F479621

General Info

Members Datasets Scaffolds Average Seq Length
762 424 1524 128

Family's Representative Sequence

Representative Sequence 3300005577|Ga0068857_101106779|Ga0068857_1011067792
Length 145
Sequence LLESVIAKGVILVFPNMSSAIMVGPLVGWMLALTVKHVIADFLLQNHWMAAGKDAKTGWALPLLSHCLIHGVLTTALVAAVAPRFWFIGPVDFVIHLAIDRAKGFCVARFDVTPTHRWFWWLIGIDQALHHLTGFGLAIWLAANQ

Samples

Sample ID Description Type Environment
1 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
16 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
17 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
18 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
19 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
20 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
24 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
45 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
46 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
47 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
48 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
51 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
52 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
59 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
60 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
61 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
62 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
63 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
64 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
86 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
87 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
88 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
89 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
131 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
132 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
133 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
139 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
140 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
143 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
144 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
145 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
146 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
147 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
148 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
152 3300033546 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE2 Metagenome Unclassified
153 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
154 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
155 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
156 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
159 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
160 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
161 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
162 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
163 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
164 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
165 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
166 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
167 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
168 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
169 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
170 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
171 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
172 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
173 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
174 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
175 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
176 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
179 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
180 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
181 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
182 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
183 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
184 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
185 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
186 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
187 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
188 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
189 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
190 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
191 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
192 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
195 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
196 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
197 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
198 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
199 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
204 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
207 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
210 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
211 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
212 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
213 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
214 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
215 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
216 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
217 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
218 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
219 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
220 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
221 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
222 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
223 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
224 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
225 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
228 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
229 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
230 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
235 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
236 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
242 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
243 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
244 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
245 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
246 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
247 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
248 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
249 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
250 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
251 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
252 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
253 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
254 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
260 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
261 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
262 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
263 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
264 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
267 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
268 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
271 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
272 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
273 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
276 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
277 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
278 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
290 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
291 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
292 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
293 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
294 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
295 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
300 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
301 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
302 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
303 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
304 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
305 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
306 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
310 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
311 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
314 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
315 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
316 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
317 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
318 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
319 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
320 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
321 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
322 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
323 3300053106 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 endosphere Metagenome Endosphere
324 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
325 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
326 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
327 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
328 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
329 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
330 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
331 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
332 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
333 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
334 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
335 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
336 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
337 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
338 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
339 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
340 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
341 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
342 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
343 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
344 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
345 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
346 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
347 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
348 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
349 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
350 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
351 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
352 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
353 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
354 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
355 3300053728 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere Metagenome Endosphere
356 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
357 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
358 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
359 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
361 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
362 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
363 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
364 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
365 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
366 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
367 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
368 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
369 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
370 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
371 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
372 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
373 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
374 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
375 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
376 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
377 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
378 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
379 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
380 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
381 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
382 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
383 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
384 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
385 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
386 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
387 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
388 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
389 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
390 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
391 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
392 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
393 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
394 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
395 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
396 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
397 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
398 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
399 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
400 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
401 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
402 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
403 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
404 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
405 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
406 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
407 2904699407
408 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
409 2906610324
410 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
411 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
412 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
413 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
414 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
415 2922368715
416 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
417 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
418 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
419 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
420 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
421 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
422 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
423 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
424 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.83
Metatranscriptomes 0.13
Isolates 8.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.17
Nodule 4.86
Rhizoplane 4.46
Rhizosphere 64.57
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068857_101106779 3300005577 Bacteria 765
2 rootH1_10019479 3300003323 Bacteria 4840
3 Ga0070683_100011764 3300005329 Bacteria 7577
4 Ga0070670_100196564 3300005331 Bacteria 1752
5 Ga0070666_10201710 3300005335 Bacteria 1399
6 Ga0070680_100242398 3300005336 Bacteria 1524
7 Ga0070682_100966243 3300005337 Bacteria 705
8 Ga0068868_101074070 3300005338 Bacteria 739
9 Ga0070660_100028099 3300005339 Bacteria 4205
10 Ga0070660_100538309 3300005339 Bacteria 974
11 Ga0070691_10381214 3300005341 Bacteria 790
12 Ga0070691_10518665 3300005341 Bacteria 691
13 Ga0070661_100071112 3300005344 Bacteria 2560
14 Ga0070661_100351280 3300005344 Bacteria 1157
15 Ga0070668_100149406 3300005347 Bacteria 1888
16 Ga0070668_100189860 3300005347 Bacteria 1682
17 Ga0070675_102123200 3300005354 Bacteria 518
18 Ga0070659_100183381 3300005366 Bacteria 1718
19 Ga0070709_10003406 3300005434 Bacteria 8539
20 Ga0070709_10025947 3300005434 Bacteria 3467
21 Ga0070709_10093269 3300005434 Bacteria 1990
22 Ga0070709_10223016 3300005434 Bacteria 1345
23 Ga0070714_100004471 3300005435 Bacteria 10536
24 Ga0070714_100007517 3300005435 Bacteria 8482
25 Ga0070714_100021788 3300005435 Bacteria 5246
26 Ga0070714_100035472 3300005435 Bacteria 4181
27 Ga0070714_100072214 3300005435 Bacteria 2987
28 Ga0070714_100199691 3300005435 Bacteria 1829
29 Ga0070713_100010463 3300005436 Bacteria 6700
30 Ga0070713_100021104 3300005436 Bacteria 5003
31 Ga0070713_100024195 3300005436 Bacteria 4727
32 Ga0070713_100043686 3300005436 Bacteria 3665
33 Ga0070713_100122233 3300005436 Bacteria 2285
34 Ga0070710_10000733 3300005437 Bacteria 15629
35 Ga0070710_10001588 3300005437 Bacteria 10728
36 Ga0070710_10017164 3300005437 Bacteria 3699
37 Ga0070711_100002277 3300005439 Bacteria 10885
38 Ga0070711_100060963 3300005439 Bacteria 2624
39 Ga0070711_100153941 3300005439 Bacteria 1736
40 Ga0070711_100203806 3300005439 Bacteria 1528
41 Ga0070711_100210944 3300005439 Bacteria 1504
42 Ga0070711_100501704 3300005439 Bacteria 1001
43 Ga0070711_101052250 3300005439 Bacteria 700
44 Ga0070694_101081610 3300005444 Bacteria 668
45 Ga0070708_100162019 3300005445 Bacteria 2085
46 Ga0070663_100174511 3300005455 Bacteria 1663
47 Ga0070663_100197919 3300005455 Bacteria 1567
48 Ga0070663_100341417 3300005455 Bacteria 1210
49 Ga0070663_101007845 3300005455 Bacteria 724
50 Ga0070681_10206709 3300005458 Bacteria 1880
51 Ga0070681_10471015 3300005458 Bacteria 1169
52 Ga0068867_100481391 3300005459 Bacteria 1064
53 Ga0068867_101156915 3300005459 Bacteria 709
54 Ga0070698_101158705 3300005471 Bacteria 722
55 Ga0070698_101609657 3300005471 Bacteria 601
56 Ga0070679_100079579 3300005530 Bacteria 3267
57 Ga0070679_100136719 3300005530 Bacteria 2432
58 Ga0070679_100163230 3300005530 Bacteria 2201
59 Ga0070679_100212191 3300005530 Bacteria 1899
60 Ga0070679_100553369 3300005530 Bacteria 1094
61 Ga0070684_100003951 3300005535 Bacteria 11230
62 Ga0070684_100027263 3300005535 Bacteria 4819
63 Ga0068853_100124111 3300005539 Bacteria 2306
64 Ga0068853_100192506 3300005539 Bacteria 1853
65 Ga0068853_100500133 3300005539 Bacteria 1147
66 Ga0070693_100391074 3300005547 Bacteria 962
67 Ga0070693_100888608 3300005547 Bacteria 667
68 Ga0070665_101261330 3300005548 Bacteria 749
69 Ga0070665_101366564 3300005548 Bacteria 718
70 Ga0068855_100147649 3300005563 Bacteria 2675
71 Ga0068855_100152593 3300005563 Bacteria 2626
72 Ga0068855_100309261 3300005563 Bacteria 1749
73 Ga0068855_100569281 3300005563 Bacteria 1225
74 Ga0068855_100817227 3300005563 Bacteria 990
75 Ga0070664_100191447 3300005564 Bacteria 1822
76 Ga0068857_100027954 3300005577 Bacteria 4974
77 Ga0068857_100285687 3300005577 Bacteria 1518
78 Ga0068856_100048478 3300005614 Bacteria 4187
79 Ga0068856_100802722 3300005614 Bacteria 961
80 Ga0070702_100163369 3300005615 Bacteria 1441
81 Ga0068852_100294178 3300005616 Bacteria 1570
82 Ga0068852_100720969 3300005616 Bacteria 1008
83 Ga0068866_11035800 3300005718 Bacteria 585
84 Ga0068851_10053517 3300005834 Bacteria 2055
85 Ga0068858_101888535 3300005842 Bacteria 590
86 Ga0068860_100772560 3300005843 Bacteria 973
87 Ga0081455_10000450 3300005937 Bacteria 54201
88 Ga0081455_10170159 3300005937 Bacteria 1660
89 Ga0081455_10229170 3300005937 Bacteria 1372
90 Ga0081538_10021290 3300005981 Bacteria 4738
91 Ga0081540_1013373 3300005983 Bacteria 5340
92 Ga0081539_10062379 3300005985 Bacteria 2037
93 Ga0070717_10001116 3300006028 Bacteria 18122
94 Ga0070717_10008258 3300006028 Bacteria 7772
95 Ga0070717_10152621 3300006028 Bacteria 1999
96 Ga0070717_10810779 3300006028 Bacteria 852
97 Ga0070717_10895087 3300006028 Bacteria 808
98 Ga0075365_10017970 3300006038 Bacteria 4339
99 Ga0075365_10024727 3300006038 Bacteria 3794
100 Ga0075365_10149696 3300006038 Bacteria 1623
101 Ga0075368_10017845 3300006042 Bacteria 2660
102 Ga0075368_10478760 3300006042 Bacteria 554
103 Ga0075363_100028887 3300006048 Bacteria 2857
104 Ga0075363_100055829 3300006048 Bacteria 2116
105 Ga0075363_100095281 3300006048 Bacteria 1642
106 Ga0075364_10033177 3300006051 Bacteria 3322
107 Ga0075364_10230463 3300006051 Bacteria 1258
108 Ga0070715_10003071 3300006163 Bacteria 5236
109 Ga0070715_10055413 3300006163 Bacteria 1721
110 Ga0070715_10260499 3300006163 Bacteria 911
111 Ga0070716_100005362 3300006173 Bacteria 6203
112 Ga0070716_100274681 3300006173 Bacteria 1160
113 Ga0070712_100017464 3300006175 Bacteria 4645
114 Ga0070712_100057009 3300006175 Bacteria 2742
115 Ga0070712_100423249 3300006175 Bacteria 1104
116 Ga0075362_10002546 3300006177 Bacteria 6151
117 Ga0075362_10211633 3300006177 Bacteria 946
118 Ga0075362_10707445 3300006177 Bacteria 526
119 Ga0075367_10057460 3300006178 Bacteria 2313
120 Ga0075367_10149752 3300006178 Bacteria 1448
121 Ga0075367_10336706 3300006178 Bacteria 951
122 Ga0075369_10098732 3300006186 Bacteria 1308
123 Ga0075369_10286512 3300006186 Bacteria 768
124 Ga0097621_100410631 3300006237 Bacteria 1214
125 Ga0075370_10156209 3300006353 Bacteria 1338
126 Ga0068871_100413741 3300006358 Bacteria 1203
127 Ga0075434_100009502 3300006871 Bacteria 9071
128 Ga0099825_1066808 3300006941 Bacteria 559
129 Ga0099824_1018691 3300006942 Bacteria 5613
130 Ga0099822_1000541 3300006943 Bacteria 35996
131 Ga0075435_100208728 3300007076 Bacteria 1656
132 Ga0075435_100510682 3300007076 Bacteria 1039
133 Ga0105251_10087189 3300009011 Bacteria 1437
134 Ga0105240_10033307 3300009093 Bacteria 6659
135 Ga0105240_10111009 3300009093 Bacteria 3318
136 Ga0105240_10648839 3300009093 Bacteria 1157
137 Ga0105245_10487544 3300009098 Bacteria 1247
138 Ga0105245_10921883 3300009098 Bacteria 916
139 Ga0105245_11001853 3300009098 Bacteria 880
140 Ga0105247_10203794 3300009101 Bacteria 1331
141 Ga0105247_10727329 3300009101 Unclassified 750
142 Ga0105241_10651211 3300009174 Bacteria 957
143 Ga0105242_10146191 3300009176 Bacteria 2057
144 Ga0105248_10042051 3300009177 Bacteria 5125
145 Ga0105237_10027168 3300009545 Bacteria 5845
146 Ga0105237_10053748 3300009545 Bacteria 4039
147 Ga0105237_10100986 3300009545 Bacteria 2877
148 Ga0105237_10143933 3300009545 Bacteria 2378
149 Ga0105237_10267578 3300009545 Bacteria 1712
150 Ga0105237_10608729 3300009545 Bacteria 1099
151 Ga0105237_11159283 3300009545 Bacteria 779
152 Ga0105238_10009337 3300009551 Bacteria 9824
153 Ga0105238_10022426 3300009551 Bacteria 6435
154 Ga0105238_10073582 3300009551 Bacteria 3411
155 Ga0105238_10077355 3300009551 Bacteria 3319
156 Ga0105238_10276270 3300009551 Bacteria 1661
157 Ga0105238_10407788 3300009551 Bacteria 1353
158 Ga0105249_10349147 3300009553 Bacteria 1498
159 Ga0105239_10070346 3300010375 Bacteria 3844
160 Ga0105239_10103032 3300010375 Bacteria 3158
161 Ga0105239_10140615 3300010375 Bacteria 2689
162 Ga0105239_10465633 3300010375 Bacteria 1435
163 Ga0105239_10902164 3300010375 Bacteria 1014
164 Ga0105239_11088156 3300010375 Bacteria 920
165 Ga0105239_11165926 3300010375 Bacteria 887
166 Ga0105239_11363899 3300010375 Bacteria 818
167 Ga0157373_10079620 3300013100 Bacteria 2311
168 Ga0157373_11160118 3300013100 Bacteria 581
169 Ga0157370_10085090 3300013104 Bacteria 2970
170 Ga0157369_10114541 3300013105 Bacteria 2863
171 Ga0157374_10027912 3300013296 Bacteria 5095
172 Ga0157374_10948508 3300013296 Bacteria 879
173 Ga0157374_11809208 3300013296 Bacteria 636
174 Ga0157378_10961265 3300013297 Bacteria 887
175 Ga0163162_10057235 3300013306 Bacteria 3926
176 Ga0163162_10141230 3300013306 Bacteria 2522
177 Ga0163162_11456893 3300013306 Bacteria 779
178 Ga0157372_10915899 3300013307 Bacteria 1017
179 Ga0157372_11114818 3300013307 Bacteria 913
180 Ga0157372_11738445 3300013307 Bacteria 717
181 Ga0157372_13223740 3300013307 Bacteria 520
182 Ga0157380_12557607 3300014326 Bacteria 576
183 Ga0182008_10695121 3300014497 Bacteria 580
184 Ga0182008_10770309 3300014497 Bacteria 556
185 Ga0157379_10033261 3300014968 Bacteria 4598
186 Ga0157379_10791086 3300014968 Bacteria 895
187 Ga0157376_11635224 3300014969 Bacteria 679
188 Ga0157376_11825393 3300014969 Bacteria 644
189 Ga0209148_1012921 3300025254 Bacteria 1514
190 Ga0209233_1015179 3300025261 Bacteria 2153
191 Ga0209564_1000718 3300025295 Bacteria 47576
192 Ga0207426_1006125 3300025302 Bacteria 5297
193 Ga0207692_10001008 3300025898 Bacteria 10274
194 Ga0207692_10006260 3300025898 Bacteria 4823
195 Ga0207692_10332765 3300025898 Bacteria 932
196 Ga0207692_10489862 3300025898 Bacteria 779
197 Ga0207710_10214390 3300025900 Bacteria 954
198 Ga0207710_10215244 3300025900 Bacteria 952
199 Ga0207647_10128799 3300025904 Bacteria 1488
200 Ga0207685_10006943 3300025905 Bacteria 3122
201 Ga0207685_10130482 3300025905 Bacteria 1115
202 Ga0207685_10403641 3300025905 Bacteria 701
203 Ga0207699_10002066 3300025906 Bacteria 9488
204 Ga0207699_10044558 3300025906 Bacteria 2583
205 Ga0207699_10107466 3300025906 Bacteria 1782
206 Ga0207699_10453028 3300025906 Bacteria 921
207 Ga0207705_10073886 3300025909 Bacteria 2474
208 Ga0207654_10115182 3300025911 Bacteria 1679
209 Ga0207707_10000143 3300025912 Bacteria 74226
210 Ga0207707_10008151 3300025912 Bacteria 9091
211 Ga0207707_10169452 3300025912 Bacteria 1908
212 Ga0207707_10456486 3300025912 Bacteria 1093
213 Ga0207695_10067035 3300025913 Bacteria 3683
214 Ga0207695_10073340 3300025913 Bacteria 3488
215 Ga0207695_10255073 3300025913 Bacteria 1653
216 Ga0207695_10612401 3300025913 Bacteria 970
217 Ga0207671_10029351 3300025914 Bacteria 4106
218 Ga0207671_10068414 3300025914 Bacteria 2646
219 Ga0207671_10189333 3300025914 Bacteria 1604
220 Ga0207693_10053219 3300025915 Bacteria 3176
221 Ga0207693_10233302 3300025915 Bacteria 1445
222 Ga0207663_10011778 3300025916 Bacteria 4709
223 Ga0207663_10019239 3300025916 Bacteria 3842
224 Ga0207663_10064626 3300025916 Bacteria 2336
225 Ga0207663_10134031 3300025916 Bacteria 1716
226 Ga0207663_10278310 3300025916 Bacteria 1242
227 Ga0207660_10079383 3300025917 Bacteria 2407
228 Ga0207660_10268635 3300025917 Bacteria 1351
229 Ga0207660_10270941 3300025917 Bacteria 1345
230 Ga0207657_10020015 3300025919 Bacteria 6338
231 Ga0207657_10443799 3300025919 Bacteria 1018
232 Ga0207657_10508421 3300025919 Bacteria 943
233 Ga0207649_10377953 3300025920 Bacteria 1055
234 Ga0207652_10059287 3300025921 Bacteria 3299
235 Ga0207652_10065253 3300025921 Bacteria 3152
236 Ga0207652_10139493 3300025921 Bacteria 2167
237 Ga0207646_10100880 3300025922 Bacteria 2588
238 Ga0207694_10050027 3300025924 Bacteria 3235
239 Ga0207694_10170150 3300025924 Bacteria 1764
240 Ga0207694_10212070 3300025924 Bacteria 1578
241 Ga0207694_10414069 3300025924 Bacteria 1122
242 Ga0207694_10678281 3300025924 Bacteria 869
243 Ga0207687_10441187 3300025927 Bacteria 1078
244 Ga0207700_10010020 3300025928 Bacteria 5955
245 Ga0207700_10024944 3300025928 Bacteria 4145
246 Ga0207700_10048102 3300025928 Bacteria 3165
247 Ga0207700_10415873 3300025928 Bacteria 1180
248 Ga0207664_10005551 3300025929 Bacteria 8637
249 Ga0207664_10016865 3300025929 Bacteria 5340
250 Ga0207664_10033029 3300025929 Bacteria 3972
251 Ga0207664_10061461 3300025929 Bacteria 2997
252 Ga0207664_10099462 3300025929 Bacteria 2400
253 Ga0207644_10700496 3300025931 Bacteria 844
254 Ga0207690_10164571 3300025932 Bacteria 1656
255 Ga0207690_11042477 3300025932 Bacteria 681
256 Ga0207686_10165909 3300025934 Bacteria 1553
257 Ga0207669_10397272 3300025937 Bacteria 1079
258 Ga0207665_10001678 3300025939 Bacteria 14897
259 Ga0207665_10039784 3300025939 Bacteria 3135
260 Ga0207665_10168214 3300025939 Bacteria 1581
261 Ga0207665_10184593 3300025939 Bacteria 1512
262 Ga0207711_10030129 3300025941 Bacteria 4577
263 Ga0207661_10014079 3300025944 Bacteria 5852
264 Ga0207661_10028137 3300025944 Bacteria 4301
265 Ga0207679_10631629 3300025945 Bacteria 967
266 Ga0207667_10157630 3300025949 Bacteria 2336
267 Ga0207667_10452707 3300025949 Bacteria 1304
268 Ga0207667_10595431 3300025949 Bacteria 1115
269 Ga0207667_11026702 3300025949 Bacteria 811
270 Ga0207668_11016449 3300025972 Bacteria 741
271 Ga0207677_10788932 3300026023 Bacteria 849
272 Ga0207703_10810726 3300026035 Bacteria 894
273 Ga0207639_10043716 3300026041 Bacteria 3365
274 Ga0207639_10045913 3300026041 Bacteria 3293
275 Ga0207639_10077369 3300026041 Bacteria 2623
276 Ga0207639_10279479 3300026041 Bacteria 1468
277 Ga0207639_10317635 3300026041 Bacteria 1382
278 Ga0207639_10687305 3300026041 Bacteria 949
279 Ga0207639_10965783 3300026041 Bacteria 797
280 Ga0207639_11426919 3300026041 Bacteria 650
281 Ga0207678_10029715 3300026067 Bacteria 4771
282 Ga0207678_10040442 3300026067 Bacteria 4044
283 Ga0207678_10548964 3300026067 Bacteria 1010
284 Ga0207702_10038470 3300026078 Bacteria 4006
285 Ga0207702_11491790 3300026078 Bacteria 670
286 Ga0207641_10307072 3300026088 Bacteria 1500
287 Ga0207641_11917874 3300026088 Bacteria 594
288 Ga0207648_11557684 3300026089 Bacteria 621
289 Ga0207674_10314566 3300026116 Bacteria 1515
290 Ga0207674_10731063 3300026116 Bacteria 955
291 Ga0207674_11339637 3300026116 Bacteria 685
292 Ga0207675_101399032 3300026118 Bacteria 720
293 Ga0207698_11707479 3300026142 Bacteria 645
294 Ga0209589_1000015 3300027357 Bacteria 225913
295 Ga0209489_100015 3300027361 Bacteria 225913
296 Ga0209700_100025 3300027363 Bacteria 225913
297 Ga0209179_1107354 3300027512 Bacteria 622
298 Ga0209813_10020777 3300027866 Bacteria 1841
299 Ga0209813_10091708 3300027866 Bacteria 1021
300 Ga0209813_10151328 3300027866 Bacteria 831
301 Ga0268266_10123778 3300028379 Bacteria 2304
302 Ga0268266_10137229 3300028379 Bacteria 2192
303 Ga0268266_11060635 3300028379 Bacteria 784
304 Ga0268264_10000356 3300028381 Bacteria 68810
305 Ga0268264_10216480 3300028381 Bacteria 1761
306 Ga0268264_10745283 3300028381 Bacteria 975
307 Ga0268264_11329672 3300028381 Bacteria 729
308 Ga0307515_10144812 3300028794 Bacteria 2524
309 Ga0307511_10052916 3300030521 Bacteria 3227
310 Ga0265339_10003456 3300031249 Bacteria 11055
311 Ga0307513_10368125 3300031456 Bacteria 1180
312 Ga0307509_10410203 3300031507 Bacteria 1058
313 Ga0307509_10444841 3300031507 Bacteria 991
314 Ga0307509_10697778 3300031507 Bacteria 681
315 Ga0307408_100394477 3300031548 Bacteria 1187
316 Ga0307408_100649534 3300031548 Bacteria 943
317 Ga0307408_101787184 3300031548 Bacteria 587
318 Ga0307508_10151308 3300031616 Bacteria 1925
319 Ga0307508_10228453 3300031616 Bacteria 1459
320 Ga0307516_10005305 3300031730 Bacteria 15512
321 Ga0307516_10429134 3300031730 Bacteria 979
322 Ga0307413_10400444 3300031824 Bacteria 1075
323 Ga0307413_11826406 3300031824 Bacteria 544
324 Ga0307412_10119958 3300031911 Bacteria 1892
325 Ga0307416_100143847 3300032002 Bacteria 2173
326 Ga0307416_102747813 3300032002 Bacteria 588
327 Ga0307415_100049710 3300032126 Bacteria 2837
328 Ga0307507_10035935 3300033179 Bacteria 5076
329 Ga0307510_10447895 3300033180 Bacteria 732
330 Ga0315911_1000021 3300033442 Bacteria 124874
331 Ga0316213_1011088 3300033546 Bacteria 623
332 Ga0316212_1024649 3300033547 Bacteria 844
333 Ga0373934_0029906 3300035086 Bacteria 2130
334 Ga0373944_0024328 3300035089 Bacteria 1774
335 Ga0373944_0237959 3300035089 Bacteria 669
336 Ga0373923_0239826 3300035111 Bacteria 846
337 Ga0373936_0014097 3300035113 Bacteria 3054
338 Ga0373936_0049975 3300035113 Bacteria 1690
339 Ga0373936_0069003 3300035113 Bacteria 1454
340 Ga0373936_0215720 3300035113 Bacteria 850
341 Ga0373954_0056253 3300035118 Bacteria 1851
342 Ga0373954_0453133 3300035118 Bacteria 635
343 Ga0373956_0112776 3300035119 Bacteria 1266
344 Ga0373957_0093408 3300035120 Bacteria 1198
345 Ga0373943_0031400 3300035170 Bacteria 2520
346 Ga0373943_0196543 3300035170 Bacteria 1115
347 Ga0373943_0273058 3300035170 Bacteria 954
348 Ga0373943_0350886 3300035170 Bacteria 845
349 Ga0373946_0001260 3300035171 Bacteria 8751
350 Ga0373946_0077383 3300035171 Bacteria 1450
351 Ga0373946_0250779 3300035171 Bacteria 863
352 Ga0373946_0366890 3300035171 Bacteria 722
353 Ga0373955_0045096 3300035172 Bacteria 2378
354 Ga0373955_0095339 3300035172 Bacteria 1702
355 Ga0373955_0944614 3300035172 Bacteria 531
356 Ga0373924_0039676 3300035410 Bacteria 1924
357 Ga0373924_0066137 3300035410 Bacteria 1519
358 Ga0373935_0001812 3300035692 Bacteria 11998
359 Ga0373935_0024407 3300035692 Bacteria 3721
360 Ga0373927_0000137 3300035695 Bacteria 56546
361 Ga0373927_0002991 3300035695 Bacteria 12261
362 Ga0373927_0078357 3300035695 Bacteria 2140
363 Ga0373933_0000108 3300035724 Bacteria 53024
364 Ga0373933_0134702 3300035724 Bacteria 1555
365 Ga0373933_0657158 3300035724 Bacteria 689
366 Ga0373933_0808791 3300035724 Bacteria 617
367 Ga0373947_0003829 3300035725 Bacteria 8862
368 Ga0373947_0004448 3300035725 Bacteria 8219
369 Ga0373947_0157962 3300035725 Bacteria 1464
370 Ga0373937_0050676 3300036401 Bacteria 3803
371 Ga0373937_0089555 3300036401 Bacteria 2849
372 Ga0373937_1320731 3300036401 Bacteria 669
373 Ga0373925_0006059 3300037068 Bacteria 8943
374 Ga0373925_0022185 3300037068 Bacteria 4629
375 Ga0373925_0151201 3300037068 Bacteria 1823
376 Ga0373925_0283129 3300037068 Bacteria 1335
377 Ga0395899_0226622 3300037312 Bacteria 1292
378 Ga0395899_0303076 3300037312 Bacteria 1081
379 Ga0395899_0354445 3300037312 Bacteria 980
380 Ga0395900_0001756 3300037418 Bacteria 24872
381 Ga0395900_0124887 3300037418 Bacteria 2639
382 Ga0395900_0207138 3300037418 Bacteria 1982
383 Ga0395900_0267181 3300037418 Bacteria 1706
384 Ga0395900_0769427 3300037418 Bacteria 892
385 Ga0395898_0005957 3300037466 Bacteria 13087
386 Ga0395898_0041792 3300037466 Bacteria 4526
387 Ga0395898_0153700 3300037466 Bacteria 2202
388 Ga0395898_0362281 3300037466 Bacteria 1382
389 Ga0395905_0801263 3300037471 Bacteria 845
390 Ga0436364_0493643 3300037853 Bacteria 921
391 Ga0395901_0130515 3300038443 Bacteria 2640
392 Ga0395901_0153136 3300038443 Bacteria 2422
393 Ga0395901_0410620 3300038443 Bacteria 1390
394 Ga0395901_0478583 3300038443 Bacteria 1270
395 Ga0436365_0215588 3300039437 Bacteria 1616
396 Ga0436365_0722182 3300039437 Bacteria 1068
397 Ga0436365_1313793 3300039437 Bacteria 737
398 Ga0436363_1499521 3300039450 Bacteria 2204
399 Ga0436363_1579090 3300039450 Bacteria 633
400 Ga0436362_0565497 3300039453 Bacteria 764
401 Ga0439465_0054270 3300041413 Bacteria 1318
402 Ga0451787_712164 3300041441 Bacteria 562
403 Ga0451793_0419078 3300041452 Bacteria 822
404 Ga0451793_1536432 3300041452 Bacteria 705
405 Ga0451800_0604730 3300041459 Bacteria 850
406 Ga0451802_1666841 3300041460 Bacteria 617
407 Ga0451804_0318545 3300041463 Bacteria 520
408 Ga0451833_0279636 3300041491 Bacteria 853
409 Ga0451839_0649857 3300041496 Bacteria 1163
410 Ga0466972_0532037 3300044658 Bacteria 554
411 Ga0466966_0159043 3300044684 Bacteria 1376
412 Ga0466963_0098934 3300044694 Bacteria 1994
413 Ga0466964_0072974 3300044706 Bacteria 1456
414 Ga0466971_0023831 3300044719 Bacteria 2728
415 Ga0466957_0067412 3300044842 Bacteria 2208
416 Ga0466960_0098962 3300044901 Bacteria 1499
417 Ga0466959_0165100 3300045049 Bacteria 1555
418 Ga0466967_0054112 3300045976 Bacteria 3530
419 Ga0466967_0082015 3300045976 Bacteria 2914
420 Ga0466967_0166550 3300045976 Bacteria 2071
421 Ga0466967_0414255 3300045976 Bacteria 1312
422 Ga0495617_240827 3300046452 Bacteria 559
423 Ga0495603_0000029 3300046455 Bacteria 60872
424 Ga0495603_0075818 3300046455 Bacteria 1974
425 Ga0495590_0023715 3300046457 Bacteria 2165
426 Ga0495629_0000029 3300046459 Bacteria 127000
427 Ga0495629_0064006 3300046459 Bacteria 2568
428 Ga0495641_0004254 3300046461 Bacteria 10233
429 Ga0495641_0125519 3300046461 Bacteria 1145
430 Ga0495651_0009405 3300046462 Bacteria 7507
431 Ga0495580_0000321 3300046472 Bacteria 39093
432 Ga0495580_0005864 3300046472 Bacteria 10082
433 Ga0495580_0369363 3300046472 Bacteria 970
434 Ga0495582_0000024 3300046473 Bacteria 82444
435 Ga0495582_0074426 3300046473 Bacteria 1880
436 Ga0495582_0122606 3300046473 Bacteria 1465
437 Ga0495639_0000006 3300046475 Bacteria 100361
438 Ga0495662_0000068 3300046476 Bacteria 36559
439 Ga0495664_0002214 3300046477 Bacteria 10401
440 Ga0495664_0040911 3300046477 Bacteria 2741
441 Ga0495594_0000170 3300046499 Bacteria 31295
442 Ga0495594_0033697 3300046499 Bacteria 2786
443 Ga0495607_0031664 3300046501 Bacteria 3235
444 Ga0495583_0078672 3300046506 Bacteria 1436
445 Ga0495606_0167138 3300046507 Bacteria 1279
446 Ga0495606_0250800 3300046507 Bacteria 982
447 Ga0495608_0651135 3300046511 Bacteria 629
448 Ga0495610_0019728 3300046512 Bacteria 3760
449 Ga0495616_0016693 3300046513 Bacteria 4057
450 Ga0495620_0017566 3300046515 Bacteria 3562
451 Ga0495628_0220994 3300046516 Bacteria 1423
452 Ga0495630_0018888 3300046517 Bacteria 5067
453 Ga0495631_0037304 3300046518 Bacteria 2166
454 Ga0495643_0020976 3300046522 Bacteria 3757
455 Ga0495648_0003177 3300046524 Bacteria 14623
456 Ga0495648_0029952 3300046524 Bacteria 3605
457 Ga0495666_0003580 3300046526 Bacteria 7855
458 Ga0495652_0005882 3300046529 Bacteria 11474
459 Ga0495652_0184450 3300046529 Bacteria 1598
460 Ga0495652_0880601 3300046529 Bacteria 592
461 Ga0495654_0012651 3300046530 Bacteria 4529
462 Ga0495665_0000158 3300046531 Bacteria 33789
463 Ga0495665_0091735 3300046531 Bacteria 1596
464 Ga0495640_0015043 3300046533 Bacteria 5830
465 Ga0495640_0048070 3300046533 Bacteria 2950
466 Ga0495587_0842458 3300046536 Bacteria 500
467 Ga0495622_0005431 3300046557 Bacteria 5915
468 Ga0495622_0020064 3300046557 Bacteria 3112
469 Ga0495622_0241732 3300046557 Bacteria 796
470 Ga0495634_0000354 3300046642 Bacteria 44714
471 Ga0495634_0082944 3300046642 Bacteria 2093
472 Ga0495611_0083924 3300046648 Bacteria 1468
473 Ga0495625_0032618 3300046660 Bacteria 3859
474 Ga0495625_0348221 3300046660 Bacteria 937
475 Ga0495625_0469897 3300046660 Bacteria 774
476 Ga0495635_0000179 3300046663 Bacteria 40014
477 Ga0495635_0060861 3300046663 Bacteria 2594
478 Ga0495661_0012280 3300046665 Bacteria 5785
479 Ga0495588_0001137 3300046674 Bacteria 11460
480 Ga0495588_0046993 3300046674 Bacteria 2215
481 Ga0495599_0233445 3300046678 Bacteria 1123
482 Ga0495623_0123297 3300046679 Bacteria 1558
483 Ga0495646_0012426 3300046680 Bacteria 5414
484 Ga0495646_0197301 3300046680 Bacteria 1098
485 Ga0495647_0000068 3300046681 Bacteria 25521
486 Ga0495658_0000428 3300046683 Bacteria 23516
487 Ga0495658_0075141 3300046683 Bacteria 1971
488 Ga0495613_0001281 3300046689 Bacteria 19201
489 Ga0495613_0204405 3300046689 Bacteria 1391
490 Ga0495613_0557486 3300046689 Bacteria 766
491 Ga0495624_0010213 3300046690 Bacteria 6471
492 Ga0495624_0455200 3300046690 Bacteria 767
493 Ga0495670_0012601 3300046691 Bacteria 4158
494 Ga0495671_0016996 3300046692 Bacteria 3875
495 Ga0495600_0039883 3300046809 Bacteria 3058
496 Ga0495600_0046129 3300046809 Bacteria 2844
497 Ga0495660_0021207 3300046810 Bacteria 3721
498 Ga0495581_0000004 3300047315 Bacteria 84424
499 Ga0495581_0048220 3300047315 Bacteria 2460
500 Ga0495604_0245286 3300047317 Bacteria 1223
501 Ga0495674_0000415 3300047319 Bacteria 38235
502 Ga0495674_0436311 3300047319 Bacteria 1054
503 Ga0495672_0041121 3300047320 Bacteria 2798
504 Ga0495676_0005774 3300047321 Bacteria 11351
505 Ga0495676_0075534 3300047321 Bacteria 2577
506 Ga0495680_0060220 3300047322 Bacteria 2928
507 Ga0495680_0116707 3300047322 Bacteria 1974
508 Ga0495675_0487689 3300047444 Bacteria 709
509 Ga0495684_0024669 3300047471 Bacteria 4628
510 Ga0495686_0013762 3300047472 Bacteria 5605
511 Ga0495686_0048332 3300047472 Bacteria 2683
512 Ga0495593_0000198 3300047673 Bacteria 31587
513 Ga0496100_0413967 3300048903 Bacteria 1028
514 Ga0496100_0520356 3300048903 Bacteria 918
515 Ga0496101_0165387 3300048904 Bacteria 1698
516 Ga0496101_0211159 3300048904 Bacteria 1504
517 Ga0496102_0130800 3300048905 Bacteria 2349
518 Ga0496102_0317899 3300048905 Bacteria 1467
519 Ga0496102_0625186 3300048905 Bacteria 1000
520 Ga0496102_1204962 3300048905 Bacteria 677
521 Ga0496103_0696530 3300048906 Bacteria 644
522 Ga0496103_1054148 3300048906 Bacteria 504
523 Ga0496104_0183863 3300048907 Bacteria 2000
524 Ga0496105_0137086 3300048908 Bacteria 2015
525 Ga0496106_0001358 3300048909 Bacteria 18318
526 Ga0496106_0143693 3300048909 Bacteria 1878
527 Ga0496106_0779194 3300048909 Bacteria 759
528 Ga0496109_0555928 3300048912 Bacteria 1083
529 Ga0496110_0048784 3300048913 Bacteria 3712
530 Ga0496110_0264227 3300048913 Bacteria 1566
531 Ga0496110_0292830 3300048913 Bacteria 1483
532 Ga0496110_0410823 3300048913 Bacteria 1234
533 Ga0496111_0021706 3300048914 Bacteria 4486
534 Ga0496112_0134441 3300048915 Bacteria 2443
535 Ga0496112_0978294 3300048915 Bacteria 766
536 Ga0496114_0126435 3300048917 Bacteria 2204
537 Ga0496114_0162845 3300048917 Bacteria 1941
538 Ga0496115_0029366 3300048918 Bacteria 4318
539 Ga0496115_0051103 3300048918 Bacteria 3314
540 Ga0496116_0047134 3300048919 Bacteria 2903
541 Ga0496116_0285945 3300048919 Bacteria 795
542 Ga0496117_0137648 3300048920 Bacteria 1468
543 Ga0496118_0003027 3300048921 Bacteria 21693
544 Ga0496118_0154601 3300048921 Bacteria 1429
545 Ga0496118_0619725 3300048921 Bacteria 514
546 Ga0496119_0024118 3300048922 Bacteria 4289
547 Ga0496120_0029287 3300048923 Bacteria 3363
548 Ga0496121_0001622 3300048924 Bacteria 37285
549 Ga0496121_0011130 3300048924 Bacteria 10036
550 Ga0496121_0027684 3300048924 Bacteria 5298
551 Ga0496121_0028197 3300048924 Bacteria 5232
552 Ga0496121_0036329 3300048924 Bacteria 4392
553 Ga0496121_0090542 3300048924 Bacteria 2391
554 Ga0496121_0108054 3300048924 Bacteria 2129
555 Ga0496121_0159478 3300048924 Bacteria 1651
556 Ga0496121_0389145 3300048924 Bacteria 917
557 Ga0496121_0450542 3300048924 Bacteria 829
558 Ga0496122_0182774 3300048925 Bacteria 1248
559 Ga0496123_0079125 3300048926 Bacteria 2010
560 Ga0496124_0002957 3300048927 Bacteria 21339
561 Ga0496124_0213217 3300048927 Bacteria 1459
562 Ga0496124_0390949 3300048927 Bacteria 969
563 Ga0496125_0001441 3300048928 Bacteria 34581
564 Ga0496125_0190143 3300048928 Bacteria 1356
565 Ga0496126_0003803 3300048929 Bacteria 18741
566 Ga0496126_0033555 3300048929 Bacteria 4827
567 Ga0496126_0038950 3300048929 Bacteria 4417
568 Ga0496126_0062191 3300048929 Bacteria 3351
569 Ga0496126_0142939 3300048929 Bacteria 2058
570 Ga0496126_0150846 3300048929 Bacteria 1992
571 Ga0496126_0202152 3300048929 Bacteria 1677
572 Ga0496126_0758138 3300048929 Bacteria 749
573 Ga0496126_0872559 3300048929 Bacteria 684
574 Ga0496126_1009675 3300048929 Bacteria 624
575 Ga0501032_0223651 3300049569 Bacteria 1224
576 Ga0501033_0035354 3300049570 Bacteria 3746
577 Ga0501033_0185891 3300049570 Bacteria 1488
578 Ga0501034_0368085 3300049571 Bacteria 1364
579 Ga0501034_0503683 3300049571 Bacteria 1124
580 Ga0501034_0776147 3300049571 Bacteria 852
581 Ga0501036_0179513 3300049572 Bacteria 1782
582 Ga0501037_0046687 3300049573 Bacteria 3176
583 Ga0501037_0429305 3300049573 Bacteria 904
584 Ga0501038_0385473 3300049574 Bacteria 1086
585 Ga0501038_0504904 3300049574 Bacteria 924
586 Ga0501039_0226534 3300049575 Bacteria 1469
587 Ga0501043_0056903 3300049579 Bacteria 3071
588 Ga0501043_0511946 3300049579 Bacteria 895
589 Ga0501046_0072915 3300049580 Bacteria 2665
590 Ga0501047_0227991 3300049581 Bacteria 1717
591 Ga0501047_0351579 3300049581 Bacteria 1310
592 Ga0501068_0249076 3300049584 Bacteria 1132
593 Ga0501069_0188866 3300049585 Bacteria 1192
594 Ga0501070_0104030 3300049586 Bacteria 2348
595 Ga0501070_0182844 3300049586 Bacteria 1725
596 Ga0501070_1125079 3300049586 Bacteria 605
597 Ga0501073_0197058 3300049589 Bacteria 1393
598 Ga0501074_0076527 3300049590 Bacteria 2402
599 Ga0501079_0260434 3300049741 Bacteria 1356
600 Ga0501080_0391278 3300049742 Bacteria 1251
601 Ga0501080_0873783 3300049742 Bacteria 785
602 Ga0501035_0247361 3300049822 Bacteria 1515
603 Ga0501044_0044865 3300049823 Bacteria 4584
604 Ga0501044_0061117 3300049823 Bacteria 3855
605 Ga0501044_0600658 3300049823 Bacteria 993
606 Ga0501045_0042384 3300049824 Bacteria 3313
607 nmdc:mga03683_655110_c1 3300050489 Bacteria 517
608 nmdc:mga03n38_119187_c1 3300050490 Bacteria 1295
609 nmdc:mga03n38_38955_c1 3300050490 Bacteria 2059
610 nmdc:mga03n38_50020_c1 3300050490 Bacteria 1861
611 nmdc:mga00v17_137589_c1 3300050491 Bacteria 1564
612 nmdc:mga00v17_454331_c1 3300050491 Bacteria 831
613 nmdc:mga00v17_53246_c1 3300050491 Bacteria 2466
614 nmdc:mga0yw44_206802_c1 3300050492 Bacteria 1298
615 nmdc:mga0yw44_30744_c1 3300050492 Bacteria 3116
616 nmdc:mga0yw44_5617_c1 3300050492 Bacteria 5962
617 nmdc:mga0yw44_63216_c1 3300050492 Bacteria 2276
618 nmdc:mga0k408_931187_c1 3300050493 Bacteria 504
619 nmdc:mga06z11_161315_c1 3300050494 Bacteria 1282
620 nmdc:mga06z11_190062_c1 3300050494 Bacteria 1188
621 nmdc:mga06z11_41158_c1 3300050494 Bacteria 2311
622 nmdc:mga04h51_267893_c1 3300050495 Bacteria 689
623 nmdc:mga04h51_33564_c1 3300050495 Bacteria 1635
624 nmdc:mga04h51_95129_c1 3300050495 Bacteria 1078
625 nmdc:mga07m45_408792_c1 3300050496 Bacteria 788
626 nmdc:mga07m45_593214_c1 3300050496 Bacteria 640
627 nmdc:mga0n895_5885_c1 3300050512 Bacteria 10304
628 nmdc:mga0rr50_1059667_c1 3300050513 Bacteria 690
629 nmdc:mga0rr50_1463421_c1 3300050513 Bacteria 578
630 nmdc:mga0rr50_283083_c1 3300050513 Bacteria 1384
631 Ga0495601_0179310 3300053077 Bacteria 1385
632 Ga0495601_0478816 3300053077 Bacteria 804
633 Ga0495612_0007133 3300053078 Bacteria 4575
634 Ga0500635_0010497 3300053080 Bacteria 2604
635 Ga0495619_0252345 3300053085 Bacteria 1222
636 Ga0500578_0076702 3300053086 Bacteria 2128
637 Ga0500643_070223 3300053087 Bacteria 972
638 Ga0500644_0004674 3300053088 Bacteria 3435
639 Ga0500581_104547 3300053089 Bacteria 1387
640 Ga0500651_0002004 3300053093 Bacteria 10570
641 Ga0500651_0070845 3300053093 Bacteria 2170
642 Ga0500566_0327065 3300053094 Bacteria 711
643 Ga0500641_0030496 3300053096 Bacteria 2119
644 Ga0500641_0155793 3300053096 Bacteria 985
645 Ga0500648_113526 3300053097 Bacteria 1493
646 Ga0500650_0220028 3300053098 Bacteria 860
647 Ga0500556_0000003 3300053104 Bacteria 679379
648 Ga0500558_117612 3300053106 Bacteria 1034
649 Ga0500572_000152 3300053111 Bacteria 24027
650 Ga0500592_001298 3300053116 Bacteria 4052
651 Ga0500594_0002506 3300053118 Bacteria 3995
652 Ga0500594_0012929 3300053118 Bacteria 1976
653 Ga0500595_000497 3300053119 Bacteria 23997
654 Ga0500595_014495 3300053119 Bacteria 2989
655 Ga0500597_335917 3300053120 Bacteria 592
656 Ga0500607_066218 3300053121 Bacteria 1875
657 Ga0500608_013688 3300053122 Bacteria 3602
658 Ga0500618_006607 3300053125 Bacteria 3387
659 Ga0500642_0000015 3300053130 Bacteria 181424
660 Ga0500642_0001744 3300053130 Bacteria 6273
661 Ga0500652_003561 3300053131 Bacteria 4724
662 Ga0500658_0041713 3300053134 Bacteria 1841
663 Ga0500658_0484314 3300053134 Bacteria 561
664 Ga0500559_0000230 3300053136 Bacteria 44504
665 Ga0500559_0054554 3300053136 Bacteria 1770
666 Ga0500568_0000536 3300053139 Bacteria 27978
667 Ga0500577_0007518 3300053142 Bacteria 3060
668 Ga0500586_000330 3300053145 Bacteria 9419
669 Ga0500588_0171166 3300053146 Bacteria 795
670 Ga0500590_080953 3300053148 Bacteria 1595
671 Ga0500590_173916 3300053148 Bacteria 943
672 Ga0500603_014003 3300053150 Bacteria 1868
673 Ga0500603_120404 3300053150 Bacteria 795
674 Ga0500604_0049230 3300053151 Bacteria 1296
675 Ga0500616_0000033 3300053153 Bacteria 398830
676 Ga0500619_308514 3300053154 Bacteria 509
677 Ga0500622_0017921 3300053156 Bacteria 3767
678 Ga0500633_0036925 3300053160 Bacteria 1618
679 Ga0500638_193486 3300053162 Bacteria 867
680 Ga0500639_067603 3300053163 Bacteria 1828
681 Ga0500636_0015308 3300053177 Bacteria 4519
682 Ga0500636_0044508 3300053177 Bacteria 2618
683 Ga0500636_0071990 3300053177 Bacteria 2003
684 Ga0500636_0118118 3300053177 Bacteria 1490
685 Ga0500636_0127824 3300053177 Bacteria 1419
686 Ga0500637_0233121 3300053178 Bacteria 1035
687 Ga0500637_0243180 3300053178 Bacteria 1008
688 Ga0500567_104152 3300053723 Bacteria 1171
689 Ga0500570_104841 3300053724 Bacteria 1172
690 Ga0500576_013023 3300053725 Bacteria 3728
691 Ga0500611_064792 3300053727 Bacteria 875
692 Ga0500611_074295 3300053727 Bacteria 835
693 Ga0500657_096055 3300053728 Bacteria 1236
694 Ga0500609_009819 3300053731 Bacteria 1288
695 Ga0500596_001316 3300053735 Bacteria 5006
696 Ga0500601_007557 3300053737 Bacteria 1205
697 Ga0587080_046267 3300059503 Bacteria 808
698 Ga0466962_0032344 3300061719 Bacteria 2504
699 2513659797 2513237096 Bacteria 8722461
700 2513857258 2513237137 Bacteria 9558895
701 2513918873 2513237145 Bacteria 8979722
702 2517888198 2517572143 Bacteria 9484767
703 2524533375 2524023228 Bacteria 10118060
704 2671119343 2667528175 Bacteria 7532676
705 2728753855 2728368998 Bacteria 8720350
706 2793073877 2791355197 Bacteria 8420563
707 2824605538 2824600985 Bacteria 8488197
708 2824610836 2824609381 Bacteria 8672835
709 2824653887 2824653114 Bacteria 8493680
710 2824663759 2824661429 Bacteria 9877870
711 2824676121 2824671348 Bacteria 8369588
712 2824692474 2824687955 Bacteria 8360029
713 2824699896 2824696289 Bacteria 8335049
714 2824706078 2824704595 Bacteria 9667483
715 2824737488 2824732956 Bacteria 7810675
716 2824748043 2824746037 Bacteria 7911610
717 2824760289 2824753945 Bacteria 9787441
718 2824771528 2824763712 Bacteria 9792355
719 2824775752 2824773399 Bacteria 8360218
720 2838125125 2838122688 Bacteria 8803140
721 2841945864 2841941048 Bacteria 8688029
722 2841956810 2841949485 Bacteria 8680857
723 2841965294 2841957949 Bacteria 8652217
724 2841973326 2841966195 Bacteria 8673214
725 2841979511 2841974524 Bacteria 8931498
726 2841989365 2841983080 Bacteria 8395090
727 2842044356 2842038055 Bacteria 8002051
728 2842051655 2842045827 Bacteria 8006841
729 2847939481 2847930680 Bacteria 9342022
730 2847941229 2847939898 Bacteria 8606328
731 2849082221 2849076700 Bacteria 7039503
732 2857513303 2857509624 Bacteria 7472071
733 2857525082 2857524615 Bacteria 6615449
734 2874622431 2874620515 Bacteria 8290088
735 2874633350 2874628541 Bacteria 8630250
736 2876761703 2876761206 Bacteria 10111113
737 2879091077 2879083081 Bacteria 8587928
738 2879106642 2879099564 Bacteria 10442239
739 2881369640 2881364244 Bacteria 7710352
740 2888389970 2888388044 Bacteria 7304136
741 2888421129 2888419890 Bacteria 7857137
742 2903752686 2903748898 Bacteria 9972761
743 2904671562 2904666416 Bacteria 8226587
744 2904692300 2904690495 Bacteria 9412302
745 2904709884
746 2904718105 2904711408 Bacteria 9771557
747 2906614445
748 2906643432 2906635258 Bacteria 8601019
749 2906666624 2906660503 Bacteria 8595048
750 2908764292 2908756301 Bacteria 8864324
751 2908776974 2908775508 Bacteria 8092255
752 2919078970 2919073203 Bacteria 6531949
753 2922377455
754 2935632664 2935630451 Bacteria 8169952
755 2941508672 2941507105 Bacteria 8166816
756 2941516502 2941515067 Bacteria 8166720
757 2941524482 2941523033 Bacteria 8169134
758 3005475643 3005474847 Bacteria 9259049
759 8006936976 8006933436 Bacteria 10410654
760 8006976944 8006973647 Bacteria 10679141
761 8019561696 8019555841 Bacteria 9642137
762 8056690835 8056689827 Bacteria 6712655
763 Ga0068857_101106779
764 rootH1_10019479
765 Ga0070683_100011764
766 Ga0070670_100196564
767 Ga0070666_10201710
768 Ga0070680_100242398
769 Ga0070682_100966243
770 Ga0068868_101074070
771 Ga0070660_100028099
772 Ga0070660_100538309
773 Ga0070691_10381214
774 Ga0070691_10518665
775 Ga0070661_100071112
776 Ga0070661_100351280
777 Ga0070668_100149406
778 Ga0070668_100189860
779 Ga0070675_102123200
780 Ga0070659_100183381
781 Ga0070709_10003406
782 Ga0070709_10025947
783 Ga0070709_10093269
784 Ga0070709_10223016
785 Ga0070714_100004471
786 Ga0070714_100007517
787 Ga0070714_100021788
788 Ga0070714_100035472
789 Ga0070714_100072214
790 Ga0070714_100199691
791 Ga0070713_100010463
792 Ga0070713_100021104
793 Ga0070713_100024195
794 Ga0070713_100043686
795 Ga0070713_100122233
796 Ga0070710_10000733
797 Ga0070710_10001588
798 Ga0070710_10017164
799 Ga0070711_100002277
800 Ga0070711_100060963
801 Ga0070711_100153941
802 Ga0070711_100203806
803 Ga0070711_100210944
804 Ga0070711_100501704
805 Ga0070711_101052250
806 Ga0070694_101081610
807 Ga0070708_100162019
808 Ga0070663_100174511
809 Ga0070663_100197919
810 Ga0070663_100341417
811 Ga0070663_101007845
812 Ga0070681_10206709
813 Ga0070681_10471015
814 Ga0068867_100481391
815 Ga0068867_101156915
816 Ga0070698_101158705
817 Ga0070698_101609657
818 Ga0070679_100079579
819 Ga0070679_100136719
820 Ga0070679_100163230
821 Ga0070679_100212191
822 Ga0070679_100553369
823 Ga0070684_100003951
824 Ga0070684_100027263
825 Ga0068853_100124111
826 Ga0068853_100192506
827 Ga0068853_100500133
828 Ga0070693_100391074
829 Ga0070693_100888608
830 Ga0070665_101261330
831 Ga0070665_101366564
832 Ga0068855_100147649
833 Ga0068855_100152593
834 Ga0068855_100309261
835 Ga0068855_100569281
836 Ga0068855_100817227
837 Ga0070664_100191447
838 Ga0068857_100027954
839 Ga0068857_100285687
840 Ga0068856_100048478
841 Ga0068856_100802722
842 Ga0070702_100163369
843 Ga0068852_100294178
844 Ga0068852_100720969
845 Ga0068866_11035800
846 Ga0068851_10053517
847 Ga0068858_101888535
848 Ga0068860_100772560
849 Ga0081455_10000450
850 Ga0081455_10170159
851 Ga0081455_10229170
852 Ga0081538_10021290
853 Ga0081540_1013373
854 Ga0081539_10062379
855 Ga0070717_10001116
856 Ga0070717_10008258
857 Ga0070717_10152621
858 Ga0070717_10810779
859 Ga0070717_10895087
860 Ga0075365_10017970
861 Ga0075365_10024727
862 Ga0075365_10149696
863 Ga0075368_10017845
864 Ga0075368_10478760
865 Ga0075363_100028887
866 Ga0075363_100055829
867 Ga0075363_100095281
868 Ga0075364_10033177
869 Ga0075364_10230463
870 Ga0070715_10003071
871 Ga0070715_10055413
872 Ga0070715_10260499
873 Ga0070716_100005362
874 Ga0070716_100274681
875 Ga0070712_100017464
876 Ga0070712_100057009
877 Ga0070712_100423249
878 Ga0075362_10002546
879 Ga0075362_10211633
880 Ga0075362_10707445
881 Ga0075367_10057460
882 Ga0075367_10149752
883 Ga0075367_10336706
884 Ga0075369_10098732
885 Ga0075369_10286512
886 Ga0097621_100410631
887 Ga0075370_10156209
888 Ga0068871_100413741
889 Ga0075434_100009502
890 Ga0099825_1066808
891 Ga0099824_1018691
892 Ga0099822_1000541
893 Ga0075435_100208728
894 Ga0075435_100510682
895 Ga0105251_10087189
896 Ga0105240_10033307
897 Ga0105240_10111009
898 Ga0105240_10648839
899 Ga0105245_10487544
900 Ga0105245_10921883
901 Ga0105245_11001853
902 Ga0105247_10203794
903 Ga0105247_10727329
904 Ga0105241_10651211
905 Ga0105242_10146191
906 Ga0105248_10042051
907 Ga0105237_10027168
908 Ga0105237_10053748
909 Ga0105237_10100986
910 Ga0105237_10143933
911 Ga0105237_10267578
912 Ga0105237_10608729
913 Ga0105237_11159283
914 Ga0105238_10009337
915 Ga0105238_10022426
916 Ga0105238_10073582
917 Ga0105238_10077355
918 Ga0105238_10276270
919 Ga0105238_10407788
920 Ga0105249_10349147
921 Ga0105239_10070346
922 Ga0105239_10103032
923 Ga0105239_10140615
924 Ga0105239_10465633
925 Ga0105239_10902164
926 Ga0105239_11088156
927 Ga0105239_11165926
928 Ga0105239_11363899
929 Ga0157373_10079620
930 Ga0157373_11160118
931 Ga0157370_10085090
932 Ga0157369_10114541
933 Ga0157374_10027912
934 Ga0157374_10948508
935 Ga0157374_11809208
936 Ga0157378_10961265
937 Ga0163162_10057235
938 Ga0163162_10141230
939 Ga0163162_11456893
940 Ga0157372_10915899
941 Ga0157372_11114818
942 Ga0157372_11738445
943 Ga0157372_13223740
944 Ga0157380_12557607
945 Ga0182008_10695121
946 Ga0182008_10770309
947 Ga0157379_10033261
948 Ga0157379_10791086
949 Ga0157376_11635224
950 Ga0157376_11825393
951 Ga0209148_1012921
952 Ga0209233_1015179
953 Ga0209564_1000718
954 Ga0207426_1006125
955 Ga0207692_10001008
956 Ga0207692_10006260
957 Ga0207692_10332765
958 Ga0207692_10489862
959 Ga0207710_10214390
960 Ga0207710_10215244
961 Ga0207647_10128799
962 Ga0207685_10006943
963 Ga0207685_10130482
964 Ga0207685_10403641
965 Ga0207699_10002066
966 Ga0207699_10044558
967 Ga0207699_10107466
968 Ga0207699_10453028
969 Ga0207705_10073886
970 Ga0207654_10115182
971 Ga0207707_10000143
972 Ga0207707_10008151
973 Ga0207707_10169452
974 Ga0207707_10456486
975 Ga0207695_10067035
976 Ga0207695_10073340
977 Ga0207695_10255073
978 Ga0207695_10612401
979 Ga0207671_10029351
980 Ga0207671_10068414
981 Ga0207671_10189333
982 Ga0207693_10053219
983 Ga0207693_10233302
984 Ga0207663_10011778
985 Ga0207663_10019239
986 Ga0207663_10064626
987 Ga0207663_10134031
988 Ga0207663_10278310
989 Ga0207660_10079383
990 Ga0207660_10268635
991 Ga0207660_10270941
992 Ga0207657_10020015
993 Ga0207657_10443799
994 Ga0207657_10508421
995 Ga0207649_10377953
996 Ga0207652_10059287
997 Ga0207652_10065253
998 Ga0207652_10139493
999 Ga0207646_10100880
1000 Ga0207694_10050027
1001 Ga0207694_10170150
1002 Ga0207694_10212070
1003 Ga0207694_10414069
1004 Ga0207694_10678281
1005 Ga0207687_10441187
1006 Ga0207700_10010020
1007 Ga0207700_10024944
1008 Ga0207700_10048102
1009 Ga0207700_10415873
1010 Ga0207664_10005551
1011 Ga0207664_10016865
1012 Ga0207664_10033029
1013 Ga0207664_10061461
1014 Ga0207664_10099462
1015 Ga0207644_10700496
1016 Ga0207690_10164571
1017 Ga0207690_11042477
1018 Ga0207686_10165909
1019 Ga0207669_10397272
1020 Ga0207665_10001678
1021 Ga0207665_10039784
1022 Ga0207665_10168214
1023 Ga0207665_10184593
1024 Ga0207711_10030129
1025 Ga0207661_10014079
1026 Ga0207661_10028137
1027 Ga0207679_10631629
1028 Ga0207667_10157630
1029 Ga0207667_10452707
1030 Ga0207667_10595431
1031 Ga0207667_11026702
1032 Ga0207668_11016449
1033 Ga0207677_10788932
1034 Ga0207703_10810726
1035 Ga0207639_10043716
1036 Ga0207639_10045913
1037 Ga0207639_10077369
1038 Ga0207639_10279479
1039 Ga0207639_10317635
1040 Ga0207639_10687305
1041 Ga0207639_10965783
1042 Ga0207639_11426919
1043 Ga0207678_10029715
1044 Ga0207678_10040442
1045 Ga0207678_10548964
1046 Ga0207702_10038470
1047 Ga0207702_11491790
1048 Ga0207641_10307072
1049 Ga0207641_11917874
1050 Ga0207648_11557684
1051 Ga0207674_10314566
1052 Ga0207674_10731063
1053 Ga0207674_11339637
1054 Ga0207675_101399032
1055 Ga0207698_11707479
1056 Ga0209589_1000015
1057 Ga0209489_100015
1058 Ga0209700_100025
1059 Ga0209179_1107354
1060 Ga0209813_10020777
1061 Ga0209813_10091708
1062 Ga0209813_10151328
1063 Ga0268266_10123778
1064 Ga0268266_10137229
1065 Ga0268266_11060635
1066 Ga0268264_10000356
1067 Ga0268264_10216480
1068 Ga0268264_10745283
1069 Ga0268264_11329672
1070 Ga0307515_10144812
1071 Ga0307511_10052916
1072 Ga0265339_10003456
1073 Ga0307513_10368125
1074 Ga0307509_10410203
1075 Ga0307509_10444841
1076 Ga0307509_10697778
1077 Ga0307408_100394477
1078 Ga0307408_100649534
1079 Ga0307408_101787184
1080 Ga0307508_10151308
1081 Ga0307508_10228453
1082 Ga0307516_10005305
1083 Ga0307516_10429134
1084 Ga0307413_10400444
1085 Ga0307413_11826406
1086 Ga0307412_10119958
1087 Ga0307416_100143847
1088 Ga0307416_102747813
1089 Ga0307415_100049710
1090 Ga0307507_10035935
1091 Ga0307510_10447895
1092 Ga0315911_1000021
1093 Ga0316213_1011088
1094 Ga0316212_1024649
1095 Ga0373934_0029906
1096 Ga0373944_0024328
1097 Ga0373944_0237959
1098 Ga0373923_0239826
1099 Ga0373936_0014097
1100 Ga0373936_0049975
1101 Ga0373936_0069003
1102 Ga0373936_0215720
1103 Ga0373954_0056253
1104 Ga0373954_0453133
1105 Ga0373956_0112776
1106 Ga0373957_0093408
1107 Ga0373943_0031400
1108 Ga0373943_0196543
1109 Ga0373943_0273058
1110 Ga0373943_0350886
1111 Ga0373946_0001260
1112 Ga0373946_0077383
1113 Ga0373946_0250779
1114 Ga0373946_0366890
1115 Ga0373955_0045096
1116 Ga0373955_0095339
1117 Ga0373955_0944614
1118 Ga0373924_0039676
1119 Ga0373924_0066137
1120 Ga0373935_0001812
1121 Ga0373935_0024407
1122 Ga0373927_0000137
1123 Ga0373927_0002991
1124 Ga0373927_0078357
1125 Ga0373933_0000108
1126 Ga0373933_0134702
1127 Ga0373933_0657158
1128 Ga0373933_0808791
1129 Ga0373947_0003829
1130 Ga0373947_0004448
1131 Ga0373947_0157962
1132 Ga0373937_0050676
1133 Ga0373937_0089555
1134 Ga0373937_1320731
1135 Ga0373925_0006059
1136 Ga0373925_0022185
1137 Ga0373925_0151201
1138 Ga0373925_0283129
1139 Ga0395899_0226622
1140 Ga0395899_0303076
1141 Ga0395899_0354445
1142 Ga0395900_0001756
1143 Ga0395900_0124887
1144 Ga0395900_0207138
1145 Ga0395900_0267181
1146 Ga0395900_0769427
1147 Ga0395898_0005957
1148 Ga0395898_0041792
1149 Ga0395898_0153700
1150 Ga0395898_0362281
1151 Ga0395905_0801263
1152 Ga0436364_0493643
1153 Ga0395901_0130515
1154 Ga0395901_0153136
1155 Ga0395901_0410620
1156 Ga0395901_0478583
1157 Ga0436365_0215588
1158 Ga0436365_0722182
1159 Ga0436365_1313793
1160 Ga0436363_1499521
1161 Ga0436363_1579090
1162 Ga0436362_0565497
1163 Ga0439465_0054270
1164 Ga0451787_712164
1165 Ga0451793_0419078
1166 Ga0451793_1536432
1167 Ga0451800_0604730
1168 Ga0451802_1666841
1169 Ga0451804_0318545
1170 Ga0451833_0279636
1171 Ga0451839_0649857
1172 Ga0466972_0532037
1173 Ga0466966_0159043
1174 Ga0466963_0098934
1175 Ga0466964_0072974
1176 Ga0466971_0023831
1177 Ga0466957_0067412
1178 Ga0466960_0098962
1179 Ga0466959_0165100
1180 Ga0466967_0054112
1181 Ga0466967_0082015
1182 Ga0466967_0166550
1183 Ga0466967_0414255
1184 Ga0495617_240827
1185 Ga0495603_0000029
1186 Ga0495603_0075818
1187 Ga0495590_0023715
1188 Ga0495629_0000029
1189 Ga0495629_0064006
1190 Ga0495641_0004254
1191 Ga0495641_0125519
1192 Ga0495651_0009405
1193 Ga0495580_0000321
1194 Ga0495580_0005864
1195 Ga0495580_0369363
1196 Ga0495582_0000024
1197 Ga0495582_0074426
1198 Ga0495582_0122606
1199 Ga0495639_0000006
1200 Ga0495662_0000068
1201 Ga0495664_0002214
1202 Ga0495664_0040911
1203 Ga0495594_0000170
1204 Ga0495594_0033697
1205 Ga0495607_0031664
1206 Ga0495583_0078672
1207 Ga0495606_0167138
1208 Ga0495606_0250800
1209 Ga0495608_0651135
1210 Ga0495610_0019728
1211 Ga0495616_0016693
1212 Ga0495620_0017566
1213 Ga0495628_0220994
1214 Ga0495630_0018888
1215 Ga0495631_0037304
1216 Ga0495643_0020976
1217 Ga0495648_0003177
1218 Ga0495648_0029952
1219 Ga0495666_0003580
1220 Ga0495652_0005882
1221 Ga0495652_0184450
1222 Ga0495652_0880601
1223 Ga0495654_0012651
1224 Ga0495665_0000158
1225 Ga0495665_0091735
1226 Ga0495640_0015043
1227 Ga0495640_0048070
1228 Ga0495587_0842458
1229 Ga0495622_0005431
1230 Ga0495622_0020064
1231 Ga0495622_0241732
1232 Ga0495634_0000354
1233 Ga0495634_0082944
1234 Ga0495611_0083924
1235 Ga0495625_0032618
1236 Ga0495625_0348221
1237 Ga0495625_0469897
1238 Ga0495635_0000179
1239 Ga0495635_0060861
1240 Ga0495661_0012280
1241 Ga0495588_0001137
1242 Ga0495588_0046993
1243 Ga0495599_0233445
1244 Ga0495623_0123297
1245 Ga0495646_0012426
1246 Ga0495646_0197301
1247 Ga0495647_0000068
1248 Ga0495658_0000428
1249 Ga0495658_0075141
1250 Ga0495613_0001281
1251 Ga0495613_0204405
1252 Ga0495613_0557486
1253 Ga0495624_0010213
1254 Ga0495624_0455200
1255 Ga0495670_0012601
1256 Ga0495671_0016996
1257 Ga0495600_0039883
1258 Ga0495600_0046129
1259 Ga0495660_0021207
1260 Ga0495581_0000004
1261 Ga0495581_0048220
1262 Ga0495604_0245286
1263 Ga0495674_0000415
1264 Ga0495674_0436311
1265 Ga0495672_0041121
1266 Ga0495676_0005774
1267 Ga0495676_0075534
1268 Ga0495680_0060220
1269 Ga0495680_0116707
1270 Ga0495675_0487689
1271 Ga0495684_0024669
1272 Ga0495686_0013762
1273 Ga0495686_0048332
1274 Ga0495593_0000198
1275 Ga0496100_0413967
1276 Ga0496100_0520356
1277 Ga0496101_0165387
1278 Ga0496101_0211159
1279 Ga0496102_0130800
1280 Ga0496102_0317899
1281 Ga0496102_0625186
1282 Ga0496102_1204962
1283 Ga0496103_0696530
1284 Ga0496103_1054148
1285 Ga0496104_0183863
1286 Ga0496105_0137086
1287 Ga0496106_0001358
1288 Ga0496106_0143693
1289 Ga0496106_0779194
1290 Ga0496109_0555928
1291 Ga0496110_0048784
1292 Ga0496110_0264227
1293 Ga0496110_0292830
1294 Ga0496110_0410823
1295 Ga0496111_0021706
1296 Ga0496112_0134441
1297 Ga0496112_0978294
1298 Ga0496114_0126435
1299 Ga0496114_0162845
1300 Ga0496115_0029366
1301 Ga0496115_0051103
1302 Ga0496116_0047134
1303 Ga0496116_0285945
1304 Ga0496117_0137648
1305 Ga0496118_0003027
1306 Ga0496118_0154601
1307 Ga0496118_0619725
1308 Ga0496119_0024118
1309 Ga0496120_0029287
1310 Ga0496121_0001622
1311 Ga0496121_0011130
1312 Ga0496121_0027684
1313 Ga0496121_0028197
1314 Ga0496121_0036329
1315 Ga0496121_0090542
1316 Ga0496121_0108054
1317 Ga0496121_0159478
1318 Ga0496121_0389145
1319 Ga0496121_0450542
1320 Ga0496122_0182774
1321 Ga0496123_0079125
1322 Ga0496124_0002957
1323 Ga0496124_0213217
1324 Ga0496124_0390949
1325 Ga0496125_0001441
1326 Ga0496125_0190143
1327 Ga0496126_0003803
1328 Ga0496126_0033555
1329 Ga0496126_0038950
1330 Ga0496126_0062191
1331 Ga0496126_0142939
1332 Ga0496126_0150846
1333 Ga0496126_0202152
1334 Ga0496126_0758138
1335 Ga0496126_0872559
1336 Ga0496126_1009675
1337 Ga0501032_0223651
1338 Ga0501033_0035354
1339 Ga0501033_0185891
1340 Ga0501034_0368085
1341 Ga0501034_0503683
1342 Ga0501034_0776147
1343 Ga0501036_0179513
1344 Ga0501037_0046687
1345 Ga0501037_0429305
1346 Ga0501038_0385473
1347 Ga0501038_0504904
1348 Ga0501039_0226534
1349 Ga0501043_0056903
1350 Ga0501043_0511946
1351 Ga0501046_0072915
1352 Ga0501047_0227991
1353 Ga0501047_0351579
1354 Ga0501068_0249076
1355 Ga0501069_0188866
1356 Ga0501070_0104030
1357 Ga0501070_0182844
1358 Ga0501070_1125079
1359 Ga0501073_0197058
1360 Ga0501074_0076527
1361 Ga0501079_0260434
1362 Ga0501080_0391278
1363 Ga0501080_0873783
1364 Ga0501035_0247361
1365 Ga0501044_0044865
1366 Ga0501044_0061117
1367 Ga0501044_0600658
1368 Ga0501045_0042384
1369 nmdc:mga03683_655110_c1
1370 nmdc:mga03n38_119187_c1
1371 nmdc:mga03n38_38955_c1
1372 nmdc:mga03n38_50020_c1
1373 nmdc:mga00v17_137589_c1
1374 nmdc:mga00v17_454331_c1
1375 nmdc:mga00v17_53246_c1
1376 nmdc:mga0yw44_206802_c1
1377 nmdc:mga0yw44_30744_c1
1378 nmdc:mga0yw44_5617_c1
1379 nmdc:mga0yw44_63216_c1
1380 nmdc:mga0k408_931187_c1
1381 nmdc:mga06z11_161315_c1
1382 nmdc:mga06z11_190062_c1
1383 nmdc:mga06z11_41158_c1
1384 nmdc:mga04h51_267893_c1
1385 nmdc:mga04h51_33564_c1
1386 nmdc:mga04h51_95129_c1
1387 nmdc:mga07m45_408792_c1
1388 nmdc:mga07m45_593214_c1
1389 nmdc:mga0n895_5885_c1
1390 nmdc:mga0rr50_1059667_c1
1391 nmdc:mga0rr50_1463421_c1
1392 nmdc:mga0rr50_283083_c1
1393 Ga0495601_0179310
1394 Ga0495601_0478816
1395 Ga0495612_0007133
1396 Ga0500635_0010497
1397 Ga0495619_0252345
1398 Ga0500578_0076702
1399 Ga0500643_070223
1400 Ga0500644_0004674
1401 Ga0500581_104547
1402 Ga0500651_0002004
1403 Ga0500651_0070845
1404 Ga0500566_0327065
1405 Ga0500641_0030496
1406 Ga0500641_0155793
1407 Ga0500648_113526
1408 Ga0500650_0220028
1409 Ga0500556_0000003
1410 Ga0500558_117612
1411 Ga0500572_000152
1412 Ga0500592_001298
1413 Ga0500594_0002506
1414 Ga0500594_0012929
1415 Ga0500595_000497
1416 Ga0500595_014495
1417 Ga0500597_335917
1418 Ga0500607_066218
1419 Ga0500608_013688
1420 Ga0500618_006607
1421 Ga0500642_0000015
1422 Ga0500642_0001744
1423 Ga0500652_003561
1424 Ga0500658_0041713
1425 Ga0500658_0484314
1426 Ga0500559_0000230
1427 Ga0500559_0054554
1428 Ga0500568_0000536
1429 Ga0500577_0007518
1430 Ga0500586_000330
1431 Ga0500588_0171166
1432 Ga0500590_080953
1433 Ga0500590_173916
1434 Ga0500603_014003
1435 Ga0500603_120404
1436 Ga0500604_0049230
1437 Ga0500616_0000033
1438 Ga0500619_308514
1439 Ga0500622_0017921
1440 Ga0500633_0036925
1441 Ga0500638_193486
1442 Ga0500639_067603
1443 Ga0500636_0015308
1444 Ga0500636_0044508
1445 Ga0500636_0071990
1446 Ga0500636_0118118
1447 Ga0500636_0127824
1448 Ga0500637_0233121
1449 Ga0500637_0243180
1450 Ga0500567_104152
1451 Ga0500570_104841
1452 Ga0500576_013023
1453 Ga0500611_064792
1454 Ga0500611_074295
1455 Ga0500657_096055
1456 Ga0500609_009819
1457 Ga0500596_001316
1458 Ga0500601_007557
1459 Ga0587080_046267
1460 Ga0466962_0032344
1461 2513659797
1462 2513857258
1463 2513918873
1464 2517888198
1465 2524533375
1466 2671119343
1467 2728753855
1468 2793073877
1469 2824605538
1470 2824610836
1471 2824653887
1472 2824663759
1473 2824676121
1474 2824692474
1475 2824699896
1476 2824706078
1477 2824737488
1478 2824748043
1479 2824760289
1480 2824771528
1481 2824775752
1482 2838125125
1483 2841945864
1484 2841956810
1485 2841965294
1486 2841973326
1487 2841979511
1488 2841989365
1489 2842044356
1490 2842051655
1491 2847939481
1492 2847941229
1493 2849082221
1494 2857513303
1495 2857525082
1496 2874622431
1497 2874633350
1498 2876761703
1499 2879091077
1500 2879106642
1501 2881369640
1502 2888389970
1503 2888421129
1504 2903752686
1505 2904671562
1506 2904692300
1507 2904709884
1508 2904718105
1509 2906614445
1510 2906643432
1511 2906666624
1512 2908764292
1513 2908776974
1514 2919078970
1515 2922377455
1516 2935632664
1517 2941508672
1518 2941516502
1519 2941524482
1520 3005475643
1521 8006936976
1522 8006976944
1523 8019561696
1524 8056690835

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11750

DUF3307

Protein of unknown function (DUF3307)

29

142

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
5a3f-assembly1.cif.gz_C crystal structure of the dynamin tetramer 0.448 12 99
8bqs-assembly1.cif.gz_AY cryo-em structure of the i-ii-iii2-iv2 respiratory supercomplex from tetrahymena thermophila 0.4152 15 103
6wp8-assembly1.cif.gz_A proton-pumping mutant of mastigocladopsis repens rhodopsin chloride pump 0.4137 12 134
7zoy-assembly1.cif.gz_A crystal structure of synechocystis halorhodopsin (syhr), so4-bound form, ground state 0.4021 12 135
1ktm-assembly1.cif.gz_A solution structure of fat domain of focal adhesion kinase 0.3932 12 136
ID Description Score Start End Superfamily
af_P9WFR7_179_308_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.4163 14 135 1.20.120.550
af_Q4DK79_238_388_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.408 13 133 1.20.120.550
af_P46567_18_314_1.20.1070.10 Mainly Alpha;Up-down Bundle;Rhopdopsin 7-helix transmembrane proteins;Rhodopsin 7-helix transmembrane proteins 0.4034 45 132 1.20.1070.10
af_A0A1P8AVE4_21_152_1.20.1420.10 Mainly Alpha;Up-down Bundle;A middle domain of Talin 1;Talin, central domain 0.4028 12 121 1.20.1420.10
af_P70600_859_1009_1.20.120.330 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Nucleotidyltransferases 0.3907 14 133 1.20.120.330
ID Description Score Start End GO Terms
AF-A0A4Q0R7A4-F1-model_v4 deleted 0.94 6 134
AF-A0A1Y2JH00-F1-model_v4 DUF3307 domain-containing protein 0.9307 20 134 GO:0016020
AF-A0A4Q0R7A4-F1-model_v4 deleted 0.926 6 134
AF-A0A1Y2JH00-F1-model_v4 DUF3307 domain-containing protein 0.9079 20 134 GO:0016020
AF-Q6N935-F1-model_v4 DUF3307 domain-containing protein 0.8844 1 136 GO:0016020

Map