688_10005763 3300025901 Bacteria 6741
211 Ga0207680_10016681 3300025903 Bacteria 3862
212 Ga0207647_10025882 3300025904 Bacteria 3846
213 Ga0207685_10021612 3300025905 Bacteria 2159
214 Ga0207685_10040830 3300025905 Bacteria 1732
215 Ga0207699_10009937 3300025906 Bacteria 4757
216 Ga0207645_10004194 3300025907 Bacteria 10703
217 Ga0207645_10036270 3300025907 Bacteria 3166
218 Ga0207643_10000613 3300025908 Bacteria 22494
219 Ga0207684_10016067 3300025910 Bacteria 6428
220 Ga0207654_10095027 3300025911 Bacteria 1825
221 Ga0207654_10590098 3300025911 Bacteria 792
222 Ga0207693_10025294 3300025915 Bacteria 4708
223 Ga0207693_10064478 3300025915 Bacteria 2870
224 Ga0207693_10362309 3300025915 Bacteria 1134
225 Ga0207693_10459426 3300025915 Bacteria 995
226 Ga0207663_10020233 3300025916 Bacteria 3766
227 Ga0207663_10047909 3300025916 Bacteria 2641
228 Ga0207662_10013357 3300025918 Bacteria 4591
229 Ga0207657_10070277 3300025919 Bacteria 2968
230 Ga0207657_10131049 3300025919 Bacteria 2055
231 Ga0207649_10045561 3300025920 Bacteria 2689
232 Ga0207646_10548769 3300025922 Bacteria 1039
233 Ga0207681_10083720 3300025923 Bacteria 2259
234 Ga0207681_10110943 3300025923 Bacteria 1995
235 Ga0207694_10180720 3300025924 Bacteria 1711
236 Ga0207650_10025557 3300025925 Bacteria 4207
237 Ga0207650_10058029 3300025925 Bacteria 2881
238 Ga0207659_10003476 3300025926 Bacteria 9448
239 Ga0207687_10007367 3300025927 Bacteria 7248
240 Ga0207687_10074800 3300025927 Bacteria 2429
241 Ga0207700_10025397 3300025928 Bacteria 4113
242 Ga0207700_10030004 3300025928 Bacteria 3845
243 Ga0207700_10056981 3300025928 Bacteria 2944
244 Ga0207700_10090696 3300025928 Bacteria 2413
245 Ga0207664_10119943 3300025929 Bacteria 2199
246 Ga0207664_10522259 3300025929 Bacteria 1064
247 Ga0207644_10123314 3300025931 Bacteria 1975
248 Ga0207690_10037231 3300025932 Bacteria 3158
249 Ga0207690_10141978 3300025932 Bacteria 1770
250 Ga0207706_10008199 3300025933 Bacteria 9637
251 Ga0207706_10255044 3300025933 Bacteria 1532
252 Ga0207686_10006129 3300025934 Bacteria 6458
253 Ga0207709_10012028 3300025935 Bacteria 4773
254 Ga0207709_10019820 3300025935 Bacteria 3786
255 Ga0207709_10120867 3300025935 Bacteria 1768
256 Ga0207669_10227776 3300025937 Bacteria 1373
257 Ga0207704_10010716 3300025938 Bacteria 4484
258 Ga0207665_10000117 3300025939 Bacteria 52204
259 Ga0207665_10027785 3300025939 Bacteria 3738
260 Ga0207665_10326536 3300025939 Bacteria 1153
261 Ga0207691_10003890 3300025940 Bacteria 14501
262 Ga0207711_10044517 3300025941 Bacteria 3789
263 Ga0207711_10063647 3300025941 Bacteria 3185
264 Ga0207689_10008252 3300025942 Bacteria 9074
265 Ga0207661_10052411 3300025944 Bacteria 3260
266 Ga0207661_10213780 3300025944 Bacteria 1701
267 Ga0207651_10318190 3300025960 Bacteria 1300
268 Ga0207712_10021631 3300025961 Bacteria 4224
269 Ga0207668_10005223 3300025972 Bacteria 7643
270 Ga0207668_10445435 3300025972 Bacteria 1104
271 Ga0207677_10001500 3300026023 Bacteria 12331
272 Ga0207677_10279359 3300026023 Bacteria 1370
273 Ga0207703_10003943 3300026035 Bacteria 12309
274 Ga0207639_10411137 3300026041 Bacteria 1221
275 Ga0207678_10005802 3300026067 Bacteria 11004
276 Ga0207678_10092246 3300026067 Bacteria 2589
277 Ga0207708_10001777 3300026075 Bacteria 15902
278 Ga0207702_10048588 3300026078 Bacteria 3579
279 Ga0207702_10913497 3300026078 Unclassified 870
280 Ga0207641_10764360 3300026088 Bacteria 954
281 Ga0207648_10004368 3300026089 Bacteria 14540
282 Ga0207648_10267311 3300026089 Bacteria 1527
283 Ga0207648_10568953 3300026089 Bacteria 1042
284 Ga0207676_10007003 3300026095 Bacteria 7990
285 Ga0207676_10544391 3300026095 Bacteria 1108
286 Ga0207675_100004824 3300026118 Bacteria 12984
287 Ga0207683_10040795 3300026121 Bacteria 4052
288 Ga0209389_1000059 3300027296 Bacteria 106207
289 Ga0209371_1001262 3300027312 Bacteria 17979
290 Ga0209969_1002424 3300027360 Bacteria 2578
291 Ga0209981_1017284 3300027378 Bacteria 1017
292 Ga0209996_1004966 3300027395 Bacteria 1699
293 Ga0209968_1006978 3300027526 Bacteria 1704
294 Ga0209999_1011274 3300027543 Bacteria 1618
295 Ga0209983_1000580 3300027665 Bacteria 7901
296 Ga0209588_1014179 3300027671 Bacteria 2438
297 Ga0209971_1000198 3300027682 Bacteria 17957
298 Ga0209974_10014693 3300027876 Bacteria 2602
299 Ga0207428_10000316 3300027907 Bacteria 63363
300 Ga0268266_10230275 3300028379 Bacteria 1706
301 Ga0268265_10118397 3300028380 Bacteria 2177
302 Ga0268264_10000050 3300028381 Bacteria 323697
303 Ga0268264_10013138 3300028381 Bacteria 6809
304 Ga0268264_10528196 3300028381 Bacteria 1154
305 Ga0268256_1002820 3300030500 Bacteria 8394
306 Ga0307513_10153857 3300031456 Bacteria 2203
307 Ga0307509_10468756 3300031507 Unclassified 950
308 Ga0316575_10011853 3300031665 Bacteria 3233
309 Ga0265314_10001560 3300031711 Bacteria 25231
310 Ga0316576_10086475 3300031727 Bacteria 2332
311 Ga0316578_10179074 3300031728 Bacteria 1277
312 Ga0373944_0038593 3300035089 Bacteria 1467
313 Ga0373936_0029593 3300035113 Bacteria 2156
314 Ga0373941_0000234 3300035115 Bacteria 10677
315 Ga0373945_0040871 3300035116 Bacteria 1675
316 Ga0373953_0003828 3300035117 Bacteria 4735
317 Ga0373956_0074055 3300035119 Bacteria 1556
318 Ga0373957_0008973 3300035120 Bacteria 3260
319 Ga0373943_0020571 3300035170 Bacteria 3043
320 Ga0373946_0018242 3300035171 Bacteria 2692
321 Ga0373946_0043402 3300035171 Bacteria 1852
322 Ga0373946_0081456 3300035171 Bacteria 1418
323 Ga0373955_0000730 3300035172 Bacteria 14079
324 Ga0316574_0000384 3300035398 Bacteria 17233
325 Ga0373931_0156313 3300035691 Unclassified 1333
326 Ga0373935_0087931 3300035692 Bacteria 2029
327 Ga0373935_0151382 3300035692 Bacteria 1574
328 Ga0373927_0111289 3300035695 Bacteria 1784
329 Ga0373927_0343863 3300035695 Unclassified 983
330 Ga0373933_0034554 3300035724 Bacteria 2946
331 Ga0373933_0235627 3300035724 Bacteria 1177
332 Ga0373947_0014391 3300035725 Bacteria 4537
333 Ga0373947_0279499 3300035725 Bacteria 1110
334 Ga0373937_0137874 3300036401 Bacteria 2281
335 Ga0316582_0048766 3300036647 Bacteria 2678
336 Ga0316584_0335759 3300036712 Bacteria 1087
337 Ga0373925_0042892 3300037068 Bacteria 3356
338 Ga0373925_0126492 3300037068 Bacteria 1989
339 Ga0373925_0396256 3300037068 Bacteria 1125
340 Ga0436364_0126567 3300037853 Bacteria 1169
341 Ga0436365_0008071 3300039437 Bacteria 11634
342 Ga0436365_0458815 3300039437 Bacteria 12358
343 Ga0436361_1026253 3300039447 Bacteria 4300
344 Ga0439438_001653 3300041405 Bacteria 9783
345 Ga0439447_000712 3300041407 Bacteria 12305
346 Ga0439466_0012676 3300041411 Bacteria 3098
347 Ga0451853_2391942 3300041512 Bacteria 1528
348 Ga0439437_009454 3300042000 Bacteria 1103
349 Ga0439432_013920 3300042006 Bacteria 2726
350 Ga0439452_011362 3300042010 Bacteria 2561
351 Ga0439463_001662 3300042016 Bacteria 5846
352 Ga0439463_002837 3300042016 Bacteria 4391
353 Ga0439463_005433 3300042016 Bacteria 3164
354 Ga0450903_010595 3300042138 Bacteria 1490
355 Ga0450904_000050 3300042139 Bacteria 27147
356 Ga0450905_001330 3300042142 Bacteria 3136
357 Ga0439446_0004342 3300042156 Bacteria 3591
358 Ga0439434_0000685 3300042435 Bacteria 9781
359 Ga0450916_000694 3300042530 Bacteria 3066
360 Ga0450893_0005428 3300042532 Bacteria 2049
361 Ga0450901_000817 3300042533 Bacteria 3650
362 Ga0453684_0425332 3300044712 Bacteria 1483
363 Ga0495627_000013 3300046453 Bacteria 332765
364 Ga0495627_006061 3300046453 Bacteria 4779
365 Ga0495627_085160 3300046453 Bacteria 912
366 Ga0495592_0032461 3300046454 Bacteria 3938
367 Ga0495603_0072365 3300046455 Bacteria 2025
368 Ga0495603_0083604 3300046455 Bacteria 1869
369 Ga0495603_0188907 3300046455 Bacteria 1191
370 Ga0495590_0028357 3300046457 Bacteria 1964
371 Ga0495591_000041 3300046458 Bacteria 155639
372 Ga0495591_000064 3300046458 Bacteria 123820
373 Ga0495591_003324 3300046458 Bacteria 8373
374 Ga0495591_003703 3300046458 Bacteria 7755
375 Ga0495591_005546 3300046458 Bacteria 5808
376 Ga0495591_027345 3300046458 Bacteria 1760
377 Ga0495629_0020590 3300046459 Bacteria 4711
378 Ga0495638_0011442 3300046460 Bacteria 6113
379 Ga0495638_0046479 3300046460 Bacteria 2727
380 Ga0495641_0055135 3300046461 Bacteria 1805
381 Ga0495641_0071602 3300046461 Bacteria 1556
382 Ga0495651_0000237 3300046462 Bacteria 42533
383 Ga0495653_0009429 3300046463 Bacteria 7986
384 Ga0495650_0000557 3300046471 Bacteria 52926
385 Ga0495650_0011120 3300046471 Bacteria 4959
386 Ga0495650_0038850 3300046471 Bacteria 2058
387 Ga0495580_0094943 3300046472 Bacteria 2074
388 Ga0495582_0034200 3300046473 Bacteria 2794
389 Ga0495582_0093592 3300046473 Bacteria 1677
390 Ga0495605_0000045 3300046474 Bacteria 176155
391 Ga0495605_0000057 3300046474 Bacteria 150333
392 Ga0495605_0000090 3300046474 Bacteria 116120
393 Ga0495605_0002360 3300046474 Bacteria 11739
394 Ga0495639_0012710 3300046475 Bacteria 3631
395 Ga0495639_0062007 3300046475 Bacteria 1715
396 Ga0495662_0134204 3300046476 Bacteria 1217
397 Ga0495664_0025155 3300046477 Bacteria 3465
398 Ga0495664_0030603 3300046477 Bacteria 3154
399 Ga0495584_0034473 3300046491 Bacteria 2560
400 Ga0495584_0287833 3300046491 Bacteria 835
401 Ga0495585_0034142 3300046492 Bacteria 2876
402 Ga0495594_0002634 3300046499 Bacteria 9329
403 Ga0495594_0049467 3300046499 Bacteria 2310
404 Ga0495594_0062107 3300046499 Bacteria 2068
405 Ga0495596_0006263 3300046500 Bacteria 5502
406 Ga0495607_0000058 3300046501 Bacteria 109864
407 Ga0495607_0000070 3300046501 Bacteria 100876
408 Ga0495607_0001018 3300046501 Bacteria 25759
409 Ga0495607_0001960 3300046501 Bacteria 17374
410 Ga0495607_0003532 3300046501 Bacteria 11907
411 Ga0495607_0019943 3300046501 Bacteria 4247
412 Ga0495607_0158427 3300046501 Bacteria 1152
413 Ga0495607_0189737 3300046501 Bacteria 1024
414 Ga0495583_0000101 3300046506 Bacteria 144916
415 Ga0495583_0000483 3300046506 Bacteria 58302
416 Ga0495583_0000788 3300046506 Bacteria 39445
417 Ga0495583_0002076 3300046506 Bacteria 18071
418 Ga0495583_0002770 3300046506 Bacteria 14457
419 Ga0495583_0005299 3300046506 Bacteria 8811
420 Ga0495606_0000743 3300046507 Bacteria 50416
421 Ga0495606_0001748 3300046507 Bacteria 27875
422 Ga0495606_0011316 3300046507 Bacteria 7290
423 Ga0495608_0006207 3300046511 Bacteria 8483
424 Ga0495608_0249593 3300046511 Bacteria 1107
425 Ga0495610_0008757 3300046512 Bacteria 6498
426 Ga0495610_0009941 3300046512 Bacteria 5950
427 Ga0495616_0048611 3300046513 Bacteria 2130
428 Ga0495618_0003087 3300046514 Bacteria 10505
429 Ga0495620_0000001 3300046515 Bacteria 386508
430 Ga0495620_0000083 3300046515 Bacteria 78909
431 Ga0495620_0000579 3300046515 Bacteria 22993
432 Ga0495620_0002423 3300046515 Bacteria 10812
433 Ga0495620_0035841 3300046515 Bacteria 2226
434 Ga0495620_0059234 3300046515 Bacteria 1601
435 Ga0495628_0044638 3300046516 Bacteria 3524
436 Ga0495628_0208936 3300046516 Bacteria 1469
437 Ga0495631_0004631 3300046518 Bacteria 7276
438 Ga0495631_0029921 3300046518 Bacteria 2474
439 Ga0495632_0001994 3300046519 Bacteria 16156
440 Ga0495632_0002685 3300046519 Bacteria 13306
441 Ga0495632_0004680 3300046519 Bacteria 9242
442 Ga0495632_0115929 3300046519 Bacteria 1255
443 Ga0495637_0000037 3300046520 Bacteria 120732
444 Ga0495637_0000141 3300046520 Bacteria 54791
445 Ga0495637_0002959 3300046520 Bacteria 9142
446 Ga0495637_0005844 3300046520 Bacteria 6225
447 Ga0495637_0015666 3300046520 Bacteria 3556
448 Ga0495637_0042536 3300046520 Bacteria 1943
449 Ga0495637_0048073 3300046520 Bacteria 1798
450 Ga0495637_0080785 3300046520 Bacteria 1296
451 Ga0495643_0001925 3300046522 Bacteria 17488
452 Ga0495643_0002023 3300046522 Bacteria 16902
453 Ga0495643_0008557 3300046522 Bacteria 6462
454 Ga0495643_0150570 3300046522 Bacteria 1152
455 Ga0495644_0002628 3300046523 Bacteria 7147
456 Ga0495648_0002687 3300046524 Bacteria 16062
457 Ga0495648_0011715 3300046524 Bacteria 6579
458 Ga0495648_0025319 3300046524 Bacteria 4019
459 Ga0495648_0128062 3300046524 Bacteria 1354
460 Ga0495666_0196732 3300046526 Bacteria 927
461 Ga0495652_0141981 3300046529 Bacteria 1887
462 Ga0495654_0002711 3300046530 Bacteria 11196
463 Ga0495654_0027279 3300046530 Bacteria 2929
464 Ga0495654_0039522 3300046530 Bacteria 2354
465 Ga0495654_0049086 3300046530 Bacteria 2068
466 Ga0495654_0157822 3300046530 Bacteria 998
467 Ga0495665_0133108 3300046531 Bacteria 1301
468 Ga0495665_0193262 3300046531 Bacteria 1056
469 Ga0495640_0013216 3300046533 Bacteria 6278
470 Ga0495586_0097345 3300046535 Bacteria 1630
471 Ga0495587_0001960 3300046536 Bacteria 13717
472 Ga0495598_0033468 3300046537 Bacteria 1459
473 Ga0495609_0000011 3300046538 Bacteria 334377
474 Ga0495609_0000012 3300046538 Bacteria 333994
475 Ga0495609_0000075 3300046538 Bacteria 121584
476 Ga0495609_0089136 3300046538 Bacteria 1342
477 Ga0495597_0000004 3300046542 Bacteria 307496
478 Ga0495597_0000714 3300046542 Bacteria 26668
479 Ga0495597_0163619 3300046542 Bacteria 907
480 Ga0495645_0000923 3300046543 Bacteria 19984
481 Ga0495645_0138957 3300046543 Bacteria 1696
482 Ga0495622_0006669 3300046557 Bacteria 5354
483 Ga0495622_0027329 3300046557 Bacteria 2663
484 Ga0495633_0000016 3300046558 Bacteria 250457
485 Ga0495633_0054331 3300046558 Bacteria 1884
486 Ga0495667_0074527 3300046559 Bacteria 2209
487 Ga0495668_0185183 3300046616 Bacteria 1140
488 Ga0495668_0208862 3300046616 Archaea 1069
489 Ga0495611_0000453 3300046648 Bacteria 24799
490 Ga0495611_0001404 3300046648 Bacteria 12018
491 Ga0495611_0049571 3300046648 Bacteria 1890
492 Ga0495611_0180958 3300046648 Bacteria 985
493 Ga0495625_0000089 3300046660 Bacteria 147075
494 Ga0495635_0011567 3300046663 Bacteria 6186
495 Ga0495635_0217746 3300046663 Bacteria 1292
496 Ga0495659_0021571 3300046664 Bacteria 2172
497 Ga0495661_0000004 3300046665 Bacteria 555340
498 Ga0495661_0000018 3300046665 Bacteria 200787
499 Ga0495661_0000101 3300046665 Bacteria 104928
500 Ga0495661_0006173 3300046665 Bacteria 8434
501 Ga0495588_0113247 3300046674 Bacteria 1429
502 Ga0495657_0011873 3300046675 Bacteria 6492
503 Ga0495599_0003497 3300046678 Bacteria 9191
504 Ga0495599_0303344 3300046678 Bacteria 964
505 Ga0495623_0001626 3300046679 Bacteria 15105
506 Ga0495647_0029257 3300046681 Bacteria 2037
507 Ga0495613_0135034 3300046689 Bacteria 1765
508 Ga0495613_0166087 3300046689 Bacteria 1568
509 Ga0495624_0083362 3300046690 Unclassified 1977
510 Ga0495670_0002190 3300046691 Bacteria 9663
511 Ga0495670_0068252 3300046691 Bacteria 1796
512 Ga0495670_0070851 3300046691 Bacteria 1764
513 Ga0495671_0002841 3300046692 Bacteria 10843
514 Ga0495671_0022780 3300046692 Bacteria 3277
515 Ga0495671_0107074 3300046692 Bacteria 1365
516 Ga0495649_0000104 3300046694 Bacteria 74938
517 Ga0495589_0003568 3300046794 Bacteria 8410
518 Ga0495600_0002401 3300046809 Bacteria 10732
519 Ga0495660_0001662 3300046810 Bacteria 14901
520 Ga0495660_0002495 3300046810 Bacteria 11735
521 Ga0495660_0010707 3300046810 Bacteria 5330
522 Ga0495660_0017029 3300046810 Bacteria 4185
523 Ga0495660_0159386 3300046810 Bacteria 1108
524 Ga0495581_0070863 3300047315 Bacteria 2017
525 Ga0495604_0005675 3300047317 Bacteria 9898
526 Ga0495674_0016539 3300047319 Bacteria 6883
527 Ga0495674_0246931 3300047319 Bacteria 1469
528 Ga0495674_0340144 3300047319 Bacteria 1220
529 Ga0495672_0016777 3300047320 Bacteria 4916
530 Ga0495672_0025044 3300047320 Bacteria 3829
531 Ga0495672_0071244 3300047320 Bacteria 1967
532 Ga0495672_0085230 3300047320 Bacteria 1751
533 Ga0495676_0000020 3300047321 Bacteria 166813
534 Ga0495676_0026509 3300047321 Bacteria 4987
535 Ga0495676_0107685 3300047321 Bacteria 2051
536 Ga0495680_0003301 3300047322 Bacteria 15975
537 Ga0495683_0000801 3300047323 Bacteria 22381
538 Ga0495683_0001109 3300047323 Bacteria 18615
539 Ga0495683_0074517 3300047323 Bacteria 1663
540 Ga0495675_0001085 3300047444 Bacteria 16486
541 Ga0495679_000079 3300047446 Bacteria 90806
542 Ga0495679_000165 3300047446 Bacteria 59805
543 Ga0495673_0000442 3300047469 Bacteria 45981
544 Ga0495673_0000466 3300047469 Bacteria 43940
545 Ga0495673_0002986 3300047469 Bacteria 11400
546 Ga0495673_0032180 3300047469 Bacteria 2448
547 Ga0495673_0056733 3300047469 Bacteria 1693
548 Ga0495681_0020101 3300047470 Bacteria 3630
549 Ga0495681_0031062 3300047470 Bacteria 2711
550 Ga0495681_0032148 3300047470 Bacteria 2645
551 Ga0495684_0199584 3300047471 Bacteria 1475
552 Ga0495686_0029004 3300047472 Bacteria 3601
553 Ga0495593_0075329 3300047673 Bacteria 1750
554 Ga0495615_0019849 3300048090 Bacteria 1498
555 Ga0495626_0000041 3300048091 Bacteria 172663
556 Ga0495626_0021755 3300048091 Bacteria 3176
557 Ga0496100_0030602 3300048903 Bacteria 3340
558 Ga0496100_0047951 3300048903 Bacteria 2755
559 Ga0496100_0201985 3300048903 Bacteria 1449
560 Ga0496101_0002475 3300048904 Bacteria 11344
561 Ga0496101_0072137 3300048904 Bacteria 2534
562 Ga0496102_0014753 3300048905 Bacteria 6795
563 Ga0496102_0058808 3300048905 Bacteria 3513
564 Ga0496102_0107464 3300048905 Bacteria 2598
565 Ga0496102_0133370 3300048905 Bacteria 2326
566 Ga0496102_0266966 3300048905 Bacteria 1613
567 Ga0496103_0000715 3300048906 Bacteria 24556
568 Ga0496103_0011599 3300048906 Bacteria 5225
569 Ga0496103_0021967 3300048906 Bacteria 3841
570 Ga0496104_0010075 3300048907 Bacteria 8437
571 Ga0496104_0017413 3300048907 Bacteria 6541
572 Ga0496104_0265600 3300048907 Bacteria 1628
573 Ga0496105_0000363 3300048908 Bacteria 30056
574 Ga0496105_0006097 3300048908 Bacteria 9227
575 Ga0496105_0027937 3300048908 Bacteria 4613
576 Ga0496106_0019047 3300048909 Bacteria 5087
577 Ga0496106_0042475 3300048909 Bacteria 3410
578 Ga0496106_0075003 3300048909 Bacteria 2590
579 Ga0496107_0006664 3300048910 Bacteria 7950
580 Ga0496107_0013529 3300048910 Bacteria 5704
581 Ga0496107_0026262 3300048910 Bacteria 4127
582 Ga0496108_0000256 3300048911 Bacteria 46076
583 Ga0496108_0009889 3300048911 Bacteria 7729
584 Ga0496109_0000730 3300048912 Bacteria 27368
585 Ga0496109_0020406 3300048912 Bacteria 5852
586 Ga0496109_0036889 3300048912 Bacteria 4414
587 Ga0496110_0003157 3300048913 Bacteria 12534
588 Ga0496110_0006378 3300048913 Bacteria 9328
589 Ga0496110_0008394 3300048913 Bacteria 8309
590 Ga0496110_0129184 3300048913 Bacteria 2281
591 Ga0496110_0187861 3300048913 Bacteria 1876
592 Ga0496111_0002097 3300048914 Bacteria 11899
593 Ga0496111_0065856 3300048914 Bacteria 2630
594 Ga0496111_0077676 3300048914 Bacteria 2420
595 Ga0496111_0290322 3300048914 Bacteria 1213
596 Ga0496111_0478864 3300048914 Bacteria 917
597 Ga0496112_0002301 3300048915 Bacteria 15303
598 Ga0496112_0053409 3300048915 Bacteria 3968
599 Ga0496112_0168662 3300048915 Bacteria 2155
600 Ga0496113_0000318 3300048916 Bacteria 22869
601 Ga0496113_0009296 3300048916 Bacteria 6447
602 Ga0496113_0165677 3300048916 Bacteria 1749
603 Ga0496114_0093424 3300048917 Bacteria 2557
604 Ga0496114_0126496 3300048917 Bacteria 2203
605 Ga0496114_0293148 3300048917 Unclassified 1435
606 Ga0496115_0037445 3300048918 Bacteria 3843
607 Ga0496115_0080897 3300048918 Bacteria 2645
608 Ga0496115_0154113 3300048918 Bacteria 1898
609 Ga0496115_0491685 3300048918 Bacteria 987
610 Ga0496116_0018095 3300048919 Bacteria 5444
611 Ga0496116_0038571 3300048919 Bacteria 3315
612 Ga0496117_0004724 3300048920 Bacteria 14797
613 Ga0496117_0011478 3300048920 Bacteria 7934
614 Ga0496117_0013119 3300048920 Bacteria 7252
615 Ga0496118_0003726 3300048921 Bacteria 18866
616 Ga0496118_0006092 3300048921 Bacteria 13406
617 Ga0496118_0028691 3300048921 Bacteria 4681
618 Ga0496118_0063016 3300048921 Bacteria 2731
619 Ga0496118_0099287 3300048921 Bacteria 1974
620 Ga0496121_0003127 3300048924 Bacteria 23909
621 Ga0496121_0005791 3300048924 Bacteria 15683
622 Ga0496122_0001632 3300048925 Bacteria 35005
623 Ga0496122_0002961 3300048925 Bacteria 23160
624 Ga0496122_0007638 3300048925 Bacteria 11940
625 Ga0496122_0023352 3300048925 Bacteria 5455
626 Ga0496123_0000901 3300048926 Bacteria 47005
627 Ga0496123_0003329 3300048926 Bacteria 18198
628 Ga0496123_0005322 3300048926 Bacteria 13017
629 Ga0496123_0088186 3300048926 Bacteria 1854
630 Ga0496124_0000172 3300048927 Bacteria 130204
631 Ga0496124_0004673 3300048927 Bacteria 15827
632 Ga0496124_0021249 3300048927 Bacteria 5984
633 Ga0496124_0021706 3300048927 Bacteria 5911
634 Ga0496124_0022425 3300048927 Bacteria 5787
635 Ga0496125_0000793 3300048928 Bacteria 51550
636 Ga0496125_0003891 3300048928 Bacteria 17642
637 Ga0496126_0016317 3300048929 Bacteria 7430
638 Ga0496126_0089207 3300048929 Bacteria 2714
639 Ga0496126_0430156 3300048929 Bacteria 1066
640 Ga0495678_000036 3300049459 Bacteria 198018
641 Ga0495678_002432 3300049459 Bacteria 12653
642 Ga0495678_005464 3300049459 Bacteria 7004
643 Ga0495678_086007 3300049459 Bacteria 1118
644 Ga0495682_0000065 3300049460 Bacteria 98530
645 Ga0495682_0000554 3300049460 Bacteria 25641
646 Ga0501032_0174095 3300049569 Bacteria 1410
647 Ga0501033_0037028 3300049570 Bacteria 3653
648 Ga0501033_0047528 3300049570 Bacteria 3190
649 Ga0501034_0000436 3300049571 Bacteria 69142
650 Ga0501034_0003203 3300049571 Bacteria 18778
651 Ga0501034_0036558 3300049571 Bacteria 4974
652 Ga0501034_0041181 3300049571 Bacteria 4673
653 Ga0501034_0090502 3300049571 Bacteria 3057
654 Ga0501036_0002786 3300049572 Bacteria 13844
655 Ga0501036_0030763 3300049572 Bacteria 4535
656 Ga0501036_0052499 3300049572 Bacteria 3452
657 Ga0501036_0075107 3300049572 Bacteria 2859
658 Ga0501036_0508986 3300049572 Bacteria 1001
659 Ga0501037_0003344 3300049573 Bacteria 11656
660 Ga0501037_0008782 3300049573 Bacteria 7409
661 Ga0501037_0301532 3300049573 Bacteria 1112
662 Ga0501038_0030940 3300049574 Bacteria 4732
663 Ga0501038_0060085 3300049574 Bacteria 3254
664 Ga0501038_0069873 3300049574 Bacteria 2982
665 Ga0501038_0453631 3300049574 Bacteria 985
666 Ga0501038_0494862 3300049574 Bacteria 935
667 Ga0501039_0009471 3300049575 Bacteria 7425
668 Ga0501039_0251178 3300049575 Bacteria 1390
669 Ga0501043_0003473 3300049579 Bacteria 12944
670 Ga0501043_0012874 3300049579 Bacteria 6539
671 Ga0501043_0020094 3300049579 Bacteria 5242
672 Ga0501046_0005131 3300049580 Bacteria 11746
673 Ga0501046_0047208 3300049580 Bacteria 3415
674 Ga0501047_0000384 3300049581 Bacteria 49644
675 Ga0501047_0121523 3300049581 Bacteria 2493
676 Ga0501048_0000074 3300049582 Bacteria 51762
677 Ga0501067_0162906 3300049583 Bacteria 1242
678 Ga0501068_0026639 3300049584 Bacteria 3407
679 Ga0501069_0065959 3300049585 Bacteria 2024
680 Ga0501069_0388830 3300049585 Bacteria 824
681 Ga0501070_0006228 3300049586 Bacteria 10156
682 Ga0501070_0079172 3300049586 Bacteria 2719
683 Ga0501070_0475534 3300049586 Bacteria 1005
684 Ga0501072_0119460 3300049588 Bacteria 2100
685 Ga0501073_0079020 3300049589 Bacteria 2289
686 Ga0501073_0214932 3300049589 Bacteria 1328
687 Ga0501073_0351600 3300049589 Bacteria 1017
688 Ga0501074_0021073 3300049590 Bacteria 4734
689 Ga0501074_0058168 3300049590 Bacteria 2784
690 Ga0501074_0061032 3300049590 Bacteria 2716
691 Ga0501076_0226266 3300049592 Bacteria 1529
692 Ga0501080_0001148 3300049742 Bacteria 21848
693 Ga0501080_0034797 3300049742 Bacteria 4704
694 Ga0501080_0141453 3300049742 Bacteria 2224
695 Ga0501083_0003658 3300049744 Bacteria 10791
696 Ga0501083_0080460 3300049744 Bacteria 2160
697 Ga0501035_0011994 3300049822 Bacteria 8016
698 Ga0501035_0022223 3300049822 Bacteria 5826
699 Ga0501044_0017087 3300049823 Bacteria 7785
700 Ga0501044_0124681 3300049823 Bacteria 2574
701 Ga0501044_0140537 3300049823 Bacteria 2403
702 Ga0501044_0224841 3300049823 Bacteria 1826
703 Ga0501044_0307503 3300049823 Bacteria 1512
704 Ga0501226_000019 3300049853 Bacteria 143773
705 nmdc:mga0yw44_11136_c1 3300050492 Bacteria 4626
706 nmdc:mga0yw44_205631_c1 3300050492 Bacteria 1301
707 nmdc:mga0yw44_8856_c1 3300050492 Bacteria 5042
708 nmdc:mga05p37_222_c1 3300050507 Bacteria 57449
709 nmdc:mga05p37_34848_c1 3300050507 Bacteria 6167
710 nmdc:mga05p37_5363_c2 3300050507 Bacteria 14304
711 nmdc:mga09592_10121_c1 3300050508 Bacteria 7671
712 nmdc:mga0qj67_1677_c1 3300050509 Bacteria 15599
713 nmdc:mga06r32_1077_c1 3300050510 Bacteria 24523
714 nmdc:mga08y16_286096_c1 3300050511 Bacteria 1700
715 nmdc:mga08y16_9271_c1 3300050511 Bacteria 10327
716 nmdc:mga0n895_180061_c1 3300050512 Bacteria 2145
717 nmdc:mga0n895_21261_c1 3300050512 Bacteria 6063
718 nmdc:mga0n895_448920_c1 3300050512 Bacteria 1302
719 nmdc:mga0n895_741_c1 3300050512 Bacteria 23095
720 nmdc:mga0rr50_138615_c1 3300050513 Bacteria 1955
721 nmdc:mga0rr50_5996_c1 3300050513 Bacteria 7333
722 nmdc:mga08x19_157278_c1 3300050514 Bacteria 1542
723 nmdc:mga08x19_432743_c1 3300050514 Bacteria 925
724 nmdc:mga0a205_63609_c1 3300050515 Bacteria 3565
725 Ga0495601_0001594 3300053077 Bacteria 12527
726 Ga0495612_0002946 3300053078 Bacteria 7063
727 Ga0495612_0007090 3300053078 Bacteria 4586
728 Ga0495655_0001886 3300053083 Bacteria 3266
729 Ga0495595_0005548 3300053084 Bacteria 5106
730 Ga0495619_0004091 3300053085 Bacteria 9333
731 Ga0495619_0014349 3300053085 Bacteria 5004
732 Ga0495619_0063819 3300053085 Bacteria 2454
733 Ga0495619_0103030 3300053085 Bacteria 1944
734 Ga0495619_0246304 3300053085 Bacteria 1238
735 Ga0500641_0011005 3300053096 Bacteria 3280
736 Ga0500641_0015439 3300053096 Bacteria 2835
737 Ga0500618_003200 3300053125 Bacteria 5721
738 Ga0500658_0198510 3300053134 Unclassified 917
739 Ga0500659_0001655 3300053135 Bacteria 13889
740 Ga0500573_0060303 3300053140 Bacteria 2173
741 Ga0500577_0047495 3300053142 Bacteria 1596
742 Ga0500645_061934 3300053730 Bacteria 1081
743 Ga0501084_0759865 3300054114 Bacteria 817
744 Ga0501082_0000460 3300060353 Bacteria 35943
745 Ga0501082_0236292 3300060353 Bacteria 1590
746 Ga0530510_0108924 3300061734 Bacteria 2028
747 2554815881 2554235132 Bacteria 6772433
748 2599974429 2599185307 Bacteria 6194719
749 2601625329 2600255283 Bacteria 6061572
750 2608382260 2606217733 Bacteria 6360972
751 2643758971 2643221547 Bacteria 4740017
752 2738690802 2738541271 Bacteria 5657310
753 2739266576 2738543016 Bacteria 5657564
754 2808904238 2808606373 Bacteria 4423627
755 3007252683 3007252601 Bacteria 4559114
756 3007421501 3007419365 Bacteria 7026924
757 3007806599 3007803356 Bacteria 5931491
758 639786341 639633007 Bacteria 4376040
759 8011357082 8011350971 Bacteria 6158957
760 8056119617 8056115690 Bacteria 5527654
761 8056124238 8056120720 Bacteria 5758328
762 8056141154 8056137416 Bacteria 6147080
763 Ga0495605_0005220
764 ARcpr5oldR_c000003
765 JGI24737J22298_10015463
766 JGI24750J21931_1006487
767 JGI24748J21848_1009726
768 JGI24749J21850_1003317
769 JGI24744J21845_10006329
770 JGI24034J26672_10006151
771 JGI24751J29686_10032542
772 JGI25406J46586_10009370
773 rootH2_10033197
774 JGI25405J52794_10009620
775 Ga0065715_10133753
776 Ga0070676_10201211
777 Ga0070683_100169528
778 Ga0070683_100218824
779 Ga0070690_100102767
780 Ga0070670_100072579
781 Ga0068869_100044006
782 Ga0070666_10071842
783 Ga0070666_10128256
784 Ga0070682_100111667
785 Ga0068868_100015678
786 Ga0068868_100183339
787 Ga0070660_100136728
788 Ga0070689_100043592
789 Ga0070689_100045057
790 Ga0070687_100008447
791 Ga0070661_100130876
792 Ga0070692_10058532
793 Ga0070668_100074626
794 Ga0070668_100334685
795 Ga0070669_100063974
796 Ga0070675_100097771
797 Ga0070671_100053045
798 Ga0070671_100272852
799 Ga0070673_100030888
800 Ga0070673_100190059
801 Ga0070673_100281199
802 Ga0070688_100061016
803 Ga0070667_100123438
804 Ga0070709_10005703
805 Ga0070714_100038644
806 Ga0070714_100070037
807 Ga0070713_100031487
808 Ga0070713_100036813
809 Ga0070713_100046041
810 Ga0070713_100085727
811 Ga0070710_10017460
812 Ga0070710_10066008
813 Ga0070701_10014910
814 Ga0070711_100106712
815 Ga0070705_100037320
816 Ga0070700_100022256
817 Ga0070694_100027173
818 Ga0070694_100040704
819 Ga0070708_100100104
820 Ga0070663_100143269
821 Ga0070678_100198194
822 Ga0070662_100072029
823 Ga0068867_100022429
824 Ga0068867_100259258
825 Ga0070707_100480028
826 Ga0070699_100233512
827 Ga0070679_100156263
828 Ga0070684_100132242
829 Ga0070684_100213939
830 Ga0070697_100162344
831 Ga0068853_100050697
832 Ga0070672_100011738
833 Ga0070672_100314561
834 Ga0070686_100001748
835 Ga0070686_100492498
836 Ga0070695_100034822
837 Ga0070696_100378380
838 Ga0070696_100440052
839 Ga0070693_100047379
840 Ga0070665_100306073
841 Ga0070704_100201982
842 Ga0070704_100456758
843 Ga0070664_100103995
844 Ga0070664_100104119
845 Ga0070664_100464967
846 Ga0068857_100136104
847 Ga0068856_100049701
848 Ga0068856_100232999
849 Ga0068856_100986655
850 Ga0068856_101083367
851 Ga0070702_100034657
852 Ga0068852_100043438
853 Ga0068859_100053285
854 Ga0068864_100010442
855 Ga0068866_10007121
856 Ga0068861_100004420
857 Ga0068851_10046938
858 Ga0068870_10046057
859 Ga0068863_100008750
860 Ga0068858_100011142
861 Ga0068860_100001139
862 Ga0068860_100101189
863 Ga0068860_100157270
864 Ga0068862_100021236
865 Ga0081455_10000002
866 Ga0081455_10001309
867 Ga0081455_10006726
868 Ga0081455_10242890
869 Ga0081540_1000453
870 Ga0075365_10191195
871 Ga0075432_10001901
872 Ga0075432_10008898
873 Ga0075432_10089055
874 Ga0070715_10000833
875 Ga0070715_10029582
876 Ga0070715_10076239
877 Ga0070716_100042013
878 Ga0070716_100163856
879 Ga0070712_100045567
880 Ga0075362_10091621
881 Ga0075367_10100904
882 Ga0097621_100012522
883 Ga0075370_10050181
884 Ga0068871_100079564
885 Ga0075428_100003527
886 Ga0075430_100001061
887 Ga0075430_100103691
888 Ga0075431_100000856
889 Ga0075433_10007007
890 Ga0075434_100000346
891 Ga0075434_100026369
892 Ga0075434_100032144
893 Ga0075434_100085463
894 Ga0075434_101066358
895 Ga0075429_100001137
896 Ga0068865_100063989
897 Ga0075436_100161659
898 Ga0075436_100406642
899 Ga0097620_100053284
900 Ga0075435_100013552
901 Ga0075435_100044490
902 Ga0099794_10028464
903 Ga0105251_10000031
904 Ga0105251_10002680
905 Ga0105251_10105748
906 Ga0105244_10004782
907 Ga0105244_10007437
908 Ga0105244_10010191
909 Ga0105244_10016606
910 Ga0105244_10050294
911 Ga0105250_10004002
912 Ga0111539_10000817
913 Ga0111539_10005785
914 Ga0111539_10569597
915 Ga0105245_10241485
916 Ga0105247_10019119
917 Ga0105247_10043079
918 Ga0114129_10003018
919 Ga0114129_10008639
920 Ga0114129_10023661
921 Ga0105243_10013709
922 Ga0105243_10016313
923 Ga0105241_10206472
924 Ga0105241_10387420
925 Ga0105242_10231832
926 Ga0105248_10028045
927 Ga0105248_10310008
928 Ga0105237_10036095
929 Ga0105249_10166469
930 Ga0105249_10217576
931 Ga0105239_10056939
932 Ga0105246_10042656
933 Ga0157373_10004460
934 Ga0157371_10000189
935 Ga0157370_10516436
936 Ga0157369_10135512
937 Ga0157369_10329581
938 Ga0157378_10019124
939 Ga0157378_10204621
940 Ga0157378_10348996
941 Ga0163162_10379223
942 Ga0157372_10004286
943 Ga0157375_10034125
944 Ga0157375_10319626
945 Ga0163163_10031916
946 Ga0163163_10124212
947 Ga0157380_10065566
948 Ga0182008_10034213
949 Ga0182008_10086317
950 Ga0157377_10006176
951 Ga0157379_10026571
952 Ga0157379_10031339
953 Ga0213872_10018011
954 Ga0213876_10059084
955 Ga0209759_1021388
956 Ga0209676_1000474
957 Ga0207656_10038776
958 Ga0207696_1000081
959 Ga0207655_1000019
960 Ga0207655_1001391
961 Ga0207655_1001782
962 Ga0207655_1002911
963 Ga0207655_1037802
964 Ga0207713_1000042
965 Ga0207713_1002568
966 Ga0207713_1002736
967 Ga0207713_1024799
968 Ga0207692_10022738
969 Ga0207692_10219567
970 Ga0207642_10002854
971 Ga0207710_10002503
972 Ga0207688_10005763
973 Ga0207680_10016681
974 Ga0207647_10025882
975 Ga0207685_10021612
976 Ga0207685_10040830
977 Ga0207699_10009937
978 Ga0207645_10004194
979 Ga0207645_10036270
980 Ga0207643_10000613
981 Ga0207684_10016067
982 Ga0207654_10095027
983 Ga0207654_10590098
984 Ga0207693_10025294
985 Ga0207693_10064478
986 Ga0207693_10362309
987 Ga0207693_10459426
988 Ga0207663_10020233
989 Ga0207663_10047909
990 Ga0207662_10013357
991 Ga0207657_10070277
992 Ga0207657_10131049
993 Ga0207649_10045561
994 Ga0207646_10548769
995 Ga0207681_10083720
996 Ga0207681_10110943
997 Ga0207694_10180720
998 Ga0207650_10025557
999 Ga0207650_10058029
1000 Ga0207659_10003476
1001 Ga0207687_10007367
1002 Ga0207687_10074800
1003 Ga0207700_10025397
1004 Ga0207700_10030004
1005 Ga0207700_10056981
1006 Ga0207700_10090696
1007 Ga0207664_10119943
1008 Ga0207664_10522259
1009 Ga0207644_10123314
1010 Ga0207690_10037231
1011 Ga0207690_10141978
1012 Ga0207706_10008199
1013 Ga0207706_10255044
1014 Ga0207686_10006129
1015 Ga0207709_10012028
1016 Ga0207709_10019820
1017 Ga0207709_10120867
1018 Ga0207669_10227776
1019 Ga0207704_10010716
1020 Ga0207665_10000117
1021 Ga0207665_10027785
1022 Ga0207665_10326536
1023 Ga0207691_10003890
1024 Ga0207711_10044517
1025 Ga0207711_10063647
1026 Ga0207689_10008252
1027 Ga0207661_10052411
1028 Ga0207661_10213780
1029 Ga0207651_10318190
1030 Ga0207712_10021631
1031 Ga0207668_10005223
1032 Ga0207668_10445435
1033 Ga0207677_10001500
1034 Ga0207677_10279359
1035 Ga0207703_10003943
1036 Ga0207639_10411137
1037 Ga0207678_10005802
1038 Ga0207678_10092246
1039 Ga0207708_10001777
1040 Ga0207702_10048588
1041 Ga0207702_10913497
1042 Ga0207641_10764360
1043 Ga0207648_10004368
1044 Ga0207648_10267311
1045 Ga0207648_10568953
1046 Ga0207676_10007003
1047 Ga0207676_10544391
1048 Ga0207675_100004824
1049 Ga0207683_10040795
1050 Ga0209389_1000059
1051 Ga0209371_1001262
1052 Ga0209969_1002424
1053 Ga0209981_1017284
1054 Ga0209996_1004966
1055 Ga0209968_1006978
1056 Ga0209999_1011274
1057 Ga0209983_1000580
1058 Ga0209588_1014179
1059 Ga0209971_1000198
1060 Ga0209974_10014693
1061 Ga0207428_10000316
1062 Ga0268266_10230275
1063 Ga0268265_10118397
1064 Ga0268264_10000050
1065 Ga0268264_10013138
1066 Ga0268264_10528196
1067 Ga0268256_1002820
1068 Ga0307513_10153857
1069 Ga0307509_10468756
1070 Ga0316575_10011853
1071 Ga0265314_10001560
1072 Ga0316576_10086475
1073 Ga0316578_10179074
1074 Ga0373944_0038593
1075 Ga0373936_0029593
1076 Ga0373941_0000234
1077 Ga0373945_0040871
1078 Ga0373953_0003828
1079 Ga0373956_0074055
1080 Ga0373957_0008973
1081 Ga0373943_0020571
1082 Ga0373946_0018242
1083 Ga0373946_0043402
1084 Ga0373946_0081456
1085 Ga0373955_0000730
1086 Ga0316574_0000384
1087 Ga0373931_0156313
1088 Ga0373935_0087931
1089 Ga0373935_0151382
1090 Ga0373927_0111289
1091 Ga0373927_0343863
1092 Ga0373933_0034554
1093 Ga0373933_0235627
1094 Ga0373947_0014391
1095 Ga0373947_0279499
1096 Ga0373937_0137874
1097 Ga0316582_0048766
1098 Ga0316584_0335759
1099 Ga0373925_0042892
1100 Ga0373925_0126492
1101 Ga0373925_0396256
1102 Ga0436364_0126567
1103 Ga0436365_0008071
1104 Ga0436365_0458815
1105 Ga0436361_1026253
1106 Ga0439438_001653
1107 Ga0439447_000712
1108 Ga0439466_0012676
1109 Ga0451853_2391942
1110 Ga0439437_009454
1111 Ga0439432_013920
1112 Ga0439452_011362
1113 Ga0439463_001662
1114 Ga0439463_002837
1115 Ga0439463_005433
1116 Ga0450903_010595
1117 Ga0450904_000050
1118 Ga0450905_001330
1119 Ga0439446_0004342
1120 Ga0439434_0000685
1121 Ga0450916_000694
1122 Ga0450893_0005428
1123 Ga0450901_000817
1124 Ga0453684_0425332
1125 Ga0495627_000013
1126 Ga0495627_006061
1127 Ga0495627_085160
1128 Ga0495592_0032461
1129 Ga0495603_0072365
1130 Ga0495603_0083604
1131 Ga0495603_0188907
1132 Ga0495590_0028357
1133 Ga0495591_000041
1134 Ga0495591_000064
1135 Ga0495591_003324
1136 Ga0495591_003703
1137 Ga0495591_005546
1138 Ga0495591_027345
1139 Ga0495629_0020590
1140 Ga0495638_0011442
1141 Ga0495638_0046479
1142 Ga0495641_0055135
1143 Ga0495641_0071602
1144 Ga0495651_0000237
1145 Ga0495653_0009429
1146 Ga0495650_0000557
1147 Ga0495650_0011120
1148 Ga0495650_0038850
1149 Ga0495580_0094943
1150 Ga0495582_0034200
1151 Ga0495582_0093592
1152 Ga0495605_0000045
1153 Ga0495605_0000057
1154 Ga0495605_0000090
1155 Ga0495605_0002360
1156 Ga0495639_0012710
1157 Ga0495639_0062007
1158 Ga0495662_0134204
1159 Ga0495664_0025155
1160 Ga0495664_0030603
1161 Ga0495584_0034473
1162 Ga0495584_0287833
1163 Ga0495585_0034142
1164 Ga0495594_0002634
1165 Ga0495594_0049467
1166 Ga0495594_0062107
1167 Ga0495596_0006263
1168 Ga0495607_0000058
1169 Ga0495607_0000070
1170 Ga0495607_0001018
1171 Ga0495607_0001960
1172 Ga0495607_0003532
1173 Ga0495607_0019943
1174 Ga0495607_0158427
1175 Ga0495607_0189737
1176 Ga0495583_0000101
1177 Ga0495583_0000483
1178 Ga0495583_0000788
1179 Ga0495583_0002076
1180 Ga0495583_0002770
1181 Ga0495583_0005299
1182 Ga0495606_0000743
1183 Ga0495606_0001748
1184 Ga0495606_0011316
1185 Ga0495608_0006207
1186 Ga0495608_0249593
1187 Ga0495610_0008757
1188 Ga0495610_0009941
1189 Ga0495616_0048611
1190 Ga0495618_0003087
1191 Ga0495620_0000001
1192 Ga0495620_0000083
1193 Ga0495620_0000579
1194 Ga0495620_0002423
1195 Ga0495620_0035841
1196 Ga0495620_0059234
1197 Ga0495628_0044638
1198 Ga0495628_0208936
1199 Ga0495631_0004631
1200 Ga0495631_0029921
1201 Ga0495632_0001994
1202 Ga0495632_0002685
1203 Ga0495632_0004680
1204 Ga0495632_0115929
1205 Ga0495637_0000037
1206 Ga0495637_0000141
1207 Ga0495637_0002959
1208 Ga0495637_0005844
1209 Ga0495637_0015666
1210 Ga0495637_0042536
1211 Ga0495637_0048073
1212 Ga0495637_0080785
1213 Ga0495643_0001925
1214 Ga0495643_0002023
1215 Ga0495643_0008557
1216 Ga0495643_0150570
1217 Ga0495644_0002628
1218 Ga0495648_0002687
1219 Ga0495648_0011715
1220 Ga0495648_0025319
1221 Ga0495648_0128062
1222 Ga0495666_0196732
1223 Ga0495652_0141981
1224 Ga0495654_0002711
1225 Ga0495654_0027279
1226 Ga0495654_0039522
1227 Ga0495654_0049086
1228 Ga0495654_0157822
1229 Ga0495665_0133108
1230 Ga0495665_0193262
1231 Ga0495640_0013216
1232 Ga0495586_0097345
1233 Ga0495587_0001960
1234 Ga0495598_0033468
1235 Ga0495609_0000011
1236 Ga0495609_0000012
1237 Ga0495609_0000075
1238 Ga0495609_0089136
1239 Ga0495597_0000004
1240 Ga0495597_0000714
1241 Ga0495597_0163619
1242 Ga0495645_0000923
1243 Ga0495645_0138957
1244 Ga0495622_0006669
1245 Ga0495622_0027329
1246 Ga0495633_0000016
1247 Ga0495633_0054331
1248 Ga0495667_0074527
1249 Ga0495668_0185183
1250 Ga0495668_0208862
1251 Ga0495611_0000453
1252 Ga0495611_0001404
1253 Ga0495611_0049571
1254 Ga0495611_0180958
1255 Ga0495625_0000089
1256 Ga0495635_0011567
1257 Ga0495635_0217746
1258 Ga0495659_0021571
1259 Ga0495661_0000004
1260 Ga0495661_0000018
1261 Ga0495661_0000101
1262 Ga0495661_0006173
1263 Ga0495588_0113247
1264 Ga0495657_0011873
1265 Ga0495599_0003497
1266 Ga0495599_0303344
1267 Ga0495623_0001626
1268 Ga0495647_0029257
1269 Ga0495613_0135034
1270 Ga0495613_0166087
1271 Ga0495624_0083362
1272 Ga0495670_0002190
1273 Ga0495670_0068252
1274 Ga0495670_0070851
1275 Ga0495671_0002841
1276 Ga0495671_0022780
1277 Ga0495671_0107074
1278 Ga0495649_0000104
1279 Ga0495589_0003568
1280 Ga0495600_0002401
1281 Ga0495660_0001662
1282 Ga0495660_0002495
1283 Ga0495660_0010707
1284 Ga0495660_0017029
1285 Ga0495660_0159386
1286 Ga0495581_0070863
1287 Ga0495604_0005675
1288 Ga0495674_0016539
1289 Ga0495674_0246931
1290 Ga0495674_0340144
1291 Ga0495672_0016777
1292 Ga0495672_0025044
1293 Ga0495672_0071244
1294 Ga0495672_0085230
1295 Ga0495676_0000020
1296 Ga0495676_0026509
1297 Ga0495676_0107685
1298 Ga0495680_0003301
1299 Ga0495683_0000801
1300 Ga0495683_0001109
1301 Ga0495683_0074517
1302 Ga0495675_0001085
1303 Ga0495679_000079
1304 Ga0495679_000165
1305 Ga0495673_0000442
1306 Ga0495673_0000466
1307 Ga0495673_0002986
1308 Ga0495673_0032180
1309 Ga0495673_0056733
1310 Ga0495681_0020101
1311 Ga0495681_0031062
1312 Ga0495681_0032148
1313 Ga0495684_0199584
1314 Ga0495686_0029004
1315 Ga0495593_0075329
1316 Ga0495615_0019849
1317 Ga0495626_0000041
1318 Ga0495626_0021755
1319 Ga0496100_0030602
1320 Ga0496100_0047951
1321 Ga0496100_0201985
1322 Ga0496101_0002475
1323 Ga0496101_0072137
1324 Ga0496102_0014753
1325 Ga0496102_0058808
1326 Ga0496102_0107464
1327 Ga0496102_0133370
1328 Ga0496102_0266966
1329 Ga0496103_0000715
1330 Ga0496103_0011599
1331 Ga0496103_0021967
1332 Ga0496104_0010075
1333 Ga0496104_0017413
1334 Ga0496104_0265600
1335 Ga0496105_0000363
1336 Ga0496105_0006097
1337 Ga0496105_0027937
1338 Ga0496106_0019047
1339 Ga0496106_0042475
1340 Ga0496106_0075003
1341 Ga0496107_0006664
1342 Ga0496107_0013529
1343 Ga0496107_0026262
1344 Ga0496108_0000256
1345 Ga0496108_0009889
1346 Ga0496109_0000730
1347 Ga0496109_0020406
1348 Ga0496109_0036889
1349 Ga0496110_0003157
1350 Ga0496110_0006378
1351 Ga0496110_0008394
1352 Ga0496110_0129184
1353 Ga0496110_0187861
1354 Ga0496111_0002097
1355 Ga0496111_0065856
1356 Ga0496111_0077676
1357 Ga0496111_0290322
1358 Ga0496111_0478864
1359 Ga0496112_0002301
1360 Ga0496112_0053409
1361 Ga0496112_0168662
1362 Ga0496113_0000318
1363 Ga0496113_0009296
1364 Ga0496113_0165677
1365 Ga0496114_0093424
1366 Ga0496114_0126496
1367 Ga0496114_0293148
1368 Ga0496115_0037445
1369 Ga0496115_0080897
1370 Ga0496115_0154113
1371 Ga0496115_0491685
1372 Ga0496116_0018095
1373 Ga0496116_0038571
1374 Ga0496117_0004724
1375 Ga0496117_0011478
1376 Ga0496117_0013119
1377 Ga0496118_0003726
1378 Ga0496118_0006092
1379 Ga0496118_0028691
1380 Ga0496118_0063016
1381 Ga0496118_0099287
1382 Ga0496121_0003127
1383 Ga0496121_0005791
1384 Ga0496122_0001632
1385 Ga0496122_0002961
1386 Ga0496122_0007638
1387 Ga0496122_0023352
1388 Ga0496123_0000901
1389 Ga0496123_0003329
1390 Ga0496123_0005322
1391 Ga0496123_0088186
1392 Ga0496124_0000172
1393 Ga0496124_0004673
1394 Ga0496124_0021249
1395 Ga0496124_0021706
1396 Ga0496124_0022425
1397 Ga0496125_0000793
1398 Ga0496125_0003891
1399 Ga0496126_0016317
1400 Ga0496126_0089207
1401 Ga0496126_0430156
1402 Ga0495678_000036
1403 Ga0495678_002432
1404 Ga0495678_005464
1405 Ga0495678_086007
1406 Ga0495682_0000065
1407 Ga0495682_0000554
1408 Ga0501032_0174095
1409 Ga0501033_0037028
1410 Ga0501033_0047528
1411 Ga0501034_0000436
1412 Ga0501034_0003203
1413 Ga0501034_0036558
1414 Ga0501034_0041181
1415 Ga0501034_0090502
1416 Ga0501036_0002786
1417 Ga0501036_0030763
1418 Ga0501036_0052499
1419 Ga0501036_0075107
1420 Ga0501036_0508986
1421 Ga0501037_0003344
1422 Ga0501037_0008782
1423 Ga0501037_0301532
1424 Ga0501038_0030940
1425 Ga0501038_0060085
1426 Ga0501038_0069873
1427 Ga0501038_0453631
1428 Ga0501038_0494862
1429 Ga0501039_0009471
1430 Ga0501039_0251178
1431 Ga0501043_0003473
1432 Ga0501043_0012874
1433 Ga0501043_0020094
1434 Ga0501046_0005131
1435 Ga0501046_0047208
1436 Ga0501047_0000384
1437 Ga0501047_0121523
1438 Ga0501048_0000074
1439 Ga0501067_0162906
1440 Ga0501068_0026639
1441 Ga0501069_0065959
1442 Ga0501069_0388830
1443 Ga0501070_0006228
1444 Ga0501070_0079172
1445 Ga0501070_0475534
1446 Ga0501072_0119460
1447 Ga0501073_0079020
1448 Ga0501073_0214932
1449 Ga0501073_0351600
1450 Ga0501074_0021073
1451 Ga0501074_0058168
1452 Ga0501074_0061032
1453 Ga0501076_0226266
1454 Ga0501080_0001148
1455 Ga0501080_0034797
1456 Ga0501080_0141453
1457 Ga0501083_0003658
1458 Ga0501083_0080460
1459 Ga0501035_0011994
1460 Ga0501035_0022223
1461 Ga0501044_0017087
1462 Ga0501044_0124681
1463 Ga0501044_0140537
1464 Ga0501044_0224841
1465 Ga0501044_0307503
1466 Ga0501226_000019
1467 nmdc:mga0yw44_11136_c1
1468 nmdc:mga0yw44_205631_c1
1469 nmdc:mga0yw44_8856_c1
1470 nmdc:mga05p37_222_c1
1471 nmdc:mga05p37_34848_c1
1472 nmdc:mga05p37_5363_c2
1473 nmdc:mga09592_10121_c1
1474 nmdc:mga0qj67_1677_c1
1475 nmdc:mga06r32_1077_c1
1476 nmdc:mga08y16_286096_c1
1477 nmdc:mga08y16_9271_c1
1478 nmdc:mga0n895_180061_c1
1479 nmdc:mga0n895_21261_c1
1480 nmdc:mga0n895_448920_c1
1481 nmdc:mga0n895_741_c1
1482 nmdc:mga0rr50_138615_c1
1483 nmdc:mga0rr50_5996_c1
1484 nmdc:mga08x19_157278_c1
1485 nmdc:mga08x19_432743_c1
1486 nmdc:mga0a205_63609_c1
1487 Ga0495601_0001594
1488 Ga0495612_0002946
1489 Ga0495612_0007090
1490 Ga0495655_0001886
1491 Ga0495595_0005548
1492 Ga0495619_0004091
1493 Ga0495619_0014349
1494 Ga0495619_0063819
1495 Ga0495619_0103030
1496 Ga0495619_0246304
1497 Ga0500641_0011005
1498 Ga0500641_0015439
1499 Ga0500618_003200
1500 Ga0500658_0198510
1501 Ga0500659_0001655
1502 Ga0500573_0060303
1503 Ga0500577_0047495
1504 Ga0500645_061934
1505 Ga0501084_0759865
1506 Ga0501082_0000460
1507 Ga0501082_0236292
1508 Ga0530510_0108924
1509 2554815881
1510 2599974429
1511 2601625329
1512 2608382260
1513 2643758971
1514 2738690802
1515 2739266576
1516 2808904238
1517 3007252683
1518 3007421501
1519 3007806599
1520 639786341
1521 8011357082
1522 8056119617
1523 8056124238
1524 8056141154

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF16123

HAGH_C

Hydroxyacylglutathione hydrolase C-terminus

199

286

0.98

PF00753

Lactamase_B

Metallo-beta-lactamase superfamily

37

198

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1xm8-assembly2.cif.gz_B x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 0.98 4 255
1xm8-assembly2.cif.gz_B x-ray structure of glyoxalase ii from arabidopsis thaliana gene at2g31350 0.9687 4 255
2qed-assembly1.cif.gz_A crystal structure of salmonella thyphimurium lt2 glyoxalase ii 0.9593 3 255
6s0i-assembly1.cif.gz_A crystal structure of escherichia coli glyoxalase ii with l-tartrate in the active site 0.9528 4 255
2qed-assembly1.cif.gz_A crystal structure of salmonella thyphimurium lt2 glyoxalase ii 0.9518 3 255
ID Description Score Start End Superfamily
af_I1MD49_73_326_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9837 4 255 3.60.15.10
af_I1MD49_73_326_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9722 4 255 3.60.15.10
2obwA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9602 3 255 3.60.15.10
af_Q8N490_119_385_3.60.15.10 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9577 4 255 3.60.15.10
2obwA00 Alpha Beta;4-Layer Sandwich;Metallo-beta-lactamase; Chain A;Ribonuclease Z/Hydroxyacylglutathione hydrolase-like 0.9528 3 255 3.60.15.10
ID Description Score Start End GO Terms
AF-A0A0Q7TB37-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) (Glx II) 0.999 1 255 GO:0004416
GO:0019243
GO:0046872
AF-A0A3C0CQI7-F1-model_v4 deleted 0.9964 3 115
AF-A0A7S2NMX8-F1-model_v4 Metallo-beta-lactamase domain-containing protein 0.9939 1 152
AF-J3HYY5-F1-model_v4 hydroxyacylglutathione hydrolase (EC 3.1.2.6) (Glyoxalase II) 0.9939 139 255 GO:0016787
GO:0046872
AF-A0A434UH30-F1-model_v4 Hydroxyacylglutathione hydrolase (EC 3.1.2.6) 0.9931 1 224 GO:0004416
GO:0019243
GO:0046872

Map