F479578

General Info

Members Datasets Scaffolds Average Seq Length
761 281 748 124

Family's Representative Sequence

Representative Sequence 3300031548|Ga0307408_100021295|Ga0307408_1000212952
Length 128
Sequence MTDKQIKELTKAEDQVMRILWKLKEAIVKDIIEEMPEPRPAYNTVSTVIRVLETKGFIDHKTYGNSHVYFPIVEEKDYKAFAFDKVLSNYFNNSYQHLVSFLVDEKKIDDAELEELNQLVEKLKNSKK

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2818991437 Pedobacter terrae 518 Isolate Unclassified
5 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
6 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
7 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
8 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
9 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
10 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
11 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
12 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
13 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
14 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
15 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
16 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
17 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
18 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
19 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
20 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
21 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
22 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
23 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
24 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
25 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
26 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
27 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
31 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
32 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
33 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
34 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
35 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
36 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
37 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
38 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
39 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
40 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
41 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
42 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
43 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
68 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
69 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
82 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
83 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
96 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
97 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
101 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
103 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
104 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
106 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
107 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
108 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
109 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
110 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
111 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
154 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
155 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
156 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
157 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
158 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
159 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
160 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
161 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
162 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
163 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
164 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
165 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
166 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
167 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
168 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
169 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
170 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
171 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
172 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
173 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
174 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
175 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
176 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
179 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
180 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
186 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
187 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
188 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
189 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
190 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
191 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
192 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
193 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
194 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
195 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
196 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
197 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
198 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
199 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
200 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
201 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
202 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
203 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
204 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
205 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
206 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
209 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
210 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
213 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
214 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
215 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
216 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
217 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
218 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
219 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
220 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
221 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
222 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
225 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
226 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
227 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
228 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
229 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
230 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
231 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
232 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
233 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
234 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
235 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
238 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
239 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
240 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
241 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
242 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
243 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
244 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
245 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
246 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
247 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
248 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
249 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
250 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
251 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
252 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
253 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
254 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
255 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
256 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
257 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
258 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
259 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
260 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
261 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
262 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
263 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
264 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
265 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
266 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
267 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
268 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
269 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
270 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
271 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
272 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
273 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
274 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
275 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
276 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
277 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
278 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
279 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
280 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
281 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.55
Metatranscriptomes 0.13
Isolates 1.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.86
Nodule 0
Rhizoplane 1.18
Rhizosphere 83.44
Stem 0
Stem Tuber 0
Unclassified 5.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1008316 3300001904 Bacteria 1726
2 JGI24736J21556_1011837 3300001904 Bacteria 1416
3 JGI24739J22299_10015871 3300001989 Bacteria 2732
4 JGI24737J22298_10001771 3300001990 Bacteria 7731
5 JGI24737J22298_10002233 3300001990 Bacteria 6906
6 JGI24735J21928_10000004 3300002067 Bacteria 381713
7 JGI24735J21928_10000033 3300002067 Bacteria 70674
8 JGI25162J39368_1000008 3300002737 Bacteria 397212
9 JGI25162J39368_1000017 3300002737 Bacteria 281385
10 JGI25162J39368_1001793 3300002737 Bacteria 10128
11 JGI25157J39369_1004659 3300002741 Bacteria 2423
12 JGI25164J39214_1001237 3300002772 Bacteria 6806
13 JGI25150J39212_1000003 3300002774 Bacteria 508651
14 JGI25151J46595_10000002 3300003187 Bacteria 731381
15 JGI25165J46597_1002573 3300003214 Bacteria 5571
16 JGI25165J46597_1036456 3300003214 Bacteria 633
17 JGI25165J46597_1050527 3300003214 Bacteria 533
18 JGI25153J46596_10000015 3300003215 Bacteria 289820
19 rootH1_10008126 3300003316 Bacteria 20133
20 rootH1_10063127 3300003316 Bacteria 8410
21 rootH1_10063127 3300003323 Bacteria 2558
22 rootH2_10003269 3300003320 Bacteria 51191
23 rootH2_10057796 3300003320 Bacteria 14763
24 rootH2_10103643 3300003320 Bacteria 6540
25 rootH2_10196503 3300003320 Bacteria 2327
26 rootH2_10269298 3300003320 Bacteria 1656
27 rootH2_10284133 3300003320 Bacteria 3346
28 rootL2_10035013 3300003322 Bacteria 6529
29 rootL2_10132836 3300003322 Bacteria 7653
30 rootH1_10005934 3300003323 Bacteria 5270
31 rootH1_10010138 3300003323 Bacteria 25280
32 rootH1_10062209 3300003323 Bacteria 4973
33 rootH1_10064415 3300003323 Bacteria 4744
34 rootH1_10110019 3300003323 Bacteria 4748
35 rootH1_10192260 3300003323 Bacteria 2031
36 Ga0055529_1007859 3300003763 Bacteria 1434
37 Ga0055536_1048487 3300003781 Bacteria 950
38 Ga0065165_1000442 3300005262 Bacteria 65218
39 Ga0065714_10002307 3300005288 Bacteria 26043
40 Ga0065714_10011237 3300005288 Bacteria 3077
41 Ga0065714_10014328 3300005288 Bacteria 2987
42 Ga0065714_10065739 3300005288 Bacteria 8667
43 Ga0065714_10126805 3300005288 Bacteria 1288
44 Ga0065714_10197124 3300005288 Bacteria 908
45 Ga0065714_10453425 3300005288 Bacteria 552
46 Ga0065704_10070323 3300005289 Bacteria 32863
47 Ga0065704_10096827 3300005289 Bacteria 2422
48 Ga0065704_10179121 3300005289 Bacteria 1247
49 Ga0065704_10396737 3300005289 Bacteria 756
50 Ga0065704_10599986 3300005289 Bacteria 607
51 Ga0070658_10000008 3300005327 Bacteria 319912
52 Ga0070658_10000018 3300005327 Bacteria 200558
53 Ga0070658_10082680 3300005327 Bacteria 2639
54 Ga0070658_10324086 3300005327 Bacteria 1316
55 Ga0070658_10353375 3300005327 Bacteria 1258
56 Ga0070676_10000465 3300005328 Bacteria 19425
57 Ga0068869_100117037 3300005334 Bacteria 2034
58 Ga0070680_100007970 3300005336 Bacteria 8085
59 Ga0068868_100143907 3300005338 Bacteria 1959
60 Ga0068868_100378158 3300005338 Bacteria 1218
61 Ga0070660_100008700 3300005339 Bacteria 7107
62 Ga0070660_100024084 3300005339 Bacteria 4516
63 Ga0070660_100043103 3300005339 Bacteria 3447
64 Ga0070660_100216474 3300005339 Bacteria 1556
65 Ga0070691_10205642 3300005341 Bacteria 1036
66 Ga0070661_101109689 3300005344 Bacteria 659
67 Ga0070675_100823046 3300005354 Unclassified 849
68 Ga0070671_100003365 3300005355 Bacteria 12470
69 Ga0070671_100859824 3300005355 Bacteria 791
70 Ga0070674_100054220 3300005356 Bacteria 2772
71 Ga0070674_100365545 3300005356 Bacteria 1169
72 Ga0070673_100002665 3300005364 Bacteria 10922
73 Ga0070673_101008862 3300005364 Bacteria 775
74 Ga0070659_100000899 3300005366 Bacteria 21771
75 Ga0070659_100018025 3300005366 Bacteria 5324
76 Ga0070713_100789340 3300005436 Bacteria 910
77 Ga0070711_101882967 3300005439 Bacteria 525
78 Ga0070663_100247673 3300005455 Bacteria 1409
79 Ga0070678_100634535 3300005456 Unclassified 957
80 Ga0070678_101080335 3300005456 Bacteria 740
81 Ga0070662_100000062 3300005457 Bacteria 57251
82 Ga0070662_100343429 3300005457 Unclassified 1222
83 Ga0070681_10112980 3300005458 Bacteria 2656
84 Ga0068867_100000923 3300005459 Bacteria 19973
85 Ga0070679_100089205 3300005530 Bacteria 3071
86 Ga0070679_100263095 3300005530 Bacteria 1680
87 Ga0070684_100017533 3300005535 Bacteria 5880
88 Ga0068853_100010560 3300005539 Bacteria 7467
89 Ga0068853_100026830 3300005539 Bacteria 4839
90 Ga0068853_100069159 3300005539 Bacteria 3071
91 Ga0068853_100083870 3300005539 Bacteria 2792
92 Ga0068853_100114242 3300005539 Bacteria 2401
93 Ga0068853_100604955 3300005539 Bacteria 1041
94 Ga0068853_100870262 3300005539 Bacteria 865
95 Ga0070672_100546171 3300005543 Unclassified 1006
96 Ga0070665_100000118 3300005548 Bacteria 149830
97 Ga0070665_100332761 3300005548 Bacteria 1523
98 Ga0068855_100000268 3300005563 Bacteria 64693
99 Ga0068855_100000967 3300005563 Bacteria 35748
100 Ga0068855_100001431 3300005563 Bacteria 29691
101 Ga0068855_100015178 3300005563 Bacteria 9276
102 Ga0068855_100027421 3300005563 Bacteria 6814
103 Ga0068855_100029172 3300005563 Bacteria 6597
104 Ga0068855_100048451 3300005563 Bacteria 5014
105 Ga0068855_100113905 3300005563 Bacteria 3101
106 Ga0068855_100123199 3300005563 Bacteria 2966
107 Ga0068855_100149792 3300005563 Bacteria 2653
108 Ga0068855_100162582 3300005563 Bacteria 2533
109 Ga0068855_100237010 3300005563 Bacteria 2040
110 Ga0068855_100286932 3300005563 Bacteria 1826
111 Ga0068855_100350233 3300005563 Bacteria 1627
112 Ga0068855_100453218 3300005563 Bacteria 1399
113 Ga0068855_100493919 3300005563 Bacteria 1331
114 Ga0068855_101053690 3300005563 Unclassified 852
115 Ga0068855_101429179 3300005563 Unclassified 712
116 Ga0068857_100131311 3300005577 Bacteria 2259
117 Ga0068857_100248276 3300005577 Bacteria 1631
118 Ga0068857_100257090 3300005577 Bacteria 1602
119 Ga0068854_100057394 3300005578 Bacteria 2808
120 Ga0068856_100017859 3300005614 Bacteria 6880
121 Ga0068856_100057792 3300005614 Bacteria 3830
122 Ga0068856_100078687 3300005614 Bacteria 3269
123 Ga0068856_100101403 3300005614 Bacteria 2871
124 Ga0068856_100277659 3300005614 Bacteria 1692
125 Ga0068856_100295764 3300005614 Bacteria 1636
126 Ga0068856_100461380 3300005614 Bacteria 1291
127 Ga0068856_100624835 3300005614 Bacteria 1098
128 Ga0068856_100705530 3300005614 Bacteria 1029
129 Ga0068856_101220242 3300005614 Unclassified 768
130 Ga0068856_101597234 3300005614 Bacteria 665
131 Ga0068852_100000862 3300005616 Bacteria 20158
132 Ga0068852_100114709 3300005616 Bacteria 2455
133 Ga0068852_100367581 3300005616 Bacteria 1408
134 Ga0068866_10056329 3300005718 Bacteria 2021
135 Ga0068866_10751871 3300005718 Unclassified 673
136 Ga0068870_10173517 3300005840 Bacteria 1288
137 Ga0068863_100863440 3300005841 Bacteria 904
138 Ga0068858_100120307 3300005842 Bacteria 2455
139 Ga0068858_100205347 3300005842 Unclassified 1864
140 Ga0068858_102545755 3300005842 Bacteria 505
141 Ga0075366_10001407 3300006195 Bacteria 12029
142 Ga0075366_10001542 3300006195 Bacteria 11528
143 Ga0075366_10005056 3300006195 Bacteria 7128
144 Ga0075366_10017247 3300006195 Bacteria 4154
145 Ga0075366_10098559 3300006195 Bacteria 1753
146 Ga0075366_10171616 3300006195 Bacteria 1316
147 Ga0097621_100000015 3300006237 Bacteria 92182
148 Ga0097621_101394576 3300006237 Bacteria 663
149 Ga0075370_10495317 3300006353 Bacteria 737
150 Ga0068871_100000051 3300006358 Bacteria 64844
151 Ga0075430_100484944 3300006846 Bacteria 1020
152 Ga0068865_100000120 3300006881 Bacteria 39809
153 Ga0105244_10041432 3300009036 Bacteria 2386
154 Ga0105244_10163055 3300009036 Bacteria 1064
155 Ga0105240_10000185 3300009093 Bacteria 126364
156 Ga0105240_10002706 3300009093 Bacteria 28164
157 Ga0105240_10013632 3300009093 Bacteria 11146
158 Ga0105240_10039125 3300009093 Bacteria 6076
159 Ga0105240_10049341 3300009093 Bacteria 5313
160 Ga0105240_10079337 3300009093 Bacteria 4039
161 Ga0105240_10143852 3300009093 Bacteria 2848
162 Ga0105240_10149122 3300009093 Bacteria 2787
163 Ga0105240_10184556 3300009093 Unclassified 2458
164 Ga0105240_10240981 3300009093 Unclassified 2096
165 Ga0105240_10298268 3300009093 Bacteria 1844
166 Ga0105240_10312511 3300009093 Bacteria 1794
167 Ga0105240_10312672 3300009093 Bacteria 1793
168 Ga0105240_10337375 3300009093 Bacteria 1713
169 Ga0105240_10362581 3300009093 Bacteria 1641
170 Ga0105240_10477310 3300009093 Bacteria 1391
171 Ga0105240_10713281 3300009093 Bacteria 1094
172 Ga0105240_11154335 3300009093 Bacteria 822
173 Ga0105240_11233548 3300009093 Bacteria 791
174 Ga0105240_12343157 3300009093 Bacteria 553
175 Ga0114129_11076180 3300009147 Bacteria 1008
176 Ga0105243_10034277 3300009148 Bacteria 3929
177 Ga0105241_10001267 3300009174 Bacteria 19273
178 Ga0105241_10003621 3300009174 Bacteria 11483
179 Ga0105241_10011403 3300009174 Bacteria 6515
180 Ga0105241_10030063 3300009174 Bacteria 4057
181 Ga0105241_10055766 3300009174 Bacteria 3028
182 Ga0105241_10069549 3300009174 Bacteria 2730
183 Ga0105241_10110233 3300009174 Bacteria 2202
184 Ga0105241_10178991 3300009174 Bacteria 1757
185 Ga0105241_10306878 3300009174 Bacteria 1364
186 Ga0105241_10427269 3300009174 Bacteria 1167
187 Ga0105241_10475229 3300009174 Unclassified 1110
188 Ga0105241_10613444 3300009174 Bacteria 984
189 Ga0105241_11418315 3300009174 Bacteria 665
190 Ga0105242_10172286 3300009176 Bacteria 1903
191 Ga0105242_10772372 3300009176 Bacteria 948
192 Ga0105242_11091223 3300009176 Bacteria 811
193 Ga0105237_10000758 3300009545 Bacteria 44281
194 Ga0105237_10000887 3300009545 Bacteria 40325
195 Ga0105237_10002011 3300009545 Bacteria 25894
196 Ga0105237_10007579 3300009545 Bacteria 11865
197 Ga0105237_10008366 3300009545 Bacteria 11216
198 Ga0105237_10016912 3300009545 Bacteria 7568
199 Ga0105237_10031079 3300009545 Bacteria 5417
200 Ga0105237_10159958 3300009545 Bacteria 2250
201 Ga0105237_10258257 3300009545 Unclassified 1745
202 Ga0105237_10417292 3300009545 Bacteria 1347
203 Ga0105237_10433497 3300009545 Bacteria 1320
204 Ga0105237_11340306 3300009545 Bacteria 722
205 Ga0105237_12048883 3300009545 Bacteria 581
206 Ga0105237_12560937 3300009545 Bacteria 521
207 Ga0105238_10015398 3300009551 Bacteria 7739
208 Ga0105238_10039973 3300009551 Bacteria 4754
209 Ga0105238_10278348 3300009551 Unclassified 1654
210 Ga0105238_10363107 3300009551 Bacteria 1438
211 Ga0105238_10621345 3300009551 Bacteria 1089
212 Ga0105238_10798214 3300009551 Bacteria 959
213 Ga0105249_10194085 3300009553 Bacteria 1983
214 Ga0105239_10000142 3300010375 Bacteria 101628
215 Ga0105239_10001435 3300010375 Bacteria 31777
216 Ga0105239_10001468 3300010375 Bacteria 31351
217 Ga0105239_10002256 3300010375 Bacteria 24634
218 Ga0105239_10002374 3300010375 Bacteria 24005
219 Ga0105239_10003905 3300010375 Bacteria 18072
220 Ga0105239_10004588 3300010375 Bacteria 16460
221 Ga0105239_10022631 3300010375 Bacteria 6929
222 Ga0105239_10029834 3300010375 Bacteria 5997
223 Ga0105239_10031340 3300010375 Bacteria 5849
224 Ga0105239_10075942 3300010375 Bacteria 3695
225 Ga0105239_10076804 3300010375 Bacteria 3674
226 Ga0105239_10105106 3300010375 Bacteria 3127
227 Ga0105239_10107988 3300010375 Bacteria 3083
228 Ga0105239_10599474 3300010375 Bacteria 1256
229 Ga0105239_11299316 3300010375 Bacteria 839
230 Ga0105239_11817595 3300010375 Bacteria 706
231 Ga0105239_13209637 3300010375 Bacteria 532
232 Ga0105246_10047095 3300011119 Bacteria 2943
233 Ga0105246_10107474 3300011119 Bacteria 2043
234 Ga0157373_10000254 3300013100 Bacteria 43477
235 Ga0157373_10000262 3300013100 Bacteria 42799
236 Ga0157373_10022406 3300013100 Bacteria 4583
237 Ga0157373_10029292 3300013100 Bacteria 3965
238 Ga0157373_10247498 3300013100 Bacteria 1260
239 Ga0157371_10000117 3300013102 Bacteria 121069
240 Ga0157371_10000912 3300013102 Bacteria 33281
241 Ga0157371_10001520 3300013102 Bacteria 23949
242 Ga0157371_10002174 3300013102 Bacteria 19066
243 Ga0157371_10004362 3300013102 Bacteria 12386
244 Ga0157371_10013752 3300013102 Bacteria 6135
245 Ga0157371_10022859 3300013102 Bacteria 4574
246 Ga0157371_10158350 3300013102 Bacteria 1617
247 Ga0157371_10168306 3300013102 Bacteria 1565
248 Ga0157371_10226002 3300013102 Bacteria 1344
249 Ga0157370_10003772 3300013104 Bacteria 17695
250 Ga0157370_10009721 3300013104 Bacteria 10224
251 Ga0157370_10010234 3300013104 Bacteria 9902
252 Ga0157370_10019570 3300013104 Bacteria 6784
253 Ga0157370_10025999 3300013104 Bacteria 5784
254 Ga0157370_10071814 3300013104 Bacteria 3266
255 Ga0157370_10075503 3300013104 Bacteria 3177
256 Ga0157370_10143214 3300013104 Unclassified 2226
257 Ga0157370_10188263 3300013104 Bacteria 1916
258 Ga0157370_10195676 3300013104 Bacteria 1876
259 Ga0157370_10269129 3300013104 Bacteria 1574
260 Ga0157370_10466876 3300013104 Bacteria 1160
261 Ga0157370_10494717 3300013104 Bacteria 1123
262 Ga0157370_10596957 3300013104 Bacteria 1011
263 Ga0157370_10790550 3300013104 Bacteria 864
264 Ga0157370_10957935 3300013104 Bacteria 776
265 Ga0157369_10000015 3300013105 Bacteria 262917
266 Ga0157369_10000047 3300013105 Bacteria 172682
267 Ga0157369_10000101 3300013105 Bacteria 118683
268 Ga0157369_10235298 3300013105 Bacteria 1914
269 Ga0157369_10237711 3300013105 Bacteria 1903
270 Ga0157369_10247576 3300013105 Bacteria 1861
271 Ga0157369_10303928 3300013105 Bacteria 1659
272 Ga0157369_10460852 3300013105 Bacteria 1316
273 Ga0157369_11438487 3300013105 Bacteria 702
274 Ga0157374_10000874 3300013296 Bacteria 26341
275 Ga0157374_10001137 3300013296 Bacteria 22784
276 Ga0157374_10012440 3300013296 Bacteria 7402
277 Ga0157374_10362962 3300013296 Bacteria 1441
278 Ga0157374_10410837 3300013296 Bacteria 1351
279 Ga0157374_10590113 3300013296 Bacteria 1120
280 Ga0157374_11524670 3300013296 Bacteria 692
281 Ga0157374_12068238 3300013296 Bacteria 596
282 Ga0157378_10010197 3300013297 Bacteria 8198
283 Ga0157378_10268463 3300013297 Bacteria 1640
284 Ga0157378_10269515 3300013297 Bacteria 1637
285 Ga0157378_10360437 3300013297 Bacteria 1423
286 Ga0157378_10427712 3300013297 Bacteria 1310
287 Ga0163162_10000012 3300013306 Bacteria 292674
288 Ga0163162_10000895 3300013306 Bacteria 27750
289 Ga0163162_10001113 3300013306 Bacteria 24963
290 Ga0163162_10004644 3300013306 Bacteria 13243
291 Ga0163162_10367947 3300013306 Bacteria 1571
292 Ga0163162_10404386 3300013306 Bacteria 1498
293 Ga0163162_10566128 3300013306 Bacteria 1264
294 Ga0163162_10827881 3300013306 Bacteria 1042
295 Ga0157372_10000041 3300013307 Bacteria 158494
296 Ga0157372_10000199 3300013307 Bacteria 66101
297 Ga0157372_10002721 3300013307 Bacteria 19136
298 Ga0157372_10014659 3300013307 Bacteria 8386
299 Ga0157372_10019379 3300013307 Bacteria 7331
300 Ga0157372_10035225 3300013307 Bacteria 5509
301 Ga0157372_10054327 3300013307 Bacteria 4467
302 Ga0157372_10065963 3300013307 Bacteria 4066
303 Ga0157372_10309694 3300013307 Bacteria 1838
304 Ga0157372_10453387 3300013307 Bacteria 1495
305 Ga0157372_11186032 3300013307 Bacteria 882
306 Ga0157375_10013601 3300013308 Bacteria 7250
307 Ga0157375_10059972 3300013308 Bacteria 3771
308 Ga0157375_10143486 3300013308 Bacteria 2517
309 Ga0157375_10898565 3300013308 Bacteria 1030
310 Ga0157375_11084893 3300013308 Bacteria 937
311 Ga0157375_11539125 3300013308 Bacteria 785
312 Ga0163163_10576626 3300014325 Bacteria 1188
313 Ga0182008_10000002 3300014497 Bacteria 480216
314 Ga0182008_10000294 3300014497 Bacteria 39204
315 Ga0182008_10124150 3300014497 Bacteria 1284
316 Ga0157377_10059831 3300014745 Bacteria 2173
317 Ga0157377_10400415 3300014745 Bacteria 935
318 Ga0157379_11385576 3300014968 Unclassified 681
319 Ga0182006_1000153 3300015261 Bacteria 73985
320 Ga0182006_1000287 3300015261 Bacteria 44409
321 Ga0182006_1000349 3300015261 Bacteria 38806
322 Ga0182006_1003312 3300015261 Bacteria 8314
323 Ga0182007_10000005 3300015262 Bacteria 442702
324 Ga0182007_10000010 3300015262 Bacteria 286070
325 Ga0183373_1002 3300015682 Bacteria 990153
326 Ga0183373_1005 3300015682 Bacteria 351562
327 Ga0163161_10000729 3300017792 Bacteria 25879
328 Ga0163161_10001299 3300017792 Bacteria 18626
329 Ga0163161_10002412 3300017792 Bacteria 13408
330 Ga0163161_10002768 3300017792 Bacteria 12458
331 Ga0163161_10006203 3300017792 Bacteria 8284
332 Ga0163161_10050655 3300017792 Bacteria 3006
333 Ga0163161_10055914 3300017792 Bacteria 2865
334 Ga0163161_10092081 3300017792 Bacteria 2244
335 Ga0163161_11264025 3300017792 Bacteria 640
336 Ga0206351_10496138 3300020077 Bacteria 504
337 Ga0213872_10008325 3300021361 Bacteria 5023
338 Ga0209563_109379 3300025230 Bacteria 1482
339 Ga0207427_100043 3300025231 Bacteria 249595
340 Ga0209437_100024 3300025233 Bacteria 592878
341 Ga0209437_100030 3300025233 Bacteria 532466
342 Ga0209437_100170 3300025233 Bacteria 142489
343 Ga0209258_114613 3300025242 Bacteria 910
344 Ga0207425_1000003 3300025245 Bacteria 1145342
345 Ga0209026_1000225 3300025250 Bacteria 77234
346 Ga0209026_1003564 3300025250 Bacteria 5030
347 Ga0209026_1024243 3300025250 Bacteria 920
348 Ga0209026_1044634 3300025250 Bacteria 638
349 Ga0209129_1000014 3300025258 Bacteria 509018
350 Ga0209129_1007976 3300025258 Bacteria 3026
351 Ga0209129_1011482 3300025258 Bacteria 2110
352 Ga0209233_1000266 3300025261 Bacteria 76176
353 Ga0209233_1048394 3300025261 Bacteria 878
354 Ga0209233_1048817 3300025261 Bacteria 872
355 Ga0209455_1001647 3300025272 Bacteria 9710
356 Ga0209455_1002288 3300025272 Bacteria 7539
357 Ga0209676_1000491 3300025292 Bacteria 63873
358 Ga0209025_1000007 3300025294 Bacteria 1145109
359 Ga0209758_1000012 3300025297 Bacteria 949866
360 Ga0209050_1081806 3300025298 Bacteria 685
361 Ga0207655_1034009 3300025728 Bacteria 2298
362 Ga0207642_10100749 3300025899 Bacteria 1449
363 Ga0207642_10624420 3300025899 Unclassified 673
364 Ga0207647_10000012 3300025904 Bacteria 152879
365 Ga0207647_10132579 3300025904 Bacteria 1464
366 Ga0207647_10188948 3300025904 Bacteria 1194
367 Ga0207645_10000058 3300025907 Bacteria 78487
368 Ga0207643_10176790 3300025908 Bacteria 1290
369 Ga0207705_10000026 3300025909 Bacteria 256051
370 Ga0207705_10000036 3300025909 Bacteria 200787
371 Ga0207705_10046191 3300025909 Bacteria 3129
372 Ga0207705_10073215 3300025909 Bacteria 2485
373 Ga0207705_10256711 3300025909 Bacteria 1334
374 Ga0207705_10268285 3300025909 Bacteria 1305
375 Ga0207654_10001331 3300025911 Bacteria 13159
376 Ga0207654_10058658 3300025911 Bacteria 2242
377 Ga0207654_10075706 3300025911 Bacteria 2012
378 Ga0207654_10098758 3300025911 Bacteria 1794
379 Ga0207654_10172222 3300025911 Bacteria 1406
380 Ga0207654_10259196 3300025911 Bacteria 1168
381 Ga0207654_10289615 3300025911 Unclassified 1110
382 Ga0207707_10088460 3300025912 Bacteria 2706
383 Ga0207695_10000117 3300025913 Bacteria 237982
384 Ga0207695_10019916 3300025913 Bacteria 7707
385 Ga0207695_10024211 3300025913 Bacteria 6836
386 Ga0207695_10060748 3300025913 Bacteria 3910
387 Ga0207695_10078136 3300025913 Bacteria 3358
388 Ga0207695_10119662 3300025913 Bacteria 2603
389 Ga0207695_10172634 3300025913 Bacteria 2086
390 Ga0207695_10196438 3300025913 Unclassified 1933
391 Ga0207695_10212441 3300025913 Bacteria 1845
392 Ga0207695_10216751 3300025913 Bacteria 1823
393 Ga0207695_10249836 3300025913 Bacteria 1673
394 Ga0207695_10264192 3300025913 Unclassified 1618
395 Ga0207695_10310842 3300025913 Bacteria 1466
396 Ga0207695_10646192 3300025913 Bacteria 939
397 Ga0207695_10955910 3300025913 Bacteria 736
398 Ga0207695_11224020 3300025913 Bacteria 631
399 Ga0207671_10000831 3300025914 Bacteria 39212
400 Ga0207671_10004503 3300025914 Bacteria 13263
401 Ga0207671_10004510 3300025914 Bacteria 13252
402 Ga0207671_10005083 3300025914 Bacteria 12283
403 Ga0207671_10019598 3300025914 Bacteria 5170
404 Ga0207671_10021131 3300025914 Bacteria 4943
405 Ga0207671_10074052 3300025914 Bacteria 2545
406 Ga0207671_10464045 3300025914 Bacteria 1009
407 Ga0207660_10011090 3300025917 Bacteria 5858
408 Ga0207657_10099781 3300025919 Unclassified 2411
409 Ga0207657_10107468 3300025919 Bacteria 2308
410 Ga0207657_10113819 3300025919 Bacteria 2232
411 Ga0207657_10210232 3300025919 Bacteria 1562
412 Ga0207652_10070876 3300025921 Bacteria 3027
413 Ga0207652_10244146 3300025921 Bacteria 1619
414 Ga0207694_10093844 3300025924 Bacteria 2371
415 Ga0207694_10328650 3300025924 Bacteria 1263
416 Ga0207694_11105958 3300025924 Unclassified 671
417 Ga0207659_10809111 3300025926 Bacteria 805
418 Ga0207700_10647102 3300025928 Bacteria 942
419 Ga0207644_10000740 3300025931 Bacteria 20704
420 Ga0207690_10000594 3300025932 Bacteria 23425
421 Ga0207706_10000430 3300025933 Bacteria 44993
422 Ga0207706_10483716 3300025933 Unclassified 1069
423 Ga0207686_10175820 3300025934 Bacteria 1514
424 Ga0207709_10029111 3300025935 Bacteria 3199
425 Ga0207669_10037635 3300025937 Bacteria 2778
426 Ga0207669_10234446 3300025937 Bacteria 1356
427 Ga0207704_10000047 3300025938 Bacteria 84386
428 Ga0207689_10766391 3300025942 Bacteria 814
429 Ga0207661_10137960 3300025944 Bacteria 2096
430 Ga0207667_10000009 3300025949 Bacteria 603135
431 Ga0207667_10001021 3300025949 Bacteria 35701
432 Ga0207667_10001079 3300025949 Bacteria 34634
433 Ga0207667_10001338 3300025949 Bacteria 30924
434 Ga0207667_10008164 3300025949 Bacteria 12463
435 Ga0207667_10022759 3300025949 Bacteria 6913
436 Ga0207667_10030764 3300025949 Bacteria 5801
437 Ga0207667_10039676 3300025949 Bacteria 5017
438 Ga0207667_10044166 3300025949 Bacteria 4724
439 Ga0207667_10128350 3300025949 Bacteria 2612
440 Ga0207667_10172942 3300025949 Bacteria 2220
441 Ga0207667_10236982 3300025949 Bacteria 1868
442 Ga0207667_10354204 3300025949 Bacteria 1497
443 Ga0207667_10380169 3300025949 Bacteria 1439
444 Ga0207667_10392029 3300025949 Bacteria 1414
445 Ga0207667_10412436 3300025949 Bacteria 1375
446 Ga0207667_10497800 3300025949 Bacteria 1236
447 Ga0207667_10646480 3300025949 Bacteria 1063
448 Ga0207651_10053476 3300025960 Bacteria 2760
449 Ga0207712_10417928 3300025961 Bacteria 1130
450 Ga0207640_10110434 3300025981 Bacteria 1948
451 Ga0207640_10380135 3300025981 Bacteria 1144
452 Ga0207677_10058813 3300026023 Bacteria 2649
453 Ga0207677_10154998 3300026023 Bacteria 1773
454 Ga0207639_10007193 3300026041 Bacteria 7582
455 Ga0207639_10024734 3300026041 Bacteria 4350
456 Ga0207639_10034261 3300026041 Bacteria 3752
457 Ga0207639_10136018 3300026041 Bacteria 2041
458 Ga0207639_10176942 3300026041 Bacteria 1812
459 Ga0207639_10338931 3300026041 Bacteria 1340
460 Ga0207639_10489443 3300026041 Bacteria 1122
461 Ga0207639_10720285 3300026041 Bacteria 926
462 Ga0207639_10873721 3300026041 Bacteria 840
463 Ga0207678_10064250 3300026067 Bacteria 3154
464 Ga0207702_10008741 3300026078 Bacteria 8540
465 Ga0207702_10009173 3300026078 Bacteria 8319
466 Ga0207702_10012151 3300026078 Bacteria 7163
467 Ga0207702_10013063 3300026078 Bacteria 6906
468 Ga0207702_10197209 3300026078 Bacteria 1864
469 Ga0207702_10248953 3300026078 Bacteria 1668
470 Ga0207702_10256685 3300026078 Bacteria 1644
471 Ga0207702_10455319 3300026078 Bacteria 1242
472 Ga0207702_10846722 3300026078 Bacteria 905
473 Ga0207702_11971821 3300026078 Bacteria 574
474 Ga0207641_10839906 3300026088 Bacteria 910
475 Ga0207648_10000458 3300026089 Bacteria 45301
476 Ga0207674_10080726 3300026116 Bacteria 3255
477 Ga0207674_10765722 3300026116 Bacteria 932
478 Ga0207683_10192567 3300026121 Bacteria 1851
479 Ga0207698_10003112 3300026142 Bacteria 9957
480 Ga0207698_10294071 3300026142 Bacteria 1509
481 Ga0207698_10611048 3300026142 Bacteria 1076
482 Ga0268266_10000121 3300028379 Bacteria 154995
483 Ga0307517_10002529 3300028786 Bacteria 29143
484 Ga0307515_10000077 3300028794 Bacteria 228162
485 Ga0307515_10001997 3300028794 Bacteria 45190
486 Ga0307515_10002629 3300028794 Bacteria 38616
487 Ga0307515_10088744 3300028794 Bacteria 3903
488 Ga0265338_10038003 3300028800 Bacteria 4570
489 Ga0265338_10174071 3300028800 Bacteria 1647
490 Ga0265338_10417512 3300028800 Bacteria 954
491 Ga0265324_10315157 3300029957 Bacteria 533
492 Ga0316176_1020422 3300030732 Bacteria 5807
493 Ga0316183_1003890 3300030742 Bacteria 25813
494 Ga0316181_1007924 3300030744 Bacteria 727
495 Ga0316181_1116089 3300030744 Bacteria 10343
496 Ga0316182_1021673 3300030745 Bacteria 1175
497 Ga0307513_10431555 3300031456 Bacteria 1046
498 Ga0307509_10056961 3300031507 Bacteria 4146
499 Ga0307509_10087936 3300031507 Bacteria 3191
500 Ga0307509_10216563 3300031507 Bacteria 1733
501 Ga0307509_10219882 3300031507 Bacteria 1714
502 Ga0307408_100021295 3300031548 Bacteria 4387
503 Ga0307408_100227339 3300031548 Bacteria 1526
504 Ga0307514_10118777 3300031649 Bacteria 1851
505 Ga0316576_10164522 3300031727 Unclassified 1674
506 Ga0316578_10471025 3300031728 Bacteria 741
507 Ga0307516_10227260 3300031730 Bacteria 1572
508 Ga0307405_10000009 3300031731 Bacteria 259388
509 Ga0307405_10001997 3300031731 Bacteria 8830
510 Ga0307405_10265964 3300031731 Bacteria 1283
511 Ga0307407_10000001 3300031903 Bacteria 570048
512 Ga0307407_10000005 3300031903 Bacteria 233125
513 Ga0307412_10000050 3300031911 Bacteria 151527
514 Ga0307412_10071034 3300031911 Bacteria 2375
515 Ga0307412_10273379 3300031911 Bacteria 1323
516 Ga0307412_10387013 3300031911 Bacteria 1134
517 Ga0307412_10399720 3300031911 Bacteria 1118
518 Ga0307412_10718646 3300031911 Bacteria 859
519 Ga0307412_10846621 3300031911 Bacteria 797
520 Ga0307409_100012342 3300031995 Bacteria 5441
521 Ga0307416_100000001 3300032002 Bacteria 515017
522 Ga0307416_100000008 3300032002 Bacteria 401343
523 Ga0307416_103098278 3300032002 Bacteria 556
524 Ga0307414_10000344 3300032004 Bacteria 26282
525 Ga0307414_10003900 3300032004 Bacteria 8034
526 Ga0307414_10010770 3300032004 Bacteria 5330
527 Ga0307414_10012376 3300032004 Bacteria 5042
528 Ga0307414_10039887 3300032004 Bacteria 3167
529 Ga0307414_10183066 3300032004 Bacteria 1687
530 Ga0307414_10990803 3300032004 Unclassified 773
531 Ga0307414_11225775 3300032004 Bacteria 695
532 Ga0307411_10141374 3300032005 Bacteria 1775
533 Ga0316580_10098515 3300032139 Bacteria 895
534 Ga0307507_10000313 3300033179 Bacteria 97672
535 Ga0307510_10006887 3300033180 Bacteria 13556
536 Ga0307510_10536911 3300033180 Bacteria 615
537 Ga0316574_0113941 3300035398 Bacteria 1734
538 Ga0316584_0091896 3300036712 Bacteria 2272
539 Ga0395899_0000017 3300037312 Bacteria 440179
540 Ga0395899_0000024 3300037312 Bacteria 357402
541 Ga0395899_0000269 3300037312 Bacteria 68033
542 Ga0395899_0075951 3300037312 Bacteria 2453
543 Ga0395900_0000140 3300037418 Bacteria 121917
544 Ga0395900_0000251 3300037418 Bacteria 83846
545 Ga0395900_0017469 3300037418 Bacteria 7322
546 Ga0395898_0002909 3300037466 Bacteria 19481
547 Ga0395898_1050121 3300037466 Unclassified 749
548 Ga0395905_0000495 3300037471 Bacteria 54122
549 Ga0395905_0001502 3300037471 Bacteria 27915
550 Ga0395905_0998756 3300037471 Bacteria 740
551 Ga0395901_0000145 3300038443 Bacteria 91739
552 Ga0395901_0001833 3300038443 Bacteria 21962
553 Ga0395901_0445701 3300038443 Unclassified 1325
554 Ga0436361_0109012 3300039447 Bacteria 6396
555 Ga0451791_0028699 3300041451 Bacteria 610
556 Ga0451793_1139462 3300041452 Bacteria 696
557 Ga0451793_1576126 3300041452 Bacteria 1503
558 Ga0451800_0740237 3300041459 Bacteria 817
559 Ga0451802_1603469 3300041460 Bacteria 652
560 Ga0451804_1040624 3300041463 Bacteria 619
561 Ga0451807_2325405 3300041486 Bacteria 664
562 Ga0439448_0035822 3300042005 Unclassified 1590
563 Ga0439455_0033159 3300042012 Unclassified 1294
564 Ga0466969_0085763 3300044656 Bacteria 1497
565 Ga0466966_0076649 3300044684 Bacteria 2087
566 Ga0466961_0043035 3300044693 Bacteria 2893
567 Ga0466961_0147126 3300044693 Bacteria 1473
568 Ga0466957_0115623 3300044842 Bacteria 1706
569 Ga0495627_032228 3300046453 Bacteria 1650
570 Ga0495592_0346473 3300046454 Bacteria 954
571 Ga0495629_0032551 3300046459 Bacteria 3691
572 Ga0495638_0074162 3300046460 Bacteria 2076
573 Ga0495638_0413256 3300046460 Bacteria 697
574 Ga0495641_0412686 3300046461 Bacteria 613
575 Ga0495651_0086017 3300046462 Bacteria 2367
576 Ga0495651_0087100 3300046462 Bacteria 2349
577 Ga0495651_0113923 3300046462 Bacteria 1996
578 Ga0495653_0813181 3300046463 Bacteria 561
579 Ga0495650_0000087 3300046471 Bacteria 234870
580 Ga0495650_0001198 3300046471 Bacteria 27382
581 Ga0495650_0047909 3300046471 Bacteria 1785
582 Ga0495650_0124812 3300046471 Bacteria 944
583 Ga0495650_0143812 3300046471 Bacteria 861
584 Ga0495605_0219130 3300046474 Bacteria 823
585 Ga0495585_0000074 3300046492 Bacteria 102651
586 Ga0495585_0000286 3300046492 Bacteria 50524
587 Ga0495585_0000459 3300046492 Bacteria 38959
588 Ga0495585_0000667 3300046492 Bacteria 31526
589 Ga0495596_0262790 3300046500 Bacteria 670
590 Ga0495583_0014434 3300046506 Bacteria 4360
591 Ga0495583_0080789 3300046506 Bacteria 1413
592 Ga0495583_0287842 3300046506 Bacteria 654
593 Ga0495583_0442151 3300046506 Bacteria 509
594 Ga0495606_0000052 3300046507 Bacteria 201529
595 Ga0495606_0000425 3300046507 Bacteria 70202
596 Ga0495606_0004916 3300046507 Bacteria 13075
597 Ga0495606_0007070 3300046507 Bacteria 10155
598 Ga0495606_0012011 3300046507 Bacteria 6993
599 Ga0495606_0017553 3300046507 Bacteria 5404
600 Ga0495606_0034004 3300046507 Bacteria 3506
601 Ga0495606_0054447 3300046507 Bacteria 2591
602 Ga0495606_0079573 3300046507 Bacteria 2041
603 Ga0495606_0173258 3300046507 Bacteria 1250
604 Ga0495606_0241869 3300046507 Unclassified 1006
605 Ga0495606_0652391 3300046507 Bacteria 509
606 Ga0495608_0444649 3300046511 Bacteria 789
607 Ga0495610_0000076 3300046512 Bacteria 118246
608 Ga0495610_0000405 3300046512 Bacteria 44184
609 Ga0495610_0003649 3300046512 Bacteria 11848
610 Ga0495610_0003743 3300046512 Bacteria 11643
611 Ga0495610_0004136 3300046512 Bacteria 10856
612 Ga0495610_0075747 3300046512 Bacteria 1557
613 Ga0495616_0001116 3300046513 Bacteria 19061
614 Ga0495616_0001648 3300046513 Bacteria 15299
615 Ga0495616_0068364 3300046513 Bacteria 1725
616 Ga0495616_0294034 3300046513 Bacteria 687
617 Ga0495618_0258111 3300046514 Bacteria 1092
618 Ga0495618_0516939 3300046514 Bacteria 718
619 Ga0495630_1391422 3300046517 Bacteria 528
620 Ga0495631_0021927 3300046518 Bacteria 2972
621 Ga0495631_0112999 3300046518 Bacteria 1168
622 Ga0495631_0413309 3300046518 Bacteria 574
623 Ga0495637_0030977 3300046520 Bacteria 2369
624 Ga0495637_0125162 3300046520 Bacteria 985
625 Ga0495644_0007953 3300046523 Bacteria 4082
626 Ga0495648_0001585 3300046524 Bacteria 22152
627 Ga0495648_0013724 3300046524 Bacteria 5971
628 Ga0495663_0164223 3300046525 Bacteria 763
629 Ga0495652_0054934 3300046529 Bacteria 3389
630 Ga0495652_0095063 3300046529 Bacteria 2429
631 Ga0495652_0296456 3300046529 Bacteria 1177
632 Ga0495652_0643047 3300046529 Bacteria 719
633 Ga0495654_0214572 3300046530 Bacteria 817
634 Ga0495609_0019281 3300046538 Bacteria 3158
635 Ga0495609_0055155 3300046538 Bacteria 1763
636 Ga0495609_0121490 3300046538 Bacteria 1122
637 Ga0495609_0219883 3300046538 Bacteria 789
638 Ga0495622_0177406 3300046557 Bacteria 956
639 Ga0495622_0218419 3300046557 Bacteria 845
640 Ga0495622_0391432 3300046557 Bacteria 599
641 Ga0495633_0000004 3300046558 Bacteria 370781
642 Ga0495633_0000035 3300046558 Bacteria 185403
643 Ga0495633_0001552 3300046558 Bacteria 17627
644 Ga0495633_0009741 3300046558 Bacteria 5280
645 Ga0495633_0158588 3300046558 Bacteria 1044
646 Ga0495668_0000032 3300046616 Bacteria 254951
647 Ga0495668_0000121 3300046616 Bacteria 116234
648 Ga0495668_0137256 3300046616 Bacteria 1339
649 Ga0495634_0388302 3300046642 Bacteria 831
650 Ga0495625_0000008 3300046660 Bacteria 536165
651 Ga0495625_0000067 3300046660 Bacteria 171483
652 Ga0495625_0000981 3300046660 Bacteria 37838
653 Ga0495625_0001612 3300046660 Bacteria 26626
654 Ga0495625_0007910 3300046660 Bacteria 9146
655 Ga0495625_0010659 3300046660 Bacteria 7576
656 Ga0495625_0043150 3300046660 Bacteria 3272
657 Ga0495625_0068042 3300046660 Bacteria 2504
658 Ga0495625_0154408 3300046660 Bacteria 1541
659 Ga0495625_0265137 3300046660 Bacteria 1110
660 Ga0495625_0271939 3300046660 Bacteria 1093
661 Ga0495625_0470086 3300046660 Bacteria 774
662 Ga0495625_0683373 3300046660 Bacteria 608
663 Ga0495661_0002168 3300046665 Bacteria 15344
664 Ga0495661_0002273 3300046665 Bacteria 14867
665 Ga0495661_0036794 3300046665 Bacteria 3061
666 Ga0495588_0671152 3300046674 Bacteria 542
667 Ga0495669_0664701 3300046684 Unclassified 507
668 Ga0495670_0181618 3300046691 Bacteria 1111
669 Ga0495670_0386267 3300046691 Bacteria 756
670 Ga0495670_0403051 3300046691 Bacteria 739
671 Ga0495671_0314576 3300046692 Bacteria 752
672 Ga0495649_0000018 3300046694 Bacteria 220586
673 Ga0495649_0000135 3300046694 Bacteria 64533
674 Ga0495649_0196926 3300046694 Bacteria 1047
675 Ga0495589_0134693 3300046794 Bacteria 1185
676 Ga0495600_0607541 3300046809 Bacteria 664
677 Ga0495660_0003458 3300046810 Bacteria 9754
678 Ga0495660_0080602 3300046810 Bacteria 1708
679 Ga0495660_0208623 3300046810 Bacteria 928
680 Ga0495676_0630359 3300047321 Bacteria 697
681 Ga0495683_0145406 3300047323 Bacteria 1108
682 Ga0495683_0222892 3300047323 Unclassified 840
683 Ga0495687_001763 3300047443 Bacteria 19137
684 Ga0495687_003533 3300047443 Bacteria 11252
685 Ga0495687_066582 3300047443 Bacteria 1461
686 Ga0495673_0032422 3300047469 Bacteria 2436
687 Ga0495673_0067119 3300047469 Bacteria 1519
688 Ga0495681_0292594 3300047470 Bacteria 632
689 Ga0495686_0000917 3300047472 Bacteria 36995
690 Ga0495686_0001013 3300047472 Bacteria 34054
691 Ga0495686_0075162 3300047472 Bacteria 2072
692 Ga0495686_0320790 3300047472 Bacteria 849
693 Ga0495686_0343957 3300047472 Bacteria 812
694 Ga0495686_0409552 3300047472 Bacteria 726
695 Ga0495614_0080811 3300048089 Bacteria 1408
696 Ga0495614_0094542 3300048089 Bacteria 1302
697 Ga0496115_0017027 3300048918 Bacteria 5545
698 Ga0496122_0004298 3300048925 Bacteria 17852
699 Ga0496123_0005429 3300048926 Bacteria 12835
700 Ga0496126_0491415 3300048929 Bacteria 982
701 Ga0495678_014483 3300049459 Bacteria 3666
702 Ga0495682_0025629 3300049460 Bacteria 2194
703 Ga0501217_067965 3300049661 Bacteria 964
704 Ga0501223_000212 3300049663 Bacteria 14832
705 Ga0501249_020121 3300049679 Bacteria 1451
706 Ga0501259_093574 3300049688 Unclassified 679
707 Ga0501225_0017101 3300049705 Bacteria 2014
708 Ga0501241_039094 3300049758 Bacteria 915
709 Ga0501280_040265 3300049776 Unclassified 756
710 Ga0501035_0932891 3300049822 Unclassified 686
711 nmdc:mga0k408_102938_c1 3300050493 Bacteria 1684
712 nmdc:mga0k408_194544_c1 3300050493 Bacteria 1210
713 nmdc:mga0k408_3098_c2 3300050493 Bacteria 8176
714 nmdc:mga0k408_623754_c1 3300050493 Bacteria 635
715 nmdc:mga0k408_65_c1 3300050493 Bacteria 52329
716 nmdc:mga0k408_715_c2 3300050493 Bacteria 11734
717 nmdc:mga0k408_979_c1 3300050493 Bacteria 15710
718 nmdc:mga0k408_99634_c1 3300050493 Bacteria 1713
719 nmdc:mga07m45_460920_c1 3300050496 Bacteria 737
720 nmdc:mga0qj67_440167_c1 3300050509 Bacteria 1050
721 nmdc:mga08y16_24884_c1 3300050511 Bacteria 6315
722 nmdc:mga0sz30_557791_c1 3300050516 Bacteria 517
723 Ga0500635_0002950 3300053080 Bacteria 4240
724 Ga0500646_0132271 3300053090 Unclassified 812
725 Ga0500651_0000350 3300053093 Bacteria 25883
726 Ga0500651_0157910 3300053093 Bacteria 1358
727 Ga0500566_0221536 3300053094 Bacteria 940
728 Ga0500650_0224623 3300053098 Bacteria 849
729 Ga0500650_0251840 3300053098 Unclassified 792
730 Ga0500594_0038912 3300053118 Bacteria 1291
731 Ga0500608_000297 3300053122 Bacteria 19220
732 Ga0500608_060695 3300053122 Bacteria 1808
733 Ga0500614_007956 3300053123 Bacteria 2242
734 Ga0500614_061382 3300053123 Bacteria 1011
735 Ga0500618_000033 3300053125 Bacteria 121886
736 Ga0500618_000037 3300053125 Bacteria 117320
737 Ga0500618_016551 3300053125 Bacteria 1845
738 Ga0500564_112304 3300053138 Bacteria 1195
739 Ga0500568_0038399 3300053139 Bacteria 1938
740 Ga0500616_0034972 3300053153 Bacteria 2734
741 Ga0500619_170958 3300053154 Bacteria 736
742 Ga0500622_0000175 3300053156 Bacteria 69363
743 Ga0500622_0240133 3300053156 Bacteria 801
744 Ga0500624_000481 3300053157 Bacteria 11801
745 Ga0500624_003615 3300053157 Bacteria 2024
746 Ga0500633_0310796 3300053160 Bacteria 579
747 Ga0500634_0019483 3300053161 Bacteria 3656
748 Ga0500645_178024 3300053730 Bacteria 579

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005439 Ga0070711_101882967 Ga0070711_1018829671 109
2 3300031507 Ga0307509_10216563 Ga0307509_102165632 109
3 iso_pu_bacteria 2599185184 2599478309 118
4 iso_pu_bacteria 2919437846 2919438993 118
5 iso_pu_bacteria 2928078545 2928080641 118
6 iso_pu_bacteria 2928147474 2928150865 118
7 iso_pu_bacteria 2932082852 2932082975 118
8 3300006846 Ga0075430_100484944 Ga0075430_1004849442 119
9 3300009147 Ga0114129_11076180 Ga0114129_110761802 119
10 3300050509 nmdc:mga0qj67_440167_c1 nmdc:mga0qj67_440167_c1_226_597 119
11 3300050511 nmdc:mga08y16_24884_c1 nmdc:mga08y16_24884_c1_2218_2589 119
12 3300053090 Ga0500646_0132271 Ga0500646_0132271_123_494 119
13 3300053093 Ga0500651_0157910 Ga0500651_0157910_252_623 119
14 3300013100 Ga0157373_10247498 Ga0157373_102474982 121
15 3300013102 Ga0157371_10158350 Ga0157371_101583502 121
16 3300013104 Ga0157370_10019570 Ga0157370_100195703 121
17 3300013104 Ga0157370_10269129 Ga0157370_102691291 121
18 3300013105 Ga0157369_10000015 Ga0157369_1000001520 121
19 3300013307 Ga0157372_10309694 Ga0157372_103096941 121
20 3300015262 Ga0182007_10000010 Ga0182007_10000010195 121
21 3300015682 Ga0183373_1005 Ga0183373_1005223 121
22 3300017792 Ga0163161_10000729 Ga0163161_100007293 121
23 3300028794 Ga0307515_10088744 Ga0307515_100887444 121
24 3300031649 Ga0307514_10118777 Ga0307514_101187772 121
25 3300031903 Ga0307407_10000005 Ga0307407_1000000539 121
26 3300031911 Ga0307412_10273379 Ga0307412_102733792 121
27 3300032002 Ga0307416_100000001 Ga0307416_100000001409 121
28 3300032004 Ga0307414_10012376 Ga0307414_100123764 121
29 3300046512 Ga0495610_0000405 Ga0495610_0000405_30461_30832 121
30 iso_pu_bacteria 2522125168 2522552671 121
31 3300001904 JGI24736J21556_1008316 JGI24736J21556_10083162 122
32 3300001904 JGI24736J21556_1011837 JGI24736J21556_10118372 122
33 3300001989 JGI24739J22299_10015871 JGI24739J22299_100158712 122
34 3300001990 JGI24737J22298_10001771 JGI24737J22298_100017718 122
35 3300001990 JGI24737J22298_10002233 JGI24737J22298_100022332 122
36 3300002067 JGI24735J21928_10000004 JGI24735J21928_10000004129 122
37 3300002067 JGI24735J21928_10000033 JGI24735J21928_1000003358 122
38 3300002737 JGI25162J39368_1000008 JGI25162J39368_100000815 122
39 3300002737 JGI25162J39368_1000017 JGI25162J39368_100001739 122
40 3300002737 JGI25162J39368_1001793 JGI25162J39368_10017939 122
41 3300002741 JGI25157J39369_1004659 JGI25157J39369_10046592 122
42 3300002772 JGI25164J39214_1001237 JGI25164J39214_10012376 122
43 3300002774 JGI25150J39212_1000003 JGI25150J39212_1000003242 122
44 3300003187 JGI25151J46595_10000002 JGI25151J46595_10000002242 122
45 3300003214 JGI25165J46597_1002573 JGI25165J46597_10025735 122
46 3300003214 JGI25165J46597_1036456 JGI25165J46597_10364561 122
47 3300003214 JGI25165J46597_1050527 JGI25165J46597_10505271 122
48 3300003215 JGI25153J46596_10000015 JGI25153J46596_1000001553 122
49 3300003316 rootH1_10008126 rootH1_100081266 122
50 3300003316 rootH1_10063127 rootH1_100631278 122
51 3300003320 rootH2_10003269 rootH2_1000326945 122
52 3300003320 rootH2_10057796 rootH2_1005779613 122
53 3300003320 rootH2_10103643 rootH2_101036437 122
54 3300003320 rootH2_10196503 rootH2_101965032 122
55 3300003320 rootH2_10269298 rootH2_102692981 122
56 3300003320 rootH2_10284133 rootH2_102841332 122
57 3300003322 rootL2_10035013 rootL2_100350135 122
58 3300003322 rootL2_10132836 rootL2_101328364 122
59 3300003323 rootH1_10005934 rootH1_100059342 122
60 3300003323 rootH1_10010138 rootH1_100101387 122
61 3300003323 rootH1_10062209 rootH1_100622097 122
62 3300003323 rootH1_10064415 rootH1_100644152 122
63 3300003323 rootH1_10110019 rootH1_101100191 122
64 3300003323 rootH1_10192260 rootH1_101922601 122
65 3300003763 Ga0055529_1007859 Ga0055529_10078591 122
66 3300003781 Ga0055536_1048487 Ga0055536_10484871 122
67 3300005262 Ga0065165_1000442 Ga0065165_100044233 122
68 3300005288 Ga0065714_10002307 Ga0065714_1000230710 122
69 3300005288 Ga0065714_10011237 Ga0065714_100112373 122
70 3300005288 Ga0065714_10014328 Ga0065714_100143282 122
71 3300005288 Ga0065714_10065739 Ga0065714_100657392 122
72 3300005288 Ga0065714_10126805 Ga0065714_101268051 122
73 3300005288 Ga0065714_10197124 Ga0065714_101971242 122
74 3300005288 Ga0065714_10453425 Ga0065714_104534251 122
75 3300005289 Ga0065704_10070323 Ga0065704_1007032315 122
76 3300005289 Ga0065704_10096827 Ga0065704_100968272 122
77 3300005289 Ga0065704_10179121 Ga0065704_101791211 122
78 3300005289 Ga0065704_10396737 Ga0065704_103967372 122
79 3300005289 Ga0065704_10599986 Ga0065704_105999861 122
80 3300005327 Ga0070658_10000008 Ga0070658_10000008132 122
81 3300005327 Ga0070658_10000008 Ga0070658_10000008134 122
82 3300005327 Ga0070658_10000018 Ga0070658_1000001888 122
83 3300005327 Ga0070658_10082680 Ga0070658_100826803 122
84 3300005327 Ga0070658_10324086 Ga0070658_103240862 122
85 3300005327 Ga0070658_10353375 Ga0070658_103533751 122
86 3300005328 Ga0070676_10000465 Ga0070676_100004659 122
87 3300005334 Ga0068869_100117037 Ga0068869_1001170371 122
88 3300005336 Ga0070680_100007970 Ga0070680_1000079708 122
89 3300005338 Ga0068868_100143907 Ga0068868_1001439072 122
90 3300005338 Ga0068868_100378158 Ga0068868_1003781582 122
91 3300005339 Ga0070660_100008700 Ga0070660_1000087002 122
92 3300005339 Ga0070660_100024084 Ga0070660_1000240845 122
93 3300005339 Ga0070660_100043103 Ga0070660_1000431032 122
94 3300005339 Ga0070660_100216474 Ga0070660_1002164742 122
95 3300005341 Ga0070691_10205642 Ga0070691_102056421 122
96 3300005344 Ga0070661_101109689 Ga0070661_1011096892 122
97 3300005354 Ga0070675_100823046 Ga0070675_1008230461 122
98 3300005355 Ga0070671_100003365 Ga0070671_1000033654 122
99 3300005355 Ga0070671_100859824 Ga0070671_1008598242 122
100 3300005356 Ga0070674_100054220 Ga0070674_1000542202 122
101 3300005356 Ga0070674_100365545 Ga0070674_1003655451 122
102 3300005364 Ga0070673_100002665 Ga0070673_1000026654 122
103 3300005364 Ga0070673_101008862 Ga0070673_1010088622 122
104 3300005366 Ga0070659_100000899 Ga0070659_10000089912 122
105 3300005366 Ga0070659_100018025 Ga0070659_1000180255 122
106 3300005436 Ga0070713_100789340 Ga0070713_1007893401 122
107 3300005455 Ga0070663_100247673 Ga0070663_1002476732 122
108 3300005456 Ga0070678_100634535 Ga0070678_1006345352 122
109 3300005456 Ga0070678_101080335 Ga0070678_1010803352 122
110 3300005457 Ga0070662_100000062 Ga0070662_10000006251 122
111 3300005457 Ga0070662_100343429 Ga0070662_1003434292 122
112 3300005458 Ga0070681_10112980 Ga0070681_101129802 122
113 3300005459 Ga0068867_100000923 Ga0068867_10000092320 122
114 3300005530 Ga0070679_100089205 Ga0070679_1000892053 122
115 3300005530 Ga0070679_100263095 Ga0070679_1002630952 122
116 3300005535 Ga0070684_100017533 Ga0070684_1000175333 122
117 3300005539 Ga0068853_100010560 Ga0068853_1000105606 122
118 3300005539 Ga0068853_100026830 Ga0068853_1000268302 122
119 3300005539 Ga0068853_100069159 Ga0068853_1000691592 122
120 3300005539 Ga0068853_100083870 Ga0068853_1000838702 122
121 3300005539 Ga0068853_100114242 Ga0068853_1001142424 122
122 3300005539 Ga0068853_100604955 Ga0068853_1006049551 122
123 3300005539 Ga0068853_100870262 Ga0068853_1008702622 122
124 3300005543 Ga0070672_100546171 Ga0070672_1005461712 122
125 3300005548 Ga0070665_100000118 Ga0070665_1000001189 122
126 3300005548 Ga0070665_100332761 Ga0070665_1003327612 122
127 3300005563 Ga0068855_100000268 Ga0068855_10000026842 122
128 3300005563 Ga0068855_100000967 Ga0068855_1000009679 122
129 3300005563 Ga0068855_100001431 Ga0068855_1000014313 122
130 3300005563 Ga0068855_100015178 Ga0068855_1000151782 122
131 3300005563 Ga0068855_100027421 Ga0068855_1000274215 122
132 3300005563 Ga0068855_100029172 Ga0068855_1000291724 122
133 3300005563 Ga0068855_100048451 Ga0068855_1000484513 122
134 3300005563 Ga0068855_100113905 Ga0068855_1001139052 122
135 3300005563 Ga0068855_100123199 Ga0068855_1001231992 122
136 3300005563 Ga0068855_100149792 Ga0068855_1001497921 122
137 3300005563 Ga0068855_100162582 Ga0068855_1001625822 122
138 3300005563 Ga0068855_100237010 Ga0068855_1002370102 122
139 3300005563 Ga0068855_100286932 Ga0068855_1002869322 122
140 3300005563 Ga0068855_100350233 Ga0068855_1003502332 122
141 3300005563 Ga0068855_100453218 Ga0068855_1004532182 122
142 3300005563 Ga0068855_100493919 Ga0068855_1004939192 122
143 3300005563 Ga0068855_101053690 Ga0068855_1010536901 122
144 3300005563 Ga0068855_101429179 Ga0068855_1014291791 122
145 3300005577 Ga0068857_100131311 Ga0068857_1001313112 122
146 3300005577 Ga0068857_100248276 Ga0068857_1002482762 122
147 3300005577 Ga0068857_100257090 Ga0068857_1002570902 122
148 3300005578 Ga0068854_100057394 Ga0068854_1000573942 122
149 3300005614 Ga0068856_100017859 Ga0068856_1000178595 122
150 3300005614 Ga0068856_100057792 Ga0068856_1000577924 122
151 3300005614 Ga0068856_100078687 Ga0068856_1000786874 122
152 3300005614 Ga0068856_100101403 Ga0068856_1001014034 122
153 3300005614 Ga0068856_100277659 Ga0068856_1002776592 122
154 3300005614 Ga0068856_100295764 Ga0068856_1002957642 122
155 3300005614 Ga0068856_100461380 Ga0068856_1004613802 122
156 3300005614 Ga0068856_100624835 Ga0068856_1006248352 122
157 3300005614 Ga0068856_100705530 Ga0068856_1007055301 122
158 3300005614 Ga0068856_101220242 Ga0068856_1012202421 122
159 3300005614 Ga0068856_101597234 Ga0068856_1015972341 122
160 3300005616 Ga0068852_100000862 Ga0068852_10000086212 122
161 3300005616 Ga0068852_100114709 Ga0068852_1001147092 122
162 3300005616 Ga0068852_100367581 Ga0068852_1003675812 122
163 3300005718 Ga0068866_10056329 Ga0068866_100563291 122
164 3300005718 Ga0068866_10751871 Ga0068866_107518711 122
165 3300005840 Ga0068870_10173517 Ga0068870_101735172 122
166 3300005841 Ga0068863_100863440 Ga0068863_1008634401 122
167 3300005842 Ga0068858_100120307 Ga0068858_1001203072 122
168 3300005842 Ga0068858_100205347 Ga0068858_1002053473 122
169 3300005842 Ga0068858_102545755 Ga0068858_1025457551 122
170 3300006195 Ga0075366_10001407 Ga0075366_100014072 122
171 3300006195 Ga0075366_10001542 Ga0075366_100015425 122
172 3300006195 Ga0075366_10005056 Ga0075366_100050563 122
173 3300006195 Ga0075366_10017247 Ga0075366_100172473 122
174 3300006195 Ga0075366_10098559 Ga0075366_100985591 122
175 3300006195 Ga0075366_10171616 Ga0075366_101716162 122
176 3300006237 Ga0097621_100000015 Ga0097621_10000001549 122
177 3300006237 Ga0097621_101394576 Ga0097621_1013945761 122
178 3300006353 Ga0075370_10495317 Ga0075370_104953172 122
179 3300006358 Ga0068871_100000051 Ga0068871_10000005132 122
180 3300006881 Ga0068865_100000120 Ga0068865_10000012031 122
181 3300009036 Ga0105244_10041432 Ga0105244_100414322 122
182 3300009036 Ga0105244_10163055 Ga0105244_101630551 122
183 3300009093 Ga0105240_10000185 Ga0105240_1000018512 122
184 3300009093 Ga0105240_10002706 Ga0105240_100027063 122
185 3300009093 Ga0105240_10013632 Ga0105240_100136326 122
186 3300009093 Ga0105240_10039125 Ga0105240_100391257 122
187 3300009093 Ga0105240_10049341 Ga0105240_100493413 122
188 3300009093 Ga0105240_10079337 Ga0105240_100793372 122
189 3300009093 Ga0105240_10079337 Ga0105240_100793374 122
190 3300009093 Ga0105240_10143852 Ga0105240_101438522 122
191 3300009093 Ga0105240_10149122 Ga0105240_101491222 122
192 3300009093 Ga0105240_10184556 Ga0105240_101845562 122
193 3300009093 Ga0105240_10240981 Ga0105240_102409812 122
194 3300009093 Ga0105240_10298268 Ga0105240_102982682 122
195 3300009093 Ga0105240_10312511 Ga0105240_103125112 122
196 3300009093 Ga0105240_10312672 Ga0105240_103126722 122
197 3300009093 Ga0105240_10337375 Ga0105240_103373752 122
198 3300009093 Ga0105240_10362581 Ga0105240_103625812 122
199 3300009093 Ga0105240_10477310 Ga0105240_104773102 122
200 3300009093 Ga0105240_10713281 Ga0105240_107132811 122
201 3300009093 Ga0105240_11154335 Ga0105240_111543352 122
202 3300009093 Ga0105240_11233548 Ga0105240_112335482 122
203 3300009093 Ga0105240_12343157 Ga0105240_123431571 122
204 3300009148 Ga0105243_10034277 Ga0105243_100342773 122
205 3300009174 Ga0105241_10001267 Ga0105241_1000126718 122
206 3300009174 Ga0105241_10003621 Ga0105241_1000362113 122
207 3300009174 Ga0105241_10011403 Ga0105241_100114035 122
208 3300009174 Ga0105241_10030063 Ga0105241_100300632 122
209 3300009174 Ga0105241_10055766 Ga0105241_100557662 122
210 3300009174 Ga0105241_10069549 Ga0105241_100695495 122
211 3300009174 Ga0105241_10110233 Ga0105241_101102333 122
212 3300009174 Ga0105241_10178991 Ga0105241_101789912 122
213 3300009174 Ga0105241_10306878 Ga0105241_103068782 122
214 3300009174 Ga0105241_10427269 Ga0105241_104272691 122
215 3300009174 Ga0105241_10475229 Ga0105241_104752292 122
216 3300009174 Ga0105241_10613444 Ga0105241_106134442 122
217 3300009174 Ga0105241_11418315 Ga0105241_114183152 122
218 3300009176 Ga0105242_10172286 Ga0105242_101722862 122
219 3300009176 Ga0105242_10772372 Ga0105242_107723722 122
220 3300009176 Ga0105242_11091223 Ga0105242_110912232 122
221 3300009545 Ga0105237_10000758 Ga0105237_1000075837 122
222 3300009545 Ga0105237_10000887 Ga0105237_1000088725 122
223 3300009545 Ga0105237_10002011 Ga0105237_100020118 122
224 3300009545 Ga0105237_10007579 Ga0105237_100075798 122
225 3300009545 Ga0105237_10008366 Ga0105237_100083666 122
226 3300009545 Ga0105237_10016912 Ga0105237_100169126 122
227 3300009545 Ga0105237_10031079 Ga0105237_100310792 122
228 3300009545 Ga0105237_10159958 Ga0105237_101599582 122
229 3300009545 Ga0105237_10258257 Ga0105237_102582572 122
230 3300009545 Ga0105237_10417292 Ga0105237_104172922 122
231 3300009545 Ga0105237_10433497 Ga0105237_104334972 122
232 3300009545 Ga0105237_11340306 Ga0105237_113403062 122
233 3300009545 Ga0105237_12048883 Ga0105237_120488831 122
234 3300009545 Ga0105237_12560937 Ga0105237_125609371 122
235 3300009551 Ga0105238_10015398 Ga0105238_100153981 122
236 3300009551 Ga0105238_10039973 Ga0105238_100399734 122
237 3300009551 Ga0105238_10278348 Ga0105238_102783482 122
238 3300009551 Ga0105238_10363107 Ga0105238_103631072 122
239 3300009551 Ga0105238_10621345 Ga0105238_106213452 122
240 3300009551 Ga0105238_10798214 Ga0105238_107982142 122
241 3300009553 Ga0105249_10194085 Ga0105249_101940852 122
242 3300010375 Ga0105239_10000142 Ga0105239_1000014252 122
243 3300010375 Ga0105239_10001435 Ga0105239_1000143519 122
244 3300010375 Ga0105239_10001468 Ga0105239_1000146822 122
245 3300010375 Ga0105239_10002256 Ga0105239_1000225616 122
246 3300010375 Ga0105239_10002374 Ga0105239_1000237419 122
247 3300010375 Ga0105239_10003905 Ga0105239_100039058 122
248 3300010375 Ga0105239_10004588 Ga0105239_100045887 122
249 3300010375 Ga0105239_10022631 Ga0105239_100226316 122
250 3300010375 Ga0105239_10029834 Ga0105239_100298342 122
251 3300010375 Ga0105239_10031340 Ga0105239_100313405 122
252 3300010375 Ga0105239_10075942 Ga0105239_100759422 122
253 3300010375 Ga0105239_10076804 Ga0105239_100768043 122
254 3300010375 Ga0105239_10105106 Ga0105239_101051063 122
255 3300010375 Ga0105239_10107988 Ga0105239_101079882 122
256 3300010375 Ga0105239_10599474 Ga0105239_105994742 122
257 3300010375 Ga0105239_11299316 Ga0105239_112993162 122
258 3300010375 Ga0105239_11817595 Ga0105239_118175951 122
259 3300010375 Ga0105239_13209637 Ga0105239_132096371 122
260 3300011119 Ga0105246_10047095 Ga0105246_100470952 122
261 3300011119 Ga0105246_10107474 Ga0105246_101074742 122
262 3300013100 Ga0157373_10000254 Ga0157373_100002543 122
263 3300013100 Ga0157373_10000262 Ga0157373_1000026224 122
264 3300013100 Ga0157373_10022406 Ga0157373_100224062 122
265 3300013100 Ga0157373_10029292 Ga0157373_100292921 122
266 3300013102 Ga0157371_10000117 Ga0157371_1000011738 122
267 3300013102 Ga0157371_10000912 Ga0157371_1000091227 122
268 3300013102 Ga0157371_10001520 Ga0157371_100015208 122
269 3300013102 Ga0157371_10002174 Ga0157371_100021742 122
270 3300013102 Ga0157371_10004362 Ga0157371_100043622 122
271 3300013102 Ga0157371_10013752 Ga0157371_100137522 122
272 3300013102 Ga0157371_10022859 Ga0157371_100228594 122
273 3300013102 Ga0157371_10168306 Ga0157371_101683062 122
274 3300013102 Ga0157371_10226002 Ga0157371_102260022 122
275 3300013104 Ga0157370_10003772 Ga0157370_1000377219 122
276 3300013104 Ga0157370_10009721 Ga0157370_100097216 122
277 3300013104 Ga0157370_10010234 Ga0157370_100102341 122
278 3300013104 Ga0157370_10025999 Ga0157370_100259992 122
279 3300013104 Ga0157370_10071814 Ga0157370_100718142 122
280 3300013104 Ga0157370_10075503 Ga0157370_100755032 122
281 3300013104 Ga0157370_10143214 Ga0157370_101432143 122
282 3300013104 Ga0157370_10188263 Ga0157370_101882632 122
283 3300013104 Ga0157370_10195676 Ga0157370_101956761 122
284 3300013104 Ga0157370_10466876 Ga0157370_104668762 122
285 3300013104 Ga0157370_10494717 Ga0157370_104947172 122
286 3300013104 Ga0157370_10596957 Ga0157370_105969572 122
287 3300013104 Ga0157370_10790550 Ga0157370_107905501 122
288 3300013104 Ga0157370_10957935 Ga0157370_109579351 122
289 3300013105 Ga0157369_10000047 Ga0157369_1000004781 122
290 3300013105 Ga0157369_10000101 Ga0157369_1000010184 122
291 3300013105 Ga0157369_10235298 Ga0157369_102352982 122
292 3300013105 Ga0157369_10237711 Ga0157369_102377112 122
293 3300013105 Ga0157369_10247576 Ga0157369_102475762 122
294 3300013105 Ga0157369_10303928 Ga0157369_103039281 122
295 3300013105 Ga0157369_10460852 Ga0157369_104608522 122
296 3300013105 Ga0157369_11438487 Ga0157369_114384871 122
297 3300013296 Ga0157374_10000874 Ga0157374_100008749 122
298 3300013296 Ga0157374_10001137 Ga0157374_1000113710 122
299 3300013296 Ga0157374_10012440 Ga0157374_100124402 122
300 3300013296 Ga0157374_10012440 Ga0157374_100124404 122
301 3300013296 Ga0157374_10362962 Ga0157374_103629622 122
302 3300013296 Ga0157374_10410837 Ga0157374_104108372 122
303 3300013296 Ga0157374_10590113 Ga0157374_105901132 122
304 3300013296 Ga0157374_11524670 Ga0157374_115246701 122
305 3300013296 Ga0157374_12068238 Ga0157374_120682381 122
306 3300013297 Ga0157378_10010197 Ga0157378_100101978 122
307 3300013297 Ga0157378_10268463 Ga0157378_102684632 122
308 3300013297 Ga0157378_10269515 Ga0157378_102695152 122
309 3300013297 Ga0157378_10360437 Ga0157378_103604372 122
310 3300013297 Ga0157378_10427712 Ga0157378_104277121 122
311 3300013306 Ga0163162_10000012 Ga0163162_1000001220 122
312 3300013306 Ga0163162_10000895 Ga0163162_1000089510 122
313 3300013306 Ga0163162_10001113 Ga0163162_100011138 122
314 3300013306 Ga0163162_10004644 Ga0163162_100046442 122
315 3300013306 Ga0163162_10367947 Ga0163162_103679472 122
316 3300013306 Ga0163162_10404386 Ga0163162_104043862 122
317 3300013306 Ga0163162_10566128 Ga0163162_105661281 122
318 3300013306 Ga0163162_10827881 Ga0163162_108278812 122
319 3300013307 Ga0157372_10000041 Ga0157372_1000004180 122
320 3300013307 Ga0157372_10000199 Ga0157372_1000019950 122
321 3300013307 Ga0157372_10002721 Ga0157372_1000272112 122
322 3300013307 Ga0157372_10014659 Ga0157372_100146592 122
323 3300013307 Ga0157372_10019379 Ga0157372_100193799 122
324 3300013307 Ga0157372_10035225 Ga0157372_100352253 122
325 3300013307 Ga0157372_10054327 Ga0157372_100543273 122
326 3300013307 Ga0157372_10065963 Ga0157372_100659631 122
327 3300013307 Ga0157372_10453387 Ga0157372_104533872 122
328 3300013307 Ga0157372_11186032 Ga0157372_111860321 122
329 3300013308 Ga0157375_10013601 Ga0157375_100136012 122
330 3300013308 Ga0157375_10059972 Ga0157375_100599723 122
331 3300013308 Ga0157375_10143486 Ga0157375_101434862 122
332 3300013308 Ga0157375_10898565 Ga0157375_108985652 122
333 3300013308 Ga0157375_11084893 Ga0157375_110848931 122
334 3300013308 Ga0157375_11539125 Ga0157375_115391252 122
335 3300014325 Ga0163163_10576626 Ga0163163_105766262 122
336 3300014497 Ga0182008_10000002 Ga0182008_10000002110 122
337 3300014497 Ga0182008_10000294 Ga0182008_1000029420 122
338 3300014497 Ga0182008_10124150 Ga0182008_101241502 122
339 3300014745 Ga0157377_10059831 Ga0157377_100598312 122
340 3300014745 Ga0157377_10400415 Ga0157377_104004151 122
341 3300014968 Ga0157379_11385576 Ga0157379_113855762 122
342 3300015261 Ga0182006_1000153 Ga0182006_100015310 122
343 3300015261 Ga0182006_1000287 Ga0182006_100028735 122
344 3300015261 Ga0182006_1000349 Ga0182006_100034919 122
345 3300015261 Ga0182006_1003312 Ga0182006_10033124 122
346 3300015262 Ga0182007_10000005 Ga0182007_10000005167 122
347 3300015682 Ga0183373_1002 Ga0183373_1002755 122
348 3300017792 Ga0163161_10001299 Ga0163161_100012993 122
349 3300017792 Ga0163161_10002412 Ga0163161_100024127 122
350 3300017792 Ga0163161_10002768 Ga0163161_1000276812 122
351 3300017792 Ga0163161_10006203 Ga0163161_100062035 122
352 3300017792 Ga0163161_10050655 Ga0163161_100506552 122
353 3300017792 Ga0163161_10055914 Ga0163161_100559142 122
354 3300017792 Ga0163161_10092081 Ga0163161_100920812 122
355 3300017792 Ga0163161_11264025 Ga0163161_112640251 122
356 3300020077 Ga0206351_10496138 Ga0206351_104961381 122
357 3300021361 Ga0213872_10008325 Ga0213872_100083255 122
358 3300025230 Ga0209563_109379 Ga0209563_1093792 122
359 3300025231 Ga0207427_100043 Ga0207427_10004322 122
360 3300025233 Ga0209437_100024 Ga0209437_100024277 122
361 3300025233 Ga0209437_100030 Ga0209437_100030366 122
362 3300025233 Ga0209437_100170 Ga0209437_10017097 122
363 3300025242 Ga0209258_114613 Ga0209258_1146131 122
364 3300025245 Ga0207425_1000003 Ga0207425_1000003600 122
365 3300025250 Ga0209026_1000225 Ga0209026_10002256 122
366 3300025250 Ga0209026_1003564 Ga0209026_10035643 122
367 3300025250 Ga0209026_1024243 Ga0209026_10242431 122
368 3300025250 Ga0209026_1044634 Ga0209026_10446341 122
369 3300025258 Ga0209129_1000014 Ga0209129_1000014233 122
370 3300025258 Ga0209129_1007976 Ga0209129_10079762 122
371 3300025258 Ga0209129_1011482 Ga0209129_10114822 122
372 3300025261 Ga0209233_1000266 Ga0209233_100026637 122
373 3300025261 Ga0209233_1048394 Ga0209233_10483941 122
374 3300025261 Ga0209233_1048817 Ga0209233_10488172 122
375 3300025272 Ga0209455_1001647 Ga0209455_10016477 122
376 3300025272 Ga0209455_1002288 Ga0209455_10022884 122
377 3300025292 Ga0209676_1000491 Ga0209676_100049151 122
378 3300025294 Ga0209025_1000007 Ga0209025_1000007599 122
379 3300025297 Ga0209758_1000012 Ga0209758_1000012600 122
380 3300025298 Ga0209050_1081806 Ga0209050_10818062 122
381 3300025728 Ga0207655_1034009 Ga0207655_10340092 122
382 3300025899 Ga0207642_10100749 Ga0207642_101007491 122
383 3300025899 Ga0207642_10624420 Ga0207642_106244201 122
384 3300025904 Ga0207647_10000012 Ga0207647_1000001210 122
385 3300025904 Ga0207647_10132579 Ga0207647_101325792 122
386 3300025904 Ga0207647_10188948 Ga0207647_101889482 122
387 3300025907 Ga0207645_10000058 Ga0207645_1000005815 122
388 3300025908 Ga0207643_10176790 Ga0207643_101767902 122
389 3300025909 Ga0207705_10000026 Ga0207705_10000026133 122
390 3300025909 Ga0207705_10000026 Ga0207705_10000026135 122
391 3300025909 Ga0207705_10000036 Ga0207705_10000036107 122
392 3300025909 Ga0207705_10046191 Ga0207705_100461912 122
393 3300025909 Ga0207705_10073215 Ga0207705_100732152 122
394 3300025909 Ga0207705_10256711 Ga0207705_102567111 122
395 3300025909 Ga0207705_10268285 Ga0207705_102682852 122
396 3300025911 Ga0207654_10001331 Ga0207654_1000133111 122
397 3300025911 Ga0207654_10058658 Ga0207654_100586582 122
398 3300025911 Ga0207654_10075706 Ga0207654_100757062 122
399 3300025911 Ga0207654_10098758 Ga0207654_100987582 122
400 3300025911 Ga0207654_10172222 Ga0207654_101722221 122
401 3300025911 Ga0207654_10259196 Ga0207654_102591961 122
402 3300025911 Ga0207654_10289615 Ga0207654_102896152 122
403 3300025912 Ga0207707_10088460 Ga0207707_100884602 122
404 3300025913 Ga0207695_10000117 Ga0207695_10000117113 122
405 3300025913 Ga0207695_10019916 Ga0207695_100199163 122
406 3300025913 Ga0207695_10024211 Ga0207695_100242112 122
407 3300025913 Ga0207695_10060748 Ga0207695_100607485 122
408 3300025913 Ga0207695_10078136 Ga0207695_100781362 122
409 3300025913 Ga0207695_10119662 Ga0207695_101196622 122
410 3300025913 Ga0207695_10172634 Ga0207695_101726342 122
411 3300025913 Ga0207695_10196438 Ga0207695_101964381 122
412 3300025913 Ga0207695_10212441 Ga0207695_102124412 122
413 3300025913 Ga0207695_10216751 Ga0207695_102167512 122
414 3300025913 Ga0207695_10249836 Ga0207695_102498362 122
415 3300025913 Ga0207695_10264192 Ga0207695_102641922 122
416 3300025913 Ga0207695_10310842 Ga0207695_103108421 122
417 3300025913 Ga0207695_10646192 Ga0207695_106461922 122
418 3300025913 Ga0207695_10955910 Ga0207695_109559101 122
419 3300025913 Ga0207695_11224020 Ga0207695_112240202 122
420 3300025914 Ga0207671_10000831 Ga0207671_1000083111 122
421 3300025914 Ga0207671_10004503 Ga0207671_100045038 122
422 3300025914 Ga0207671_10004510 Ga0207671_100045105 122
423 3300025914 Ga0207671_10005083 Ga0207671_100050838 122
424 3300025914 Ga0207671_10019598 Ga0207671_100195986 122
425 3300025914 Ga0207671_10021131 Ga0207671_100211311 122
426 3300025914 Ga0207671_10074052 Ga0207671_100740522 122
427 3300025914 Ga0207671_10464045 Ga0207671_104640451 122
428 3300025917 Ga0207660_10011090 Ga0207660_100110902 122
429 3300025919 Ga0207657_10099781 Ga0207657_100997812 122
430 3300025919 Ga0207657_10107468 Ga0207657_101074682 122
431 3300025919 Ga0207657_10113819 Ga0207657_101138192 122
432 3300025919 Ga0207657_10210232 Ga0207657_102102322 122
433 3300025921 Ga0207652_10070876 Ga0207652_100708763 122
434 3300025921 Ga0207652_10244146 Ga0207652_102441462 122
435 3300025924 Ga0207694_10093844 Ga0207694_100938442 122
436 3300025924 Ga0207694_10328650 Ga0207694_103286502 122
437 3300025924 Ga0207694_11105958 Ga0207694_111059581 122
438 3300025926 Ga0207659_10809111 Ga0207659_108091111 122
439 3300025928 Ga0207700_10647102 Ga0207700_106471022 122
440 3300025931 Ga0207644_10000740 Ga0207644_100007409 122
441 3300025932 Ga0207690_10000594 Ga0207690_1000059415 122
442 3300025933 Ga0207706_10000430 Ga0207706_1000043040 122
443 3300025933 Ga0207706_10483716 Ga0207706_104837162 122
444 3300025934 Ga0207686_10175820 Ga0207686_101758202 122
445 3300025935 Ga0207709_10029111 Ga0207709_100291112 122
446 3300025937 Ga0207669_10037635 Ga0207669_100376352 122
447 3300025937 Ga0207669_10234446 Ga0207669_102344462 122
448 3300025938 Ga0207704_10000047 Ga0207704_100000478 122
449 3300025942 Ga0207689_10766391 Ga0207689_107663911 122
450 3300025944 Ga0207661_10137960 Ga0207661_101379602 122
451 3300025949 Ga0207667_10000009 Ga0207667_10000009380 122
452 3300025949 Ga0207667_10001021 Ga0207667_1000102122 122
453 3300025949 Ga0207667_10001079 Ga0207667_1000107944 122
454 3300025949 Ga0207667_10001338 Ga0207667_100013383 122
455 3300025949 Ga0207667_10008164 Ga0207667_100081646 122
456 3300025949 Ga0207667_10022759 Ga0207667_100227595 122
457 3300025949 Ga0207667_10030764 Ga0207667_100307643 122
458 3300025949 Ga0207667_10039676 Ga0207667_100396764 122
459 3300025949 Ga0207667_10044166 Ga0207667_100441663 122
460 3300025949 Ga0207667_10128350 Ga0207667_101283504 122
461 3300025949 Ga0207667_10172942 Ga0207667_101729422 122
462 3300025949 Ga0207667_10236982 Ga0207667_102369821 122
463 3300025949 Ga0207667_10354204 Ga0207667_103542042 122
464 3300025949 Ga0207667_10380169 Ga0207667_103801692 122
465 3300025949 Ga0207667_10392029 Ga0207667_103920292 122
466 3300025949 Ga0207667_10412436 Ga0207667_104124362 122
467 3300025949 Ga0207667_10497800 Ga0207667_104978002 122
468 3300025949 Ga0207667_10646480 Ga0207667_106464802 122
469 3300025960 Ga0207651_10053476 Ga0207651_100534762 122
470 3300025961 Ga0207712_10417928 Ga0207712_104179282 122
471 3300025981 Ga0207640_10110434 Ga0207640_101104342 122
472 3300025981 Ga0207640_10380135 Ga0207640_103801351 122
473 3300026023 Ga0207677_10058813 Ga0207677_100588132 122
474 3300026023 Ga0207677_10154998 Ga0207677_101549981 122
475 3300026041 Ga0207639_10007193 Ga0207639_100071934 122
476 3300026041 Ga0207639_10024734 Ga0207639_100247342 122
477 3300026041 Ga0207639_10034261 Ga0207639_100342612 122
478 3300026041 Ga0207639_10136018 Ga0207639_101360182 122
479 3300026041 Ga0207639_10176942 Ga0207639_101769422 122
480 3300026041 Ga0207639_10338931 Ga0207639_103389312 122
481 3300026041 Ga0207639_10489443 Ga0207639_104894432 122
482 3300026041 Ga0207639_10720285 Ga0207639_107202852 122
483 3300026041 Ga0207639_10873721 Ga0207639_108737212 122
484 3300026067 Ga0207678_10064250 Ga0207678_100642503 122
485 3300026078 Ga0207702_10008741 Ga0207702_100087419 122
486 3300026078 Ga0207702_10009173 Ga0207702_100091738 122
487 3300026078 Ga0207702_10012151 Ga0207702_100121518 122
488 3300026078 Ga0207702_10013063 Ga0207702_100130635 122
489 3300026078 Ga0207702_10197209 Ga0207702_101972092 122
490 3300026078 Ga0207702_10248953 Ga0207702_102489531 122
491 3300026078 Ga0207702_10256685 Ga0207702_102566852 122
492 3300026078 Ga0207702_10455319 Ga0207702_104553192 122
493 3300026078 Ga0207702_10846722 Ga0207702_108467222 122
494 3300026078 Ga0207702_11971821 Ga0207702_119718211 122
495 3300026088 Ga0207641_10839906 Ga0207641_108399061 122
496 3300026089 Ga0207648_10000458 Ga0207648_100004587 122
497 3300026116 Ga0207674_10080726 Ga0207674_100807262 122
498 3300026116 Ga0207674_10765722 Ga0207674_107657222 122
499 3300026121 Ga0207683_10192567 Ga0207683_101925672 122
500 3300026142 Ga0207698_10003112 Ga0207698_1000311210 122
501 3300026142 Ga0207698_10294071 Ga0207698_102940712 122
502 3300026142 Ga0207698_10611048 Ga0207698_106110482 122
503 3300028379 Ga0268266_10000121 Ga0268266_10000121147 122
504 3300028786 Ga0307517_10002529 Ga0307517_1000252921 122
505 3300028794 Ga0307515_10000077 Ga0307515_10000077109 122
506 3300028794 Ga0307515_10001997 Ga0307515_100019977 122
507 3300028794 Ga0307515_10002629 Ga0307515_1000262921 122
508 3300028800 Ga0265338_10038003 Ga0265338_100380032 122
509 3300028800 Ga0265338_10174071 Ga0265338_101740712 122
510 3300028800 Ga0265338_10417512 Ga0265338_104175122 122
511 3300029957 Ga0265324_10315157 Ga0265324_103151571 122
512 3300030732 Ga0316176_1020422 Ga0316176_10204225 122
513 3300030742 Ga0316183_1003890 Ga0316183_100389014 122
514 3300030744 Ga0316181_1007924 Ga0316181_10079241 122
515 3300030744 Ga0316181_1116089 Ga0316181_11160894 122
516 3300030745 Ga0316182_1021673 Ga0316182_10216731 122
517 3300031456 Ga0307513_10431555 Ga0307513_104315552 122
518 3300031507 Ga0307509_10056961 Ga0307509_100569612 122
519 3300031507 Ga0307509_10087936 Ga0307509_100879364 122
520 3300031507 Ga0307509_10219882 Ga0307509_102198822 122
521 3300031548 Ga0307408_100021295 Ga0307408_1000212952 122
522 3300031548 Ga0307408_100227339 Ga0307408_1002273392 122
523 3300031727 Ga0316576_10164522 Ga0316576_101645222 122
524 3300031728 Ga0316578_10471025 Ga0316578_104710252 122
525 3300031730 Ga0307516_10227260 Ga0307516_102272602 122
526 3300031731 Ga0307405_10000009 Ga0307405_10000009106 122
527 3300031731 Ga0307405_10001997 Ga0307405_100019972 122
528 3300031731 Ga0307405_10265964 Ga0307405_102659642 122
529 3300031903 Ga0307407_10000001 Ga0307407_10000001282 122
530 3300031911 Ga0307412_10000050 Ga0307412_1000005056 122
531 3300031911 Ga0307412_10071034 Ga0307412_100710342 122
532 3300031911 Ga0307412_10387013 Ga0307412_103870131 122
533 3300031911 Ga0307412_10399720 Ga0307412_103997202 122
534 3300031911 Ga0307412_10718646 Ga0307412_107186462 122
535 3300031911 Ga0307412_10846621 Ga0307412_108466212 122
536 3300031995 Ga0307409_100012342 Ga0307409_1000123424 122
537 3300032002 Ga0307416_100000008 Ga0307416_100000008107 122
538 3300032002 Ga0307416_103098278 Ga0307416_1030982781 122
539 3300032004 Ga0307414_10000344 Ga0307414_1000034415 122
540 3300032004 Ga0307414_10003900 Ga0307414_100039007 122
541 3300032004 Ga0307414_10010770 Ga0307414_100107703 122
542 3300032004 Ga0307414_10039887 Ga0307414_100398873 122
543 3300032004 Ga0307414_10183066 Ga0307414_101830662 122
544 3300032004 Ga0307414_10990803 Ga0307414_109908032 122
545 3300032004 Ga0307414_11225775 Ga0307414_112257751 122
546 3300032005 Ga0307411_10141374 Ga0307411_101413742 122
547 3300032139 Ga0316580_10098515 Ga0316580_100985152 122
548 3300033179 Ga0307507_10000313 Ga0307507_1000031324 122
549 3300033180 Ga0307510_10006887 Ga0307510_100068879 122
550 3300033180 Ga0307510_10536911 Ga0307510_105369111 122
551 3300035398 Ga0316574_0113941 Ga0316574_0113941_232_636 122
552 3300036712 Ga0316584_0091896 Ga0316584_0091896_717_1100 122
553 3300037312 Ga0395899_0000017 Ga0395899_0000017_78306_78680 122
554 3300037312 Ga0395899_0000024 Ga0395899_0000024_223760_224131 122
555 3300037312 Ga0395899_0000269 Ga0395899_0000269_32032_32403 122
556 3300037312 Ga0395899_0075951 Ga0395899_0075951_732_1103 122
557 3300037418 Ga0395900_0000140 Ga0395900_0000140_56647_57018 122
558 3300037418 Ga0395900_0000251 Ga0395900_0000251_34834_35205 122
559 3300037418 Ga0395900_0017469 Ga0395900_0017469_6051_6422 122
560 3300037466 Ga0395898_0002909 Ga0395898_0002909_14727_15098 122
561 3300037466 Ga0395898_1050121 Ga0395898_1050121_214_585 122
562 3300037471 Ga0395905_0000495 Ga0395905_0000495_17496_17867 122
563 3300037471 Ga0395905_0001502 Ga0395905_0001502_13330_13701 122
564 3300037471 Ga0395905_0998756 Ga0395905_0998756_21_392 122
565 3300038443 Ga0395901_0000145 Ga0395901_0000145_22294_22665 122
566 3300038443 Ga0395901_0001833 Ga0395901_0001833_7019_7390 122
567 3300038443 Ga0395901_0445701 Ga0395901_0445701_245_616 122
568 3300039447 Ga0436361_0109012 Ga0436361_0109012_4493_4864 122
569 3300041451 Ga0451791_0028699 Ga0451791_0028699_162_533 122
570 3300041452 Ga0451793_1139462 Ga0451793_1139462_244_615 122
571 3300041452 Ga0451793_1576126 Ga0451793_1576126_221_598 122
572 3300041459 Ga0451800_0740237 Ga0451800_0740237_261_638 122
573 3300041460 Ga0451802_1603469 Ga0451802_1603469_158_529 122
574 3300041463 Ga0451804_1040624 Ga0451804_1040624_200_577 122
575 3300041486 Ga0451807_2325405 Ga0451807_2325405_156_527 122
576 3300042005 Ga0439448_0035822 Ga0439448_0035822_1032_1403 122
577 3300042012 Ga0439455_0033159 Ga0439455_0033159_67_438 122
578 3300044656 Ga0466969_0085763 Ga0466969_0085763_527_898 122
579 3300044684 Ga0466966_0076649 Ga0466966_0076649_26_397 122
580 3300044693 Ga0466961_0043035 Ga0466961_0043035_851_1222 122
581 3300044693 Ga0466961_0147126 Ga0466961_0147126_279_650 122
582 3300044842 Ga0466957_0115623 Ga0466957_0115623_672_1043 122
583 3300046453 Ga0495627_032228 Ga0495627_032228_857_1234 122
584 3300046454 Ga0495592_0346473 Ga0495592_0346473_494_871 122
585 3300046459 Ga0495629_0032551 Ga0495629_0032551_1160_1531 122
586 3300046460 Ga0495638_0074162 Ga0495638_0074162_121_492 122
587 3300046460 Ga0495638_0413256 Ga0495638_0413256_238_615 122
588 3300046461 Ga0495641_0412686 Ga0495641_0412686_175_546 122
589 3300046462 Ga0495651_0086017 Ga0495651_0086017_1740_2111 122
590 3300046462 Ga0495651_0087100 Ga0495651_0087100_1635_2012 122
591 3300046462 Ga0495651_0113923 Ga0495651_0113923_171_548 122
592 3300046463 Ga0495653_0813181 Ga0495653_0813181_128_499 122
593 3300046471 Ga0495650_0000087 Ga0495650_0000087_47912_48289 122
594 3300046471 Ga0495650_0001198 Ga0495650_0001198_1724_2095 122
595 3300046471 Ga0495650_0047909 Ga0495650_0047909_414_791 122
596 3300046471 Ga0495650_0124812 Ga0495650_0124812_42_413 122
597 3300046471 Ga0495650_0143812 Ga0495650_0143812_406_777 122
598 3300046474 Ga0495605_0219130 Ga0495605_0219130_432_803 122
599 3300046492 Ga0495585_0000074 Ga0495585_0000074_84504_84875 122
600 3300046492 Ga0495585_0000286 Ga0495585_0000286_6907_7284 122
601 3300046492 Ga0495585_0000459 Ga0495585_0000459_15922_16293 122
602 3300046492 Ga0495585_0000667 Ga0495585_0000667_9561_9941 122
603 3300046500 Ga0495596_0262790 Ga0495596_0262790_143_514 122
604 3300046506 Ga0495583_0014434 Ga0495583_0014434_1038_1415 122
605 3300046506 Ga0495583_0080789 Ga0495583_0080789_795_1166 122
606 3300046506 Ga0495583_0287842 Ga0495583_0287842_35_406 122
607 3300046506 Ga0495583_0442151 Ga0495583_0442151_53_424 122
608 3300046507 Ga0495606_0000052 Ga0495606_0000052_148086_148463 122
609 3300046507 Ga0495606_0000425 Ga0495606_0000425_22562_22933 122
610 3300046507 Ga0495606_0004916 Ga0495606_0004916_7154_7525 122
611 3300046507 Ga0495606_0007070 Ga0495606_0007070_6212_6583 122
612 3300046507 Ga0495606_0012011 Ga0495606_0012011_4951_5322 122
613 3300046507 Ga0495606_0017553 Ga0495606_0017553_161_535 122
614 3300046507 Ga0495606_0034004 Ga0495606_0034004_3042_3419 122
615 3300046507 Ga0495606_0054447 Ga0495606_0054447_1449_1820 122
616 3300046507 Ga0495606_0079573 Ga0495606_0079573_1410_1781 122
617 3300046507 Ga0495606_0173258 Ga0495606_0173258_208_579 122
618 3300046507 Ga0495606_0241869 Ga0495606_0241869_499_870 122
619 3300046507 Ga0495606_0652391 Ga0495606_0652391_36_416 122
620 3300046511 Ga0495608_0444649 Ga0495608_0444649_145_516 122
621 3300046512 Ga0495610_0000076 Ga0495610_0000076_31880_32257 122
622 3300046512 Ga0495610_0003649 Ga0495610_0003649_3032_3409 122
623 3300046512 Ga0495610_0003743 Ga0495610_0003743_6074_6445 122
624 3300046512 Ga0495610_0004136 Ga0495610_0004136_7193_7570 122
625 3300046512 Ga0495610_0075747 Ga0495610_0075747_410_787 122
626 3300046513 Ga0495616_0001116 Ga0495616_0001116_15432_15803 122
627 3300046513 Ga0495616_0001648 Ga0495616_0001648_4567_4938 122
628 3300046513 Ga0495616_0068364 Ga0495616_0068364_1222_1599 122
629 3300046513 Ga0495616_0294034 Ga0495616_0294034_14_385 122
630 3300046514 Ga0495618_0258111 Ga0495618_0258111_564_941 122
631 3300046514 Ga0495618_0516939 Ga0495618_0516939_337_708 122
632 3300046517 Ga0495630_1391422 Ga0495630_1391422_112_483 122
633 3300046518 Ga0495631_0021927 Ga0495631_0021927_754_1125 122
634 3300046518 Ga0495631_0112999 Ga0495631_0112999_234_605 122
635 3300046518 Ga0495631_0413309 Ga0495631_0413309_17_394 122
636 3300046520 Ga0495637_0030977 Ga0495637_0030977_814_1191 122
637 3300046520 Ga0495637_0125162 Ga0495637_0125162_86_457 122
638 3300046523 Ga0495644_0007953 Ga0495644_0007953_3028_3399 122
639 3300046524 Ga0495648_0001585 Ga0495648_0001585_20957_21328 122
640 3300046524 Ga0495648_0013724 Ga0495648_0013724_4095_4475 122
641 3300046525 Ga0495663_0164223 Ga0495663_0164223_220_591 122
642 3300046529 Ga0495652_0054934 Ga0495652_0054934_12_392 122
643 3300046529 Ga0495652_0095063 Ga0495652_0095063_1339_1710 122
644 3300046529 Ga0495652_0296456 Ga0495652_0296456_237_614 122
645 3300046529 Ga0495652_0643047 Ga0495652_0643047_178_555 122
646 3300046530 Ga0495654_0214572 Ga0495654_0214572_34_405 122
647 3300046538 Ga0495609_0019281 Ga0495609_0019281_1573_1953 122
648 3300046538 Ga0495609_0055155 Ga0495609_0055155_607_978 122
649 3300046538 Ga0495609_0121490 Ga0495609_0121490_138_515 122
650 3300046538 Ga0495609_0219883 Ga0495609_0219883_260_631 122
651 3300046557 Ga0495622_0177406 Ga0495622_0177406_301_681 122
652 3300046557 Ga0495622_0218419 Ga0495622_0218419_137_508 122
653 3300046557 Ga0495622_0391432 Ga0495622_0391432_105_476 122
654 3300046558 Ga0495633_0000004 Ga0495633_0000004_241680_242051 122
655 3300046558 Ga0495633_0000035 Ga0495633_0000035_156155_156535 122
656 3300046558 Ga0495633_0001552 Ga0495633_0001552_12283_12654 122
657 3300046558 Ga0495633_0009741 Ga0495633_0009741_3783_4160 122
658 3300046558 Ga0495633_0158588 Ga0495633_0158588_505_882 122
659 3300046616 Ga0495668_0000032 Ga0495668_0000032_38288_38668 122
660 3300046616 Ga0495668_0000121 Ga0495668_0000121_81135_81506 122
661 3300046616 Ga0495668_0137256 Ga0495668_0137256_66_437 122
662 3300046642 Ga0495634_0388302 Ga0495634_0388302_277_648 122
663 3300046660 Ga0495625_0000008 Ga0495625_0000008_512279_512656 122
664 3300046660 Ga0495625_0000067 Ga0495625_0000067_120293_120664 122
665 3300046660 Ga0495625_0000981 Ga0495625_0000981_26381_26761 122
666 3300046660 Ga0495625_0001612 Ga0495625_0001612_3587_3958 122
667 3300046660 Ga0495625_0007910 Ga0495625_0007910_1350_1721 122
668 3300046660 Ga0495625_0010659 Ga0495625_0010659_2625_2996 122
669 3300046660 Ga0495625_0043150 Ga0495625_0043150_2009_2380 122
670 3300046660 Ga0495625_0068042 Ga0495625_0068042_1953_2324 122
671 3300046660 Ga0495625_0154408 Ga0495625_0154408_1124_1501 122
672 3300046660 Ga0495625_0265137 Ga0495625_0265137_485_856 122
673 3300046660 Ga0495625_0271939 Ga0495625_0271939_192_563 122
674 3300046660 Ga0495625_0470086 Ga0495625_0470086_218_592 122
675 3300046660 Ga0495625_0683373 Ga0495625_0683373_176_550 122
676 3300046665 Ga0495661_0002168 Ga0495661_0002168_771_1148 122
677 3300046665 Ga0495661_0002273 Ga0495661_0002273_9574_9945 122
678 3300046665 Ga0495661_0036794 Ga0495661_0036794_633_1010 122
679 3300046674 Ga0495588_0671152 Ga0495588_0671152_101_472 122
680 3300046684 Ga0495669_0664701 Ga0495669_0664701_108_479 122
681 3300046691 Ga0495670_0181618 Ga0495670_0181618_206_577 122
682 3300046691 Ga0495670_0386267 Ga0495670_0386267_185_565 122
683 3300046691 Ga0495670_0403051 Ga0495670_0403051_175_546 122
684 3300046692 Ga0495671_0314576 Ga0495671_0314576_36_413 122
685 3300046694 Ga0495649_0000018 Ga0495649_0000018_23510_23887 122
686 3300046694 Ga0495649_0000135 Ga0495649_0000135_50780_51151 122
687 3300046694 Ga0495649_0196926 Ga0495649_0196926_419_790 122
688 3300046794 Ga0495589_0134693 Ga0495589_0134693_207_584 122
689 3300046809 Ga0495600_0607541 Ga0495600_0607541_262_633 122
690 3300046810 Ga0495660_0003458 Ga0495660_0003458_6545_6916 122
691 3300046810 Ga0495660_0080602 Ga0495660_0080602_581_952 122
692 3300046810 Ga0495660_0208623 Ga0495660_0208623_282_662 122
693 3300047321 Ga0495676_0630359 Ga0495676_0630359_219_590 122
694 3300047323 Ga0495683_0145406 Ga0495683_0145406_44_415 122
695 3300047323 Ga0495683_0222892 Ga0495683_0222892_167_538 122
696 3300047443 Ga0495687_001763 Ga0495687_001763_16405_16782 122
697 3300047443 Ga0495687_003533 Ga0495687_003533_9720_10091 122
698 3300047443 Ga0495687_066582 Ga0495687_066582_825_1196 122
699 3300047469 Ga0495673_0032422 Ga0495673_0032422_1971_2342 122
700 3300047469 Ga0495673_0067119 Ga0495673_0067119_1105_1482 122
701 3300047470 Ga0495681_0292594 Ga0495681_0292594_150_521 122
702 3300047472 Ga0495686_0000917 Ga0495686_0000917_28898_29269 122
703 3300047472 Ga0495686_0001013 Ga0495686_0001013_23832_24203 122
704 3300047472 Ga0495686_0075162 Ga0495686_0075162_248_619 122
705 3300047472 Ga0495686_0320790 Ga0495686_0320790_444_821 122
706 3300047472 Ga0495686_0343957 Ga0495686_0343957_126_497 122
707 3300047472 Ga0495686_0409552 Ga0495686_0409552_67_444 122
708 3300048089 Ga0495614_0080811 Ga0495614_0080811_995_1375 122
709 3300048089 Ga0495614_0094542 Ga0495614_0094542_409_780 122
710 3300048918 Ga0496115_0017027 Ga0496115_0017027_4762_5139 122
711 3300048925 Ga0496122_0004298 Ga0496122_0004298_1036_1413 122
712 3300048926 Ga0496123_0005429 Ga0496123_0005429_9378_9755 122
713 3300048929 Ga0496126_0491415 Ga0496126_0491415_596_967 122
714 3300049459 Ga0495678_014483 Ga0495678_014483_1261_1632 122
715 3300049460 Ga0495682_0025629 Ga0495682_0025629_1450_1821 122
716 3300049661 Ga0501217_067965 Ga0501217_067965_536_910 122
717 3300049663 Ga0501223_000212 Ga0501223_000212_2301_2672 122
718 3300049679 Ga0501249_020121 Ga0501249_020121_354_728 122
719 3300049688 Ga0501259_093574 Ga0501259_093574_280_651 122
720 3300049705 Ga0501225_0017101 Ga0501225_0017101_563_937 122
721 3300049758 Ga0501241_039094 Ga0501241_039094_214_591 122
722 3300049776 Ga0501280_040265 Ga0501280_040265_31_408 122
723 3300049822 Ga0501035_0932891 Ga0501035_0932891_71_448 122
724 3300050493 nmdc:mga0k408_102938_c1 nmdc:mga0k408_102938_c1_1137_1511 122
725 3300050493 nmdc:mga0k408_194544_c1 nmdc:mga0k408_194544_c1_71_448 122
726 3300050493 nmdc:mga0k408_3098_c2 nmdc:mga0k408_3098_c2_5222_5593 122
727 3300050493 nmdc:mga0k408_623754_c1 nmdc:mga0k408_623754_c1_225_596 122
728 3300050493 nmdc:mga0k408_65_c1 nmdc:mga0k408_65_c1_20142_20513 122
729 3300050493 nmdc:mga0k408_715_c2 nmdc:mga0k408_715_c2_8554_8925 122
730 3300050493 nmdc:mga0k408_979_c1 nmdc:mga0k408_979_c1_415_795 122
731 3300050493 nmdc:mga0k408_99634_c1 nmdc:mga0k408_99634_c1_721_1098 122
732 3300050496 nmdc:mga07m45_460920_c1 nmdc:mga07m45_460920_c1_138_509 122
733 3300050516 nmdc:mga0sz30_557791_c1 nmdc:mga0sz30_557791_c1_35_406 122
734 3300053080 Ga0500635_0002950 Ga0500635_0002950_2872_3243 122
735 3300053093 Ga0500651_0000350 Ga0500651_0000350_10271_10648 122
736 3300053094 Ga0500566_0221536 Ga0500566_0221536_262_639 122
737 3300053098 Ga0500650_0224623 Ga0500650_0224623_291_662 122
738 3300053098 Ga0500650_0251840 Ga0500650_0251840_234_605 122
739 3300053118 Ga0500594_0038912 Ga0500594_0038912_627_998 122
740 3300053122 Ga0500608_000297 Ga0500608_000297_17711_18082 122
741 3300053122 Ga0500608_060695 Ga0500608_060695_76_447 122
742 3300053123 Ga0500614_007956 Ga0500614_007956_1407_1778 122
743 3300053123 Ga0500614_061382 Ga0500614_061382_407_787 122
744 3300053125 Ga0500618_000033 Ga0500618_000033_29335_29706 122
745 3300053125 Ga0500618_000037 Ga0500618_000037_39467_39847 122
746 3300053125 Ga0500618_016551 Ga0500618_016551_1228_1605 122
747 3300053138 Ga0500564_112304 Ga0500564_112304_709_1086 122
748 3300053139 Ga0500568_0038399 Ga0500568_0038399_487_864 122
749 3300053153 Ga0500616_0034972 Ga0500616_0034972_1637_2014 122
750 3300053154 Ga0500619_170958 Ga0500619_170958_108_485 122
751 3300053156 Ga0500622_0000175 Ga0500622_0000175_65948_66319 122
752 3300053156 Ga0500622_0240133 Ga0500622_0240133_256_633 122
753 3300053157 Ga0500624_000481 Ga0500624_000481_686_1057 122
754 3300053157 Ga0500624_003615 Ga0500624_003615_1322_1699 122
755 3300053160 Ga0500633_0310796 Ga0500633_0310796_130_510 122
756 3300053161 Ga0500634_0019483 Ga0500634_0019483_1760_2131 122
757 3300053730 Ga0500645_178024 Ga0500645_178024_91_462 122
758 iso_pu_bacteria 2585427687 2586211122 122
759 iso_pu_bacteria 2818991437 2819547473 122
760 iso_pu_bacteria 2945997725 2946003204 122
761 iso_pu_bacteria 2954016120 2954020061 122

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03965

Penicillinase_R

Penicillinase repressor

9

122

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1r22-assembly1.cif.gz_B crystal structure of the cyanobacterial metallothionein repressor smtb (c14s/c61s/c121s mutant) in the zn2alpha5-form 0.8721 7 68
7ne9-assembly1.cif.gz_DDD a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8718 4 68
7ne9-assembly1.cif.gz_CCC a single sensor controls large variations in zinc quotas in a marine cyanobacterium 0.8652 4 68
2fe3-assembly1.cif.gz_B the crystal structure of bacillus subtilis perr-zn reveals a novel zn(cys)4 structural redox switch 0.8568 5 70
1p6r-assembly1.cif.gz_A solution structure of the dna binding domain of the repressor blai. 0.8348 2 75
ID Description Score Start End Superfamily
4kmfA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9316 10 69 1.10.10.10
af_Q57824_147_206_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9011 6 67 1.10.10.10
af_Q58184_329_408_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8985 5 69 1.10.10.10
4lb5B00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8939 9 70 1.10.10.10
1saxB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8778 7 69 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A1F3P524-F1-model_v4 Transcriptional regulator 0.9798 4 82 GO:0003677
GO:0005737
GO:0045892
AF-H1DIA1-F1-model_v4 Penicillinase repressor 0.9757 4 76 GO:0003677
GO:0005737
GO:0045892
AF-A0A7J7AZU7-F1-model_v4 deleted 0.9754 4 80
AF-A0A7C6AW35-F1-model_v4 BlaI/MecI/CopY family transcriptional regulator 0.9634 4 91 GO:0003677
GO:0005737
GO:0045892
AF-A0A359G5H8-F1-model_v4 Transcriptional regulator 0.9628 2 91 GO:0003677
GO:0005737
GO:0045892

Feature Viewer

pLDDT pTM Quality
87.46 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map