F479578
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 761 | 281 | 748 | 124 |
Family's Representative Sequence
| Representative Sequence | 3300031548|Ga0307408_100021295|Ga0307408_1000212952 |
| Length | 128 |
| Sequence | MTDKQIKELTKAEDQVMRILWKLKEAIVKDIIEEMPEPRPAYNTVSTVIRVLETKGFIDHKTYGNSHVYFPIVEEKDYKAFAFDKVLSNYFNNSYQHLVSFLVDEKKIDDAELEELNQLVEKLKNSKK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 2 | 2585427687 | Pedobacter borealis DSM 19626 | Isolate | Rhizosphere |
| 3 | 2599185184 | Mucilaginibacter sp. NFR10 | Isolate | Rhizoplane |
| 4 | 2818991437 | Pedobacter terrae 518 | Isolate | Unclassified |
| 5 | 2919437846 | Mucilaginibacter pocheonensis 3262 | Isolate | Rhizosphere |
| 6 | 2928078545 | Mucilaginibacter rubeus 1215 | Isolate | Unclassified |
| 7 | 2928147474 | Mucilaginibacter rubeus 2025 | Isolate | Unclassified |
| 8 | 2932082852 | Mucilaginibacter sp. 3215 | Isolate | Rhizosphere |
| 9 | 2945997725 | Pedobacter sp. W3I1 | Isolate | Rhizosphere |
| 10 | 2954016120 | Flavobacterium sp. W4I14 | Isolate | Rhizosphere |
| 11 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 12 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 13 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 14 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 15 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 16 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 17 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 18 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 19 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 20 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 21 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 22 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 23 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 24 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 25 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 26 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 27 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 29 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 30 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 31 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 34 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 35 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 36 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 52 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 57 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 58 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 59 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 66 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 68 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 69 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 70 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 71 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 96 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 97 | 3300015682 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 101 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 102 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 103 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 104 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 105 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 106 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 107 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 108 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 110 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 111 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 154 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 155 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 156 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 157 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 158 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 159 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 160 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 161 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 162 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 163 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 164 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 165 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 166 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 167 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 168 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 169 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 170 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 172 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 173 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 174 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 175 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 176 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 177 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 178 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 179 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 180 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 186 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 187 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 188 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 189 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 190 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 191 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 192 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 193 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 194 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 195 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 196 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 197 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 198 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 246 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 247 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 248 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 249 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 252 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 253 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 254 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 255 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 256 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 257 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 258 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 260 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 261 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 262 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 263 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 264 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 265 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 266 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 267 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 268 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 269 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 270 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 271 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 272 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 273 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 274 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 275 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 276 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 277 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 278 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 279 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 280 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 281 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.55 |
| Metatranscriptomes | 0.13 |
| Isolates | 1.31 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.86 |
| Nodule | 0 |
| Rhizoplane | 1.18 |
| Rhizosphere | 83.44 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1008316 | 3300001904 | Bacteria | 1726 |
| 2 | JGI24736J21556_1011837 | 3300001904 | Bacteria | 1416 |
| 3 | JGI24739J22299_10015871 | 3300001989 | Bacteria | 2732 |
| 4 | JGI24737J22298_10001771 | 3300001990 | Bacteria | 7731 |
| 5 | JGI24737J22298_10002233 | 3300001990 | Bacteria | 6906 |
| 6 | JGI24735J21928_10000004 | 3300002067 | Bacteria | 381713 |
| 7 | JGI24735J21928_10000033 | 3300002067 | Bacteria | 70674 |
| 8 | JGI25162J39368_1000008 | 3300002737 | Bacteria | 397212 |
| 9 | JGI25162J39368_1000017 | 3300002737 | Bacteria | 281385 |
| 10 | JGI25162J39368_1001793 | 3300002737 | Bacteria | 10128 |
| 11 | JGI25157J39369_1004659 | 3300002741 | Bacteria | 2423 |
| 12 | JGI25164J39214_1001237 | 3300002772 | Bacteria | 6806 |
| 13 | JGI25150J39212_1000003 | 3300002774 | Bacteria | 508651 |
| 14 | JGI25151J46595_10000002 | 3300003187 | Bacteria | 731381 |
| 15 | JGI25165J46597_1002573 | 3300003214 | Bacteria | 5571 |
| 16 | JGI25165J46597_1036456 | 3300003214 | Bacteria | 633 |
| 17 | JGI25165J46597_1050527 | 3300003214 | Bacteria | 533 |
| 18 | JGI25153J46596_10000015 | 3300003215 | Bacteria | 289820 |
| 19 | rootH1_10008126 | 3300003316 | Bacteria | 20133 |
| 20 | rootH1_10063127 | 3300003316 | Bacteria | 8410 |
| 21 | rootH1_10063127 | 3300003323 | Bacteria | 2558 |
| 22 | rootH2_10003269 | 3300003320 | Bacteria | 51191 |
| 23 | rootH2_10057796 | 3300003320 | Bacteria | 14763 |
| 24 | rootH2_10103643 | 3300003320 | Bacteria | 6540 |
| 25 | rootH2_10196503 | 3300003320 | Bacteria | 2327 |
| 26 | rootH2_10269298 | 3300003320 | Bacteria | 1656 |
| 27 | rootH2_10284133 | 3300003320 | Bacteria | 3346 |
| 28 | rootL2_10035013 | 3300003322 | Bacteria | 6529 |
| 29 | rootL2_10132836 | 3300003322 | Bacteria | 7653 |
| 30 | rootH1_10005934 | 3300003323 | Bacteria | 5270 |
| 31 | rootH1_10010138 | 3300003323 | Bacteria | 25280 |
| 32 | rootH1_10062209 | 3300003323 | Bacteria | 4973 |
| 33 | rootH1_10064415 | 3300003323 | Bacteria | 4744 |
| 34 | rootH1_10110019 | 3300003323 | Bacteria | 4748 |
| 35 | rootH1_10192260 | 3300003323 | Bacteria | 2031 |
| 36 | Ga0055529_1007859 | 3300003763 | Bacteria | 1434 |
| 37 | Ga0055536_1048487 | 3300003781 | Bacteria | 950 |
| 38 | Ga0065165_1000442 | 3300005262 | Bacteria | 65218 |
| 39 | Ga0065714_10002307 | 3300005288 | Bacteria | 26043 |
| 40 | Ga0065714_10011237 | 3300005288 | Bacteria | 3077 |
| 41 | Ga0065714_10014328 | 3300005288 | Bacteria | 2987 |
| 42 | Ga0065714_10065739 | 3300005288 | Bacteria | 8667 |
| 43 | Ga0065714_10126805 | 3300005288 | Bacteria | 1288 |
| 44 | Ga0065714_10197124 | 3300005288 | Bacteria | 908 |
| 45 | Ga0065714_10453425 | 3300005288 | Bacteria | 552 |
| 46 | Ga0065704_10070323 | 3300005289 | Bacteria | 32863 |
| 47 | Ga0065704_10096827 | 3300005289 | Bacteria | 2422 |
| 48 | Ga0065704_10179121 | 3300005289 | Bacteria | 1247 |
| 49 | Ga0065704_10396737 | 3300005289 | Bacteria | 756 |
| 50 | Ga0065704_10599986 | 3300005289 | Bacteria | 607 |
| 51 | Ga0070658_10000008 | 3300005327 | Bacteria | 319912 |
| 52 | Ga0070658_10000018 | 3300005327 | Bacteria | 200558 |
| 53 | Ga0070658_10082680 | 3300005327 | Bacteria | 2639 |
| 54 | Ga0070658_10324086 | 3300005327 | Bacteria | 1316 |
| 55 | Ga0070658_10353375 | 3300005327 | Bacteria | 1258 |
| 56 | Ga0070676_10000465 | 3300005328 | Bacteria | 19425 |
| 57 | Ga0068869_100117037 | 3300005334 | Bacteria | 2034 |
| 58 | Ga0070680_100007970 | 3300005336 | Bacteria | 8085 |
| 59 | Ga0068868_100143907 | 3300005338 | Bacteria | 1959 |
| 60 | Ga0068868_100378158 | 3300005338 | Bacteria | 1218 |
| 61 | Ga0070660_100008700 | 3300005339 | Bacteria | 7107 |
| 62 | Ga0070660_100024084 | 3300005339 | Bacteria | 4516 |
| 63 | Ga0070660_100043103 | 3300005339 | Bacteria | 3447 |
| 64 | Ga0070660_100216474 | 3300005339 | Bacteria | 1556 |
| 65 | Ga0070691_10205642 | 3300005341 | Bacteria | 1036 |
| 66 | Ga0070661_101109689 | 3300005344 | Bacteria | 659 |
| 67 | Ga0070675_100823046 | 3300005354 | Unclassified | 849 |
| 68 | Ga0070671_100003365 | 3300005355 | Bacteria | 12470 |
| 69 | Ga0070671_100859824 | 3300005355 | Bacteria | 791 |
| 70 | Ga0070674_100054220 | 3300005356 | Bacteria | 2772 |
| 71 | Ga0070674_100365545 | 3300005356 | Bacteria | 1169 |
| 72 | Ga0070673_100002665 | 3300005364 | Bacteria | 10922 |
| 73 | Ga0070673_101008862 | 3300005364 | Bacteria | 775 |
| 74 | Ga0070659_100000899 | 3300005366 | Bacteria | 21771 |
| 75 | Ga0070659_100018025 | 3300005366 | Bacteria | 5324 |
| 76 | Ga0070713_100789340 | 3300005436 | Bacteria | 910 |
| 77 | Ga0070711_101882967 | 3300005439 | Bacteria | 525 |
| 78 | Ga0070663_100247673 | 3300005455 | Bacteria | 1409 |
| 79 | Ga0070678_100634535 | 3300005456 | Unclassified | 957 |
| 80 | Ga0070678_101080335 | 3300005456 | Bacteria | 740 |
| 81 | Ga0070662_100000062 | 3300005457 | Bacteria | 57251 |
| 82 | Ga0070662_100343429 | 3300005457 | Unclassified | 1222 |
| 83 | Ga0070681_10112980 | 3300005458 | Bacteria | 2656 |
| 84 | Ga0068867_100000923 | 3300005459 | Bacteria | 19973 |
| 85 | Ga0070679_100089205 | 3300005530 | Bacteria | 3071 |
| 86 | Ga0070679_100263095 | 3300005530 | Bacteria | 1680 |
| 87 | Ga0070684_100017533 | 3300005535 | Bacteria | 5880 |
| 88 | Ga0068853_100010560 | 3300005539 | Bacteria | 7467 |
| 89 | Ga0068853_100026830 | 3300005539 | Bacteria | 4839 |
| 90 | Ga0068853_100069159 | 3300005539 | Bacteria | 3071 |
| 91 | Ga0068853_100083870 | 3300005539 | Bacteria | 2792 |
| 92 | Ga0068853_100114242 | 3300005539 | Bacteria | 2401 |
| 93 | Ga0068853_100604955 | 3300005539 | Bacteria | 1041 |
| 94 | Ga0068853_100870262 | 3300005539 | Bacteria | 865 |
| 95 | Ga0070672_100546171 | 3300005543 | Unclassified | 1006 |
| 96 | Ga0070665_100000118 | 3300005548 | Bacteria | 149830 |
| 97 | Ga0070665_100332761 | 3300005548 | Bacteria | 1523 |
| 98 | Ga0068855_100000268 | 3300005563 | Bacteria | 64693 |
| 99 | Ga0068855_100000967 | 3300005563 | Bacteria | 35748 |
| 100 | Ga0068855_100001431 | 3300005563 | Bacteria | 29691 |
| 101 | Ga0068855_100015178 | 3300005563 | Bacteria | 9276 |
| 102 | Ga0068855_100027421 | 3300005563 | Bacteria | 6814 |
| 103 | Ga0068855_100029172 | 3300005563 | Bacteria | 6597 |
| 104 | Ga0068855_100048451 | 3300005563 | Bacteria | 5014 |
| 105 | Ga0068855_100113905 | 3300005563 | Bacteria | 3101 |
| 106 | Ga0068855_100123199 | 3300005563 | Bacteria | 2966 |
| 107 | Ga0068855_100149792 | 3300005563 | Bacteria | 2653 |
| 108 | Ga0068855_100162582 | 3300005563 | Bacteria | 2533 |
| 109 | Ga0068855_100237010 | 3300005563 | Bacteria | 2040 |
| 110 | Ga0068855_100286932 | 3300005563 | Bacteria | 1826 |
| 111 | Ga0068855_100350233 | 3300005563 | Bacteria | 1627 |
| 112 | Ga0068855_100453218 | 3300005563 | Bacteria | 1399 |
| 113 | Ga0068855_100493919 | 3300005563 | Bacteria | 1331 |
| 114 | Ga0068855_101053690 | 3300005563 | Unclassified | 852 |
| 115 | Ga0068855_101429179 | 3300005563 | Unclassified | 712 |
| 116 | Ga0068857_100131311 | 3300005577 | Bacteria | 2259 |
| 117 | Ga0068857_100248276 | 3300005577 | Bacteria | 1631 |
| 118 | Ga0068857_100257090 | 3300005577 | Bacteria | 1602 |
| 119 | Ga0068854_100057394 | 3300005578 | Bacteria | 2808 |
| 120 | Ga0068856_100017859 | 3300005614 | Bacteria | 6880 |
| 121 | Ga0068856_100057792 | 3300005614 | Bacteria | 3830 |
| 122 | Ga0068856_100078687 | 3300005614 | Bacteria | 3269 |
| 123 | Ga0068856_100101403 | 3300005614 | Bacteria | 2871 |
| 124 | Ga0068856_100277659 | 3300005614 | Bacteria | 1692 |
| 125 | Ga0068856_100295764 | 3300005614 | Bacteria | 1636 |
| 126 | Ga0068856_100461380 | 3300005614 | Bacteria | 1291 |
| 127 | Ga0068856_100624835 | 3300005614 | Bacteria | 1098 |
| 128 | Ga0068856_100705530 | 3300005614 | Bacteria | 1029 |
| 129 | Ga0068856_101220242 | 3300005614 | Unclassified | 768 |
| 130 | Ga0068856_101597234 | 3300005614 | Bacteria | 665 |
| 131 | Ga0068852_100000862 | 3300005616 | Bacteria | 20158 |
| 132 | Ga0068852_100114709 | 3300005616 | Bacteria | 2455 |
| 133 | Ga0068852_100367581 | 3300005616 | Bacteria | 1408 |
| 134 | Ga0068866_10056329 | 3300005718 | Bacteria | 2021 |
| 135 | Ga0068866_10751871 | 3300005718 | Unclassified | 673 |
| 136 | Ga0068870_10173517 | 3300005840 | Bacteria | 1288 |
| 137 | Ga0068863_100863440 | 3300005841 | Bacteria | 904 |
| 138 | Ga0068858_100120307 | 3300005842 | Bacteria | 2455 |
| 139 | Ga0068858_100205347 | 3300005842 | Unclassified | 1864 |
| 140 | Ga0068858_102545755 | 3300005842 | Bacteria | 505 |
| 141 | Ga0075366_10001407 | 3300006195 | Bacteria | 12029 |
| 142 | Ga0075366_10001542 | 3300006195 | Bacteria | 11528 |
| 143 | Ga0075366_10005056 | 3300006195 | Bacteria | 7128 |
| 144 | Ga0075366_10017247 | 3300006195 | Bacteria | 4154 |
| 145 | Ga0075366_10098559 | 3300006195 | Bacteria | 1753 |
| 146 | Ga0075366_10171616 | 3300006195 | Bacteria | 1316 |
| 147 | Ga0097621_100000015 | 3300006237 | Bacteria | 92182 |
| 148 | Ga0097621_101394576 | 3300006237 | Bacteria | 663 |
| 149 | Ga0075370_10495317 | 3300006353 | Bacteria | 737 |
| 150 | Ga0068871_100000051 | 3300006358 | Bacteria | 64844 |
| 151 | Ga0075430_100484944 | 3300006846 | Bacteria | 1020 |
| 152 | Ga0068865_100000120 | 3300006881 | Bacteria | 39809 |
| 153 | Ga0105244_10041432 | 3300009036 | Bacteria | 2386 |
| 154 | Ga0105244_10163055 | 3300009036 | Bacteria | 1064 |
| 155 | Ga0105240_10000185 | 3300009093 | Bacteria | 126364 |
| 156 | Ga0105240_10002706 | 3300009093 | Bacteria | 28164 |
| 157 | Ga0105240_10013632 | 3300009093 | Bacteria | 11146 |
| 158 | Ga0105240_10039125 | 3300009093 | Bacteria | 6076 |
| 159 | Ga0105240_10049341 | 3300009093 | Bacteria | 5313 |
| 160 | Ga0105240_10079337 | 3300009093 | Bacteria | 4039 |
| 161 | Ga0105240_10143852 | 3300009093 | Bacteria | 2848 |
| 162 | Ga0105240_10149122 | 3300009093 | Bacteria | 2787 |
| 163 | Ga0105240_10184556 | 3300009093 | Unclassified | 2458 |
| 164 | Ga0105240_10240981 | 3300009093 | Unclassified | 2096 |
| 165 | Ga0105240_10298268 | 3300009093 | Bacteria | 1844 |
| 166 | Ga0105240_10312511 | 3300009093 | Bacteria | 1794 |
| 167 | Ga0105240_10312672 | 3300009093 | Bacteria | 1793 |
| 168 | Ga0105240_10337375 | 3300009093 | Bacteria | 1713 |
| 169 | Ga0105240_10362581 | 3300009093 | Bacteria | 1641 |
| 170 | Ga0105240_10477310 | 3300009093 | Bacteria | 1391 |
| 171 | Ga0105240_10713281 | 3300009093 | Bacteria | 1094 |
| 172 | Ga0105240_11154335 | 3300009093 | Bacteria | 822 |
| 173 | Ga0105240_11233548 | 3300009093 | Bacteria | 791 |
| 174 | Ga0105240_12343157 | 3300009093 | Bacteria | 553 |
| 175 | Ga0114129_11076180 | 3300009147 | Bacteria | 1008 |
| 176 | Ga0105243_10034277 | 3300009148 | Bacteria | 3929 |
| 177 | Ga0105241_10001267 | 3300009174 | Bacteria | 19273 |
| 178 | Ga0105241_10003621 | 3300009174 | Bacteria | 11483 |
| 179 | Ga0105241_10011403 | 3300009174 | Bacteria | 6515 |
| 180 | Ga0105241_10030063 | 3300009174 | Bacteria | 4057 |
| 181 | Ga0105241_10055766 | 3300009174 | Bacteria | 3028 |
| 182 | Ga0105241_10069549 | 3300009174 | Bacteria | 2730 |
| 183 | Ga0105241_10110233 | 3300009174 | Bacteria | 2202 |
| 184 | Ga0105241_10178991 | 3300009174 | Bacteria | 1757 |
| 185 | Ga0105241_10306878 | 3300009174 | Bacteria | 1364 |
| 186 | Ga0105241_10427269 | 3300009174 | Bacteria | 1167 |
| 187 | Ga0105241_10475229 | 3300009174 | Unclassified | 1110 |
| 188 | Ga0105241_10613444 | 3300009174 | Bacteria | 984 |
| 189 | Ga0105241_11418315 | 3300009174 | Bacteria | 665 |
| 190 | Ga0105242_10172286 | 3300009176 | Bacteria | 1903 |
| 191 | Ga0105242_10772372 | 3300009176 | Bacteria | 948 |
| 192 | Ga0105242_11091223 | 3300009176 | Bacteria | 811 |
| 193 | Ga0105237_10000758 | 3300009545 | Bacteria | 44281 |
| 194 | Ga0105237_10000887 | 3300009545 | Bacteria | 40325 |
| 195 | Ga0105237_10002011 | 3300009545 | Bacteria | 25894 |
| 196 | Ga0105237_10007579 | 3300009545 | Bacteria | 11865 |
| 197 | Ga0105237_10008366 | 3300009545 | Bacteria | 11216 |
| 198 | Ga0105237_10016912 | 3300009545 | Bacteria | 7568 |
| 199 | Ga0105237_10031079 | 3300009545 | Bacteria | 5417 |
| 200 | Ga0105237_10159958 | 3300009545 | Bacteria | 2250 |
| 201 | Ga0105237_10258257 | 3300009545 | Unclassified | 1745 |
| 202 | Ga0105237_10417292 | 3300009545 | Bacteria | 1347 |
| 203 | Ga0105237_10433497 | 3300009545 | Bacteria | 1320 |
| 204 | Ga0105237_11340306 | 3300009545 | Bacteria | 722 |
| 205 | Ga0105237_12048883 | 3300009545 | Bacteria | 581 |
| 206 | Ga0105237_12560937 | 3300009545 | Bacteria | 521 |
| 207 | Ga0105238_10015398 | 3300009551 | Bacteria | 7739 |
| 208 | Ga0105238_10039973 | 3300009551 | Bacteria | 4754 |
| 209 | Ga0105238_10278348 | 3300009551 | Unclassified | 1654 |
| 210 | Ga0105238_10363107 | 3300009551 | Bacteria | 1438 |
| 211 | Ga0105238_10621345 | 3300009551 | Bacteria | 1089 |
| 212 | Ga0105238_10798214 | 3300009551 | Bacteria | 959 |
| 213 | Ga0105249_10194085 | 3300009553 | Bacteria | 1983 |
| 214 | Ga0105239_10000142 | 3300010375 | Bacteria | 101628 |
| 215 | Ga0105239_10001435 | 3300010375 | Bacteria | 31777 |
| 216 | Ga0105239_10001468 | 3300010375 | Bacteria | 31351 |
| 217 | Ga0105239_10002256 | 3300010375 | Bacteria | 24634 |
| 218 | Ga0105239_10002374 | 3300010375 | Bacteria | 24005 |
| 219 | Ga0105239_10003905 | 3300010375 | Bacteria | 18072 |
| 220 | Ga0105239_10004588 | 3300010375 | Bacteria | 16460 |
| 221 | Ga0105239_10022631 | 3300010375 | Bacteria | 6929 |
| 222 | Ga0105239_10029834 | 3300010375 | Bacteria | 5997 |
| 223 | Ga0105239_10031340 | 3300010375 | Bacteria | 5849 |
| 224 | Ga0105239_10075942 | 3300010375 | Bacteria | 3695 |
| 225 | Ga0105239_10076804 | 3300010375 | Bacteria | 3674 |
| 226 | Ga0105239_10105106 | 3300010375 | Bacteria | 3127 |
| 227 | Ga0105239_10107988 | 3300010375 | Bacteria | 3083 |
| 228 | Ga0105239_10599474 | 3300010375 | Bacteria | 1256 |
| 229 | Ga0105239_11299316 | 3300010375 | Bacteria | 839 |
| 230 | Ga0105239_11817595 | 3300010375 | Bacteria | 706 |
| 231 | Ga0105239_13209637 | 3300010375 | Bacteria | 532 |
| 232 | Ga0105246_10047095 | 3300011119 | Bacteria | 2943 |
| 233 | Ga0105246_10107474 | 3300011119 | Bacteria | 2043 |
| 234 | Ga0157373_10000254 | 3300013100 | Bacteria | 43477 |
| 235 | Ga0157373_10000262 | 3300013100 | Bacteria | 42799 |
| 236 | Ga0157373_10022406 | 3300013100 | Bacteria | 4583 |
| 237 | Ga0157373_10029292 | 3300013100 | Bacteria | 3965 |
| 238 | Ga0157373_10247498 | 3300013100 | Bacteria | 1260 |
| 239 | Ga0157371_10000117 | 3300013102 | Bacteria | 121069 |
| 240 | Ga0157371_10000912 | 3300013102 | Bacteria | 33281 |
| 241 | Ga0157371_10001520 | 3300013102 | Bacteria | 23949 |
| 242 | Ga0157371_10002174 | 3300013102 | Bacteria | 19066 |
| 243 | Ga0157371_10004362 | 3300013102 | Bacteria | 12386 |
| 244 | Ga0157371_10013752 | 3300013102 | Bacteria | 6135 |
| 245 | Ga0157371_10022859 | 3300013102 | Bacteria | 4574 |
| 246 | Ga0157371_10158350 | 3300013102 | Bacteria | 1617 |
| 247 | Ga0157371_10168306 | 3300013102 | Bacteria | 1565 |
| 248 | Ga0157371_10226002 | 3300013102 | Bacteria | 1344 |
| 249 | Ga0157370_10003772 | 3300013104 | Bacteria | 17695 |
| 250 | Ga0157370_10009721 | 3300013104 | Bacteria | 10224 |
| 251 | Ga0157370_10010234 | 3300013104 | Bacteria | 9902 |
| 252 | Ga0157370_10019570 | 3300013104 | Bacteria | 6784 |
| 253 | Ga0157370_10025999 | 3300013104 | Bacteria | 5784 |
| 254 | Ga0157370_10071814 | 3300013104 | Bacteria | 3266 |
| 255 | Ga0157370_10075503 | 3300013104 | Bacteria | 3177 |
| 256 | Ga0157370_10143214 | 3300013104 | Unclassified | 2226 |
| 257 | Ga0157370_10188263 | 3300013104 | Bacteria | 1916 |
| 258 | Ga0157370_10195676 | 3300013104 | Bacteria | 1876 |
| 259 | Ga0157370_10269129 | 3300013104 | Bacteria | 1574 |
| 260 | Ga0157370_10466876 | 3300013104 | Bacteria | 1160 |
| 261 | Ga0157370_10494717 | 3300013104 | Bacteria | 1123 |
| 262 | Ga0157370_10596957 | 3300013104 | Bacteria | 1011 |
| 263 | Ga0157370_10790550 | 3300013104 | Bacteria | 864 |
| 264 | Ga0157370_10957935 | 3300013104 | Bacteria | 776 |
| 265 | Ga0157369_10000015 | 3300013105 | Bacteria | 262917 |
| 266 | Ga0157369_10000047 | 3300013105 | Bacteria | 172682 |
| 267 | Ga0157369_10000101 | 3300013105 | Bacteria | 118683 |
| 268 | Ga0157369_10235298 | 3300013105 | Bacteria | 1914 |
| 269 | Ga0157369_10237711 | 3300013105 | Bacteria | 1903 |
| 270 | Ga0157369_10247576 | 3300013105 | Bacteria | 1861 |
| 271 | Ga0157369_10303928 | 3300013105 | Bacteria | 1659 |
| 272 | Ga0157369_10460852 | 3300013105 | Bacteria | 1316 |
| 273 | Ga0157369_11438487 | 3300013105 | Bacteria | 702 |
| 274 | Ga0157374_10000874 | 3300013296 | Bacteria | 26341 |
| 275 | Ga0157374_10001137 | 3300013296 | Bacteria | 22784 |
| 276 | Ga0157374_10012440 | 3300013296 | Bacteria | 7402 |
| 277 | Ga0157374_10362962 | 3300013296 | Bacteria | 1441 |
| 278 | Ga0157374_10410837 | 3300013296 | Bacteria | 1351 |
| 279 | Ga0157374_10590113 | 3300013296 | Bacteria | 1120 |
| 280 | Ga0157374_11524670 | 3300013296 | Bacteria | 692 |
| 281 | Ga0157374_12068238 | 3300013296 | Bacteria | 596 |
| 282 | Ga0157378_10010197 | 3300013297 | Bacteria | 8198 |
| 283 | Ga0157378_10268463 | 3300013297 | Bacteria | 1640 |
| 284 | Ga0157378_10269515 | 3300013297 | Bacteria | 1637 |
| 285 | Ga0157378_10360437 | 3300013297 | Bacteria | 1423 |
| 286 | Ga0157378_10427712 | 3300013297 | Bacteria | 1310 |
| 287 | Ga0163162_10000012 | 3300013306 | Bacteria | 292674 |
| 288 | Ga0163162_10000895 | 3300013306 | Bacteria | 27750 |
| 289 | Ga0163162_10001113 | 3300013306 | Bacteria | 24963 |
| 290 | Ga0163162_10004644 | 3300013306 | Bacteria | 13243 |
| 291 | Ga0163162_10367947 | 3300013306 | Bacteria | 1571 |
| 292 | Ga0163162_10404386 | 3300013306 | Bacteria | 1498 |
| 293 | Ga0163162_10566128 | 3300013306 | Bacteria | 1264 |
| 294 | Ga0163162_10827881 | 3300013306 | Bacteria | 1042 |
| 295 | Ga0157372_10000041 | 3300013307 | Bacteria | 158494 |
| 296 | Ga0157372_10000199 | 3300013307 | Bacteria | 66101 |
| 297 | Ga0157372_10002721 | 3300013307 | Bacteria | 19136 |
| 298 | Ga0157372_10014659 | 3300013307 | Bacteria | 8386 |
| 299 | Ga0157372_10019379 | 3300013307 | Bacteria | 7331 |
| 300 | Ga0157372_10035225 | 3300013307 | Bacteria | 5509 |
| 301 | Ga0157372_10054327 | 3300013307 | Bacteria | 4467 |
| 302 | Ga0157372_10065963 | 3300013307 | Bacteria | 4066 |
| 303 | Ga0157372_10309694 | 3300013307 | Bacteria | 1838 |
| 304 | Ga0157372_10453387 | 3300013307 | Bacteria | 1495 |
| 305 | Ga0157372_11186032 | 3300013307 | Bacteria | 882 |
| 306 | Ga0157375_10013601 | 3300013308 | Bacteria | 7250 |
| 307 | Ga0157375_10059972 | 3300013308 | Bacteria | 3771 |
| 308 | Ga0157375_10143486 | 3300013308 | Bacteria | 2517 |
| 309 | Ga0157375_10898565 | 3300013308 | Bacteria | 1030 |
| 310 | Ga0157375_11084893 | 3300013308 | Bacteria | 937 |
| 311 | Ga0157375_11539125 | 3300013308 | Bacteria | 785 |
| 312 | Ga0163163_10576626 | 3300014325 | Bacteria | 1188 |
| 313 | Ga0182008_10000002 | 3300014497 | Bacteria | 480216 |
| 314 | Ga0182008_10000294 | 3300014497 | Bacteria | 39204 |
| 315 | Ga0182008_10124150 | 3300014497 | Bacteria | 1284 |
| 316 | Ga0157377_10059831 | 3300014745 | Bacteria | 2173 |
| 317 | Ga0157377_10400415 | 3300014745 | Bacteria | 935 |
| 318 | Ga0157379_11385576 | 3300014968 | Unclassified | 681 |
| 319 | Ga0182006_1000153 | 3300015261 | Bacteria | 73985 |
| 320 | Ga0182006_1000287 | 3300015261 | Bacteria | 44409 |
| 321 | Ga0182006_1000349 | 3300015261 | Bacteria | 38806 |
| 322 | Ga0182006_1003312 | 3300015261 | Bacteria | 8314 |
| 323 | Ga0182007_10000005 | 3300015262 | Bacteria | 442702 |
| 324 | Ga0182007_10000010 | 3300015262 | Bacteria | 286070 |
| 325 | Ga0183373_1002 | 3300015682 | Bacteria | 990153 |
| 326 | Ga0183373_1005 | 3300015682 | Bacteria | 351562 |
| 327 | Ga0163161_10000729 | 3300017792 | Bacteria | 25879 |
| 328 | Ga0163161_10001299 | 3300017792 | Bacteria | 18626 |
| 329 | Ga0163161_10002412 | 3300017792 | Bacteria | 13408 |
| 330 | Ga0163161_10002768 | 3300017792 | Bacteria | 12458 |
| 331 | Ga0163161_10006203 | 3300017792 | Bacteria | 8284 |
| 332 | Ga0163161_10050655 | 3300017792 | Bacteria | 3006 |
| 333 | Ga0163161_10055914 | 3300017792 | Bacteria | 2865 |
| 334 | Ga0163161_10092081 | 3300017792 | Bacteria | 2244 |
| 335 | Ga0163161_11264025 | 3300017792 | Bacteria | 640 |
| 336 | Ga0206351_10496138 | 3300020077 | Bacteria | 504 |
| 337 | Ga0213872_10008325 | 3300021361 | Bacteria | 5023 |
| 338 | Ga0209563_109379 | 3300025230 | Bacteria | 1482 |
| 339 | Ga0207427_100043 | 3300025231 | Bacteria | 249595 |
| 340 | Ga0209437_100024 | 3300025233 | Bacteria | 592878 |
| 341 | Ga0209437_100030 | 3300025233 | Bacteria | 532466 |
| 342 | Ga0209437_100170 | 3300025233 | Bacteria | 142489 |
| 343 | Ga0209258_114613 | 3300025242 | Bacteria | 910 |
| 344 | Ga0207425_1000003 | 3300025245 | Bacteria | 1145342 |
| 345 | Ga0209026_1000225 | 3300025250 | Bacteria | 77234 |
| 346 | Ga0209026_1003564 | 3300025250 | Bacteria | 5030 |
| 347 | Ga0209026_1024243 | 3300025250 | Bacteria | 920 |
| 348 | Ga0209026_1044634 | 3300025250 | Bacteria | 638 |
| 349 | Ga0209129_1000014 | 3300025258 | Bacteria | 509018 |
| 350 | Ga0209129_1007976 | 3300025258 | Bacteria | 3026 |
| 351 | Ga0209129_1011482 | 3300025258 | Bacteria | 2110 |
| 352 | Ga0209233_1000266 | 3300025261 | Bacteria | 76176 |
| 353 | Ga0209233_1048394 | 3300025261 | Bacteria | 878 |
| 354 | Ga0209233_1048817 | 3300025261 | Bacteria | 872 |
| 355 | Ga0209455_1001647 | 3300025272 | Bacteria | 9710 |
| 356 | Ga0209455_1002288 | 3300025272 | Bacteria | 7539 |
| 357 | Ga0209676_1000491 | 3300025292 | Bacteria | 63873 |
| 358 | Ga0209025_1000007 | 3300025294 | Bacteria | 1145109 |
| 359 | Ga0209758_1000012 | 3300025297 | Bacteria | 949866 |
| 360 | Ga0209050_1081806 | 3300025298 | Bacteria | 685 |
| 361 | Ga0207655_1034009 | 3300025728 | Bacteria | 2298 |
| 362 | Ga0207642_10100749 | 3300025899 | Bacteria | 1449 |
| 363 | Ga0207642_10624420 | 3300025899 | Unclassified | 673 |
| 364 | Ga0207647_10000012 | 3300025904 | Bacteria | 152879 |
| 365 | Ga0207647_10132579 | 3300025904 | Bacteria | 1464 |
| 366 | Ga0207647_10188948 | 3300025904 | Bacteria | 1194 |
| 367 | Ga0207645_10000058 | 3300025907 | Bacteria | 78487 |
| 368 | Ga0207643_10176790 | 3300025908 | Bacteria | 1290 |
| 369 | Ga0207705_10000026 | 3300025909 | Bacteria | 256051 |
| 370 | Ga0207705_10000036 | 3300025909 | Bacteria | 200787 |
| 371 | Ga0207705_10046191 | 3300025909 | Bacteria | 3129 |
| 372 | Ga0207705_10073215 | 3300025909 | Bacteria | 2485 |
| 373 | Ga0207705_10256711 | 3300025909 | Bacteria | 1334 |
| 374 | Ga0207705_10268285 | 3300025909 | Bacteria | 1305 |
| 375 | Ga0207654_10001331 | 3300025911 | Bacteria | 13159 |
| 376 | Ga0207654_10058658 | 3300025911 | Bacteria | 2242 |
| 377 | Ga0207654_10075706 | 3300025911 | Bacteria | 2012 |
| 378 | Ga0207654_10098758 | 3300025911 | Bacteria | 1794 |
| 379 | Ga0207654_10172222 | 3300025911 | Bacteria | 1406 |
| 380 | Ga0207654_10259196 | 3300025911 | Bacteria | 1168 |
| 381 | Ga0207654_10289615 | 3300025911 | Unclassified | 1110 |
| 382 | Ga0207707_10088460 | 3300025912 | Bacteria | 2706 |
| 383 | Ga0207695_10000117 | 3300025913 | Bacteria | 237982 |
| 384 | Ga0207695_10019916 | 3300025913 | Bacteria | 7707 |
| 385 | Ga0207695_10024211 | 3300025913 | Bacteria | 6836 |
| 386 | Ga0207695_10060748 | 3300025913 | Bacteria | 3910 |
| 387 | Ga0207695_10078136 | 3300025913 | Bacteria | 3358 |
| 388 | Ga0207695_10119662 | 3300025913 | Bacteria | 2603 |
| 389 | Ga0207695_10172634 | 3300025913 | Bacteria | 2086 |
| 390 | Ga0207695_10196438 | 3300025913 | Unclassified | 1933 |
| 391 | Ga0207695_10212441 | 3300025913 | Bacteria | 1845 |
| 392 | Ga0207695_10216751 | 3300025913 | Bacteria | 1823 |
| 393 | Ga0207695_10249836 | 3300025913 | Bacteria | 1673 |
| 394 | Ga0207695_10264192 | 3300025913 | Unclassified | 1618 |
| 395 | Ga0207695_10310842 | 3300025913 | Bacteria | 1466 |
| 396 | Ga0207695_10646192 | 3300025913 | Bacteria | 939 |
| 397 | Ga0207695_10955910 | 3300025913 | Bacteria | 736 |
| 398 | Ga0207695_11224020 | 3300025913 | Bacteria | 631 |
| 399 | Ga0207671_10000831 | 3300025914 | Bacteria | 39212 |
| 400 | Ga0207671_10004503 | 3300025914 | Bacteria | 13263 |
| 401 | Ga0207671_10004510 | 3300025914 | Bacteria | 13252 |
| 402 | Ga0207671_10005083 | 3300025914 | Bacteria | 12283 |
| 403 | Ga0207671_10019598 | 3300025914 | Bacteria | 5170 |
| 404 | Ga0207671_10021131 | 3300025914 | Bacteria | 4943 |
| 405 | Ga0207671_10074052 | 3300025914 | Bacteria | 2545 |
| 406 | Ga0207671_10464045 | 3300025914 | Bacteria | 1009 |
| 407 | Ga0207660_10011090 | 3300025917 | Bacteria | 5858 |
| 408 | Ga0207657_10099781 | 3300025919 | Unclassified | 2411 |
| 409 | Ga0207657_10107468 | 3300025919 | Bacteria | 2308 |
| 410 | Ga0207657_10113819 | 3300025919 | Bacteria | 2232 |
| 411 | Ga0207657_10210232 | 3300025919 | Bacteria | 1562 |
| 412 | Ga0207652_10070876 | 3300025921 | Bacteria | 3027 |
| 413 | Ga0207652_10244146 | 3300025921 | Bacteria | 1619 |
| 414 | Ga0207694_10093844 | 3300025924 | Bacteria | 2371 |
| 415 | Ga0207694_10328650 | 3300025924 | Bacteria | 1263 |
| 416 | Ga0207694_11105958 | 3300025924 | Unclassified | 671 |
| 417 | Ga0207659_10809111 | 3300025926 | Bacteria | 805 |
| 418 | Ga0207700_10647102 | 3300025928 | Bacteria | 942 |
| 419 | Ga0207644_10000740 | 3300025931 | Bacteria | 20704 |
| 420 | Ga0207690_10000594 | 3300025932 | Bacteria | 23425 |
| 421 | Ga0207706_10000430 | 3300025933 | Bacteria | 44993 |
| 422 | Ga0207706_10483716 | 3300025933 | Unclassified | 1069 |
| 423 | Ga0207686_10175820 | 3300025934 | Bacteria | 1514 |
| 424 | Ga0207709_10029111 | 3300025935 | Bacteria | 3199 |
| 425 | Ga0207669_10037635 | 3300025937 | Bacteria | 2778 |
| 426 | Ga0207669_10234446 | 3300025937 | Bacteria | 1356 |
| 427 | Ga0207704_10000047 | 3300025938 | Bacteria | 84386 |
| 428 | Ga0207689_10766391 | 3300025942 | Bacteria | 814 |
| 429 | Ga0207661_10137960 | 3300025944 | Bacteria | 2096 |
| 430 | Ga0207667_10000009 | 3300025949 | Bacteria | 603135 |
| 431 | Ga0207667_10001021 | 3300025949 | Bacteria | 35701 |
| 432 | Ga0207667_10001079 | 3300025949 | Bacteria | 34634 |
| 433 | Ga0207667_10001338 | 3300025949 | Bacteria | 30924 |
| 434 | Ga0207667_10008164 | 3300025949 | Bacteria | 12463 |
| 435 | Ga0207667_10022759 | 3300025949 | Bacteria | 6913 |
| 436 | Ga0207667_10030764 | 3300025949 | Bacteria | 5801 |
| 437 | Ga0207667_10039676 | 3300025949 | Bacteria | 5017 |
| 438 | Ga0207667_10044166 | 3300025949 | Bacteria | 4724 |
| 439 | Ga0207667_10128350 | 3300025949 | Bacteria | 2612 |
| 440 | Ga0207667_10172942 | 3300025949 | Bacteria | 2220 |
| 441 | Ga0207667_10236982 | 3300025949 | Bacteria | 1868 |
| 442 | Ga0207667_10354204 | 3300025949 | Bacteria | 1497 |
| 443 | Ga0207667_10380169 | 3300025949 | Bacteria | 1439 |
| 444 | Ga0207667_10392029 | 3300025949 | Bacteria | 1414 |
| 445 | Ga0207667_10412436 | 3300025949 | Bacteria | 1375 |
| 446 | Ga0207667_10497800 | 3300025949 | Bacteria | 1236 |
| 447 | Ga0207667_10646480 | 3300025949 | Bacteria | 1063 |
| 448 | Ga0207651_10053476 | 3300025960 | Bacteria | 2760 |
| 449 | Ga0207712_10417928 | 3300025961 | Bacteria | 1130 |
| 450 | Ga0207640_10110434 | 3300025981 | Bacteria | 1948 |
| 451 | Ga0207640_10380135 | 3300025981 | Bacteria | 1144 |
| 452 | Ga0207677_10058813 | 3300026023 | Bacteria | 2649 |
| 453 | Ga0207677_10154998 | 3300026023 | Bacteria | 1773 |
| 454 | Ga0207639_10007193 | 3300026041 | Bacteria | 7582 |
| 455 | Ga0207639_10024734 | 3300026041 | Bacteria | 4350 |
| 456 | Ga0207639_10034261 | 3300026041 | Bacteria | 3752 |
| 457 | Ga0207639_10136018 | 3300026041 | Bacteria | 2041 |
| 458 | Ga0207639_10176942 | 3300026041 | Bacteria | 1812 |
| 459 | Ga0207639_10338931 | 3300026041 | Bacteria | 1340 |
| 460 | Ga0207639_10489443 | 3300026041 | Bacteria | 1122 |
| 461 | Ga0207639_10720285 | 3300026041 | Bacteria | 926 |
| 462 | Ga0207639_10873721 | 3300026041 | Bacteria | 840 |
| 463 | Ga0207678_10064250 | 3300026067 | Bacteria | 3154 |
| 464 | Ga0207702_10008741 | 3300026078 | Bacteria | 8540 |
| 465 | Ga0207702_10009173 | 3300026078 | Bacteria | 8319 |
| 466 | Ga0207702_10012151 | 3300026078 | Bacteria | 7163 |
| 467 | Ga0207702_10013063 | 3300026078 | Bacteria | 6906 |
| 468 | Ga0207702_10197209 | 3300026078 | Bacteria | 1864 |
| 469 | Ga0207702_10248953 | 3300026078 | Bacteria | 1668 |
| 470 | Ga0207702_10256685 | 3300026078 | Bacteria | 1644 |
| 471 | Ga0207702_10455319 | 3300026078 | Bacteria | 1242 |
| 472 | Ga0207702_10846722 | 3300026078 | Bacteria | 905 |
| 473 | Ga0207702_11971821 | 3300026078 | Bacteria | 574 |
| 474 | Ga0207641_10839906 | 3300026088 | Bacteria | 910 |
| 475 | Ga0207648_10000458 | 3300026089 | Bacteria | 45301 |
| 476 | Ga0207674_10080726 | 3300026116 | Bacteria | 3255 |
| 477 | Ga0207674_10765722 | 3300026116 | Bacteria | 932 |
| 478 | Ga0207683_10192567 | 3300026121 | Bacteria | 1851 |
| 479 | Ga0207698_10003112 | 3300026142 | Bacteria | 9957 |
| 480 | Ga0207698_10294071 | 3300026142 | Bacteria | 1509 |
| 481 | Ga0207698_10611048 | 3300026142 | Bacteria | 1076 |
| 482 | Ga0268266_10000121 | 3300028379 | Bacteria | 154995 |
| 483 | Ga0307517_10002529 | 3300028786 | Bacteria | 29143 |
| 484 | Ga0307515_10000077 | 3300028794 | Bacteria | 228162 |
| 485 | Ga0307515_10001997 | 3300028794 | Bacteria | 45190 |
| 486 | Ga0307515_10002629 | 3300028794 | Bacteria | 38616 |
| 487 | Ga0307515_10088744 | 3300028794 | Bacteria | 3903 |
| 488 | Ga0265338_10038003 | 3300028800 | Bacteria | 4570 |
| 489 | Ga0265338_10174071 | 3300028800 | Bacteria | 1647 |
| 490 | Ga0265338_10417512 | 3300028800 | Bacteria | 954 |
| 491 | Ga0265324_10315157 | 3300029957 | Bacteria | 533 |
| 492 | Ga0316176_1020422 | 3300030732 | Bacteria | 5807 |
| 493 | Ga0316183_1003890 | 3300030742 | Bacteria | 25813 |
| 494 | Ga0316181_1007924 | 3300030744 | Bacteria | 727 |
| 495 | Ga0316181_1116089 | 3300030744 | Bacteria | 10343 |
| 496 | Ga0316182_1021673 | 3300030745 | Bacteria | 1175 |
| 497 | Ga0307513_10431555 | 3300031456 | Bacteria | 1046 |
| 498 | Ga0307509_10056961 | 3300031507 | Bacteria | 4146 |
| 499 | Ga0307509_10087936 | 3300031507 | Bacteria | 3191 |
| 500 | Ga0307509_10216563 | 3300031507 | Bacteria | 1733 |
| 501 | Ga0307509_10219882 | 3300031507 | Bacteria | 1714 |
| 502 | Ga0307408_100021295 | 3300031548 | Bacteria | 4387 |
| 503 | Ga0307408_100227339 | 3300031548 | Bacteria | 1526 |
| 504 | Ga0307514_10118777 | 3300031649 | Bacteria | 1851 |
| 505 | Ga0316576_10164522 | 3300031727 | Unclassified | 1674 |
| 506 | Ga0316578_10471025 | 3300031728 | Bacteria | 741 |
| 507 | Ga0307516_10227260 | 3300031730 | Bacteria | 1572 |
| 508 | Ga0307405_10000009 | 3300031731 | Bacteria | 259388 |
| 509 | Ga0307405_10001997 | 3300031731 | Bacteria | 8830 |
| 510 | Ga0307405_10265964 | 3300031731 | Bacteria | 1283 |
| 511 | Ga0307407_10000001 | 3300031903 | Bacteria | 570048 |
| 512 | Ga0307407_10000005 | 3300031903 | Bacteria | 233125 |
| 513 | Ga0307412_10000050 | 3300031911 | Bacteria | 151527 |
| 514 | Ga0307412_10071034 | 3300031911 | Bacteria | 2375 |
| 515 | Ga0307412_10273379 | 3300031911 | Bacteria | 1323 |
| 516 | Ga0307412_10387013 | 3300031911 | Bacteria | 1134 |
| 517 | Ga0307412_10399720 | 3300031911 | Bacteria | 1118 |
| 518 | Ga0307412_10718646 | 3300031911 | Bacteria | 859 |
| 519 | Ga0307412_10846621 | 3300031911 | Bacteria | 797 |
| 520 | Ga0307409_100012342 | 3300031995 | Bacteria | 5441 |
| 521 | Ga0307416_100000001 | 3300032002 | Bacteria | 515017 |
| 522 | Ga0307416_100000008 | 3300032002 | Bacteria | 401343 |
| 523 | Ga0307416_103098278 | 3300032002 | Bacteria | 556 |
| 524 | Ga0307414_10000344 | 3300032004 | Bacteria | 26282 |
| 525 | Ga0307414_10003900 | 3300032004 | Bacteria | 8034 |
| 526 | Ga0307414_10010770 | 3300032004 | Bacteria | 5330 |
| 527 | Ga0307414_10012376 | 3300032004 | Bacteria | 5042 |
| 528 | Ga0307414_10039887 | 3300032004 | Bacteria | 3167 |
| 529 | Ga0307414_10183066 | 3300032004 | Bacteria | 1687 |
| 530 | Ga0307414_10990803 | 3300032004 | Unclassified | 773 |
| 531 | Ga0307414_11225775 | 3300032004 | Bacteria | 695 |
| 532 | Ga0307411_10141374 | 3300032005 | Bacteria | 1775 |
| 533 | Ga0316580_10098515 | 3300032139 | Bacteria | 895 |
| 534 | Ga0307507_10000313 | 3300033179 | Bacteria | 97672 |
| 535 | Ga0307510_10006887 | 3300033180 | Bacteria | 13556 |
| 536 | Ga0307510_10536911 | 3300033180 | Bacteria | 615 |
| 537 | Ga0316574_0113941 | 3300035398 | Bacteria | 1734 |
| 538 | Ga0316584_0091896 | 3300036712 | Bacteria | 2272 |
| 539 | Ga0395899_0000017 | 3300037312 | Bacteria | 440179 |
| 540 | Ga0395899_0000024 | 3300037312 | Bacteria | 357402 |
| 541 | Ga0395899_0000269 | 3300037312 | Bacteria | 68033 |
| 542 | Ga0395899_0075951 | 3300037312 | Bacteria | 2453 |
| 543 | Ga0395900_0000140 | 3300037418 | Bacteria | 121917 |
| 544 | Ga0395900_0000251 | 3300037418 | Bacteria | 83846 |
| 545 | Ga0395900_0017469 | 3300037418 | Bacteria | 7322 |
| 546 | Ga0395898_0002909 | 3300037466 | Bacteria | 19481 |
| 547 | Ga0395898_1050121 | 3300037466 | Unclassified | 749 |
| 548 | Ga0395905_0000495 | 3300037471 | Bacteria | 54122 |
| 549 | Ga0395905_0001502 | 3300037471 | Bacteria | 27915 |
| 550 | Ga0395905_0998756 | 3300037471 | Bacteria | 740 |
| 551 | Ga0395901_0000145 | 3300038443 | Bacteria | 91739 |
| 552 | Ga0395901_0001833 | 3300038443 | Bacteria | 21962 |
| 553 | Ga0395901_0445701 | 3300038443 | Unclassified | 1325 |
| 554 | Ga0436361_0109012 | 3300039447 | Bacteria | 6396 |
| 555 | Ga0451791_0028699 | 3300041451 | Bacteria | 610 |
| 556 | Ga0451793_1139462 | 3300041452 | Bacteria | 696 |
| 557 | Ga0451793_1576126 | 3300041452 | Bacteria | 1503 |
| 558 | Ga0451800_0740237 | 3300041459 | Bacteria | 817 |
| 559 | Ga0451802_1603469 | 3300041460 | Bacteria | 652 |
| 560 | Ga0451804_1040624 | 3300041463 | Bacteria | 619 |
| 561 | Ga0451807_2325405 | 3300041486 | Bacteria | 664 |
| 562 | Ga0439448_0035822 | 3300042005 | Unclassified | 1590 |
| 563 | Ga0439455_0033159 | 3300042012 | Unclassified | 1294 |
| 564 | Ga0466969_0085763 | 3300044656 | Bacteria | 1497 |
| 565 | Ga0466966_0076649 | 3300044684 | Bacteria | 2087 |
| 566 | Ga0466961_0043035 | 3300044693 | Bacteria | 2893 |
| 567 | Ga0466961_0147126 | 3300044693 | Bacteria | 1473 |
| 568 | Ga0466957_0115623 | 3300044842 | Bacteria | 1706 |
| 569 | Ga0495627_032228 | 3300046453 | Bacteria | 1650 |
| 570 | Ga0495592_0346473 | 3300046454 | Bacteria | 954 |
| 571 | Ga0495629_0032551 | 3300046459 | Bacteria | 3691 |
| 572 | Ga0495638_0074162 | 3300046460 | Bacteria | 2076 |
| 573 | Ga0495638_0413256 | 3300046460 | Bacteria | 697 |
| 574 | Ga0495641_0412686 | 3300046461 | Bacteria | 613 |
| 575 | Ga0495651_0086017 | 3300046462 | Bacteria | 2367 |
| 576 | Ga0495651_0087100 | 3300046462 | Bacteria | 2349 |
| 577 | Ga0495651_0113923 | 3300046462 | Bacteria | 1996 |
| 578 | Ga0495653_0813181 | 3300046463 | Bacteria | 561 |
| 579 | Ga0495650_0000087 | 3300046471 | Bacteria | 234870 |
| 580 | Ga0495650_0001198 | 3300046471 | Bacteria | 27382 |
| 581 | Ga0495650_0047909 | 3300046471 | Bacteria | 1785 |
| 582 | Ga0495650_0124812 | 3300046471 | Bacteria | 944 |
| 583 | Ga0495650_0143812 | 3300046471 | Bacteria | 861 |
| 584 | Ga0495605_0219130 | 3300046474 | Bacteria | 823 |
| 585 | Ga0495585_0000074 | 3300046492 | Bacteria | 102651 |
| 586 | Ga0495585_0000286 | 3300046492 | Bacteria | 50524 |
| 587 | Ga0495585_0000459 | 3300046492 | Bacteria | 38959 |
| 588 | Ga0495585_0000667 | 3300046492 | Bacteria | 31526 |
| 589 | Ga0495596_0262790 | 3300046500 | Bacteria | 670 |
| 590 | Ga0495583_0014434 | 3300046506 | Bacteria | 4360 |
| 591 | Ga0495583_0080789 | 3300046506 | Bacteria | 1413 |
| 592 | Ga0495583_0287842 | 3300046506 | Bacteria | 654 |
| 593 | Ga0495583_0442151 | 3300046506 | Bacteria | 509 |
| 594 | Ga0495606_0000052 | 3300046507 | Bacteria | 201529 |
| 595 | Ga0495606_0000425 | 3300046507 | Bacteria | 70202 |
| 596 | Ga0495606_0004916 | 3300046507 | Bacteria | 13075 |
| 597 | Ga0495606_0007070 | 3300046507 | Bacteria | 10155 |
| 598 | Ga0495606_0012011 | 3300046507 | Bacteria | 6993 |
| 599 | Ga0495606_0017553 | 3300046507 | Bacteria | 5404 |
| 600 | Ga0495606_0034004 | 3300046507 | Bacteria | 3506 |
| 601 | Ga0495606_0054447 | 3300046507 | Bacteria | 2591 |
| 602 | Ga0495606_0079573 | 3300046507 | Bacteria | 2041 |
| 603 | Ga0495606_0173258 | 3300046507 | Bacteria | 1250 |
| 604 | Ga0495606_0241869 | 3300046507 | Unclassified | 1006 |
| 605 | Ga0495606_0652391 | 3300046507 | Bacteria | 509 |
| 606 | Ga0495608_0444649 | 3300046511 | Bacteria | 789 |
| 607 | Ga0495610_0000076 | 3300046512 | Bacteria | 118246 |
| 608 | Ga0495610_0000405 | 3300046512 | Bacteria | 44184 |
| 609 | Ga0495610_0003649 | 3300046512 | Bacteria | 11848 |
| 610 | Ga0495610_0003743 | 3300046512 | Bacteria | 11643 |
| 611 | Ga0495610_0004136 | 3300046512 | Bacteria | 10856 |
| 612 | Ga0495610_0075747 | 3300046512 | Bacteria | 1557 |
| 613 | Ga0495616_0001116 | 3300046513 | Bacteria | 19061 |
| 614 | Ga0495616_0001648 | 3300046513 | Bacteria | 15299 |
| 615 | Ga0495616_0068364 | 3300046513 | Bacteria | 1725 |
| 616 | Ga0495616_0294034 | 3300046513 | Bacteria | 687 |
| 617 | Ga0495618_0258111 | 3300046514 | Bacteria | 1092 |
| 618 | Ga0495618_0516939 | 3300046514 | Bacteria | 718 |
| 619 | Ga0495630_1391422 | 3300046517 | Bacteria | 528 |
| 620 | Ga0495631_0021927 | 3300046518 | Bacteria | 2972 |
| 621 | Ga0495631_0112999 | 3300046518 | Bacteria | 1168 |
| 622 | Ga0495631_0413309 | 3300046518 | Bacteria | 574 |
| 623 | Ga0495637_0030977 | 3300046520 | Bacteria | 2369 |
| 624 | Ga0495637_0125162 | 3300046520 | Bacteria | 985 |
| 625 | Ga0495644_0007953 | 3300046523 | Bacteria | 4082 |
| 626 | Ga0495648_0001585 | 3300046524 | Bacteria | 22152 |
| 627 | Ga0495648_0013724 | 3300046524 | Bacteria | 5971 |
| 628 | Ga0495663_0164223 | 3300046525 | Bacteria | 763 |
| 629 | Ga0495652_0054934 | 3300046529 | Bacteria | 3389 |
| 630 | Ga0495652_0095063 | 3300046529 | Bacteria | 2429 |
| 631 | Ga0495652_0296456 | 3300046529 | Bacteria | 1177 |
| 632 | Ga0495652_0643047 | 3300046529 | Bacteria | 719 |
| 633 | Ga0495654_0214572 | 3300046530 | Bacteria | 817 |
| 634 | Ga0495609_0019281 | 3300046538 | Bacteria | 3158 |
| 635 | Ga0495609_0055155 | 3300046538 | Bacteria | 1763 |
| 636 | Ga0495609_0121490 | 3300046538 | Bacteria | 1122 |
| 637 | Ga0495609_0219883 | 3300046538 | Bacteria | 789 |
| 638 | Ga0495622_0177406 | 3300046557 | Bacteria | 956 |
| 639 | Ga0495622_0218419 | 3300046557 | Bacteria | 845 |
| 640 | Ga0495622_0391432 | 3300046557 | Bacteria | 599 |
| 641 | Ga0495633_0000004 | 3300046558 | Bacteria | 370781 |
| 642 | Ga0495633_0000035 | 3300046558 | Bacteria | 185403 |
| 643 | Ga0495633_0001552 | 3300046558 | Bacteria | 17627 |
| 644 | Ga0495633_0009741 | 3300046558 | Bacteria | 5280 |
| 645 | Ga0495633_0158588 | 3300046558 | Bacteria | 1044 |
| 646 | Ga0495668_0000032 | 3300046616 | Bacteria | 254951 |
| 647 | Ga0495668_0000121 | 3300046616 | Bacteria | 116234 |
| 648 | Ga0495668_0137256 | 3300046616 | Bacteria | 1339 |
| 649 | Ga0495634_0388302 | 3300046642 | Bacteria | 831 |
| 650 | Ga0495625_0000008 | 3300046660 | Bacteria | 536165 |
| 651 | Ga0495625_0000067 | 3300046660 | Bacteria | 171483 |
| 652 | Ga0495625_0000981 | 3300046660 | Bacteria | 37838 |
| 653 | Ga0495625_0001612 | 3300046660 | Bacteria | 26626 |
| 654 | Ga0495625_0007910 | 3300046660 | Bacteria | 9146 |
| 655 | Ga0495625_0010659 | 3300046660 | Bacteria | 7576 |
| 656 | Ga0495625_0043150 | 3300046660 | Bacteria | 3272 |
| 657 | Ga0495625_0068042 | 3300046660 | Bacteria | 2504 |
| 658 | Ga0495625_0154408 | 3300046660 | Bacteria | 1541 |
| 659 | Ga0495625_0265137 | 3300046660 | Bacteria | 1110 |
| 660 | Ga0495625_0271939 | 3300046660 | Bacteria | 1093 |
| 661 | Ga0495625_0470086 | 3300046660 | Bacteria | 774 |
| 662 | Ga0495625_0683373 | 3300046660 | Bacteria | 608 |
| 663 | Ga0495661_0002168 | 3300046665 | Bacteria | 15344 |
| 664 | Ga0495661_0002273 | 3300046665 | Bacteria | 14867 |
| 665 | Ga0495661_0036794 | 3300046665 | Bacteria | 3061 |
| 666 | Ga0495588_0671152 | 3300046674 | Bacteria | 542 |
| 667 | Ga0495669_0664701 | 3300046684 | Unclassified | 507 |
| 668 | Ga0495670_0181618 | 3300046691 | Bacteria | 1111 |
| 669 | Ga0495670_0386267 | 3300046691 | Bacteria | 756 |
| 670 | Ga0495670_0403051 | 3300046691 | Bacteria | 739 |
| 671 | Ga0495671_0314576 | 3300046692 | Bacteria | 752 |
| 672 | Ga0495649_0000018 | 3300046694 | Bacteria | 220586 |
| 673 | Ga0495649_0000135 | 3300046694 | Bacteria | 64533 |
| 674 | Ga0495649_0196926 | 3300046694 | Bacteria | 1047 |
| 675 | Ga0495589_0134693 | 3300046794 | Bacteria | 1185 |
| 676 | Ga0495600_0607541 | 3300046809 | Bacteria | 664 |
| 677 | Ga0495660_0003458 | 3300046810 | Bacteria | 9754 |
| 678 | Ga0495660_0080602 | 3300046810 | Bacteria | 1708 |
| 679 | Ga0495660_0208623 | 3300046810 | Bacteria | 928 |
| 680 | Ga0495676_0630359 | 3300047321 | Bacteria | 697 |
| 681 | Ga0495683_0145406 | 3300047323 | Bacteria | 1108 |
| 682 | Ga0495683_0222892 | 3300047323 | Unclassified | 840 |
| 683 | Ga0495687_001763 | 3300047443 | Bacteria | 19137 |
| 684 | Ga0495687_003533 | 3300047443 | Bacteria | 11252 |
| 685 | Ga0495687_066582 | 3300047443 | Bacteria | 1461 |
| 686 | Ga0495673_0032422 | 3300047469 | Bacteria | 2436 |
| 687 | Ga0495673_0067119 | 3300047469 | Bacteria | 1519 |
| 688 | Ga0495681_0292594 | 3300047470 | Bacteria | 632 |
| 689 | Ga0495686_0000917 | 3300047472 | Bacteria | 36995 |
| 690 | Ga0495686_0001013 | 3300047472 | Bacteria | 34054 |
| 691 | Ga0495686_0075162 | 3300047472 | Bacteria | 2072 |
| 692 | Ga0495686_0320790 | 3300047472 | Bacteria | 849 |
| 693 | Ga0495686_0343957 | 3300047472 | Bacteria | 812 |
| 694 | Ga0495686_0409552 | 3300047472 | Bacteria | 726 |
| 695 | Ga0495614_0080811 | 3300048089 | Bacteria | 1408 |
| 696 | Ga0495614_0094542 | 3300048089 | Bacteria | 1302 |
| 697 | Ga0496115_0017027 | 3300048918 | Bacteria | 5545 |
| 698 | Ga0496122_0004298 | 3300048925 | Bacteria | 17852 |
| 699 | Ga0496123_0005429 | 3300048926 | Bacteria | 12835 |
| 700 | Ga0496126_0491415 | 3300048929 | Bacteria | 982 |
| 701 | Ga0495678_014483 | 3300049459 | Bacteria | 3666 |
| 702 | Ga0495682_0025629 | 3300049460 | Bacteria | 2194 |
| 703 | Ga0501217_067965 | 3300049661 | Bacteria | 964 |
| 704 | Ga0501223_000212 | 3300049663 | Bacteria | 14832 |
| 705 | Ga0501249_020121 | 3300049679 | Bacteria | 1451 |
| 706 | Ga0501259_093574 | 3300049688 | Unclassified | 679 |
| 707 | Ga0501225_0017101 | 3300049705 | Bacteria | 2014 |
| 708 | Ga0501241_039094 | 3300049758 | Bacteria | 915 |
| 709 | Ga0501280_040265 | 3300049776 | Unclassified | 756 |
| 710 | Ga0501035_0932891 | 3300049822 | Unclassified | 686 |
| 711 | nmdc:mga0k408_102938_c1 | 3300050493 | Bacteria | 1684 |
| 712 | nmdc:mga0k408_194544_c1 | 3300050493 | Bacteria | 1210 |
| 713 | nmdc:mga0k408_3098_c2 | 3300050493 | Bacteria | 8176 |
| 714 | nmdc:mga0k408_623754_c1 | 3300050493 | Bacteria | 635 |
| 715 | nmdc:mga0k408_65_c1 | 3300050493 | Bacteria | 52329 |
| 716 | nmdc:mga0k408_715_c2 | 3300050493 | Bacteria | 11734 |
| 717 | nmdc:mga0k408_979_c1 | 3300050493 | Bacteria | 15710 |
| 718 | nmdc:mga0k408_99634_c1 | 3300050493 | Bacteria | 1713 |
| 719 | nmdc:mga07m45_460920_c1 | 3300050496 | Bacteria | 737 |
| 720 | nmdc:mga0qj67_440167_c1 | 3300050509 | Bacteria | 1050 |
| 721 | nmdc:mga08y16_24884_c1 | 3300050511 | Bacteria | 6315 |
| 722 | nmdc:mga0sz30_557791_c1 | 3300050516 | Bacteria | 517 |
| 723 | Ga0500635_0002950 | 3300053080 | Bacteria | 4240 |
| 724 | Ga0500646_0132271 | 3300053090 | Unclassified | 812 |
| 725 | Ga0500651_0000350 | 3300053093 | Bacteria | 25883 |
| 726 | Ga0500651_0157910 | 3300053093 | Bacteria | 1358 |
| 727 | Ga0500566_0221536 | 3300053094 | Bacteria | 940 |
| 728 | Ga0500650_0224623 | 3300053098 | Bacteria | 849 |
| 729 | Ga0500650_0251840 | 3300053098 | Unclassified | 792 |
| 730 | Ga0500594_0038912 | 3300053118 | Bacteria | 1291 |
| 731 | Ga0500608_000297 | 3300053122 | Bacteria | 19220 |
| 732 | Ga0500608_060695 | 3300053122 | Bacteria | 1808 |
| 733 | Ga0500614_007956 | 3300053123 | Bacteria | 2242 |
| 734 | Ga0500614_061382 | 3300053123 | Bacteria | 1011 |
| 735 | Ga0500618_000033 | 3300053125 | Bacteria | 121886 |
| 736 | Ga0500618_000037 | 3300053125 | Bacteria | 117320 |
| 737 | Ga0500618_016551 | 3300053125 | Bacteria | 1845 |
| 738 | Ga0500564_112304 | 3300053138 | Bacteria | 1195 |
| 739 | Ga0500568_0038399 | 3300053139 | Bacteria | 1938 |
| 740 | Ga0500616_0034972 | 3300053153 | Bacteria | 2734 |
| 741 | Ga0500619_170958 | 3300053154 | Bacteria | 736 |
| 742 | Ga0500622_0000175 | 3300053156 | Bacteria | 69363 |
| 743 | Ga0500622_0240133 | 3300053156 | Bacteria | 801 |
| 744 | Ga0500624_000481 | 3300053157 | Bacteria | 11801 |
| 745 | Ga0500624_003615 | 3300053157 | Bacteria | 2024 |
| 746 | Ga0500633_0310796 | 3300053160 | Bacteria | 579 |
| 747 | Ga0500634_0019483 | 3300053161 | Bacteria | 3656 |
| 748 | Ga0500645_178024 | 3300053730 | Bacteria | 579 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005439 | Ga0070711_101882967 | Ga0070711_1018829671 | 109 |
| 2 | 3300031507 | Ga0307509_10216563 | Ga0307509_102165632 | 109 |
| 3 | iso_pu_bacteria | 2599185184 | 2599478309 | 118 |
| 4 | iso_pu_bacteria | 2919437846 | 2919438993 | 118 |
| 5 | iso_pu_bacteria | 2928078545 | 2928080641 | 118 |
| 6 | iso_pu_bacteria | 2928147474 | 2928150865 | 118 |
| 7 | iso_pu_bacteria | 2932082852 | 2932082975 | 118 |
| 8 | 3300006846 | Ga0075430_100484944 | Ga0075430_1004849442 | 119 |
| 9 | 3300009147 | Ga0114129_11076180 | Ga0114129_110761802 | 119 |
| 10 | 3300050509 | nmdc:mga0qj67_440167_c1 | nmdc:mga0qj67_440167_c1_226_597 | 119 |
| 11 | 3300050511 | nmdc:mga08y16_24884_c1 | nmdc:mga08y16_24884_c1_2218_2589 | 119 |
| 12 | 3300053090 | Ga0500646_0132271 | Ga0500646_0132271_123_494 | 119 |
| 13 | 3300053093 | Ga0500651_0157910 | Ga0500651_0157910_252_623 | 119 |
| 14 | 3300013100 | Ga0157373_10247498 | Ga0157373_102474982 | 121 |
| 15 | 3300013102 | Ga0157371_10158350 | Ga0157371_101583502 | 121 |
| 16 | 3300013104 | Ga0157370_10019570 | Ga0157370_100195703 | 121 |
| 17 | 3300013104 | Ga0157370_10269129 | Ga0157370_102691291 | 121 |
| 18 | 3300013105 | Ga0157369_10000015 | Ga0157369_1000001520 | 121 |
| 19 | 3300013307 | Ga0157372_10309694 | Ga0157372_103096941 | 121 |
| 20 | 3300015262 | Ga0182007_10000010 | Ga0182007_10000010195 | 121 |
| 21 | 3300015682 | Ga0183373_1005 | Ga0183373_1005223 | 121 |
| 22 | 3300017792 | Ga0163161_10000729 | Ga0163161_100007293 | 121 |
| 23 | 3300028794 | Ga0307515_10088744 | Ga0307515_100887444 | 121 |
| 24 | 3300031649 | Ga0307514_10118777 | Ga0307514_101187772 | 121 |
| 25 | 3300031903 | Ga0307407_10000005 | Ga0307407_1000000539 | 121 |
| 26 | 3300031911 | Ga0307412_10273379 | Ga0307412_102733792 | 121 |
| 27 | 3300032002 | Ga0307416_100000001 | Ga0307416_100000001409 | 121 |
| 28 | 3300032004 | Ga0307414_10012376 | Ga0307414_100123764 | 121 |
| 29 | 3300046512 | Ga0495610_0000405 | Ga0495610_0000405_30461_30832 | 121 |
| 30 | iso_pu_bacteria | 2522125168 | 2522552671 | 121 |
| 31 | 3300001904 | JGI24736J21556_1008316 | JGI24736J21556_10083162 | 122 |
| 32 | 3300001904 | JGI24736J21556_1011837 | JGI24736J21556_10118372 | 122 |
| 33 | 3300001989 | JGI24739J22299_10015871 | JGI24739J22299_100158712 | 122 |
| 34 | 3300001990 | JGI24737J22298_10001771 | JGI24737J22298_100017718 | 122 |
| 35 | 3300001990 | JGI24737J22298_10002233 | JGI24737J22298_100022332 | 122 |
| 36 | 3300002067 | JGI24735J21928_10000004 | JGI24735J21928_10000004129 | 122 |
| 37 | 3300002067 | JGI24735J21928_10000033 | JGI24735J21928_1000003358 | 122 |
| 38 | 3300002737 | JGI25162J39368_1000008 | JGI25162J39368_100000815 | 122 |
| 39 | 3300002737 | JGI25162J39368_1000017 | JGI25162J39368_100001739 | 122 |
| 40 | 3300002737 | JGI25162J39368_1001793 | JGI25162J39368_10017939 | 122 |
| 41 | 3300002741 | JGI25157J39369_1004659 | JGI25157J39369_10046592 | 122 |
| 42 | 3300002772 | JGI25164J39214_1001237 | JGI25164J39214_10012376 | 122 |
| 43 | 3300002774 | JGI25150J39212_1000003 | JGI25150J39212_1000003242 | 122 |
| 44 | 3300003187 | JGI25151J46595_10000002 | JGI25151J46595_10000002242 | 122 |
| 45 | 3300003214 | JGI25165J46597_1002573 | JGI25165J46597_10025735 | 122 |
| 46 | 3300003214 | JGI25165J46597_1036456 | JGI25165J46597_10364561 | 122 |
| 47 | 3300003214 | JGI25165J46597_1050527 | JGI25165J46597_10505271 | 122 |
| 48 | 3300003215 | JGI25153J46596_10000015 | JGI25153J46596_1000001553 | 122 |
| 49 | 3300003316 | rootH1_10008126 | rootH1_100081266 | 122 |
| 50 | 3300003316 | rootH1_10063127 | rootH1_100631278 | 122 |
| 51 | 3300003320 | rootH2_10003269 | rootH2_1000326945 | 122 |
| 52 | 3300003320 | rootH2_10057796 | rootH2_1005779613 | 122 |
| 53 | 3300003320 | rootH2_10103643 | rootH2_101036437 | 122 |
| 54 | 3300003320 | rootH2_10196503 | rootH2_101965032 | 122 |
| 55 | 3300003320 | rootH2_10269298 | rootH2_102692981 | 122 |
| 56 | 3300003320 | rootH2_10284133 | rootH2_102841332 | 122 |
| 57 | 3300003322 | rootL2_10035013 | rootL2_100350135 | 122 |
| 58 | 3300003322 | rootL2_10132836 | rootL2_101328364 | 122 |
| 59 | 3300003323 | rootH1_10005934 | rootH1_100059342 | 122 |
| 60 | 3300003323 | rootH1_10010138 | rootH1_100101387 | 122 |
| 61 | 3300003323 | rootH1_10062209 | rootH1_100622097 | 122 |
| 62 | 3300003323 | rootH1_10064415 | rootH1_100644152 | 122 |
| 63 | 3300003323 | rootH1_10110019 | rootH1_101100191 | 122 |
| 64 | 3300003323 | rootH1_10192260 | rootH1_101922601 | 122 |
| 65 | 3300003763 | Ga0055529_1007859 | Ga0055529_10078591 | 122 |
| 66 | 3300003781 | Ga0055536_1048487 | Ga0055536_10484871 | 122 |
| 67 | 3300005262 | Ga0065165_1000442 | Ga0065165_100044233 | 122 |
| 68 | 3300005288 | Ga0065714_10002307 | Ga0065714_1000230710 | 122 |
| 69 | 3300005288 | Ga0065714_10011237 | Ga0065714_100112373 | 122 |
| 70 | 3300005288 | Ga0065714_10014328 | Ga0065714_100143282 | 122 |
| 71 | 3300005288 | Ga0065714_10065739 | Ga0065714_100657392 | 122 |
| 72 | 3300005288 | Ga0065714_10126805 | Ga0065714_101268051 | 122 |
| 73 | 3300005288 | Ga0065714_10197124 | Ga0065714_101971242 | 122 |
| 74 | 3300005288 | Ga0065714_10453425 | Ga0065714_104534251 | 122 |
| 75 | 3300005289 | Ga0065704_10070323 | Ga0065704_1007032315 | 122 |
| 76 | 3300005289 | Ga0065704_10096827 | Ga0065704_100968272 | 122 |
| 77 | 3300005289 | Ga0065704_10179121 | Ga0065704_101791211 | 122 |
| 78 | 3300005289 | Ga0065704_10396737 | Ga0065704_103967372 | 122 |
| 79 | 3300005289 | Ga0065704_10599986 | Ga0065704_105999861 | 122 |
| 80 | 3300005327 | Ga0070658_10000008 | Ga0070658_10000008132 | 122 |
| 81 | 3300005327 | Ga0070658_10000008 | Ga0070658_10000008134 | 122 |
| 82 | 3300005327 | Ga0070658_10000018 | Ga0070658_1000001888 | 122 |
| 83 | 3300005327 | Ga0070658_10082680 | Ga0070658_100826803 | 122 |
| 84 | 3300005327 | Ga0070658_10324086 | Ga0070658_103240862 | 122 |
| 85 | 3300005327 | Ga0070658_10353375 | Ga0070658_103533751 | 122 |
| 86 | 3300005328 | Ga0070676_10000465 | Ga0070676_100004659 | 122 |
| 87 | 3300005334 | Ga0068869_100117037 | Ga0068869_1001170371 | 122 |
| 88 | 3300005336 | Ga0070680_100007970 | Ga0070680_1000079708 | 122 |
| 89 | 3300005338 | Ga0068868_100143907 | Ga0068868_1001439072 | 122 |
| 90 | 3300005338 | Ga0068868_100378158 | Ga0068868_1003781582 | 122 |
| 91 | 3300005339 | Ga0070660_100008700 | Ga0070660_1000087002 | 122 |
| 92 | 3300005339 | Ga0070660_100024084 | Ga0070660_1000240845 | 122 |
| 93 | 3300005339 | Ga0070660_100043103 | Ga0070660_1000431032 | 122 |
| 94 | 3300005339 | Ga0070660_100216474 | Ga0070660_1002164742 | 122 |
| 95 | 3300005341 | Ga0070691_10205642 | Ga0070691_102056421 | 122 |
| 96 | 3300005344 | Ga0070661_101109689 | Ga0070661_1011096892 | 122 |
| 97 | 3300005354 | Ga0070675_100823046 | Ga0070675_1008230461 | 122 |
| 98 | 3300005355 | Ga0070671_100003365 | Ga0070671_1000033654 | 122 |
| 99 | 3300005355 | Ga0070671_100859824 | Ga0070671_1008598242 | 122 |
| 100 | 3300005356 | Ga0070674_100054220 | Ga0070674_1000542202 | 122 |
| 101 | 3300005356 | Ga0070674_100365545 | Ga0070674_1003655451 | 122 |
| 102 | 3300005364 | Ga0070673_100002665 | Ga0070673_1000026654 | 122 |
| 103 | 3300005364 | Ga0070673_101008862 | Ga0070673_1010088622 | 122 |
| 104 | 3300005366 | Ga0070659_100000899 | Ga0070659_10000089912 | 122 |
| 105 | 3300005366 | Ga0070659_100018025 | Ga0070659_1000180255 | 122 |
| 106 | 3300005436 | Ga0070713_100789340 | Ga0070713_1007893401 | 122 |
| 107 | 3300005455 | Ga0070663_100247673 | Ga0070663_1002476732 | 122 |
| 108 | 3300005456 | Ga0070678_100634535 | Ga0070678_1006345352 | 122 |
| 109 | 3300005456 | Ga0070678_101080335 | Ga0070678_1010803352 | 122 |
| 110 | 3300005457 | Ga0070662_100000062 | Ga0070662_10000006251 | 122 |
| 111 | 3300005457 | Ga0070662_100343429 | Ga0070662_1003434292 | 122 |
| 112 | 3300005458 | Ga0070681_10112980 | Ga0070681_101129802 | 122 |
| 113 | 3300005459 | Ga0068867_100000923 | Ga0068867_10000092320 | 122 |
| 114 | 3300005530 | Ga0070679_100089205 | Ga0070679_1000892053 | 122 |
| 115 | 3300005530 | Ga0070679_100263095 | Ga0070679_1002630952 | 122 |
| 116 | 3300005535 | Ga0070684_100017533 | Ga0070684_1000175333 | 122 |
| 117 | 3300005539 | Ga0068853_100010560 | Ga0068853_1000105606 | 122 |
| 118 | 3300005539 | Ga0068853_100026830 | Ga0068853_1000268302 | 122 |
| 119 | 3300005539 | Ga0068853_100069159 | Ga0068853_1000691592 | 122 |
| 120 | 3300005539 | Ga0068853_100083870 | Ga0068853_1000838702 | 122 |
| 121 | 3300005539 | Ga0068853_100114242 | Ga0068853_1001142424 | 122 |
| 122 | 3300005539 | Ga0068853_100604955 | Ga0068853_1006049551 | 122 |
| 123 | 3300005539 | Ga0068853_100870262 | Ga0068853_1008702622 | 122 |
| 124 | 3300005543 | Ga0070672_100546171 | Ga0070672_1005461712 | 122 |
| 125 | 3300005548 | Ga0070665_100000118 | Ga0070665_1000001189 | 122 |
| 126 | 3300005548 | Ga0070665_100332761 | Ga0070665_1003327612 | 122 |
| 127 | 3300005563 | Ga0068855_100000268 | Ga0068855_10000026842 | 122 |
| 128 | 3300005563 | Ga0068855_100000967 | Ga0068855_1000009679 | 122 |
| 129 | 3300005563 | Ga0068855_100001431 | Ga0068855_1000014313 | 122 |
| 130 | 3300005563 | Ga0068855_100015178 | Ga0068855_1000151782 | 122 |
| 131 | 3300005563 | Ga0068855_100027421 | Ga0068855_1000274215 | 122 |
| 132 | 3300005563 | Ga0068855_100029172 | Ga0068855_1000291724 | 122 |
| 133 | 3300005563 | Ga0068855_100048451 | Ga0068855_1000484513 | 122 |
| 134 | 3300005563 | Ga0068855_100113905 | Ga0068855_1001139052 | 122 |
| 135 | 3300005563 | Ga0068855_100123199 | Ga0068855_1001231992 | 122 |
| 136 | 3300005563 | Ga0068855_100149792 | Ga0068855_1001497921 | 122 |
| 137 | 3300005563 | Ga0068855_100162582 | Ga0068855_1001625822 | 122 |
| 138 | 3300005563 | Ga0068855_100237010 | Ga0068855_1002370102 | 122 |
| 139 | 3300005563 | Ga0068855_100286932 | Ga0068855_1002869322 | 122 |
| 140 | 3300005563 | Ga0068855_100350233 | Ga0068855_1003502332 | 122 |
| 141 | 3300005563 | Ga0068855_100453218 | Ga0068855_1004532182 | 122 |
| 142 | 3300005563 | Ga0068855_100493919 | Ga0068855_1004939192 | 122 |
| 143 | 3300005563 | Ga0068855_101053690 | Ga0068855_1010536901 | 122 |
| 144 | 3300005563 | Ga0068855_101429179 | Ga0068855_1014291791 | 122 |
| 145 | 3300005577 | Ga0068857_100131311 | Ga0068857_1001313112 | 122 |
| 146 | 3300005577 | Ga0068857_100248276 | Ga0068857_1002482762 | 122 |
| 147 | 3300005577 | Ga0068857_100257090 | Ga0068857_1002570902 | 122 |
| 148 | 3300005578 | Ga0068854_100057394 | Ga0068854_1000573942 | 122 |
| 149 | 3300005614 | Ga0068856_100017859 | Ga0068856_1000178595 | 122 |
| 150 | 3300005614 | Ga0068856_100057792 | Ga0068856_1000577924 | 122 |
| 151 | 3300005614 | Ga0068856_100078687 | Ga0068856_1000786874 | 122 |
| 152 | 3300005614 | Ga0068856_100101403 | Ga0068856_1001014034 | 122 |
| 153 | 3300005614 | Ga0068856_100277659 | Ga0068856_1002776592 | 122 |
| 154 | 3300005614 | Ga0068856_100295764 | Ga0068856_1002957642 | 122 |
| 155 | 3300005614 | Ga0068856_100461380 | Ga0068856_1004613802 | 122 |
| 156 | 3300005614 | Ga0068856_100624835 | Ga0068856_1006248352 | 122 |
| 157 | 3300005614 | Ga0068856_100705530 | Ga0068856_1007055301 | 122 |
| 158 | 3300005614 | Ga0068856_101220242 | Ga0068856_1012202421 | 122 |
| 159 | 3300005614 | Ga0068856_101597234 | Ga0068856_1015972341 | 122 |
| 160 | 3300005616 | Ga0068852_100000862 | Ga0068852_10000086212 | 122 |
| 161 | 3300005616 | Ga0068852_100114709 | Ga0068852_1001147092 | 122 |
| 162 | 3300005616 | Ga0068852_100367581 | Ga0068852_1003675812 | 122 |
| 163 | 3300005718 | Ga0068866_10056329 | Ga0068866_100563291 | 122 |
| 164 | 3300005718 | Ga0068866_10751871 | Ga0068866_107518711 | 122 |
| 165 | 3300005840 | Ga0068870_10173517 | Ga0068870_101735172 | 122 |
| 166 | 3300005841 | Ga0068863_100863440 | Ga0068863_1008634401 | 122 |
| 167 | 3300005842 | Ga0068858_100120307 | Ga0068858_1001203072 | 122 |
| 168 | 3300005842 | Ga0068858_100205347 | Ga0068858_1002053473 | 122 |
| 169 | 3300005842 | Ga0068858_102545755 | Ga0068858_1025457551 | 122 |
| 170 | 3300006195 | Ga0075366_10001407 | Ga0075366_100014072 | 122 |
| 171 | 3300006195 | Ga0075366_10001542 | Ga0075366_100015425 | 122 |
| 172 | 3300006195 | Ga0075366_10005056 | Ga0075366_100050563 | 122 |
| 173 | 3300006195 | Ga0075366_10017247 | Ga0075366_100172473 | 122 |
| 174 | 3300006195 | Ga0075366_10098559 | Ga0075366_100985591 | 122 |
| 175 | 3300006195 | Ga0075366_10171616 | Ga0075366_101716162 | 122 |
| 176 | 3300006237 | Ga0097621_100000015 | Ga0097621_10000001549 | 122 |
| 177 | 3300006237 | Ga0097621_101394576 | Ga0097621_1013945761 | 122 |
| 178 | 3300006353 | Ga0075370_10495317 | Ga0075370_104953172 | 122 |
| 179 | 3300006358 | Ga0068871_100000051 | Ga0068871_10000005132 | 122 |
| 180 | 3300006881 | Ga0068865_100000120 | Ga0068865_10000012031 | 122 |
| 181 | 3300009036 | Ga0105244_10041432 | Ga0105244_100414322 | 122 |
| 182 | 3300009036 | Ga0105244_10163055 | Ga0105244_101630551 | 122 |
| 183 | 3300009093 | Ga0105240_10000185 | Ga0105240_1000018512 | 122 |
| 184 | 3300009093 | Ga0105240_10002706 | Ga0105240_100027063 | 122 |
| 185 | 3300009093 | Ga0105240_10013632 | Ga0105240_100136326 | 122 |
| 186 | 3300009093 | Ga0105240_10039125 | Ga0105240_100391257 | 122 |
| 187 | 3300009093 | Ga0105240_10049341 | Ga0105240_100493413 | 122 |
| 188 | 3300009093 | Ga0105240_10079337 | Ga0105240_100793372 | 122 |
| 189 | 3300009093 | Ga0105240_10079337 | Ga0105240_100793374 | 122 |
| 190 | 3300009093 | Ga0105240_10143852 | Ga0105240_101438522 | 122 |
| 191 | 3300009093 | Ga0105240_10149122 | Ga0105240_101491222 | 122 |
| 192 | 3300009093 | Ga0105240_10184556 | Ga0105240_101845562 | 122 |
| 193 | 3300009093 | Ga0105240_10240981 | Ga0105240_102409812 | 122 |
| 194 | 3300009093 | Ga0105240_10298268 | Ga0105240_102982682 | 122 |
| 195 | 3300009093 | Ga0105240_10312511 | Ga0105240_103125112 | 122 |
| 196 | 3300009093 | Ga0105240_10312672 | Ga0105240_103126722 | 122 |
| 197 | 3300009093 | Ga0105240_10337375 | Ga0105240_103373752 | 122 |
| 198 | 3300009093 | Ga0105240_10362581 | Ga0105240_103625812 | 122 |
| 199 | 3300009093 | Ga0105240_10477310 | Ga0105240_104773102 | 122 |
| 200 | 3300009093 | Ga0105240_10713281 | Ga0105240_107132811 | 122 |
| 201 | 3300009093 | Ga0105240_11154335 | Ga0105240_111543352 | 122 |
| 202 | 3300009093 | Ga0105240_11233548 | Ga0105240_112335482 | 122 |
| 203 | 3300009093 | Ga0105240_12343157 | Ga0105240_123431571 | 122 |
| 204 | 3300009148 | Ga0105243_10034277 | Ga0105243_100342773 | 122 |
| 205 | 3300009174 | Ga0105241_10001267 | Ga0105241_1000126718 | 122 |
| 206 | 3300009174 | Ga0105241_10003621 | Ga0105241_1000362113 | 122 |
| 207 | 3300009174 | Ga0105241_10011403 | Ga0105241_100114035 | 122 |
| 208 | 3300009174 | Ga0105241_10030063 | Ga0105241_100300632 | 122 |
| 209 | 3300009174 | Ga0105241_10055766 | Ga0105241_100557662 | 122 |
| 210 | 3300009174 | Ga0105241_10069549 | Ga0105241_100695495 | 122 |
| 211 | 3300009174 | Ga0105241_10110233 | Ga0105241_101102333 | 122 |
| 212 | 3300009174 | Ga0105241_10178991 | Ga0105241_101789912 | 122 |
| 213 | 3300009174 | Ga0105241_10306878 | Ga0105241_103068782 | 122 |
| 214 | 3300009174 | Ga0105241_10427269 | Ga0105241_104272691 | 122 |
| 215 | 3300009174 | Ga0105241_10475229 | Ga0105241_104752292 | 122 |
| 216 | 3300009174 | Ga0105241_10613444 | Ga0105241_106134442 | 122 |
| 217 | 3300009174 | Ga0105241_11418315 | Ga0105241_114183152 | 122 |
| 218 | 3300009176 | Ga0105242_10172286 | Ga0105242_101722862 | 122 |
| 219 | 3300009176 | Ga0105242_10772372 | Ga0105242_107723722 | 122 |
| 220 | 3300009176 | Ga0105242_11091223 | Ga0105242_110912232 | 122 |
| 221 | 3300009545 | Ga0105237_10000758 | Ga0105237_1000075837 | 122 |
| 222 | 3300009545 | Ga0105237_10000887 | Ga0105237_1000088725 | 122 |
| 223 | 3300009545 | Ga0105237_10002011 | Ga0105237_100020118 | 122 |
| 224 | 3300009545 | Ga0105237_10007579 | Ga0105237_100075798 | 122 |
| 225 | 3300009545 | Ga0105237_10008366 | Ga0105237_100083666 | 122 |
| 226 | 3300009545 | Ga0105237_10016912 | Ga0105237_100169126 | 122 |
| 227 | 3300009545 | Ga0105237_10031079 | Ga0105237_100310792 | 122 |
| 228 | 3300009545 | Ga0105237_10159958 | Ga0105237_101599582 | 122 |
| 229 | 3300009545 | Ga0105237_10258257 | Ga0105237_102582572 | 122 |
| 230 | 3300009545 | Ga0105237_10417292 | Ga0105237_104172922 | 122 |
| 231 | 3300009545 | Ga0105237_10433497 | Ga0105237_104334972 | 122 |
| 232 | 3300009545 | Ga0105237_11340306 | Ga0105237_113403062 | 122 |
| 233 | 3300009545 | Ga0105237_12048883 | Ga0105237_120488831 | 122 |
| 234 | 3300009545 | Ga0105237_12560937 | Ga0105237_125609371 | 122 |
| 235 | 3300009551 | Ga0105238_10015398 | Ga0105238_100153981 | 122 |
| 236 | 3300009551 | Ga0105238_10039973 | Ga0105238_100399734 | 122 |
| 237 | 3300009551 | Ga0105238_10278348 | Ga0105238_102783482 | 122 |
| 238 | 3300009551 | Ga0105238_10363107 | Ga0105238_103631072 | 122 |
| 239 | 3300009551 | Ga0105238_10621345 | Ga0105238_106213452 | 122 |
| 240 | 3300009551 | Ga0105238_10798214 | Ga0105238_107982142 | 122 |
| 241 | 3300009553 | Ga0105249_10194085 | Ga0105249_101940852 | 122 |
| 242 | 3300010375 | Ga0105239_10000142 | Ga0105239_1000014252 | 122 |
| 243 | 3300010375 | Ga0105239_10001435 | Ga0105239_1000143519 | 122 |
| 244 | 3300010375 | Ga0105239_10001468 | Ga0105239_1000146822 | 122 |
| 245 | 3300010375 | Ga0105239_10002256 | Ga0105239_1000225616 | 122 |
| 246 | 3300010375 | Ga0105239_10002374 | Ga0105239_1000237419 | 122 |
| 247 | 3300010375 | Ga0105239_10003905 | Ga0105239_100039058 | 122 |
| 248 | 3300010375 | Ga0105239_10004588 | Ga0105239_100045887 | 122 |
| 249 | 3300010375 | Ga0105239_10022631 | Ga0105239_100226316 | 122 |
| 250 | 3300010375 | Ga0105239_10029834 | Ga0105239_100298342 | 122 |
| 251 | 3300010375 | Ga0105239_10031340 | Ga0105239_100313405 | 122 |
| 252 | 3300010375 | Ga0105239_10075942 | Ga0105239_100759422 | 122 |
| 253 | 3300010375 | Ga0105239_10076804 | Ga0105239_100768043 | 122 |
| 254 | 3300010375 | Ga0105239_10105106 | Ga0105239_101051063 | 122 |
| 255 | 3300010375 | Ga0105239_10107988 | Ga0105239_101079882 | 122 |
| 256 | 3300010375 | Ga0105239_10599474 | Ga0105239_105994742 | 122 |
| 257 | 3300010375 | Ga0105239_11299316 | Ga0105239_112993162 | 122 |
| 258 | 3300010375 | Ga0105239_11817595 | Ga0105239_118175951 | 122 |
| 259 | 3300010375 | Ga0105239_13209637 | Ga0105239_132096371 | 122 |
| 260 | 3300011119 | Ga0105246_10047095 | Ga0105246_100470952 | 122 |
| 261 | 3300011119 | Ga0105246_10107474 | Ga0105246_101074742 | 122 |
| 262 | 3300013100 | Ga0157373_10000254 | Ga0157373_100002543 | 122 |
| 263 | 3300013100 | Ga0157373_10000262 | Ga0157373_1000026224 | 122 |
| 264 | 3300013100 | Ga0157373_10022406 | Ga0157373_100224062 | 122 |
| 265 | 3300013100 | Ga0157373_10029292 | Ga0157373_100292921 | 122 |
| 266 | 3300013102 | Ga0157371_10000117 | Ga0157371_1000011738 | 122 |
| 267 | 3300013102 | Ga0157371_10000912 | Ga0157371_1000091227 | 122 |
| 268 | 3300013102 | Ga0157371_10001520 | Ga0157371_100015208 | 122 |
| 269 | 3300013102 | Ga0157371_10002174 | Ga0157371_100021742 | 122 |
| 270 | 3300013102 | Ga0157371_10004362 | Ga0157371_100043622 | 122 |
| 271 | 3300013102 | Ga0157371_10013752 | Ga0157371_100137522 | 122 |
| 272 | 3300013102 | Ga0157371_10022859 | Ga0157371_100228594 | 122 |
| 273 | 3300013102 | Ga0157371_10168306 | Ga0157371_101683062 | 122 |
| 274 | 3300013102 | Ga0157371_10226002 | Ga0157371_102260022 | 122 |
| 275 | 3300013104 | Ga0157370_10003772 | Ga0157370_1000377219 | 122 |
| 276 | 3300013104 | Ga0157370_10009721 | Ga0157370_100097216 | 122 |
| 277 | 3300013104 | Ga0157370_10010234 | Ga0157370_100102341 | 122 |
| 278 | 3300013104 | Ga0157370_10025999 | Ga0157370_100259992 | 122 |
| 279 | 3300013104 | Ga0157370_10071814 | Ga0157370_100718142 | 122 |
| 280 | 3300013104 | Ga0157370_10075503 | Ga0157370_100755032 | 122 |
| 281 | 3300013104 | Ga0157370_10143214 | Ga0157370_101432143 | 122 |
| 282 | 3300013104 | Ga0157370_10188263 | Ga0157370_101882632 | 122 |
| 283 | 3300013104 | Ga0157370_10195676 | Ga0157370_101956761 | 122 |
| 284 | 3300013104 | Ga0157370_10466876 | Ga0157370_104668762 | 122 |
| 285 | 3300013104 | Ga0157370_10494717 | Ga0157370_104947172 | 122 |
| 286 | 3300013104 | Ga0157370_10596957 | Ga0157370_105969572 | 122 |
| 287 | 3300013104 | Ga0157370_10790550 | Ga0157370_107905501 | 122 |
| 288 | 3300013104 | Ga0157370_10957935 | Ga0157370_109579351 | 122 |
| 289 | 3300013105 | Ga0157369_10000047 | Ga0157369_1000004781 | 122 |
| 290 | 3300013105 | Ga0157369_10000101 | Ga0157369_1000010184 | 122 |
| 291 | 3300013105 | Ga0157369_10235298 | Ga0157369_102352982 | 122 |
| 292 | 3300013105 | Ga0157369_10237711 | Ga0157369_102377112 | 122 |
| 293 | 3300013105 | Ga0157369_10247576 | Ga0157369_102475762 | 122 |
| 294 | 3300013105 | Ga0157369_10303928 | Ga0157369_103039281 | 122 |
| 295 | 3300013105 | Ga0157369_10460852 | Ga0157369_104608522 | 122 |
| 296 | 3300013105 | Ga0157369_11438487 | Ga0157369_114384871 | 122 |
| 297 | 3300013296 | Ga0157374_10000874 | Ga0157374_100008749 | 122 |
| 298 | 3300013296 | Ga0157374_10001137 | Ga0157374_1000113710 | 122 |
| 299 | 3300013296 | Ga0157374_10012440 | Ga0157374_100124402 | 122 |
| 300 | 3300013296 | Ga0157374_10012440 | Ga0157374_100124404 | 122 |
| 301 | 3300013296 | Ga0157374_10362962 | Ga0157374_103629622 | 122 |
| 302 | 3300013296 | Ga0157374_10410837 | Ga0157374_104108372 | 122 |
| 303 | 3300013296 | Ga0157374_10590113 | Ga0157374_105901132 | 122 |
| 304 | 3300013296 | Ga0157374_11524670 | Ga0157374_115246701 | 122 |
| 305 | 3300013296 | Ga0157374_12068238 | Ga0157374_120682381 | 122 |
| 306 | 3300013297 | Ga0157378_10010197 | Ga0157378_100101978 | 122 |
| 307 | 3300013297 | Ga0157378_10268463 | Ga0157378_102684632 | 122 |
| 308 | 3300013297 | Ga0157378_10269515 | Ga0157378_102695152 | 122 |
| 309 | 3300013297 | Ga0157378_10360437 | Ga0157378_103604372 | 122 |
| 310 | 3300013297 | Ga0157378_10427712 | Ga0157378_104277121 | 122 |
| 311 | 3300013306 | Ga0163162_10000012 | Ga0163162_1000001220 | 122 |
| 312 | 3300013306 | Ga0163162_10000895 | Ga0163162_1000089510 | 122 |
| 313 | 3300013306 | Ga0163162_10001113 | Ga0163162_100011138 | 122 |
| 314 | 3300013306 | Ga0163162_10004644 | Ga0163162_100046442 | 122 |
| 315 | 3300013306 | Ga0163162_10367947 | Ga0163162_103679472 | 122 |
| 316 | 3300013306 | Ga0163162_10404386 | Ga0163162_104043862 | 122 |
| 317 | 3300013306 | Ga0163162_10566128 | Ga0163162_105661281 | 122 |
| 318 | 3300013306 | Ga0163162_10827881 | Ga0163162_108278812 | 122 |
| 319 | 3300013307 | Ga0157372_10000041 | Ga0157372_1000004180 | 122 |
| 320 | 3300013307 | Ga0157372_10000199 | Ga0157372_1000019950 | 122 |
| 321 | 3300013307 | Ga0157372_10002721 | Ga0157372_1000272112 | 122 |
| 322 | 3300013307 | Ga0157372_10014659 | Ga0157372_100146592 | 122 |
| 323 | 3300013307 | Ga0157372_10019379 | Ga0157372_100193799 | 122 |
| 324 | 3300013307 | Ga0157372_10035225 | Ga0157372_100352253 | 122 |
| 325 | 3300013307 | Ga0157372_10054327 | Ga0157372_100543273 | 122 |
| 326 | 3300013307 | Ga0157372_10065963 | Ga0157372_100659631 | 122 |
| 327 | 3300013307 | Ga0157372_10453387 | Ga0157372_104533872 | 122 |
| 328 | 3300013307 | Ga0157372_11186032 | Ga0157372_111860321 | 122 |
| 329 | 3300013308 | Ga0157375_10013601 | Ga0157375_100136012 | 122 |
| 330 | 3300013308 | Ga0157375_10059972 | Ga0157375_100599723 | 122 |
| 331 | 3300013308 | Ga0157375_10143486 | Ga0157375_101434862 | 122 |
| 332 | 3300013308 | Ga0157375_10898565 | Ga0157375_108985652 | 122 |
| 333 | 3300013308 | Ga0157375_11084893 | Ga0157375_110848931 | 122 |
| 334 | 3300013308 | Ga0157375_11539125 | Ga0157375_115391252 | 122 |
| 335 | 3300014325 | Ga0163163_10576626 | Ga0163163_105766262 | 122 |
| 336 | 3300014497 | Ga0182008_10000002 | Ga0182008_10000002110 | 122 |
| 337 | 3300014497 | Ga0182008_10000294 | Ga0182008_1000029420 | 122 |
| 338 | 3300014497 | Ga0182008_10124150 | Ga0182008_101241502 | 122 |
| 339 | 3300014745 | Ga0157377_10059831 | Ga0157377_100598312 | 122 |
| 340 | 3300014745 | Ga0157377_10400415 | Ga0157377_104004151 | 122 |
| 341 | 3300014968 | Ga0157379_11385576 | Ga0157379_113855762 | 122 |
| 342 | 3300015261 | Ga0182006_1000153 | Ga0182006_100015310 | 122 |
| 343 | 3300015261 | Ga0182006_1000287 | Ga0182006_100028735 | 122 |
| 344 | 3300015261 | Ga0182006_1000349 | Ga0182006_100034919 | 122 |
| 345 | 3300015261 | Ga0182006_1003312 | Ga0182006_10033124 | 122 |
| 346 | 3300015262 | Ga0182007_10000005 | Ga0182007_10000005167 | 122 |
| 347 | 3300015682 | Ga0183373_1002 | Ga0183373_1002755 | 122 |
| 348 | 3300017792 | Ga0163161_10001299 | Ga0163161_100012993 | 122 |
| 349 | 3300017792 | Ga0163161_10002412 | Ga0163161_100024127 | 122 |
| 350 | 3300017792 | Ga0163161_10002768 | Ga0163161_1000276812 | 122 |
| 351 | 3300017792 | Ga0163161_10006203 | Ga0163161_100062035 | 122 |
| 352 | 3300017792 | Ga0163161_10050655 | Ga0163161_100506552 | 122 |
| 353 | 3300017792 | Ga0163161_10055914 | Ga0163161_100559142 | 122 |
| 354 | 3300017792 | Ga0163161_10092081 | Ga0163161_100920812 | 122 |
| 355 | 3300017792 | Ga0163161_11264025 | Ga0163161_112640251 | 122 |
| 356 | 3300020077 | Ga0206351_10496138 | Ga0206351_104961381 | 122 |
| 357 | 3300021361 | Ga0213872_10008325 | Ga0213872_100083255 | 122 |
| 358 | 3300025230 | Ga0209563_109379 | Ga0209563_1093792 | 122 |
| 359 | 3300025231 | Ga0207427_100043 | Ga0207427_10004322 | 122 |
| 360 | 3300025233 | Ga0209437_100024 | Ga0209437_100024277 | 122 |
| 361 | 3300025233 | Ga0209437_100030 | Ga0209437_100030366 | 122 |
| 362 | 3300025233 | Ga0209437_100170 | Ga0209437_10017097 | 122 |
| 363 | 3300025242 | Ga0209258_114613 | Ga0209258_1146131 | 122 |
| 364 | 3300025245 | Ga0207425_1000003 | Ga0207425_1000003600 | 122 |
| 365 | 3300025250 | Ga0209026_1000225 | Ga0209026_10002256 | 122 |
| 366 | 3300025250 | Ga0209026_1003564 | Ga0209026_10035643 | 122 |
| 367 | 3300025250 | Ga0209026_1024243 | Ga0209026_10242431 | 122 |
| 368 | 3300025250 | Ga0209026_1044634 | Ga0209026_10446341 | 122 |
| 369 | 3300025258 | Ga0209129_1000014 | Ga0209129_1000014233 | 122 |
| 370 | 3300025258 | Ga0209129_1007976 | Ga0209129_10079762 | 122 |
| 371 | 3300025258 | Ga0209129_1011482 | Ga0209129_10114822 | 122 |
| 372 | 3300025261 | Ga0209233_1000266 | Ga0209233_100026637 | 122 |
| 373 | 3300025261 | Ga0209233_1048394 | Ga0209233_10483941 | 122 |
| 374 | 3300025261 | Ga0209233_1048817 | Ga0209233_10488172 | 122 |
| 375 | 3300025272 | Ga0209455_1001647 | Ga0209455_10016477 | 122 |
| 376 | 3300025272 | Ga0209455_1002288 | Ga0209455_10022884 | 122 |
| 377 | 3300025292 | Ga0209676_1000491 | Ga0209676_100049151 | 122 |
| 378 | 3300025294 | Ga0209025_1000007 | Ga0209025_1000007599 | 122 |
| 379 | 3300025297 | Ga0209758_1000012 | Ga0209758_1000012600 | 122 |
| 380 | 3300025298 | Ga0209050_1081806 | Ga0209050_10818062 | 122 |
| 381 | 3300025728 | Ga0207655_1034009 | Ga0207655_10340092 | 122 |
| 382 | 3300025899 | Ga0207642_10100749 | Ga0207642_101007491 | 122 |
| 383 | 3300025899 | Ga0207642_10624420 | Ga0207642_106244201 | 122 |
| 384 | 3300025904 | Ga0207647_10000012 | Ga0207647_1000001210 | 122 |
| 385 | 3300025904 | Ga0207647_10132579 | Ga0207647_101325792 | 122 |
| 386 | 3300025904 | Ga0207647_10188948 | Ga0207647_101889482 | 122 |
| 387 | 3300025907 | Ga0207645_10000058 | Ga0207645_1000005815 | 122 |
| 388 | 3300025908 | Ga0207643_10176790 | Ga0207643_101767902 | 122 |
| 389 | 3300025909 | Ga0207705_10000026 | Ga0207705_10000026133 | 122 |
| 390 | 3300025909 | Ga0207705_10000026 | Ga0207705_10000026135 | 122 |
| 391 | 3300025909 | Ga0207705_10000036 | Ga0207705_10000036107 | 122 |
| 392 | 3300025909 | Ga0207705_10046191 | Ga0207705_100461912 | 122 |
| 393 | 3300025909 | Ga0207705_10073215 | Ga0207705_100732152 | 122 |
| 394 | 3300025909 | Ga0207705_10256711 | Ga0207705_102567111 | 122 |
| 395 | 3300025909 | Ga0207705_10268285 | Ga0207705_102682852 | 122 |
| 396 | 3300025911 | Ga0207654_10001331 | Ga0207654_1000133111 | 122 |
| 397 | 3300025911 | Ga0207654_10058658 | Ga0207654_100586582 | 122 |
| 398 | 3300025911 | Ga0207654_10075706 | Ga0207654_100757062 | 122 |
| 399 | 3300025911 | Ga0207654_10098758 | Ga0207654_100987582 | 122 |
| 400 | 3300025911 | Ga0207654_10172222 | Ga0207654_101722221 | 122 |
| 401 | 3300025911 | Ga0207654_10259196 | Ga0207654_102591961 | 122 |
| 402 | 3300025911 | Ga0207654_10289615 | Ga0207654_102896152 | 122 |
| 403 | 3300025912 | Ga0207707_10088460 | Ga0207707_100884602 | 122 |
| 404 | 3300025913 | Ga0207695_10000117 | Ga0207695_10000117113 | 122 |
| 405 | 3300025913 | Ga0207695_10019916 | Ga0207695_100199163 | 122 |
| 406 | 3300025913 | Ga0207695_10024211 | Ga0207695_100242112 | 122 |
| 407 | 3300025913 | Ga0207695_10060748 | Ga0207695_100607485 | 122 |
| 408 | 3300025913 | Ga0207695_10078136 | Ga0207695_100781362 | 122 |
| 409 | 3300025913 | Ga0207695_10119662 | Ga0207695_101196622 | 122 |
| 410 | 3300025913 | Ga0207695_10172634 | Ga0207695_101726342 | 122 |
| 411 | 3300025913 | Ga0207695_10196438 | Ga0207695_101964381 | 122 |
| 412 | 3300025913 | Ga0207695_10212441 | Ga0207695_102124412 | 122 |
| 413 | 3300025913 | Ga0207695_10216751 | Ga0207695_102167512 | 122 |
| 414 | 3300025913 | Ga0207695_10249836 | Ga0207695_102498362 | 122 |
| 415 | 3300025913 | Ga0207695_10264192 | Ga0207695_102641922 | 122 |
| 416 | 3300025913 | Ga0207695_10310842 | Ga0207695_103108421 | 122 |
| 417 | 3300025913 | Ga0207695_10646192 | Ga0207695_106461922 | 122 |
| 418 | 3300025913 | Ga0207695_10955910 | Ga0207695_109559101 | 122 |
| 419 | 3300025913 | Ga0207695_11224020 | Ga0207695_112240202 | 122 |
| 420 | 3300025914 | Ga0207671_10000831 | Ga0207671_1000083111 | 122 |
| 421 | 3300025914 | Ga0207671_10004503 | Ga0207671_100045038 | 122 |
| 422 | 3300025914 | Ga0207671_10004510 | Ga0207671_100045105 | 122 |
| 423 | 3300025914 | Ga0207671_10005083 | Ga0207671_100050838 | 122 |
| 424 | 3300025914 | Ga0207671_10019598 | Ga0207671_100195986 | 122 |
| 425 | 3300025914 | Ga0207671_10021131 | Ga0207671_100211311 | 122 |
| 426 | 3300025914 | Ga0207671_10074052 | Ga0207671_100740522 | 122 |
| 427 | 3300025914 | Ga0207671_10464045 | Ga0207671_104640451 | 122 |
| 428 | 3300025917 | Ga0207660_10011090 | Ga0207660_100110902 | 122 |
| 429 | 3300025919 | Ga0207657_10099781 | Ga0207657_100997812 | 122 |
| 430 | 3300025919 | Ga0207657_10107468 | Ga0207657_101074682 | 122 |
| 431 | 3300025919 | Ga0207657_10113819 | Ga0207657_101138192 | 122 |
| 432 | 3300025919 | Ga0207657_10210232 | Ga0207657_102102322 | 122 |
| 433 | 3300025921 | Ga0207652_10070876 | Ga0207652_100708763 | 122 |
| 434 | 3300025921 | Ga0207652_10244146 | Ga0207652_102441462 | 122 |
| 435 | 3300025924 | Ga0207694_10093844 | Ga0207694_100938442 | 122 |
| 436 | 3300025924 | Ga0207694_10328650 | Ga0207694_103286502 | 122 |
| 437 | 3300025924 | Ga0207694_11105958 | Ga0207694_111059581 | 122 |
| 438 | 3300025926 | Ga0207659_10809111 | Ga0207659_108091111 | 122 |
| 439 | 3300025928 | Ga0207700_10647102 | Ga0207700_106471022 | 122 |
| 440 | 3300025931 | Ga0207644_10000740 | Ga0207644_100007409 | 122 |
| 441 | 3300025932 | Ga0207690_10000594 | Ga0207690_1000059415 | 122 |
| 442 | 3300025933 | Ga0207706_10000430 | Ga0207706_1000043040 | 122 |
| 443 | 3300025933 | Ga0207706_10483716 | Ga0207706_104837162 | 122 |
| 444 | 3300025934 | Ga0207686_10175820 | Ga0207686_101758202 | 122 |
| 445 | 3300025935 | Ga0207709_10029111 | Ga0207709_100291112 | 122 |
| 446 | 3300025937 | Ga0207669_10037635 | Ga0207669_100376352 | 122 |
| 447 | 3300025937 | Ga0207669_10234446 | Ga0207669_102344462 | 122 |
| 448 | 3300025938 | Ga0207704_10000047 | Ga0207704_100000478 | 122 |
| 449 | 3300025942 | Ga0207689_10766391 | Ga0207689_107663911 | 122 |
| 450 | 3300025944 | Ga0207661_10137960 | Ga0207661_101379602 | 122 |
| 451 | 3300025949 | Ga0207667_10000009 | Ga0207667_10000009380 | 122 |
| 452 | 3300025949 | Ga0207667_10001021 | Ga0207667_1000102122 | 122 |
| 453 | 3300025949 | Ga0207667_10001079 | Ga0207667_1000107944 | 122 |
| 454 | 3300025949 | Ga0207667_10001338 | Ga0207667_100013383 | 122 |
| 455 | 3300025949 | Ga0207667_10008164 | Ga0207667_100081646 | 122 |
| 456 | 3300025949 | Ga0207667_10022759 | Ga0207667_100227595 | 122 |
| 457 | 3300025949 | Ga0207667_10030764 | Ga0207667_100307643 | 122 |
| 458 | 3300025949 | Ga0207667_10039676 | Ga0207667_100396764 | 122 |
| 459 | 3300025949 | Ga0207667_10044166 | Ga0207667_100441663 | 122 |
| 460 | 3300025949 | Ga0207667_10128350 | Ga0207667_101283504 | 122 |
| 461 | 3300025949 | Ga0207667_10172942 | Ga0207667_101729422 | 122 |
| 462 | 3300025949 | Ga0207667_10236982 | Ga0207667_102369821 | 122 |
| 463 | 3300025949 | Ga0207667_10354204 | Ga0207667_103542042 | 122 |
| 464 | 3300025949 | Ga0207667_10380169 | Ga0207667_103801692 | 122 |
| 465 | 3300025949 | Ga0207667_10392029 | Ga0207667_103920292 | 122 |
| 466 | 3300025949 | Ga0207667_10412436 | Ga0207667_104124362 | 122 |
| 467 | 3300025949 | Ga0207667_10497800 | Ga0207667_104978002 | 122 |
| 468 | 3300025949 | Ga0207667_10646480 | Ga0207667_106464802 | 122 |
| 469 | 3300025960 | Ga0207651_10053476 | Ga0207651_100534762 | 122 |
| 470 | 3300025961 | Ga0207712_10417928 | Ga0207712_104179282 | 122 |
| 471 | 3300025981 | Ga0207640_10110434 | Ga0207640_101104342 | 122 |
| 472 | 3300025981 | Ga0207640_10380135 | Ga0207640_103801351 | 122 |
| 473 | 3300026023 | Ga0207677_10058813 | Ga0207677_100588132 | 122 |
| 474 | 3300026023 | Ga0207677_10154998 | Ga0207677_101549981 | 122 |
| 475 | 3300026041 | Ga0207639_10007193 | Ga0207639_100071934 | 122 |
| 476 | 3300026041 | Ga0207639_10024734 | Ga0207639_100247342 | 122 |
| 477 | 3300026041 | Ga0207639_10034261 | Ga0207639_100342612 | 122 |
| 478 | 3300026041 | Ga0207639_10136018 | Ga0207639_101360182 | 122 |
| 479 | 3300026041 | Ga0207639_10176942 | Ga0207639_101769422 | 122 |
| 480 | 3300026041 | Ga0207639_10338931 | Ga0207639_103389312 | 122 |
| 481 | 3300026041 | Ga0207639_10489443 | Ga0207639_104894432 | 122 |
| 482 | 3300026041 | Ga0207639_10720285 | Ga0207639_107202852 | 122 |
| 483 | 3300026041 | Ga0207639_10873721 | Ga0207639_108737212 | 122 |
| 484 | 3300026067 | Ga0207678_10064250 | Ga0207678_100642503 | 122 |
| 485 | 3300026078 | Ga0207702_10008741 | Ga0207702_100087419 | 122 |
| 486 | 3300026078 | Ga0207702_10009173 | Ga0207702_100091738 | 122 |
| 487 | 3300026078 | Ga0207702_10012151 | Ga0207702_100121518 | 122 |
| 488 | 3300026078 | Ga0207702_10013063 | Ga0207702_100130635 | 122 |
| 489 | 3300026078 | Ga0207702_10197209 | Ga0207702_101972092 | 122 |
| 490 | 3300026078 | Ga0207702_10248953 | Ga0207702_102489531 | 122 |
| 491 | 3300026078 | Ga0207702_10256685 | Ga0207702_102566852 | 122 |
| 492 | 3300026078 | Ga0207702_10455319 | Ga0207702_104553192 | 122 |
| 493 | 3300026078 | Ga0207702_10846722 | Ga0207702_108467222 | 122 |
| 494 | 3300026078 | Ga0207702_11971821 | Ga0207702_119718211 | 122 |
| 495 | 3300026088 | Ga0207641_10839906 | Ga0207641_108399061 | 122 |
| 496 | 3300026089 | Ga0207648_10000458 | Ga0207648_100004587 | 122 |
| 497 | 3300026116 | Ga0207674_10080726 | Ga0207674_100807262 | 122 |
| 498 | 3300026116 | Ga0207674_10765722 | Ga0207674_107657222 | 122 |
| 499 | 3300026121 | Ga0207683_10192567 | Ga0207683_101925672 | 122 |
| 500 | 3300026142 | Ga0207698_10003112 | Ga0207698_1000311210 | 122 |
| 501 | 3300026142 | Ga0207698_10294071 | Ga0207698_102940712 | 122 |
| 502 | 3300026142 | Ga0207698_10611048 | Ga0207698_106110482 | 122 |
| 503 | 3300028379 | Ga0268266_10000121 | Ga0268266_10000121147 | 122 |
| 504 | 3300028786 | Ga0307517_10002529 | Ga0307517_1000252921 | 122 |
| 505 | 3300028794 | Ga0307515_10000077 | Ga0307515_10000077109 | 122 |
| 506 | 3300028794 | Ga0307515_10001997 | Ga0307515_100019977 | 122 |
| 507 | 3300028794 | Ga0307515_10002629 | Ga0307515_1000262921 | 122 |
| 508 | 3300028800 | Ga0265338_10038003 | Ga0265338_100380032 | 122 |
| 509 | 3300028800 | Ga0265338_10174071 | Ga0265338_101740712 | 122 |
| 510 | 3300028800 | Ga0265338_10417512 | Ga0265338_104175122 | 122 |
| 511 | 3300029957 | Ga0265324_10315157 | Ga0265324_103151571 | 122 |
| 512 | 3300030732 | Ga0316176_1020422 | Ga0316176_10204225 | 122 |
| 513 | 3300030742 | Ga0316183_1003890 | Ga0316183_100389014 | 122 |
| 514 | 3300030744 | Ga0316181_1007924 | Ga0316181_10079241 | 122 |
| 515 | 3300030744 | Ga0316181_1116089 | Ga0316181_11160894 | 122 |
| 516 | 3300030745 | Ga0316182_1021673 | Ga0316182_10216731 | 122 |
| 517 | 3300031456 | Ga0307513_10431555 | Ga0307513_104315552 | 122 |
| 518 | 3300031507 | Ga0307509_10056961 | Ga0307509_100569612 | 122 |
| 519 | 3300031507 | Ga0307509_10087936 | Ga0307509_100879364 | 122 |
| 520 | 3300031507 | Ga0307509_10219882 | Ga0307509_102198822 | 122 |
| 521 | 3300031548 | Ga0307408_100021295 | Ga0307408_1000212952 | 122 |
| 522 | 3300031548 | Ga0307408_100227339 | Ga0307408_1002273392 | 122 |
| 523 | 3300031727 | Ga0316576_10164522 | Ga0316576_101645222 | 122 |
| 524 | 3300031728 | Ga0316578_10471025 | Ga0316578_104710252 | 122 |
| 525 | 3300031730 | Ga0307516_10227260 | Ga0307516_102272602 | 122 |
| 526 | 3300031731 | Ga0307405_10000009 | Ga0307405_10000009106 | 122 |
| 527 | 3300031731 | Ga0307405_10001997 | Ga0307405_100019972 | 122 |
| 528 | 3300031731 | Ga0307405_10265964 | Ga0307405_102659642 | 122 |
| 529 | 3300031903 | Ga0307407_10000001 | Ga0307407_10000001282 | 122 |
| 530 | 3300031911 | Ga0307412_10000050 | Ga0307412_1000005056 | 122 |
| 531 | 3300031911 | Ga0307412_10071034 | Ga0307412_100710342 | 122 |
| 532 | 3300031911 | Ga0307412_10387013 | Ga0307412_103870131 | 122 |
| 533 | 3300031911 | Ga0307412_10399720 | Ga0307412_103997202 | 122 |
| 534 | 3300031911 | Ga0307412_10718646 | Ga0307412_107186462 | 122 |
| 535 | 3300031911 | Ga0307412_10846621 | Ga0307412_108466212 | 122 |
| 536 | 3300031995 | Ga0307409_100012342 | Ga0307409_1000123424 | 122 |
| 537 | 3300032002 | Ga0307416_100000008 | Ga0307416_100000008107 | 122 |
| 538 | 3300032002 | Ga0307416_103098278 | Ga0307416_1030982781 | 122 |
| 539 | 3300032004 | Ga0307414_10000344 | Ga0307414_1000034415 | 122 |
| 540 | 3300032004 | Ga0307414_10003900 | Ga0307414_100039007 | 122 |
| 541 | 3300032004 | Ga0307414_10010770 | Ga0307414_100107703 | 122 |
| 542 | 3300032004 | Ga0307414_10039887 | Ga0307414_100398873 | 122 |
| 543 | 3300032004 | Ga0307414_10183066 | Ga0307414_101830662 | 122 |
| 544 | 3300032004 | Ga0307414_10990803 | Ga0307414_109908032 | 122 |
| 545 | 3300032004 | Ga0307414_11225775 | Ga0307414_112257751 | 122 |
| 546 | 3300032005 | Ga0307411_10141374 | Ga0307411_101413742 | 122 |
| 547 | 3300032139 | Ga0316580_10098515 | Ga0316580_100985152 | 122 |
| 548 | 3300033179 | Ga0307507_10000313 | Ga0307507_1000031324 | 122 |
| 549 | 3300033180 | Ga0307510_10006887 | Ga0307510_100068879 | 122 |
| 550 | 3300033180 | Ga0307510_10536911 | Ga0307510_105369111 | 122 |
| 551 | 3300035398 | Ga0316574_0113941 | Ga0316574_0113941_232_636 | 122 |
| 552 | 3300036712 | Ga0316584_0091896 | Ga0316584_0091896_717_1100 | 122 |
| 553 | 3300037312 | Ga0395899_0000017 | Ga0395899_0000017_78306_78680 | 122 |
| 554 | 3300037312 | Ga0395899_0000024 | Ga0395899_0000024_223760_224131 | 122 |
| 555 | 3300037312 | Ga0395899_0000269 | Ga0395899_0000269_32032_32403 | 122 |
| 556 | 3300037312 | Ga0395899_0075951 | Ga0395899_0075951_732_1103 | 122 |
| 557 | 3300037418 | Ga0395900_0000140 | Ga0395900_0000140_56647_57018 | 122 |
| 558 | 3300037418 | Ga0395900_0000251 | Ga0395900_0000251_34834_35205 | 122 |
| 559 | 3300037418 | Ga0395900_0017469 | Ga0395900_0017469_6051_6422 | 122 |
| 560 | 3300037466 | Ga0395898_0002909 | Ga0395898_0002909_14727_15098 | 122 |
| 561 | 3300037466 | Ga0395898_1050121 | Ga0395898_1050121_214_585 | 122 |
| 562 | 3300037471 | Ga0395905_0000495 | Ga0395905_0000495_17496_17867 | 122 |
| 563 | 3300037471 | Ga0395905_0001502 | Ga0395905_0001502_13330_13701 | 122 |
| 564 | 3300037471 | Ga0395905_0998756 | Ga0395905_0998756_21_392 | 122 |
| 565 | 3300038443 | Ga0395901_0000145 | Ga0395901_0000145_22294_22665 | 122 |
| 566 | 3300038443 | Ga0395901_0001833 | Ga0395901_0001833_7019_7390 | 122 |
| 567 | 3300038443 | Ga0395901_0445701 | Ga0395901_0445701_245_616 | 122 |
| 568 | 3300039447 | Ga0436361_0109012 | Ga0436361_0109012_4493_4864 | 122 |
| 569 | 3300041451 | Ga0451791_0028699 | Ga0451791_0028699_162_533 | 122 |
| 570 | 3300041452 | Ga0451793_1139462 | Ga0451793_1139462_244_615 | 122 |
| 571 | 3300041452 | Ga0451793_1576126 | Ga0451793_1576126_221_598 | 122 |
| 572 | 3300041459 | Ga0451800_0740237 | Ga0451800_0740237_261_638 | 122 |
| 573 | 3300041460 | Ga0451802_1603469 | Ga0451802_1603469_158_529 | 122 |
| 574 | 3300041463 | Ga0451804_1040624 | Ga0451804_1040624_200_577 | 122 |
| 575 | 3300041486 | Ga0451807_2325405 | Ga0451807_2325405_156_527 | 122 |
| 576 | 3300042005 | Ga0439448_0035822 | Ga0439448_0035822_1032_1403 | 122 |
| 577 | 3300042012 | Ga0439455_0033159 | Ga0439455_0033159_67_438 | 122 |
| 578 | 3300044656 | Ga0466969_0085763 | Ga0466969_0085763_527_898 | 122 |
| 579 | 3300044684 | Ga0466966_0076649 | Ga0466966_0076649_26_397 | 122 |
| 580 | 3300044693 | Ga0466961_0043035 | Ga0466961_0043035_851_1222 | 122 |
| 581 | 3300044693 | Ga0466961_0147126 | Ga0466961_0147126_279_650 | 122 |
| 582 | 3300044842 | Ga0466957_0115623 | Ga0466957_0115623_672_1043 | 122 |
| 583 | 3300046453 | Ga0495627_032228 | Ga0495627_032228_857_1234 | 122 |
| 584 | 3300046454 | Ga0495592_0346473 | Ga0495592_0346473_494_871 | 122 |
| 585 | 3300046459 | Ga0495629_0032551 | Ga0495629_0032551_1160_1531 | 122 |
| 586 | 3300046460 | Ga0495638_0074162 | Ga0495638_0074162_121_492 | 122 |
| 587 | 3300046460 | Ga0495638_0413256 | Ga0495638_0413256_238_615 | 122 |
| 588 | 3300046461 | Ga0495641_0412686 | Ga0495641_0412686_175_546 | 122 |
| 589 | 3300046462 | Ga0495651_0086017 | Ga0495651_0086017_1740_2111 | 122 |
| 590 | 3300046462 | Ga0495651_0087100 | Ga0495651_0087100_1635_2012 | 122 |
| 591 | 3300046462 | Ga0495651_0113923 | Ga0495651_0113923_171_548 | 122 |
| 592 | 3300046463 | Ga0495653_0813181 | Ga0495653_0813181_128_499 | 122 |
| 593 | 3300046471 | Ga0495650_0000087 | Ga0495650_0000087_47912_48289 | 122 |
| 594 | 3300046471 | Ga0495650_0001198 | Ga0495650_0001198_1724_2095 | 122 |
| 595 | 3300046471 | Ga0495650_0047909 | Ga0495650_0047909_414_791 | 122 |
| 596 | 3300046471 | Ga0495650_0124812 | Ga0495650_0124812_42_413 | 122 |
| 597 | 3300046471 | Ga0495650_0143812 | Ga0495650_0143812_406_777 | 122 |
| 598 | 3300046474 | Ga0495605_0219130 | Ga0495605_0219130_432_803 | 122 |
| 599 | 3300046492 | Ga0495585_0000074 | Ga0495585_0000074_84504_84875 | 122 |
| 600 | 3300046492 | Ga0495585_0000286 | Ga0495585_0000286_6907_7284 | 122 |
| 601 | 3300046492 | Ga0495585_0000459 | Ga0495585_0000459_15922_16293 | 122 |
| 602 | 3300046492 | Ga0495585_0000667 | Ga0495585_0000667_9561_9941 | 122 |
| 603 | 3300046500 | Ga0495596_0262790 | Ga0495596_0262790_143_514 | 122 |
| 604 | 3300046506 | Ga0495583_0014434 | Ga0495583_0014434_1038_1415 | 122 |
| 605 | 3300046506 | Ga0495583_0080789 | Ga0495583_0080789_795_1166 | 122 |
| 606 | 3300046506 | Ga0495583_0287842 | Ga0495583_0287842_35_406 | 122 |
| 607 | 3300046506 | Ga0495583_0442151 | Ga0495583_0442151_53_424 | 122 |
| 608 | 3300046507 | Ga0495606_0000052 | Ga0495606_0000052_148086_148463 | 122 |
| 609 | 3300046507 | Ga0495606_0000425 | Ga0495606_0000425_22562_22933 | 122 |
| 610 | 3300046507 | Ga0495606_0004916 | Ga0495606_0004916_7154_7525 | 122 |
| 611 | 3300046507 | Ga0495606_0007070 | Ga0495606_0007070_6212_6583 | 122 |
| 612 | 3300046507 | Ga0495606_0012011 | Ga0495606_0012011_4951_5322 | 122 |
| 613 | 3300046507 | Ga0495606_0017553 | Ga0495606_0017553_161_535 | 122 |
| 614 | 3300046507 | Ga0495606_0034004 | Ga0495606_0034004_3042_3419 | 122 |
| 615 | 3300046507 | Ga0495606_0054447 | Ga0495606_0054447_1449_1820 | 122 |
| 616 | 3300046507 | Ga0495606_0079573 | Ga0495606_0079573_1410_1781 | 122 |
| 617 | 3300046507 | Ga0495606_0173258 | Ga0495606_0173258_208_579 | 122 |
| 618 | 3300046507 | Ga0495606_0241869 | Ga0495606_0241869_499_870 | 122 |
| 619 | 3300046507 | Ga0495606_0652391 | Ga0495606_0652391_36_416 | 122 |
| 620 | 3300046511 | Ga0495608_0444649 | Ga0495608_0444649_145_516 | 122 |
| 621 | 3300046512 | Ga0495610_0000076 | Ga0495610_0000076_31880_32257 | 122 |
| 622 | 3300046512 | Ga0495610_0003649 | Ga0495610_0003649_3032_3409 | 122 |
| 623 | 3300046512 | Ga0495610_0003743 | Ga0495610_0003743_6074_6445 | 122 |
| 624 | 3300046512 | Ga0495610_0004136 | Ga0495610_0004136_7193_7570 | 122 |
| 625 | 3300046512 | Ga0495610_0075747 | Ga0495610_0075747_410_787 | 122 |
| 626 | 3300046513 | Ga0495616_0001116 | Ga0495616_0001116_15432_15803 | 122 |
| 627 | 3300046513 | Ga0495616_0001648 | Ga0495616_0001648_4567_4938 | 122 |
| 628 | 3300046513 | Ga0495616_0068364 | Ga0495616_0068364_1222_1599 | 122 |
| 629 | 3300046513 | Ga0495616_0294034 | Ga0495616_0294034_14_385 | 122 |
| 630 | 3300046514 | Ga0495618_0258111 | Ga0495618_0258111_564_941 | 122 |
| 631 | 3300046514 | Ga0495618_0516939 | Ga0495618_0516939_337_708 | 122 |
| 632 | 3300046517 | Ga0495630_1391422 | Ga0495630_1391422_112_483 | 122 |
| 633 | 3300046518 | Ga0495631_0021927 | Ga0495631_0021927_754_1125 | 122 |
| 634 | 3300046518 | Ga0495631_0112999 | Ga0495631_0112999_234_605 | 122 |
| 635 | 3300046518 | Ga0495631_0413309 | Ga0495631_0413309_17_394 | 122 |
| 636 | 3300046520 | Ga0495637_0030977 | Ga0495637_0030977_814_1191 | 122 |
| 637 | 3300046520 | Ga0495637_0125162 | Ga0495637_0125162_86_457 | 122 |
| 638 | 3300046523 | Ga0495644_0007953 | Ga0495644_0007953_3028_3399 | 122 |
| 639 | 3300046524 | Ga0495648_0001585 | Ga0495648_0001585_20957_21328 | 122 |
| 640 | 3300046524 | Ga0495648_0013724 | Ga0495648_0013724_4095_4475 | 122 |
| 641 | 3300046525 | Ga0495663_0164223 | Ga0495663_0164223_220_591 | 122 |
| 642 | 3300046529 | Ga0495652_0054934 | Ga0495652_0054934_12_392 | 122 |
| 643 | 3300046529 | Ga0495652_0095063 | Ga0495652_0095063_1339_1710 | 122 |
| 644 | 3300046529 | Ga0495652_0296456 | Ga0495652_0296456_237_614 | 122 |
| 645 | 3300046529 | Ga0495652_0643047 | Ga0495652_0643047_178_555 | 122 |
| 646 | 3300046530 | Ga0495654_0214572 | Ga0495654_0214572_34_405 | 122 |
| 647 | 3300046538 | Ga0495609_0019281 | Ga0495609_0019281_1573_1953 | 122 |
| 648 | 3300046538 | Ga0495609_0055155 | Ga0495609_0055155_607_978 | 122 |
| 649 | 3300046538 | Ga0495609_0121490 | Ga0495609_0121490_138_515 | 122 |
| 650 | 3300046538 | Ga0495609_0219883 | Ga0495609_0219883_260_631 | 122 |
| 651 | 3300046557 | Ga0495622_0177406 | Ga0495622_0177406_301_681 | 122 |
| 652 | 3300046557 | Ga0495622_0218419 | Ga0495622_0218419_137_508 | 122 |
| 653 | 3300046557 | Ga0495622_0391432 | Ga0495622_0391432_105_476 | 122 |
| 654 | 3300046558 | Ga0495633_0000004 | Ga0495633_0000004_241680_242051 | 122 |
| 655 | 3300046558 | Ga0495633_0000035 | Ga0495633_0000035_156155_156535 | 122 |
| 656 | 3300046558 | Ga0495633_0001552 | Ga0495633_0001552_12283_12654 | 122 |
| 657 | 3300046558 | Ga0495633_0009741 | Ga0495633_0009741_3783_4160 | 122 |
| 658 | 3300046558 | Ga0495633_0158588 | Ga0495633_0158588_505_882 | 122 |
| 659 | 3300046616 | Ga0495668_0000032 | Ga0495668_0000032_38288_38668 | 122 |
| 660 | 3300046616 | Ga0495668_0000121 | Ga0495668_0000121_81135_81506 | 122 |
| 661 | 3300046616 | Ga0495668_0137256 | Ga0495668_0137256_66_437 | 122 |
| 662 | 3300046642 | Ga0495634_0388302 | Ga0495634_0388302_277_648 | 122 |
| 663 | 3300046660 | Ga0495625_0000008 | Ga0495625_0000008_512279_512656 | 122 |
| 664 | 3300046660 | Ga0495625_0000067 | Ga0495625_0000067_120293_120664 | 122 |
| 665 | 3300046660 | Ga0495625_0000981 | Ga0495625_0000981_26381_26761 | 122 |
| 666 | 3300046660 | Ga0495625_0001612 | Ga0495625_0001612_3587_3958 | 122 |
| 667 | 3300046660 | Ga0495625_0007910 | Ga0495625_0007910_1350_1721 | 122 |
| 668 | 3300046660 | Ga0495625_0010659 | Ga0495625_0010659_2625_2996 | 122 |
| 669 | 3300046660 | Ga0495625_0043150 | Ga0495625_0043150_2009_2380 | 122 |
| 670 | 3300046660 | Ga0495625_0068042 | Ga0495625_0068042_1953_2324 | 122 |
| 671 | 3300046660 | Ga0495625_0154408 | Ga0495625_0154408_1124_1501 | 122 |
| 672 | 3300046660 | Ga0495625_0265137 | Ga0495625_0265137_485_856 | 122 |
| 673 | 3300046660 | Ga0495625_0271939 | Ga0495625_0271939_192_563 | 122 |
| 674 | 3300046660 | Ga0495625_0470086 | Ga0495625_0470086_218_592 | 122 |
| 675 | 3300046660 | Ga0495625_0683373 | Ga0495625_0683373_176_550 | 122 |
| 676 | 3300046665 | Ga0495661_0002168 | Ga0495661_0002168_771_1148 | 122 |
| 677 | 3300046665 | Ga0495661_0002273 | Ga0495661_0002273_9574_9945 | 122 |
| 678 | 3300046665 | Ga0495661_0036794 | Ga0495661_0036794_633_1010 | 122 |
| 679 | 3300046674 | Ga0495588_0671152 | Ga0495588_0671152_101_472 | 122 |
| 680 | 3300046684 | Ga0495669_0664701 | Ga0495669_0664701_108_479 | 122 |
| 681 | 3300046691 | Ga0495670_0181618 | Ga0495670_0181618_206_577 | 122 |
| 682 | 3300046691 | Ga0495670_0386267 | Ga0495670_0386267_185_565 | 122 |
| 683 | 3300046691 | Ga0495670_0403051 | Ga0495670_0403051_175_546 | 122 |
| 684 | 3300046692 | Ga0495671_0314576 | Ga0495671_0314576_36_413 | 122 |
| 685 | 3300046694 | Ga0495649_0000018 | Ga0495649_0000018_23510_23887 | 122 |
| 686 | 3300046694 | Ga0495649_0000135 | Ga0495649_0000135_50780_51151 | 122 |
| 687 | 3300046694 | Ga0495649_0196926 | Ga0495649_0196926_419_790 | 122 |
| 688 | 3300046794 | Ga0495589_0134693 | Ga0495589_0134693_207_584 | 122 |
| 689 | 3300046809 | Ga0495600_0607541 | Ga0495600_0607541_262_633 | 122 |
| 690 | 3300046810 | Ga0495660_0003458 | Ga0495660_0003458_6545_6916 | 122 |
| 691 | 3300046810 | Ga0495660_0080602 | Ga0495660_0080602_581_952 | 122 |
| 692 | 3300046810 | Ga0495660_0208623 | Ga0495660_0208623_282_662 | 122 |
| 693 | 3300047321 | Ga0495676_0630359 | Ga0495676_0630359_219_590 | 122 |
| 694 | 3300047323 | Ga0495683_0145406 | Ga0495683_0145406_44_415 | 122 |
| 695 | 3300047323 | Ga0495683_0222892 | Ga0495683_0222892_167_538 | 122 |
| 696 | 3300047443 | Ga0495687_001763 | Ga0495687_001763_16405_16782 | 122 |
| 697 | 3300047443 | Ga0495687_003533 | Ga0495687_003533_9720_10091 | 122 |
| 698 | 3300047443 | Ga0495687_066582 | Ga0495687_066582_825_1196 | 122 |
| 699 | 3300047469 | Ga0495673_0032422 | Ga0495673_0032422_1971_2342 | 122 |
| 700 | 3300047469 | Ga0495673_0067119 | Ga0495673_0067119_1105_1482 | 122 |
| 701 | 3300047470 | Ga0495681_0292594 | Ga0495681_0292594_150_521 | 122 |
| 702 | 3300047472 | Ga0495686_0000917 | Ga0495686_0000917_28898_29269 | 122 |
| 703 | 3300047472 | Ga0495686_0001013 | Ga0495686_0001013_23832_24203 | 122 |
| 704 | 3300047472 | Ga0495686_0075162 | Ga0495686_0075162_248_619 | 122 |
| 705 | 3300047472 | Ga0495686_0320790 | Ga0495686_0320790_444_821 | 122 |
| 706 | 3300047472 | Ga0495686_0343957 | Ga0495686_0343957_126_497 | 122 |
| 707 | 3300047472 | Ga0495686_0409552 | Ga0495686_0409552_67_444 | 122 |
| 708 | 3300048089 | Ga0495614_0080811 | Ga0495614_0080811_995_1375 | 122 |
| 709 | 3300048089 | Ga0495614_0094542 | Ga0495614_0094542_409_780 | 122 |
| 710 | 3300048918 | Ga0496115_0017027 | Ga0496115_0017027_4762_5139 | 122 |
| 711 | 3300048925 | Ga0496122_0004298 | Ga0496122_0004298_1036_1413 | 122 |
| 712 | 3300048926 | Ga0496123_0005429 | Ga0496123_0005429_9378_9755 | 122 |
| 713 | 3300048929 | Ga0496126_0491415 | Ga0496126_0491415_596_967 | 122 |
| 714 | 3300049459 | Ga0495678_014483 | Ga0495678_014483_1261_1632 | 122 |
| 715 | 3300049460 | Ga0495682_0025629 | Ga0495682_0025629_1450_1821 | 122 |
| 716 | 3300049661 | Ga0501217_067965 | Ga0501217_067965_536_910 | 122 |
| 717 | 3300049663 | Ga0501223_000212 | Ga0501223_000212_2301_2672 | 122 |
| 718 | 3300049679 | Ga0501249_020121 | Ga0501249_020121_354_728 | 122 |
| 719 | 3300049688 | Ga0501259_093574 | Ga0501259_093574_280_651 | 122 |
| 720 | 3300049705 | Ga0501225_0017101 | Ga0501225_0017101_563_937 | 122 |
| 721 | 3300049758 | Ga0501241_039094 | Ga0501241_039094_214_591 | 122 |
| 722 | 3300049776 | Ga0501280_040265 | Ga0501280_040265_31_408 | 122 |
| 723 | 3300049822 | Ga0501035_0932891 | Ga0501035_0932891_71_448 | 122 |
| 724 | 3300050493 | nmdc:mga0k408_102938_c1 | nmdc:mga0k408_102938_c1_1137_1511 | 122 |
| 725 | 3300050493 | nmdc:mga0k408_194544_c1 | nmdc:mga0k408_194544_c1_71_448 | 122 |
| 726 | 3300050493 | nmdc:mga0k408_3098_c2 | nmdc:mga0k408_3098_c2_5222_5593 | 122 |
| 727 | 3300050493 | nmdc:mga0k408_623754_c1 | nmdc:mga0k408_623754_c1_225_596 | 122 |
| 728 | 3300050493 | nmdc:mga0k408_65_c1 | nmdc:mga0k408_65_c1_20142_20513 | 122 |
| 729 | 3300050493 | nmdc:mga0k408_715_c2 | nmdc:mga0k408_715_c2_8554_8925 | 122 |
| 730 | 3300050493 | nmdc:mga0k408_979_c1 | nmdc:mga0k408_979_c1_415_795 | 122 |
| 731 | 3300050493 | nmdc:mga0k408_99634_c1 | nmdc:mga0k408_99634_c1_721_1098 | 122 |
| 732 | 3300050496 | nmdc:mga07m45_460920_c1 | nmdc:mga07m45_460920_c1_138_509 | 122 |
| 733 | 3300050516 | nmdc:mga0sz30_557791_c1 | nmdc:mga0sz30_557791_c1_35_406 | 122 |
| 734 | 3300053080 | Ga0500635_0002950 | Ga0500635_0002950_2872_3243 | 122 |
| 735 | 3300053093 | Ga0500651_0000350 | Ga0500651_0000350_10271_10648 | 122 |
| 736 | 3300053094 | Ga0500566_0221536 | Ga0500566_0221536_262_639 | 122 |
| 737 | 3300053098 | Ga0500650_0224623 | Ga0500650_0224623_291_662 | 122 |
| 738 | 3300053098 | Ga0500650_0251840 | Ga0500650_0251840_234_605 | 122 |
| 739 | 3300053118 | Ga0500594_0038912 | Ga0500594_0038912_627_998 | 122 |
| 740 | 3300053122 | Ga0500608_000297 | Ga0500608_000297_17711_18082 | 122 |
| 741 | 3300053122 | Ga0500608_060695 | Ga0500608_060695_76_447 | 122 |
| 742 | 3300053123 | Ga0500614_007956 | Ga0500614_007956_1407_1778 | 122 |
| 743 | 3300053123 | Ga0500614_061382 | Ga0500614_061382_407_787 | 122 |
| 744 | 3300053125 | Ga0500618_000033 | Ga0500618_000033_29335_29706 | 122 |
| 745 | 3300053125 | Ga0500618_000037 | Ga0500618_000037_39467_39847 | 122 |
| 746 | 3300053125 | Ga0500618_016551 | Ga0500618_016551_1228_1605 | 122 |
| 747 | 3300053138 | Ga0500564_112304 | Ga0500564_112304_709_1086 | 122 |
| 748 | 3300053139 | Ga0500568_0038399 | Ga0500568_0038399_487_864 | 122 |
| 749 | 3300053153 | Ga0500616_0034972 | Ga0500616_0034972_1637_2014 | 122 |
| 750 | 3300053154 | Ga0500619_170958 | Ga0500619_170958_108_485 | 122 |
| 751 | 3300053156 | Ga0500622_0000175 | Ga0500622_0000175_65948_66319 | 122 |
| 752 | 3300053156 | Ga0500622_0240133 | Ga0500622_0240133_256_633 | 122 |
| 753 | 3300053157 | Ga0500624_000481 | Ga0500624_000481_686_1057 | 122 |
| 754 | 3300053157 | Ga0500624_003615 | Ga0500624_003615_1322_1699 | 122 |
| 755 | 3300053160 | Ga0500633_0310796 | Ga0500633_0310796_130_510 | 122 |
| 756 | 3300053161 | Ga0500634_0019483 | Ga0500634_0019483_1760_2131 | 122 |
| 757 | 3300053730 | Ga0500645_178024 | Ga0500645_178024_91_462 | 122 |
| 758 | iso_pu_bacteria | 2585427687 | 2586211122 | 122 |
| 759 | iso_pu_bacteria | 2818991437 | 2819547473 | 122 |
| 760 | iso_pu_bacteria | 2945997725 | 2946003204 | 122 |
| 761 | iso_pu_bacteria | 2954016120 | 2954020061 | 122 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1r22-assembly1.cif.gz_B | crystal structure of the cyanobacterial metallothionein repressor smtb (c14s/c61s/c121s mutant) in the zn2alpha5-form | 0.8721 | 7 | 68 |
| 7ne9-assembly1.cif.gz_DDD | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.8718 | 4 | 68 |
| 7ne9-assembly1.cif.gz_CCC | a single sensor controls large variations in zinc quotas in a marine cyanobacterium | 0.8652 | 4 | 68 |
| 2fe3-assembly1.cif.gz_B | the crystal structure of bacillus subtilis perr-zn reveals a novel zn(cys)4 structural redox switch | 0.8568 | 5 | 70 |
| 1p6r-assembly1.cif.gz_A | solution structure of the dna binding domain of the repressor blai. | 0.8348 | 2 | 75 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4kmfA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9316 | 10 | 69 | 1.10.10.10 |
| af_Q57824_147_206_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9011 | 6 | 67 | 1.10.10.10 |
| af_Q58184_329_408_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8985 | 5 | 69 | 1.10.10.10 |
| 4lb5B00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8939 | 9 | 70 | 1.10.10.10 |
| 1saxB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8778 | 7 | 69 | 1.10.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1F3P524-F1-model_v4 | Transcriptional regulator | 0.9798 | 4 | 82 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-H1DIA1-F1-model_v4 | Penicillinase repressor | 0.9757 | 4 | 76 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-A0A7J7AZU7-F1-model_v4 | deleted | 0.9754 | 4 | 80 |
|
| AF-A0A7C6AW35-F1-model_v4 | BlaI/MecI/CopY family transcriptional regulator | 0.9634 | 4 | 91 |
GO:0003677
GO:0005737 GO:0045892 |
| AF-A0A359G5H8-F1-model_v4 | Transcriptional regulator | 0.9628 | 2 | 91 |
GO:0003677
GO:0005737 GO:0045892 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar