F479571
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 761 | 405 | 761 | 59 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10500555|Ga0099794_105005552 |
| Length | 69 |
| Sequence | VNAMSLGTSLEMSLGPYASFIVTAYLAATVVVAVLIAWIAIDYRSQTHRLRALDESGVVRRSGRGATEL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 2 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 3 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 4 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 5 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 26 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 30 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 33 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 41 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 42 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 43 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 45 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 46 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 47 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 48 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 49 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 50 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 51 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 52 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 53 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 54 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 55 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 63 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 64 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 71 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 85 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 100 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 101 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 104 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 105 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 106 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 107 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 108 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 109 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 151 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 152 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 154 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 155 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 156 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 157 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 158 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 159 | 3300031889 | Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO | Metagenome | Rhizosphere |
| 160 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 161 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 162 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 163 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 164 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 165 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 166 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 167 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 168 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 169 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 170 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 171 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 172 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 175 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 176 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 178 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 180 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 181 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 182 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 183 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 185 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 188 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 189 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 190 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 191 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 192 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 193 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 194 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 195 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 196 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 197 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 198 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 199 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 200 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 201 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 202 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 203 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 204 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 205 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 206 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 207 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 208 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 209 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 292 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 293 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 294 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 295 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 296 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 297 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 299 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 300 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 301 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 302 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 303 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 304 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 305 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 306 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 307 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 308 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 309 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 310 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 311 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 312 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 313 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 314 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 315 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 316 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 320 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 321 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 322 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 325 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 327 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 329 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 335 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 336 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 339 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 341 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 342 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 343 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 344 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 345 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 346 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 347 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 348 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 349 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 350 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 351 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 354 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 357 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 358 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 359 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 360 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 361 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 362 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 363 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 364 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 365 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 366 | 3300053099 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere | Metagenome | Endosphere |
| 367 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 368 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 369 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 370 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 371 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 372 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 373 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 374 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 375 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 376 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 377 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 378 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 379 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 380 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 381 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 382 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 383 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 384 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 385 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 386 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 387 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 388 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 389 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 390 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 391 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 392 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 393 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 394 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 395 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 396 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 397 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 398 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 399 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 400 | 3300053723 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere | Metagenome | Endosphere |
| 401 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 402 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 403 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 404 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 405 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.34 |
| Metatranscriptomes | 0.66 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.27 |
| Nodule | 0 |
| Rhizoplane | 5.12 |
| Rhizosphere | 76.35 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.26 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25153J46596_10008562 | 3300003215 | Bacteria | 4875 |
| 2 | JGI25404J52841_10028662 | 3300003659 | Bacteria | 1195 |
| 3 | JGI25404J52841_10058670 | 3300003659 | Bacteria | 807 |
| 4 | Ga0055542_1013126 | 3300003762 | Bacteria | 1404 |
| 5 | Ga0055529_1028398 | 3300003763 | Bacteria | 689 |
| 6 | Ga0070658_11080274 | 3300005327 | Bacteria | 698 |
| 7 | Ga0070683_100037044 | 3300005329 | Bacteria | 4464 |
| 8 | Ga0070677_10759471 | 3300005333 | Bacteria | 551 |
| 9 | Ga0070680_100117410 | 3300005336 | Bacteria | 2218 |
| 10 | Ga0070680_100140998 | 3300005336 | Bacteria | 2021 |
| 11 | Ga0070680_100590734 | 3300005336 | Bacteria | 953 |
| 12 | Ga0070680_101253046 | 3300005336 | Bacteria | 642 |
| 13 | Ga0070682_100084056 | 3300005337 | Bacteria | 2067 |
| 14 | Ga0070682_100623510 | 3300005337 | Bacteria | 855 |
| 15 | Ga0070682_101443476 | 3300005337 | Bacteria | 590 |
| 16 | Ga0070660_100158914 | 3300005339 | Bacteria | 1820 |
| 17 | Ga0070689_101611093 | 3300005340 | Bacteria | 590 |
| 18 | Ga0070691_10082325 | 3300005341 | Bacteria | 1578 |
| 19 | Ga0070691_10341589 | 3300005341 | Bacteria | 829 |
| 20 | Ga0070691_10911095 | 3300005341 | Bacteria | 543 |
| 21 | Ga0070661_100037794 | 3300005344 | Bacteria | 3513 |
| 22 | Ga0070661_100821582 | 3300005344 | Bacteria | 764 |
| 23 | Ga0070668_100301498 | 3300005347 | Bacteria | 1344 |
| 24 | Ga0070668_101898410 | 3300005347 | Bacteria | 548 |
| 25 | Ga0070671_100127930 | 3300005355 | Bacteria | 2139 |
| 26 | Ga0070674_100362098 | 3300005356 | Bacteria | 1175 |
| 27 | Ga0070674_100746463 | 3300005356 | Bacteria | 841 |
| 28 | Ga0070714_100070525 | 3300005435 | Bacteria | 3021 |
| 29 | Ga0070714_100739113 | 3300005435 | Bacteria | 951 |
| 30 | Ga0070714_100971817 | 3300005435 | Bacteria | 826 |
| 31 | Ga0070713_100037902 | 3300005436 | Bacteria | 3901 |
| 32 | Ga0070713_100235418 | 3300005436 | Bacteria | 1666 |
| 33 | Ga0070710_10646984 | 3300005437 | Bacteria | 741 |
| 34 | Ga0070710_11394923 | 3300005437 | Bacteria | 524 |
| 35 | Ga0070710_11429009 | 3300005437 | Bacteria | 518 |
| 36 | Ga0070711_100004422 | 3300005439 | Bacteria | 8294 |
| 37 | Ga0070711_100013801 | 3300005439 | Bacteria | 5081 |
| 38 | Ga0070711_100585970 | 3300005439 | Bacteria | 929 |
| 39 | Ga0070711_101045403 | 3300005439 | Bacteria | 702 |
| 40 | Ga0070711_101611461 | 3300005439 | Bacteria | 568 |
| 41 | Ga0070700_101911325 | 3300005441 | Bacteria | 513 |
| 42 | Ga0070663_100034129 | 3300005455 | Bacteria | 3521 |
| 43 | Ga0070663_100255829 | 3300005455 | Bacteria | 1387 |
| 44 | Ga0070663_100399998 | 3300005455 | Bacteria | 1122 |
| 45 | Ga0070663_100427434 | 3300005455 | Bacteria | 1088 |
| 46 | Ga0070663_100662746 | 3300005455 | Bacteria | 884 |
| 47 | Ga0070663_100907133 | 3300005455 | Bacteria | 761 |
| 48 | Ga0070678_100118683 | 3300005456 | Bacteria | 2082 |
| 49 | Ga0070678_102212541 | 3300005456 | Bacteria | 521 |
| 50 | Ga0070681_10001077 | 3300005458 | Bacteria | 23275 |
| 51 | Ga0070681_10067755 | 3300005458 | Bacteria | 3537 |
| 52 | Ga0070681_10138614 | 3300005458 | Bacteria | 2362 |
| 53 | Ga0070681_10202596 | 3300005458 | Bacteria | 1902 |
| 54 | Ga0068867_100443955 | 3300005459 | Bacteria | 1104 |
| 55 | Ga0070685_11001738 | 3300005466 | Bacteria | 627 |
| 56 | Ga0070706_101350705 | 3300005467 | Bacteria | 653 |
| 57 | Ga0070699_101360571 | 3300005518 | Bacteria | 651 |
| 58 | Ga0070679_100074727 | 3300005530 | Bacteria | 3379 |
| 59 | Ga0070679_100137816 | 3300005530 | Bacteria | 2421 |
| 60 | Ga0070679_100210300 | 3300005530 | Bacteria | 1909 |
| 61 | Ga0070679_101845088 | 3300005530 | Bacteria | 553 |
| 62 | Ga0070679_102041598 | 3300005530 | Bacteria | 522 |
| 63 | Ga0070684_100014169 | 3300005535 | Bacteria | 6449 |
| 64 | Ga0070684_100062962 | 3300005535 | Bacteria | 3250 |
| 65 | Ga0070684_100134499 | 3300005535 | Bacteria | 2232 |
| 66 | Ga0070684_100258132 | 3300005535 | Bacteria | 1594 |
| 67 | Ga0070697_100932647 | 3300005536 | Bacteria | 771 |
| 68 | Ga0070697_101244284 | 3300005536 | Bacteria | 664 |
| 69 | Ga0068853_100050798 | 3300005539 | Bacteria | 3567 |
| 70 | Ga0068853_100738271 | 3300005539 | Bacteria | 940 |
| 71 | Ga0068853_100894012 | 3300005539 | Bacteria | 853 |
| 72 | Ga0068853_100991068 | 3300005539 | Bacteria | 809 |
| 73 | Ga0070672_100626023 | 3300005543 | Bacteria | 939 |
| 74 | Ga0070695_101341023 | 3300005545 | Bacteria | 592 |
| 75 | Ga0070696_101648826 | 3300005546 | Bacteria | 552 |
| 76 | Ga0070693_100155781 | 3300005547 | Bacteria | 1451 |
| 77 | Ga0070665_100113166 | 3300005548 | Bacteria | 2716 |
| 78 | Ga0070665_101238078 | 3300005548 | Bacteria | 757 |
| 79 | Ga0070665_101508950 | 3300005548 | Bacteria | 680 |
| 80 | Ga0068855_100234941 | 3300005563 | Bacteria | 2050 |
| 81 | Ga0068855_100325036 | 3300005563 | Bacteria | 1699 |
| 82 | Ga0070664_100337346 | 3300005564 | Bacteria | 1368 |
| 83 | Ga0070664_100701948 | 3300005564 | Bacteria | 943 |
| 84 | Ga0070664_100794046 | 3300005564 | Bacteria | 885 |
| 85 | Ga0070664_101071009 | 3300005564 | Bacteria | 759 |
| 86 | Ga0068857_100033406 | 3300005577 | Bacteria | 4550 |
| 87 | Ga0068857_100278299 | 3300005577 | Bacteria | 1539 |
| 88 | Ga0068857_100484269 | 3300005577 | Bacteria | 1160 |
| 89 | Ga0068854_100446137 | 3300005578 | Bacteria | 1080 |
| 90 | Ga0068854_100733195 | 3300005578 | Bacteria | 856 |
| 91 | Ga0068854_101365078 | 3300005578 | Bacteria | 640 |
| 92 | Ga0068856_100000883 | 3300005614 | Bacteria | 32112 |
| 93 | Ga0068856_100185359 | 3300005614 | Bacteria | 2095 |
| 94 | Ga0068856_102130367 | 3300005614 | Bacteria | 570 |
| 95 | Ga0068856_102155659 | 3300005614 | Bacteria | 567 |
| 96 | Ga0070702_100771141 | 3300005615 | Bacteria | 741 |
| 97 | Ga0068852_100137945 | 3300005616 | Bacteria | 2254 |
| 98 | Ga0068852_101144966 | 3300005616 | Bacteria | 799 |
| 99 | Ga0068852_101236745 | 3300005616 | Bacteria | 768 |
| 100 | Ga0068864_100697192 | 3300005618 | Bacteria | 992 |
| 101 | Ga0068866_11170866 | 3300005718 | Bacteria | 554 |
| 102 | Ga0068861_100102538 | 3300005719 | Bacteria | 2278 |
| 103 | Ga0068851_10030531 | 3300005834 | Bacteria | 2673 |
| 104 | Ga0068851_10272978 | 3300005834 | Bacteria | 965 |
| 105 | Ga0068863_100609883 | 3300005841 | Bacteria | 1081 |
| 106 | Ga0068858_102225665 | 3300005842 | Bacteria | 542 |
| 107 | Ga0068860_100302277 | 3300005843 | Bacteria | 1568 |
| 108 | Ga0081455_10050780 | 3300005937 | Bacteria | 3563 |
| 109 | Ga0081540_1005580 | 3300005983 | Bacteria | 9369 |
| 110 | Ga0081540_1011553 | 3300005983 | Bacteria | 5898 |
| 111 | Ga0081540_1036340 | 3300005983 | Bacteria | 2628 |
| 112 | Ga0081539_10031076 | 3300005985 | Bacteria | 3299 |
| 113 | Ga0070717_10010596 | 3300006028 | Bacteria | 6965 |
| 114 | Ga0070717_10707160 | 3300006028 | Bacteria | 915 |
| 115 | Ga0070717_10973001 | 3300006028 | Bacteria | 773 |
| 116 | Ga0075365_10043435 | 3300006038 | Bacteria | 2942 |
| 117 | Ga0075365_10337527 | 3300006038 | Bacteria | 1062 |
| 118 | Ga0075365_10395277 | 3300006038 | Bacteria | 975 |
| 119 | Ga0075365_10649289 | 3300006038 | Bacteria | 746 |
| 120 | Ga0075363_100114480 | 3300006048 | Bacteria | 1501 |
| 121 | Ga0075363_100246140 | 3300006048 | Bacteria | 1029 |
| 122 | Ga0075364_10099785 | 3300006051 | Bacteria | 1933 |
| 123 | Ga0075364_10669110 | 3300006051 | Bacteria | 709 |
| 124 | Ga0075364_10695549 | 3300006051 | Bacteria | 694 |
| 125 | Ga0075364_11132101 | 3300006051 | Bacteria | 531 |
| 126 | Ga0070715_10114301 | 3300006163 | Bacteria | 1278 |
| 127 | Ga0070716_100636588 | 3300006173 | Bacteria | 807 |
| 128 | Ga0070716_100815104 | 3300006173 | Bacteria | 724 |
| 129 | Ga0070716_101249910 | 3300006173 | Bacteria | 598 |
| 130 | Ga0070716_101526249 | 3300006173 | Bacteria | 547 |
| 131 | Ga0070712_100069559 | 3300006175 | Bacteria | 2511 |
| 132 | Ga0070712_100169236 | 3300006175 | Bacteria | 1694 |
| 133 | Ga0070712_100973289 | 3300006175 | Bacteria | 733 |
| 134 | Ga0070712_101093769 | 3300006175 | Bacteria | 692 |
| 135 | Ga0075362_10638160 | 3300006177 | Bacteria | 552 |
| 136 | Ga0075367_10088967 | 3300006178 | Bacteria | 1877 |
| 137 | Ga0075369_10172646 | 3300006186 | Bacteria | 993 |
| 138 | Ga0097621_101076806 | 3300006237 | Bacteria | 754 |
| 139 | Ga0097621_101125780 | 3300006237 | Bacteria | 738 |
| 140 | Ga0097621_101735319 | 3300006237 | Bacteria | 595 |
| 141 | Ga0097621_102389613 | 3300006237 | Bacteria | 506 |
| 142 | Ga0075370_10141709 | 3300006353 | Bacteria | 1405 |
| 143 | Ga0075370_10269892 | 3300006353 | Bacteria | 1010 |
| 144 | Ga0075370_10411781 | 3300006353 | Bacteria | 812 |
| 145 | Ga0068871_100989737 | 3300006358 | Bacteria | 783 |
| 146 | Ga0075433_11306457 | 3300006852 | Bacteria | 628 |
| 147 | Ga0075434_100106463 | 3300006871 | Bacteria | 2814 |
| 148 | Ga0075429_100129121 | 3300006880 | Bacteria | 2211 |
| 149 | Ga0068865_100649218 | 3300006881 | Bacteria | 897 |
| 150 | Ga0075435_100017556 | 3300007076 | Bacteria | 5420 |
| 151 | Ga0075435_100250082 | 3300007076 | Bacteria | 1509 |
| 152 | Ga0099794_10500555 | 3300007265 | Bacteria | 639 |
| 153 | Ga0105250_10131028 | 3300009092 | Bacteria | 1035 |
| 154 | Ga0105240_10082975 | 3300009093 | Bacteria | 3935 |
| 155 | Ga0105240_10103958 | 3300009093 | Bacteria | 3449 |
| 156 | Ga0105240_11261316 | 3300009093 | Bacteria | 781 |
| 157 | Ga0105247_10422786 | 3300009101 | Bacteria | 954 |
| 158 | Ga0105247_10464656 | 3300009101 | Bacteria | 915 |
| 159 | Ga0105243_10807452 | 3300009148 | Bacteria | 925 |
| 160 | Ga0105243_11357155 | 3300009148 | Bacteria | 730 |
| 161 | Ga0105243_11410672 | 3300009148 | Bacteria | 717 |
| 162 | Ga0105241_10345784 | 3300009174 | Bacteria | 1290 |
| 163 | Ga0105242_10991626 | 3300009176 | Bacteria | 847 |
| 164 | Ga0105248_10374595 | 3300009177 | Bacteria | 1603 |
| 165 | Ga0105248_11283825 | 3300009177 | Bacteria | 828 |
| 166 | Ga0105237_10035449 | 3300009545 | Bacteria | 5049 |
| 167 | Ga0105237_10251441 | 3300009545 | Bacteria | 1770 |
| 168 | Ga0105237_10255792 | 3300009545 | Bacteria | 1753 |
| 169 | Ga0105237_10383874 | 3300009545 | Bacteria | 1410 |
| 170 | Ga0105237_11925135 | 3300009545 | Bacteria | 599 |
| 171 | Ga0105238_10055393 | 3300009551 | Bacteria | 3980 |
| 172 | Ga0105238_10224258 | 3300009551 | Bacteria | 1856 |
| 173 | Ga0105238_11142189 | 3300009551 | Bacteria | 802 |
| 174 | Ga0105238_11728046 | 3300009551 | Bacteria | 657 |
| 175 | Ga0105238_12403090 | 3300009551 | Bacteria | 563 |
| 176 | Ga0105249_10120137 | 3300009553 | Bacteria | 2496 |
| 177 | Ga0105249_12278030 | 3300009553 | Bacteria | 614 |
| 178 | Ga0099796_10313878 | 3300010159 | Bacteria | 667 |
| 179 | Ga0105239_10149716 | 3300010375 | Bacteria | 2604 |
| 180 | Ga0105239_10957711 | 3300010375 | Bacteria | 983 |
| 181 | Ga0105239_10983446 | 3300010375 | Bacteria | 970 |
| 182 | Ga0105239_13161928 | 3300010375 | Bacteria | 536 |
| 183 | Ga0157319_1008774 | 3300012497 | Bacteria | 781 |
| 184 | Ga0157370_10448664 | 3300013104 | Bacteria | 1186 |
| 185 | Ga0157370_11422785 | 3300013104 | Bacteria | 624 |
| 186 | Ga0157370_11719075 | 3300013104 | Bacteria | 563 |
| 187 | Ga0157369_10002556 | 3300013105 | Bacteria | 21777 |
| 188 | Ga0157369_10096664 | 3300013105 | Bacteria | 3151 |
| 189 | Ga0157369_10690186 | 3300013105 | Bacteria | 1052 |
| 190 | Ga0157369_12547113 | 3300013105 | Bacteria | 518 |
| 191 | Ga0157378_10676467 | 3300013297 | Bacteria | 1050 |
| 192 | Ga0157378_11512605 | 3300013297 | Bacteria | 716 |
| 193 | Ga0163162_10208356 | 3300013306 | Bacteria | 2084 |
| 194 | Ga0163162_11968248 | 3300013306 | Bacteria | 669 |
| 195 | Ga0157372_10931208 | 3300013307 | Bacteria | 1007 |
| 196 | Ga0157375_11203541 | 3300013308 | Bacteria | 889 |
| 197 | Ga0163163_13340787 | 3300014325 | Bacteria | 500 |
| 198 | Ga0157380_10409237 | 3300014326 | Bacteria | 1290 |
| 199 | Ga0182008_10107413 | 3300014497 | Bacteria | 1381 |
| 200 | Ga0157379_11985808 | 3300014968 | Bacteria | 575 |
| 201 | Ga0157376_11476046 | 3300014969 | Bacteria | 713 |
| 202 | Ga0157376_12221419 | 3300014969 | Bacteria | 588 |
| 203 | Ga0157376_12340798 | 3300014969 | Bacteria | 573 |
| 204 | Ga0157376_12882820 | 3300014969 | Bacteria | 520 |
| 205 | Ga0163161_10343350 | 3300017792 | Bacteria | 1185 |
| 206 | Ga0197907_10041262 | 3300020069 | Bacteria | 989 |
| 207 | Ga0206356_10043115 | 3300020070 | Bacteria | 971 |
| 208 | Ga0206354_10901948 | 3300020081 | Bacteria | 1519 |
| 209 | Ga0206353_10873863 | 3300020082 | Bacteria | 639 |
| 210 | Ga0213872_10102891 | 3300021361 | Bacteria | 1272 |
| 211 | Ga0213871_10063168 | 3300021441 | Bacteria | 1034 |
| 212 | Ga0209148_1000295 | 3300025254 | Bacteria | 73660 |
| 213 | Ga0209233_1007194 | 3300025261 | Bacteria | 3542 |
| 214 | Ga0209455_1003242 | 3300025272 | Bacteria | 5866 |
| 215 | Ga0209758_1001013 | 3300025297 | Bacteria | 37209 |
| 216 | Ga0209758_1003254 | 3300025297 | Bacteria | 15064 |
| 217 | Ga0209758_1052492 | 3300025297 | Bacteria | 1409 |
| 218 | Ga0207697_10128727 | 3300025315 | Bacteria | 1093 |
| 219 | Ga0207656_10016861 | 3300025321 | Bacteria | 2850 |
| 220 | Ga0207692_10366829 | 3300025898 | Bacteria | 891 |
| 221 | Ga0207692_10403852 | 3300025898 | Bacteria | 852 |
| 222 | Ga0207692_10767106 | 3300025898 | Bacteria | 629 |
| 223 | Ga0207642_10080069 | 3300025899 | Bacteria | 1583 |
| 224 | Ga0207685_10066599 | 3300025905 | Bacteria | 1446 |
| 225 | Ga0207685_10622233 | 3300025905 | Bacteria | 581 |
| 226 | Ga0207699_10010872 | 3300025906 | Bacteria | 4583 |
| 227 | Ga0207705_10049390 | 3300025909 | Bacteria | 3028 |
| 228 | Ga0207705_10414138 | 3300025909 | Bacteria | 1043 |
| 229 | Ga0207707_10001830 | 3300025912 | Bacteria | 19505 |
| 230 | Ga0207707_10008128 | 3300025912 | Bacteria | 9110 |
| 231 | Ga0207707_10059002 | 3300025912 | Bacteria | 3338 |
| 232 | Ga0207707_10093659 | 3300025912 | Bacteria | 2624 |
| 233 | Ga0207707_10170982 | 3300025912 | Bacteria | 1899 |
| 234 | Ga0207695_10069402 | 3300025913 | Bacteria | 3606 |
| 235 | Ga0207695_11022785 | 3300025913 | Bacteria | 706 |
| 236 | Ga0207695_11351961 | 3300025913 | Bacteria | 593 |
| 237 | Ga0207671_10276376 | 3300025914 | Bacteria | 1324 |
| 238 | Ga0207671_11199470 | 3300025914 | Bacteria | 594 |
| 239 | Ga0207693_10025107 | 3300025915 | Bacteria | 4728 |
| 240 | Ga0207693_10137110 | 3300025915 | Bacteria | 1924 |
| 241 | Ga0207693_10629760 | 3300025915 | Bacteria | 834 |
| 242 | Ga0207663_10079167 | 3300025916 | Bacteria | 2145 |
| 243 | Ga0207663_10207923 | 3300025916 | Bacteria | 1416 |
| 244 | Ga0207663_10693315 | 3300025916 | Bacteria | 806 |
| 245 | Ga0207663_11646587 | 3300025916 | Bacteria | 516 |
| 246 | Ga0207660_10008461 | 3300025917 | Bacteria | 6656 |
| 247 | Ga0207660_10017636 | 3300025917 | Bacteria | 4746 |
| 248 | Ga0207660_10164607 | 3300025917 | Bacteria | 1713 |
| 249 | Ga0207660_10189206 | 3300025917 | Bacteria | 1602 |
| 250 | Ga0207660_10955152 | 3300025917 | Bacteria | 699 |
| 251 | Ga0207657_10022795 | 3300025919 | Bacteria | 5847 |
| 252 | Ga0207649_10122254 | 3300025920 | Bacteria | 1756 |
| 253 | Ga0207649_10155073 | 3300025920 | Bacteria | 1581 |
| 254 | Ga0207652_10018784 | 3300025921 | Bacteria | 5674 |
| 255 | Ga0207652_10048787 | 3300025921 | Bacteria | 3621 |
| 256 | Ga0207652_10076567 | 3300025921 | Bacteria | 2918 |
| 257 | Ga0207652_10078201 | 3300025921 | Bacteria | 2888 |
| 258 | Ga0207652_11403618 | 3300025921 | Bacteria | 602 |
| 259 | Ga0207694_10025727 | 3300025924 | Bacteria | 4474 |
| 260 | Ga0207694_10163685 | 3300025924 | Bacteria | 1798 |
| 261 | Ga0207694_10461323 | 3300025924 | Bacteria | 1061 |
| 262 | Ga0207694_11530553 | 3300025924 | Bacteria | 563 |
| 263 | Ga0207700_10031127 | 3300025928 | Bacteria | 3787 |
| 264 | Ga0207700_10221842 | 3300025928 | Bacteria | 1603 |
| 265 | Ga0207664_10091181 | 3300025929 | Bacteria | 2499 |
| 266 | Ga0207690_10331349 | 3300025932 | Bacteria | 1199 |
| 267 | Ga0207706_10194624 | 3300025933 | Bacteria | 1779 |
| 268 | Ga0207706_10968838 | 3300025933 | Bacteria | 716 |
| 269 | Ga0207709_10573293 | 3300025935 | Bacteria | 890 |
| 270 | Ga0207709_10817494 | 3300025935 | Bacteria | 753 |
| 271 | Ga0207669_11180070 | 3300025937 | Bacteria | 648 |
| 272 | Ga0207669_11272110 | 3300025937 | Bacteria | 624 |
| 273 | Ga0207665_10028702 | 3300025939 | Bacteria | 3677 |
| 274 | Ga0207665_10491769 | 3300025939 | Bacteria | 947 |
| 275 | Ga0207665_10796180 | 3300025939 | Bacteria | 747 |
| 276 | Ga0207665_11121513 | 3300025939 | Bacteria | 627 |
| 277 | Ga0207691_10070200 | 3300025940 | Bacteria | 3163 |
| 278 | Ga0207661_10004360 | 3300025944 | Bacteria | 9917 |
| 279 | Ga0207661_10017144 | 3300025944 | Bacteria | 5353 |
| 280 | Ga0207661_10041208 | 3300025944 | Bacteria | 3634 |
| 281 | Ga0207679_10222756 | 3300025945 | Bacteria | 1588 |
| 282 | Ga0207679_10585848 | 3300025945 | Bacteria | 1004 |
| 283 | Ga0207679_10744386 | 3300025945 | Bacteria | 891 |
| 284 | Ga0207679_12075607 | 3300025945 | Bacteria | 517 |
| 285 | Ga0207667_10046395 | 3300025949 | Bacteria | 4600 |
| 286 | Ga0207667_10086452 | 3300025949 | Bacteria | 3245 |
| 287 | Ga0207667_10221432 | 3300025949 | Bacteria | 1939 |
| 288 | Ga0207667_11722931 | 3300025949 | Bacteria | 593 |
| 289 | Ga0207667_12107007 | 3300025949 | Bacteria | 522 |
| 290 | Ga0207668_10446952 | 3300025972 | Bacteria | 1102 |
| 291 | Ga0207668_10948418 | 3300025972 | Bacteria | 767 |
| 292 | Ga0207668_11178023 | 3300025972 | Bacteria | 688 |
| 293 | Ga0207640_10522392 | 3300025981 | Bacteria | 992 |
| 294 | Ga0207639_10084729 | 3300026041 | Bacteria | 2518 |
| 295 | Ga0207639_10293443 | 3300026041 | Bacteria | 1434 |
| 296 | Ga0207639_10787979 | 3300026041 | Bacteria | 885 |
| 297 | Ga0207678_10004213 | 3300026067 | Bacteria | 12909 |
| 298 | Ga0207678_10522643 | 3300026067 | Bacteria | 1036 |
| 299 | Ga0207678_10615552 | 3300026067 | Bacteria | 953 |
| 300 | Ga0207678_11512877 | 3300026067 | Bacteria | 592 |
| 301 | Ga0207708_10440067 | 3300026075 | Bacteria | 1084 |
| 302 | Ga0207702_10000318 | 3300026078 | Bacteria | 55209 |
| 303 | Ga0207702_10314263 | 3300026078 | Bacteria | 1490 |
| 304 | Ga0207702_10469132 | 3300026078 | Bacteria | 1224 |
| 305 | Ga0207702_10633721 | 3300026078 | Bacteria | 1051 |
| 306 | Ga0207702_11237301 | 3300026078 | Bacteria | 741 |
| 307 | Ga0207702_11350149 | 3300026078 | Bacteria | 707 |
| 308 | Ga0207641_10551532 | 3300026088 | Bacteria | 1124 |
| 309 | Ga0207641_11512971 | 3300026088 | Bacteria | 673 |
| 310 | Ga0207648_10380350 | 3300026089 | Bacteria | 1276 |
| 311 | Ga0207676_10653774 | 3300026095 | Bacteria | 1015 |
| 312 | Ga0207674_10100669 | 3300026116 | Bacteria | 2871 |
| 313 | Ga0207674_10117297 | 3300026116 | Bacteria | 2632 |
| 314 | Ga0207674_10543883 | 3300026116 | Bacteria | 1122 |
| 315 | Ga0207674_11649813 | 3300026116 | Bacteria | 609 |
| 316 | Ga0207683_10927454 | 3300026121 | Bacteria | 809 |
| 317 | Ga0207698_10187729 | 3300026142 | Bacteria | 1837 |
| 318 | Ga0207698_12248129 | 3300026142 | Bacteria | 558 |
| 319 | Ga0268266_10213070 | 3300028379 | Bacteria | 1772 |
| 320 | Ga0268266_11077111 | 3300028379 | Bacteria | 778 |
| 321 | Ga0307515_10191546 | 3300028794 | Bacteria | 1953 |
| 322 | Ga0265328_10130440 | 3300031239 | Bacteria | 941 |
| 323 | Ga0265339_10355550 | 3300031249 | Bacteria | 690 |
| 324 | Ga0307513_10931616 | 3300031456 | Bacteria | 577 |
| 325 | Ga0307408_102239940 | 3300031548 | Bacteria | 528 |
| 326 | Ga0307508_10000045 | 3300031616 | Bacteria | 142824 |
| 327 | Ga0307508_10024470 | 3300031616 | Bacteria | 5479 |
| 328 | Ga0307508_10691212 | 3300031616 | Bacteria | 629 |
| 329 | Ga0265314_10151721 | 3300031711 | Bacteria | 1420 |
| 330 | Ga0307405_10514475 | 3300031731 | Bacteria | 962 |
| 331 | Ga0307405_10614393 | 3300031731 | Bacteria | 889 |
| 332 | Ga0307413_10995885 | 3300031824 | Bacteria | 718 |
| 333 | Ga0307413_11977996 | 3300031824 | Bacteria | 525 |
| 334 | Ga0326468_10024312 | 3300031889 | Bacteria | 752 |
| 335 | Ga0307406_10923955 | 3300031901 | Bacteria | 744 |
| 336 | Ga0307412_10032668 | 3300031911 | Bacteria | 3301 |
| 337 | Ga0307412_10708243 | 3300031911 | Bacteria | 865 |
| 338 | Ga0307412_11477899 | 3300031911 | Bacteria | 617 |
| 339 | Ga0307409_100312813 | 3300031995 | Bacteria | 1466 |
| 340 | Ga0307409_100473334 | 3300031995 | Bacteria | 1214 |
| 341 | Ga0307416_100417733 | 3300032002 | Bacteria | 1384 |
| 342 | Ga0307416_100484234 | 3300032002 | Bacteria | 1298 |
| 343 | Ga0307416_101206065 | 3300032002 | Bacteria | 862 |
| 344 | Ga0307411_11002459 | 3300032005 | Bacteria | 748 |
| 345 | Ga0307411_11213109 | 3300032005 | Bacteria | 684 |
| 346 | Ga0307411_11502652 | 3300032005 | Bacteria | 619 |
| 347 | Ga0307415_101010633 | 3300032126 | Bacteria | 773 |
| 348 | Ga0307415_101076124 | 3300032126 | Bacteria | 751 |
| 349 | Ga0373934_0033081 | 3300035086 | Bacteria | 2029 |
| 350 | Ga0373944_0108551 | 3300035089 | Bacteria | 945 |
| 351 | Ga0373923_0050361 | 3300035111 | Bacteria | 1744 |
| 352 | Ga0373923_0052729 | 3300035111 | Bacteria | 1709 |
| 353 | Ga0373936_0041380 | 3300035113 | Bacteria | 1848 |
| 354 | Ga0373945_0156028 | 3300035116 | Bacteria | 928 |
| 355 | Ga0373953_0018502 | 3300035117 | Bacteria | 2579 |
| 356 | Ga0373953_0018581 | 3300035117 | Bacteria | 2574 |
| 357 | Ga0373954_0006969 | 3300035118 | Bacteria | 4934 |
| 358 | Ga0373954_0007810 | 3300035118 | Bacteria | 4685 |
| 359 | Ga0373954_0023461 | 3300035118 | Bacteria | 2805 |
| 360 | Ga0373956_0088528 | 3300035119 | Bacteria | 1426 |
| 361 | Ga0373957_0052286 | 3300035120 | Bacteria | 1564 |
| 362 | Ga0373957_0101302 | 3300035120 | Bacteria | 1153 |
| 363 | Ga0373943_0009727 | 3300035170 | Bacteria | 4307 |
| 364 | Ga0373955_0002799 | 3300035172 | Bacteria | 7662 |
| 365 | Ga0373955_0056100 | 3300035172 | Bacteria | 2160 |
| 366 | Ga0373955_0401811 | 3300035172 | Bacteria | 832 |
| 367 | Ga0373924_0041454 | 3300035410 | Bacteria | 1886 |
| 368 | Ga0373924_0045145 | 3300035410 | Bacteria | 1812 |
| 369 | Ga0373924_0136808 | 3300035410 | Bacteria | 1067 |
| 370 | Ga0373931_0829866 | 3300035691 | Bacteria | 618 |
| 371 | Ga0373935_0117792 | 3300035692 | Bacteria | 1771 |
| 372 | Ga0373935_0128647 | 3300035692 | Bacteria | 1699 |
| 373 | Ga0373935_1243793 | 3300035692 | Bacteria | 555 |
| 374 | Ga0373927_0090551 | 3300035695 | Bacteria | 1986 |
| 375 | Ga0373933_0513536 | 3300035724 | Bacteria | 785 |
| 376 | Ga0373933_0640520 | 3300035724 | Bacteria | 698 |
| 377 | Ga0373947_0034346 | 3300035725 | Bacteria | 2998 |
| 378 | Ga0373937_0019726 | 3300036401 | Bacteria | 6038 |
| 379 | Ga0373937_0029464 | 3300036401 | Bacteria | 4971 |
| 380 | Ga0373937_0046562 | 3300036401 | Bacteria | 3966 |
| 381 | Ga0372808_000548 | 3300036459 | Bacteria | 3087 |
| 382 | Ga0373925_0012279 | 3300037068 | Bacteria | 6197 |
| 383 | Ga0373925_0110821 | 3300037068 | Bacteria | 2120 |
| 384 | Ga0373925_1511270 | 3300037068 | Bacteria | 549 |
| 385 | Ga0395899_0191736 | 3300037312 | Bacteria | 1430 |
| 386 | Ga0395900_0977528 | 3300037418 | Bacteria | 767 |
| 387 | Ga0395898_1303842 | 3300037466 | Bacteria | 655 |
| 388 | Ga0395901_0267112 | 3300038443 | Bacteria | 1780 |
| 389 | Ga0436365_0422270 | 3300039437 | Bacteria | 2007 |
| 390 | Ga0436365_1865258 | 3300039437 | Bacteria | 3199 |
| 391 | Ga0436360_0035660 | 3300039438 | Bacteria | 2190 |
| 392 | Ga0436361_0034753 | 3300039447 | Bacteria | 2945 |
| 393 | Ga0436361_0208430 | 3300039447 | Bacteria | 864 |
| 394 | Ga0436363_0976239 | 3300039450 | Bacteria | 1038 |
| 395 | Ga0436363_1632720 | 3300039450 | Bacteria | 920 |
| 396 | Ga0436362_0798067 | 3300039453 | Bacteria | 5843 |
| 397 | Ga0451800_1499558 | 3300041459 | Bacteria | 761 |
| 398 | Ga0451804_0609357 | 3300041463 | Bacteria | 701 |
| 399 | Ga0451839_0628551 | 3300041496 | Bacteria | 634 |
| 400 | Ga0451841_1157327 | 3300041498 | Bacteria | 643 |
| 401 | Ga0439459_0046903 | 3300042438 | Bacteria | 937 |
| 402 | Ga0466966_0056008 | 3300044684 | Bacteria | 2495 |
| 403 | Ga0466966_0669967 | 3300044684 | Bacteria | 625 |
| 404 | Ga0466961_0190673 | 3300044693 | Bacteria | 1270 |
| 405 | Ga0466963_0082044 | 3300044694 | Bacteria | 2185 |
| 406 | Ga0466964_0076656 | 3300044706 | Bacteria | 1426 |
| 407 | Ga0466970_0142879 | 3300044765 | Bacteria | 1319 |
| 408 | Ga0466970_0330453 | 3300044765 | Bacteria | 863 |
| 409 | Ga0466957_0107372 | 3300044842 | Bacteria | 1767 |
| 410 | Ga0466957_0777719 | 3300044842 | Bacteria | 679 |
| 411 | Ga0466959_0014935 | 3300045049 | Bacteria | 5658 |
| 412 | Ga0466959_0063742 | 3300045049 | Bacteria | 2676 |
| 413 | Ga0466958_0316935 | 3300045836 | Bacteria | 1002 |
| 414 | Ga0466967_0281578 | 3300045976 | Bacteria | 1595 |
| 415 | Ga0466967_0515142 | 3300045976 | Bacteria | 1175 |
| 416 | Ga0466967_1794918 | 3300045976 | Bacteria | 610 |
| 417 | Ga0495592_0026198 | 3300046454 | Bacteria | 4423 |
| 418 | Ga0495592_0076532 | 3300046454 | Bacteria | 2427 |
| 419 | Ga0495592_0144855 | 3300046454 | Bacteria | 1648 |
| 420 | Ga0495592_0247576 | 3300046454 | Bacteria | 1180 |
| 421 | Ga0495603_0155244 | 3300046455 | Bacteria | 1328 |
| 422 | Ga0495603_0545228 | 3300046455 | Bacteria | 664 |
| 423 | Ga0495591_092469 | 3300046458 | Bacteria | 758 |
| 424 | Ga0495629_0017285 | 3300046459 | Bacteria | 5171 |
| 425 | Ga0495629_0072839 | 3300046459 | Bacteria | 2399 |
| 426 | Ga0495638_0088791 | 3300046460 | Bacteria | 1865 |
| 427 | Ga0495638_0230549 | 3300046460 | Bacteria | 1030 |
| 428 | Ga0495638_0351035 | 3300046460 | Bacteria | 779 |
| 429 | Ga0495638_0494309 | 3300046460 | Bacteria | 617 |
| 430 | Ga0495638_0583231 | 3300046460 | Bacteria | 551 |
| 431 | Ga0495641_0115962 | 3300046461 | Bacteria | 1195 |
| 432 | Ga0495641_0490904 | 3300046461 | Bacteria | 560 |
| 433 | Ga0495651_0034650 | 3300046462 | Bacteria | 3934 |
| 434 | Ga0495651_0210693 | 3300046462 | Bacteria | 1352 |
| 435 | Ga0495651_0313441 | 3300046462 | Bacteria | 1048 |
| 436 | Ga0495653_0011881 | 3300046463 | Bacteria | 7112 |
| 437 | Ga0495653_0105939 | 3300046463 | Bacteria | 2029 |
| 438 | Ga0495653_0149079 | 3300046463 | Bacteria | 1636 |
| 439 | Ga0495580_0001981 | 3300046472 | Bacteria | 18011 |
| 440 | Ga0495582_0007153 | 3300046473 | Bacteria | 6200 |
| 441 | Ga0495605_0306434 | 3300046474 | Bacteria | 671 |
| 442 | Ga0495639_0004165 | 3300046475 | Bacteria | 6200 |
| 443 | Ga0495639_0068928 | 3300046475 | Bacteria | 1631 |
| 444 | Ga0495662_0343618 | 3300046476 | Bacteria | 734 |
| 445 | Ga0495664_0004612 | 3300046477 | Bacteria | 7535 |
| 446 | Ga0495664_0080946 | 3300046477 | Bacteria | 1947 |
| 447 | Ga0495585_0275274 | 3300046492 | Bacteria | 833 |
| 448 | Ga0495594_0218284 | 3300046499 | Bacteria | 1087 |
| 449 | Ga0495596_0330591 | 3300046500 | Bacteria | 593 |
| 450 | Ga0495607_0195714 | 3300046501 | Bacteria | 1004 |
| 451 | Ga0495607_0267908 | 3300046501 | Bacteria | 815 |
| 452 | Ga0495583_0071868 | 3300046506 | Bacteria | 1519 |
| 453 | Ga0495606_0047553 | 3300046507 | Bacteria | 2827 |
| 454 | Ga0495608_0017638 | 3300046511 | Bacteria | 4936 |
| 455 | Ga0495608_0070418 | 3300046511 | Bacteria | 2282 |
| 456 | Ga0495608_0698872 | 3300046511 | Bacteria | 603 |
| 457 | Ga0495610_0013962 | 3300046512 | Bacteria | 4746 |
| 458 | Ga0495610_0277186 | 3300046512 | Bacteria | 654 |
| 459 | Ga0495618_0014329 | 3300046514 | Bacteria | 4830 |
| 460 | Ga0495618_0162324 | 3300046514 | Bacteria | 1424 |
| 461 | Ga0495618_0251260 | 3300046514 | Bacteria | 1109 |
| 462 | Ga0495620_0028200 | 3300046515 | Bacteria | 2614 |
| 463 | Ga0495620_0063536 | 3300046515 | Bacteria | 1530 |
| 464 | Ga0495628_0025951 | 3300046516 | Bacteria | 4783 |
| 465 | Ga0495628_0543998 | 3300046516 | Bacteria | 834 |
| 466 | Ga0495630_0110073 | 3300046517 | Bacteria | 2086 |
| 467 | Ga0495630_0808351 | 3300046517 | Bacteria | 716 |
| 468 | Ga0495631_0036994 | 3300046518 | Bacteria | 2176 |
| 469 | Ga0495631_0043066 | 3300046518 | Bacteria | 1992 |
| 470 | Ga0495631_0445304 | 3300046518 | Bacteria | 551 |
| 471 | Ga0495632_0131004 | 3300046519 | Bacteria | 1167 |
| 472 | Ga0495637_0055392 | 3300046520 | Bacteria | 1644 |
| 473 | Ga0495643_0237461 | 3300046522 | Bacteria | 857 |
| 474 | Ga0495643_0249730 | 3300046522 | Bacteria | 828 |
| 475 | Ga0495644_0022208 | 3300046523 | Bacteria | 2419 |
| 476 | Ga0495648_0059255 | 3300046524 | Bacteria | 2285 |
| 477 | Ga0495648_0324809 | 3300046524 | Bacteria | 712 |
| 478 | Ga0495663_0073680 | 3300046525 | Bacteria | 1091 |
| 479 | Ga0495652_0021450 | 3300046529 | Bacteria | 5742 |
| 480 | Ga0495652_0112657 | 3300046529 | Bacteria | 2185 |
| 481 | Ga0495652_0687475 | 3300046529 | Bacteria | 689 |
| 482 | Ga0495652_0854281 | 3300046529 | Bacteria | 603 |
| 483 | Ga0495665_0545974 | 3300046531 | Bacteria | 582 |
| 484 | Ga0495640_0018260 | 3300046533 | Bacteria | 5208 |
| 485 | Ga0495640_0057123 | 3300046533 | Bacteria | 2664 |
| 486 | Ga0495640_0092748 | 3300046533 | Bacteria | 1991 |
| 487 | Ga0495586_0562142 | 3300046535 | Bacteria | 659 |
| 488 | Ga0495587_0009714 | 3300046536 | Bacteria | 6152 |
| 489 | Ga0495587_0317659 | 3300046536 | Bacteria | 870 |
| 490 | Ga0495587_0720322 | 3300046536 | Bacteria | 546 |
| 491 | Ga0495598_0103970 | 3300046537 | Bacteria | 943 |
| 492 | Ga0495609_0051495 | 3300046538 | Bacteria | 1833 |
| 493 | Ga0495609_0352142 | 3300046538 | Bacteria | 594 |
| 494 | Ga0495609_0415617 | 3300046538 | Bacteria | 537 |
| 495 | Ga0495621_0052498 | 3300046539 | Bacteria | 1461 |
| 496 | Ga0495645_0010485 | 3300046543 | Bacteria | 6499 |
| 497 | Ga0495645_0093242 | 3300046543 | Bacteria | 2149 |
| 498 | Ga0495622_0205987 | 3300046557 | Bacteria | 875 |
| 499 | Ga0495633_0236593 | 3300046558 | Bacteria | 834 |
| 500 | Ga0495667_0003525 | 3300046559 | Bacteria | 10504 |
| 501 | Ga0495667_0209891 | 3300046559 | Bacteria | 1244 |
| 502 | Ga0495656_0372079 | 3300046615 | Bacteria | 743 |
| 503 | Ga0495668_0101673 | 3300046616 | Bacteria | 1572 |
| 504 | Ga0495634_0032414 | 3300046642 | Bacteria | 3594 |
| 505 | Ga0495634_0051141 | 3300046642 | Bacteria | 2773 |
| 506 | Ga0495634_0542737 | 3300046642 | Bacteria | 678 |
| 507 | Ga0495611_0067172 | 3300046648 | Bacteria | 1636 |
| 508 | Ga0495611_0175393 | 3300046648 | Bacteria | 1002 |
| 509 | Ga0495625_0153563 | 3300046660 | Bacteria | 1546 |
| 510 | Ga0495625_0621295 | 3300046660 | Bacteria | 646 |
| 511 | Ga0495635_0007981 | 3300046663 | Bacteria | 7400 |
| 512 | Ga0495635_0054013 | 3300046663 | Bacteria | 2767 |
| 513 | Ga0495635_0112152 | 3300046663 | Bacteria | 1862 |
| 514 | Ga0495661_0194607 | 3300046665 | Bacteria | 1065 |
| 515 | Ga0495588_0267626 | 3300046674 | Bacteria | 900 |
| 516 | Ga0495657_0004913 | 3300046675 | Bacteria | 10635 |
| 517 | Ga0495657_0232602 | 3300046675 | Bacteria | 1114 |
| 518 | Ga0495599_0429059 | 3300046678 | Bacteria | 784 |
| 519 | Ga0495623_0041079 | 3300046679 | Bacteria | 2951 |
| 520 | Ga0495623_0068214 | 3300046679 | Bacteria | 2218 |
| 521 | Ga0495623_0517828 | 3300046679 | Bacteria | 628 |
| 522 | Ga0495646_0069394 | 3300046680 | Bacteria | 2079 |
| 523 | Ga0495646_0127658 | 3300046680 | Bacteria | 1434 |
| 524 | Ga0495646_0291614 | 3300046680 | Bacteria | 865 |
| 525 | Ga0495647_0012555 | 3300046681 | Bacteria | 2919 |
| 526 | Ga0495658_0046528 | 3300046683 | Bacteria | 2439 |
| 527 | Ga0495669_0172397 | 3300046684 | Bacteria | 1029 |
| 528 | Ga0495613_0132279 | 3300046689 | Bacteria | 1786 |
| 529 | Ga0495613_0980907 | 3300046689 | Bacteria | 543 |
| 530 | Ga0495670_0063201 | 3300046691 | Bacteria | 1863 |
| 531 | Ga0495671_0395721 | 3300046692 | Bacteria | 661 |
| 532 | Ga0495589_0121939 | 3300046794 | Bacteria | 1255 |
| 533 | Ga0495589_0532145 | 3300046794 | Bacteria | 536 |
| 534 | Ga0495600_0020007 | 3300046809 | Bacteria | 4279 |
| 535 | Ga0495600_0196043 | 3300046809 | Bacteria | 1298 |
| 536 | Ga0495600_0284244 | 3300046809 | Bacteria | 1046 |
| 537 | Ga0495660_0113626 | 3300046810 | Bacteria | 1379 |
| 538 | Ga0495581_0713450 | 3300047315 | Bacteria | 578 |
| 539 | Ga0495581_0910227 | 3300047315 | Bacteria | 502 |
| 540 | Ga0495604_0002900 | 3300047317 | Bacteria | 13743 |
| 541 | Ga0495604_0106518 | 3300047317 | Bacteria | 2051 |
| 542 | Ga0495674_0031429 | 3300047319 | Bacteria | 4823 |
| 543 | Ga0495674_0098054 | 3300047319 | Bacteria | 2496 |
| 544 | Ga0495674_0170502 | 3300047319 | Bacteria | 1816 |
| 545 | Ga0495672_0222555 | 3300047320 | Bacteria | 931 |
| 546 | Ga0495672_0334975 | 3300047320 | Bacteria | 707 |
| 547 | Ga0495676_0066265 | 3300047321 | Bacteria | 2800 |
| 548 | Ga0495680_0025446 | 3300047322 | Bacteria | 4897 |
| 549 | Ga0495680_0052112 | 3300047322 | Bacteria | 3191 |
| 550 | Ga0495680_0450725 | 3300047322 | Bacteria | 881 |
| 551 | Ga0495675_0061451 | 3300047444 | Bacteria | 2379 |
| 552 | Ga0495675_0137244 | 3300047444 | Bacteria | 1517 |
| 553 | Ga0495677_0117234 | 3300047445 | Bacteria | 1014 |
| 554 | Ga0495677_0158174 | 3300047445 | Bacteria | 874 |
| 555 | Ga0495685_150004 | 3300047447 | Bacteria | 757 |
| 556 | Ga0495673_0273062 | 3300047469 | Bacteria | 612 |
| 557 | Ga0495681_0064308 | 3300047470 | Bacteria | 1681 |
| 558 | Ga0495684_0034017 | 3300047471 | Bacteria | 3910 |
| 559 | Ga0495684_0295214 | 3300047471 | Bacteria | 1165 |
| 560 | Ga0495686_0090210 | 3300047472 | Bacteria | 1862 |
| 561 | Ga0495686_0106625 | 3300047472 | Bacteria | 1684 |
| 562 | Ga0495593_0003761 | 3300047673 | Bacteria | 9064 |
| 563 | Ga0495593_0017042 | 3300047673 | Bacteria | 4089 |
| 564 | Ga0495602_0058849 | 3300048088 | Bacteria | 3360 |
| 565 | Ga0495602_0111824 | 3300048088 | Bacteria | 2217 |
| 566 | Ga0495614_0112116 | 3300048089 | Bacteria | 1198 |
| 567 | Ga0495614_0137626 | 3300048089 | Bacteria | 1084 |
| 568 | Ga0496100_0084827 | 3300048903 | Bacteria | 2148 |
| 569 | Ga0496100_0164023 | 3300048903 | Bacteria | 1595 |
| 570 | Ga0496100_0404472 | 3300048903 | Bacteria | 1040 |
| 571 | Ga0496100_1541450 | 3300048903 | Bacteria | 525 |
| 572 | Ga0496101_0109901 | 3300048904 | Bacteria | 2074 |
| 573 | Ga0496101_0161922 | 3300048904 | Bacteria | 1716 |
| 574 | Ga0496101_0192059 | 3300048904 | Bacteria | 1576 |
| 575 | Ga0496104_1006856 | 3300048907 | Bacteria | 737 |
| 576 | Ga0496104_1057227 | 3300048907 | Bacteria | 715 |
| 577 | Ga0496105_0487389 | 3300048908 | Bacteria | 969 |
| 578 | Ga0496105_0619756 | 3300048908 | Bacteria | 838 |
| 579 | Ga0496106_0001943 | 3300048909 | Bacteria | 15501 |
| 580 | Ga0496106_1221753 | 3300048909 | Bacteria | 586 |
| 581 | Ga0496106_1342121 | 3300048909 | Bacteria | 554 |
| 582 | Ga0496107_0008009 | 3300048910 | Bacteria | 7293 |
| 583 | Ga0496107_0365946 | 3300048910 | Bacteria | 1072 |
| 584 | Ga0496107_0594152 | 3300048910 | Bacteria | 818 |
| 585 | Ga0496108_0000927 | 3300048911 | Bacteria | 22857 |
| 586 | Ga0496108_1298051 | 3300048911 | Bacteria | 612 |
| 587 | Ga0496109_0000229 | 3300048912 | Bacteria | 54733 |
| 588 | Ga0496109_0098872 | 3300048912 | Bacteria | 2706 |
| 589 | Ga0496109_1273344 | 3300048912 | Bacteria | 671 |
| 590 | Ga0496110_0138835 | 3300048913 | Bacteria | 2197 |
| 591 | Ga0496111_0027253 | 3300048914 | Bacteria | 4041 |
| 592 | Ga0496111_0200167 | 3300048914 | Bacteria | 1485 |
| 593 | Ga0496112_0001343 | 3300048915 | Bacteria | 18708 |
| 594 | Ga0496113_0751627 | 3300048916 | Bacteria | 776 |
| 595 | Ga0496114_0118033 | 3300048917 | Bacteria | 2279 |
| 596 | Ga0496114_0287126 | 3300048917 | Bacteria | 1451 |
| 597 | Ga0496114_0395961 | 3300048917 | Bacteria | 1223 |
| 598 | Ga0496114_0428277 | 3300048917 | Bacteria | 1172 |
| 599 | Ga0496114_1081221 | 3300048917 | Bacteria | 687 |
| 600 | Ga0496114_1782771 | 3300048917 | Bacteria | 504 |
| 601 | Ga0496115_0119448 | 3300048918 | Bacteria | 2168 |
| 602 | Ga0496115_0263705 | 3300048918 | Bacteria | 1416 |
| 603 | Ga0496115_0410826 | 3300048918 | Bacteria | 1097 |
| 604 | Ga0496115_0504336 | 3300048918 | Bacteria | 972 |
| 605 | Ga0496116_0001930 | 3300048919 | Bacteria | 22336 |
| 606 | Ga0496116_0059236 | 3300048919 | Bacteria | 2492 |
| 607 | Ga0496117_0032761 | 3300048920 | Bacteria | 3942 |
| 608 | Ga0496117_0059473 | 3300048920 | Bacteria | 2639 |
| 609 | Ga0496118_0040566 | 3300048921 | Bacteria | 3699 |
| 610 | Ga0496118_0055065 | 3300048921 | Bacteria | 3005 |
| 611 | Ga0496118_0135281 | 3300048921 | Bacteria | 1574 |
| 612 | Ga0496119_0061944 | 3300048922 | Bacteria | 2231 |
| 613 | Ga0496119_0244834 | 3300048922 | Bacteria | 906 |
| 614 | Ga0496119_0509803 | 3300048922 | Bacteria | 558 |
| 615 | Ga0496120_0318030 | 3300048923 | Bacteria | 708 |
| 616 | Ga0496121_0083960 | 3300048924 | Bacteria | 2512 |
| 617 | Ga0496121_0622525 | 3300048924 | Bacteria | 662 |
| 618 | Ga0496122_0020170 | 3300048925 | Bacteria | 6043 |
| 619 | Ga0496122_0071255 | 3300048925 | Bacteria | 2478 |
| 620 | Ga0496123_0009028 | 3300048926 | Bacteria | 9040 |
| 621 | Ga0496124_0115166 | 3300048927 | Bacteria | 2158 |
| 622 | Ga0496124_0520535 | 3300048927 | Bacteria | 792 |
| 623 | Ga0496124_0668359 | 3300048927 | Bacteria | 664 |
| 624 | Ga0496125_0000843 | 3300048928 | Bacteria | 49244 |
| 625 | Ga0496125_0003929 | 3300048928 | Bacteria | 17533 |
| 626 | Ga0496125_0045135 | 3300048928 | Bacteria | 3714 |
| 627 | Ga0496126_0047419 | 3300048929 | Bacteria | 3933 |
| 628 | Ga0496126_0183069 | 3300048929 | Bacteria | 1778 |
| 629 | Ga0496126_0553651 | 3300048929 | Bacteria | 912 |
| 630 | Ga0496126_0600145 | 3300048929 | Bacteria | 867 |
| 631 | Ga0496126_0665375 | 3300048929 | Bacteria | 813 |
| 632 | Ga0496126_0807366 | 3300048929 | Bacteria | 719 |
| 633 | Ga0495678_154079 | 3300049459 | Bacteria | 740 |
| 634 | Ga0501031_0014869 | 3300049568 | Bacteria | 5057 |
| 635 | Ga0501032_0010617 | 3300049569 | Bacteria | 6631 |
| 636 | Ga0501032_0136848 | 3300049569 | Bacteria | 1614 |
| 637 | Ga0501033_0002710 | 3300049570 | Bacteria | 14858 |
| 638 | Ga0501034_0894827 | 3300049571 | Bacteria | 776 |
| 639 | Ga0501036_0047626 | 3300049572 | Bacteria | 3630 |
| 640 | Ga0501036_0703829 | 3300049572 | Bacteria | 835 |
| 641 | Ga0501037_0001298 | 3300049573 | Bacteria | 18369 |
| 642 | Ga0501037_0131156 | 3300049573 | Bacteria | 1797 |
| 643 | Ga0501038_0012835 | 3300049574 | Bacteria | 7648 |
| 644 | Ga0501038_0102205 | 3300049574 | Bacteria | 2385 |
| 645 | Ga0501039_0044276 | 3300049575 | Bacteria | 3437 |
| 646 | Ga0501039_0090146 | 3300049575 | Bacteria | 2389 |
| 647 | Ga0501041_0593984 | 3300049577 | Bacteria | 706 |
| 648 | Ga0501042_0072752 | 3300049578 | Bacteria | 2459 |
| 649 | Ga0501042_0479930 | 3300049578 | Bacteria | 902 |
| 650 | Ga0501042_1133925 | 3300049578 | Bacteria | 570 |
| 651 | Ga0501043_0096194 | 3300049579 | Bacteria | 2327 |
| 652 | Ga0501046_0030078 | 3300049580 | Bacteria | 4410 |
| 653 | Ga0501046_0168371 | 3300049580 | Bacteria | 1645 |
| 654 | Ga0501067_0809440 | 3300049583 | Bacteria | 528 |
| 655 | Ga0501067_0849530 | 3300049583 | Bacteria | 515 |
| 656 | Ga0501068_0059540 | 3300049584 | Bacteria | 2319 |
| 657 | Ga0501068_0842041 | 3300049584 | Bacteria | 602 |
| 658 | Ga0501069_0614158 | 3300049585 | Bacteria | 653 |
| 659 | Ga0501075_1005296 | 3300049591 | Bacteria | 634 |
| 660 | Ga0501076_0551364 | 3300049592 | Bacteria | 950 |
| 661 | Ga0501079_0389431 | 3300049741 | Bacteria | 1093 |
| 662 | Ga0501079_1187996 | 3300049741 | Bacteria | 601 |
| 663 | Ga0501080_0874368 | 3300049742 | Bacteria | 785 |
| 664 | Ga0501081_0871311 | 3300049743 | Bacteria | 679 |
| 665 | Ga0501035_0001311 | 3300049822 | Bacteria | 25709 |
| 666 | Ga0501044_0048874 | 3300049823 | Bacteria | 4367 |
| 667 | Ga0501044_0966445 | 3300049823 | Bacteria | 724 |
| 668 | Ga0501045_0246868 | 3300049824 | Bacteria | 1329 |
| 669 | nmdc:mga03n38_195895_c1 | 3300050490 | Bacteria | 1043 |
| 670 | nmdc:mga00v17_558334_c1 | 3300050491 | Bacteria | 740 |
| 671 | nmdc:mga00v17_704219_c1 | 3300050491 | Bacteria | 647 |
| 672 | nmdc:mga0yw44_248904_c1 | 3300050492 | Bacteria | 1182 |
| 673 | nmdc:mga0yw44_280364_c1 | 3300050492 | Bacteria | 1114 |
| 674 | nmdc:mga0yw44_468936_c1 | 3300050492 | Bacteria | 854 |
| 675 | nmdc:mga0yw44_476959_c1 | 3300050492 | Bacteria | 846 |
| 676 | nmdc:mga06z11_73926_c1 | 3300050494 | Bacteria | 1811 |
| 677 | nmdc:mga07m45_129657_c1 | 3300050496 | Bacteria | 1459 |
| 678 | nmdc:mga05p37_72116_c1 | 3300050507 | Bacteria | 4249 |
| 679 | nmdc:mga06r32_469230_c1 | 3300050510 | Bacteria | 1237 |
| 680 | nmdc:mga0n895_101162_c1 | 3300050512 | Bacteria | 2892 |
| 681 | nmdc:mga0n895_435306_c1 | 3300050512 | Bacteria | 1325 |
| 682 | nmdc:mga0rr50_150317_c1 | 3300050513 | Bacteria | 1881 |
| 683 | nmdc:mga0a205_1260416_c1 | 3300050515 | Bacteria | 587 |
| 684 | nmdc:mga0sz30_162434_c1 | 3300050516 | Bacteria | 990 |
| 685 | Ga0495601_0025408 | 3300053077 | Bacteria | 3652 |
| 686 | Ga0495601_0199611 | 3300053077 | Bacteria | 1307 |
| 687 | Ga0495601_0245791 | 3300053077 | Bacteria | 1168 |
| 688 | Ga0495612_0020737 | 3300053078 | Bacteria | 2635 |
| 689 | Ga0495612_0538014 | 3300053078 | Bacteria | 537 |
| 690 | Ga0500635_0022200 | 3300053080 | Bacteria | 1965 |
| 691 | Ga0495595_0001339 | 3300053084 | Bacteria | 9565 |
| 692 | Ga0495595_0029009 | 3300053084 | Bacteria | 2473 |
| 693 | Ga0495619_0008552 | 3300053085 | Bacteria | 6477 |
| 694 | Ga0495619_0725857 | 3300053085 | Bacteria | 675 |
| 695 | Ga0495619_0866902 | 3300053085 | Bacteria | 608 |
| 696 | Ga0495619_0874259 | 3300053085 | Bacteria | 605 |
| 697 | Ga0500578_0244440 | 3300053086 | Bacteria | 1083 |
| 698 | Ga0500643_152494 | 3300053087 | Bacteria | 620 |
| 699 | Ga0500643_181162 | 3300053087 | Bacteria | 565 |
| 700 | Ga0500581_111615 | 3300053089 | Bacteria | 1331 |
| 701 | Ga0500646_0018789 | 3300053090 | Bacteria | 1824 |
| 702 | Ga0500646_0357082 | 3300053090 | Bacteria | 533 |
| 703 | Ga0500647_0451632 | 3300053091 | Bacteria | 508 |
| 704 | Ga0500583_0252970 | 3300053092 | Bacteria | 869 |
| 705 | Ga0500566_0000107 | 3300053094 | Bacteria | 42130 |
| 706 | Ga0500640_106878 | 3300053095 | Bacteria | 1146 |
| 707 | Ga0500641_0010703 | 3300053096 | Bacteria | 3321 |
| 708 | Ga0500641_0013776 | 3300053096 | Bacteria | 2974 |
| 709 | Ga0500641_0027147 | 3300053096 | Bacteria | 2228 |
| 710 | Ga0500650_0000245 | 3300053098 | Bacteria | 13194 |
| 711 | Ga0500654_184684 | 3300053099 | Bacteria | 658 |
| 712 | Ga0500555_063634 | 3300053103 | Bacteria | 987 |
| 713 | Ga0500556_0000006 | 3300053104 | Bacteria | 453982 |
| 714 | Ga0500556_0393604 | 3300053104 | Bacteria | 532 |
| 715 | Ga0500557_061553 | 3300053105 | Bacteria | 1220 |
| 716 | Ga0500562_024724 | 3300053108 | Bacteria | 1570 |
| 717 | Ga0500569_027511 | 3300053109 | Bacteria | 1567 |
| 718 | Ga0500572_065685 | 3300053111 | Bacteria | 1111 |
| 719 | Ga0500592_023880 | 3300053116 | Bacteria | 985 |
| 720 | Ga0500593_093751 | 3300053117 | Bacteria | 1266 |
| 721 | Ga0500594_0051380 | 3300053118 | Bacteria | 1162 |
| 722 | Ga0500594_0060471 | 3300053118 | Bacteria | 1091 |
| 723 | Ga0500607_129470 | 3300053121 | Bacteria | 1206 |
| 724 | Ga0500608_110319 | 3300053122 | Bacteria | 1262 |
| 725 | Ga0500614_047140 | 3300053123 | Bacteria | 1118 |
| 726 | Ga0500642_0000004 | 3300053130 | Bacteria | 433122 |
| 727 | Ga0500642_0288666 | 3300053130 | Bacteria | 743 |
| 728 | Ga0500642_0451871 | 3300053130 | Bacteria | 551 |
| 729 | Ga0500652_000294 | 3300053131 | Bacteria | 18164 |
| 730 | Ga0500658_0055005 | 3300053134 | Bacteria | 1637 |
| 731 | Ga0500658_0524803 | 3300053134 | Bacteria | 534 |
| 732 | Ga0500559_0044825 | 3300053136 | Bacteria | 1935 |
| 733 | Ga0500559_0181246 | 3300053136 | Bacteria | 992 |
| 734 | Ga0500568_0006383 | 3300053139 | Bacteria | 5923 |
| 735 | Ga0500573_0548928 | 3300053140 | Bacteria | 512 |
| 736 | Ga0500577_0001713 | 3300053142 | Bacteria | 5614 |
| 737 | Ga0500577_0404478 | 3300053142 | Bacteria | 597 |
| 738 | Ga0500586_001899 | 3300053145 | Bacteria | 4547 |
| 739 | Ga0500588_0139664 | 3300053146 | Bacteria | 869 |
| 740 | Ga0500588_0145174 | 3300053146 | Bacteria | 855 |
| 741 | Ga0500589_082946 | 3300053147 | Bacteria | 1427 |
| 742 | Ga0500590_068212 | 3300053148 | Bacteria | 1773 |
| 743 | Ga0500603_002672 | 3300053150 | Bacteria | 3884 |
| 744 | Ga0500604_0012314 | 3300053151 | Bacteria | 2308 |
| 745 | Ga0500604_0107466 | 3300053151 | Bacteria | 924 |
| 746 | Ga0500616_0000022 | 3300053153 | Bacteria | 460463 |
| 747 | Ga0500619_030737 | 3300053154 | Bacteria | 1634 |
| 748 | Ga0500630_230444 | 3300053159 | Bacteria | 682 |
| 749 | Ga0500633_0050696 | 3300053160 | Bacteria | 1431 |
| 750 | Ga0500634_0080584 | 3300053161 | Bacteria | 1679 |
| 751 | Ga0500634_0204184 | 3300053161 | Bacteria | 864 |
| 752 | Ga0500638_310618 | 3300053162 | Bacteria | 603 |
| 753 | Ga0500639_032775 | 3300053163 | Bacteria | 2745 |
| 754 | Ga0500639_214051 | 3300053163 | Bacteria | 812 |
| 755 | Ga0500637_0280048 | 3300053178 | Bacteria | 918 |
| 756 | Ga0500567_139228 | 3300053723 | Bacteria | 932 |
| 757 | Ga0500570_144382 | 3300053724 | Bacteria | 865 |
| 758 | Ga0500645_014664 | 3300053730 | Bacteria | 2493 |
| 759 | Ga0500609_066175 | 3300053731 | Bacteria | 507 |
| 760 | Ga0500596_003754 | 3300053735 | Bacteria | 2850 |
| 761 | Ga0500601_011934 | 3300053737 | Bacteria | 978 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005983 | Ga0081540_1011553 | Ga0081540_10115536 | 55 |
| 2 | 3300003215 | JGI25153J46596_10008562 | JGI25153J46596_100085623 | 58 |
| 3 | 3300003659 | JGI25404J52841_10028662 | JGI25404J52841_100286621 | 58 |
| 4 | 3300003659 | JGI25404J52841_10058670 | JGI25404J52841_100586702 | 58 |
| 5 | 3300003762 | Ga0055542_1013126 | Ga0055542_10131261 | 58 |
| 6 | 3300003763 | Ga0055529_1028398 | Ga0055529_10283982 | 58 |
| 7 | 3300005327 | Ga0070658_11080274 | Ga0070658_110802742 | 58 |
| 8 | 3300005329 | Ga0070683_100037044 | Ga0070683_1000370446 | 58 |
| 9 | 3300005333 | Ga0070677_10759471 | Ga0070677_107594712 | 58 |
| 10 | 3300005336 | Ga0070680_100117410 | Ga0070680_1001174103 | 58 |
| 11 | 3300005336 | Ga0070680_100140998 | Ga0070680_1001409984 | 58 |
| 12 | 3300005336 | Ga0070680_100590734 | Ga0070680_1005907342 | 58 |
| 13 | 3300005336 | Ga0070680_101253046 | Ga0070680_1012530461 | 58 |
| 14 | 3300005337 | Ga0070682_100084056 | Ga0070682_1000840564 | 58 |
| 15 | 3300005337 | Ga0070682_100623510 | Ga0070682_1006235102 | 58 |
| 16 | 3300005337 | Ga0070682_101443476 | Ga0070682_1014434762 | 58 |
| 17 | 3300005339 | Ga0070660_100158914 | Ga0070660_1001589142 | 58 |
| 18 | 3300005340 | Ga0070689_101611093 | Ga0070689_1016110931 | 58 |
| 19 | 3300005341 | Ga0070691_10082325 | Ga0070691_100823252 | 58 |
| 20 | 3300005341 | Ga0070691_10341589 | Ga0070691_103415892 | 58 |
| 21 | 3300005341 | Ga0070691_10911095 | Ga0070691_109110952 | 58 |
| 22 | 3300005344 | Ga0070661_100037794 | Ga0070661_1000377944 | 58 |
| 23 | 3300005344 | Ga0070661_100821582 | Ga0070661_1008215822 | 58 |
| 24 | 3300005347 | Ga0070668_100301498 | Ga0070668_1003014982 | 58 |
| 25 | 3300005347 | Ga0070668_101898410 | Ga0070668_1018984102 | 58 |
| 26 | 3300005355 | Ga0070671_100127930 | Ga0070671_1001279304 | 58 |
| 27 | 3300005356 | Ga0070674_100362098 | Ga0070674_1003620982 | 58 |
| 28 | 3300005356 | Ga0070674_100746463 | Ga0070674_1007464632 | 58 |
| 29 | 3300005435 | Ga0070714_100070525 | Ga0070714_1000705253 | 58 |
| 30 | 3300005435 | Ga0070714_100739113 | Ga0070714_1007391132 | 58 |
| 31 | 3300005435 | Ga0070714_100971817 | Ga0070714_1009718172 | 58 |
| 32 | 3300005436 | Ga0070713_100037902 | Ga0070713_1000379024 | 58 |
| 33 | 3300005436 | Ga0070713_100235418 | Ga0070713_1002354183 | 58 |
| 34 | 3300005437 | Ga0070710_10646984 | Ga0070710_106469842 | 58 |
| 35 | 3300005437 | Ga0070710_11394923 | Ga0070710_113949232 | 58 |
| 36 | 3300005437 | Ga0070710_11429009 | Ga0070710_114290091 | 58 |
| 37 | 3300005439 | Ga0070711_100004422 | Ga0070711_1000044228 | 58 |
| 38 | 3300005439 | Ga0070711_100013801 | Ga0070711_1000138015 | 58 |
| 39 | 3300005439 | Ga0070711_100585970 | Ga0070711_1005859702 | 58 |
| 40 | 3300005439 | Ga0070711_101045403 | Ga0070711_1010454032 | 58 |
| 41 | 3300005439 | Ga0070711_101611461 | Ga0070711_1016114611 | 58 |
| 42 | 3300005441 | Ga0070700_101911325 | Ga0070700_1019113251 | 58 |
| 43 | 3300005455 | Ga0070663_100034129 | Ga0070663_1000341294 | 58 |
| 44 | 3300005455 | Ga0070663_100255829 | Ga0070663_1002558292 | 58 |
| 45 | 3300005455 | Ga0070663_100399998 | Ga0070663_1003999982 | 58 |
| 46 | 3300005455 | Ga0070663_100427434 | Ga0070663_1004274342 | 58 |
| 47 | 3300005455 | Ga0070663_100662746 | Ga0070663_1006627462 | 58 |
| 48 | 3300005455 | Ga0070663_100907133 | Ga0070663_1009071332 | 58 |
| 49 | 3300005456 | Ga0070678_100118683 | Ga0070678_1001186832 | 58 |
| 50 | 3300005456 | Ga0070678_102212541 | Ga0070678_1022125411 | 58 |
| 51 | 3300005458 | Ga0070681_10001077 | Ga0070681_1000107711 | 58 |
| 52 | 3300005458 | Ga0070681_10067755 | Ga0070681_100677552 | 58 |
| 53 | 3300005458 | Ga0070681_10138614 | Ga0070681_101386143 | 58 |
| 54 | 3300005458 | Ga0070681_10202596 | Ga0070681_102025962 | 58 |
| 55 | 3300005459 | Ga0068867_100443955 | Ga0068867_1004439552 | 58 |
| 56 | 3300005466 | Ga0070685_11001738 | Ga0070685_110017382 | 58 |
| 57 | 3300005467 | Ga0070706_101350705 | Ga0070706_1013507052 | 58 |
| 58 | 3300005518 | Ga0070699_101360571 | Ga0070699_1013605712 | 58 |
| 59 | 3300005530 | Ga0070679_100074727 | Ga0070679_1000747274 | 58 |
| 60 | 3300005530 | Ga0070679_100137816 | Ga0070679_1001378163 | 58 |
| 61 | 3300005530 | Ga0070679_100210300 | Ga0070679_1002103002 | 58 |
| 62 | 3300005530 | Ga0070679_101845088 | Ga0070679_1018450882 | 58 |
| 63 | 3300005530 | Ga0070679_102041598 | Ga0070679_1020415981 | 58 |
| 64 | 3300005535 | Ga0070684_100014169 | Ga0070684_1000141693 | 58 |
| 65 | 3300005535 | Ga0070684_100062962 | Ga0070684_1000629623 | 58 |
| 66 | 3300005535 | Ga0070684_100134499 | Ga0070684_1001344993 | 58 |
| 67 | 3300005535 | Ga0070684_100258132 | Ga0070684_1002581321 | 58 |
| 68 | 3300005536 | Ga0070697_100932647 | Ga0070697_1009326472 | 58 |
| 69 | 3300005536 | Ga0070697_101244284 | Ga0070697_1012442842 | 58 |
| 70 | 3300005539 | Ga0068853_100050798 | Ga0068853_1000507984 | 58 |
| 71 | 3300005539 | Ga0068853_100738271 | Ga0068853_1007382712 | 58 |
| 72 | 3300005539 | Ga0068853_100894012 | Ga0068853_1008940121 | 58 |
| 73 | 3300005539 | Ga0068853_100991068 | Ga0068853_1009910681 | 58 |
| 74 | 3300005543 | Ga0070672_100626023 | Ga0070672_1006260232 | 58 |
| 75 | 3300005545 | Ga0070695_101341023 | Ga0070695_1013410231 | 58 |
| 76 | 3300005546 | Ga0070696_101648826 | Ga0070696_1016488262 | 58 |
| 77 | 3300005547 | Ga0070693_100155781 | Ga0070693_1001557813 | 58 |
| 78 | 3300005548 | Ga0070665_100113166 | Ga0070665_1001131665 | 58 |
| 79 | 3300005548 | Ga0070665_101238078 | Ga0070665_1012380782 | 58 |
| 80 | 3300005548 | Ga0070665_101508950 | Ga0070665_1015089502 | 58 |
| 81 | 3300005563 | Ga0068855_100234941 | Ga0068855_1002349413 | 58 |
| 82 | 3300005563 | Ga0068855_100325036 | Ga0068855_1003250362 | 58 |
| 83 | 3300005564 | Ga0070664_100337346 | Ga0070664_1003373462 | 58 |
| 84 | 3300005564 | Ga0070664_100701948 | Ga0070664_1007019482 | 58 |
| 85 | 3300005564 | Ga0070664_100794046 | Ga0070664_1007940462 | 58 |
| 86 | 3300005564 | Ga0070664_101071009 | Ga0070664_1010710092 | 58 |
| 87 | 3300005577 | Ga0068857_100033406 | Ga0068857_1000334064 | 58 |
| 88 | 3300005577 | Ga0068857_100278299 | Ga0068857_1002782992 | 58 |
| 89 | 3300005577 | Ga0068857_100484269 | Ga0068857_1004842692 | 58 |
| 90 | 3300005578 | Ga0068854_100446137 | Ga0068854_1004461372 | 58 |
| 91 | 3300005578 | Ga0068854_100733195 | Ga0068854_1007331952 | 58 |
| 92 | 3300005578 | Ga0068854_101365078 | Ga0068854_1013650782 | 58 |
| 93 | 3300005614 | Ga0068856_100000883 | Ga0068856_10000088317 | 58 |
| 94 | 3300005614 | Ga0068856_100185359 | Ga0068856_1001853591 | 58 |
| 95 | 3300005614 | Ga0068856_102130367 | Ga0068856_1021303672 | 58 |
| 96 | 3300005614 | Ga0068856_102155659 | Ga0068856_1021556592 | 58 |
| 97 | 3300005615 | Ga0070702_100771141 | Ga0070702_1007711412 | 58 |
| 98 | 3300005616 | Ga0068852_100137945 | Ga0068852_1001379454 | 58 |
| 99 | 3300005616 | Ga0068852_101144966 | Ga0068852_1011449662 | 58 |
| 100 | 3300005616 | Ga0068852_101236745 | Ga0068852_1012367452 | 58 |
| 101 | 3300005618 | Ga0068864_100697192 | Ga0068864_1006971922 | 58 |
| 102 | 3300005718 | Ga0068866_11170866 | Ga0068866_111708662 | 58 |
| 103 | 3300005719 | Ga0068861_100102538 | Ga0068861_1001025384 | 58 |
| 104 | 3300005834 | Ga0068851_10030531 | Ga0068851_100305314 | 58 |
| 105 | 3300005834 | Ga0068851_10272978 | Ga0068851_102729782 | 58 |
| 106 | 3300005841 | Ga0068863_100609883 | Ga0068863_1006098832 | 58 |
| 107 | 3300005842 | Ga0068858_102225665 | Ga0068858_1022256651 | 58 |
| 108 | 3300005843 | Ga0068860_100302277 | Ga0068860_1003022773 | 58 |
| 109 | 3300005937 | Ga0081455_10050780 | Ga0081455_100507805 | 58 |
| 110 | 3300005983 | Ga0081540_1005580 | Ga0081540_10055806 | 58 |
| 111 | 3300005983 | Ga0081540_1036340 | Ga0081540_10363402 | 58 |
| 112 | 3300005985 | Ga0081539_10031076 | Ga0081539_100310763 | 58 |
| 113 | 3300006028 | Ga0070717_10010596 | Ga0070717_100105965 | 58 |
| 114 | 3300006028 | Ga0070717_10707160 | Ga0070717_107071602 | 58 |
| 115 | 3300006028 | Ga0070717_10973001 | Ga0070717_109730012 | 58 |
| 116 | 3300006038 | Ga0075365_10043435 | Ga0075365_100434354 | 58 |
| 117 | 3300006038 | Ga0075365_10337527 | Ga0075365_103375272 | 58 |
| 118 | 3300006038 | Ga0075365_10395277 | Ga0075365_103952772 | 58 |
| 119 | 3300006038 | Ga0075365_10649289 | Ga0075365_106492892 | 58 |
| 120 | 3300006048 | Ga0075363_100114480 | Ga0075363_1001144802 | 58 |
| 121 | 3300006048 | Ga0075363_100246140 | Ga0075363_1002461402 | 58 |
| 122 | 3300006051 | Ga0075364_10099785 | Ga0075364_100997854 | 58 |
| 123 | 3300006051 | Ga0075364_10669110 | Ga0075364_106691102 | 58 |
| 124 | 3300006051 | Ga0075364_10695549 | Ga0075364_106955492 | 58 |
| 125 | 3300006051 | Ga0075364_11132101 | Ga0075364_111321012 | 58 |
| 126 | 3300006163 | Ga0070715_10114301 | Ga0070715_101143012 | 58 |
| 127 | 3300006173 | Ga0070716_100636588 | Ga0070716_1006365882 | 58 |
| 128 | 3300006173 | Ga0070716_100815104 | Ga0070716_1008151042 | 58 |
| 129 | 3300006173 | Ga0070716_101249910 | Ga0070716_1012499102 | 58 |
| 130 | 3300006173 | Ga0070716_101526249 | Ga0070716_1015262492 | 58 |
| 131 | 3300006175 | Ga0070712_100069559 | Ga0070712_1000695594 | 58 |
| 132 | 3300006175 | Ga0070712_100169236 | Ga0070712_1001692363 | 58 |
| 133 | 3300006175 | Ga0070712_100973289 | Ga0070712_1009732892 | 58 |
| 134 | 3300006175 | Ga0070712_101093769 | Ga0070712_1010937692 | 58 |
| 135 | 3300006177 | Ga0075362_10638160 | Ga0075362_106381602 | 58 |
| 136 | 3300006178 | Ga0075367_10088967 | Ga0075367_100889672 | 58 |
| 137 | 3300006186 | Ga0075369_10172646 | Ga0075369_101726462 | 58 |
| 138 | 3300006237 | Ga0097621_101076806 | Ga0097621_1010768062 | 58 |
| 139 | 3300006237 | Ga0097621_101125780 | Ga0097621_1011257802 | 58 |
| 140 | 3300006237 | Ga0097621_101735319 | Ga0097621_1017353192 | 58 |
| 141 | 3300006237 | Ga0097621_102389613 | Ga0097621_1023896132 | 58 |
| 142 | 3300006353 | Ga0075370_10141709 | Ga0075370_101417093 | 58 |
| 143 | 3300006353 | Ga0075370_10269892 | Ga0075370_102698921 | 58 |
| 144 | 3300006353 | Ga0075370_10411781 | Ga0075370_104117812 | 58 |
| 145 | 3300006358 | Ga0068871_100989737 | Ga0068871_1009897372 | 58 |
| 146 | 3300006852 | Ga0075433_11306457 | Ga0075433_113064572 | 58 |
| 147 | 3300006871 | Ga0075434_100106463 | Ga0075434_1001064633 | 58 |
| 148 | 3300006880 | Ga0075429_100129121 | Ga0075429_1001291214 | 58 |
| 149 | 3300006881 | Ga0068865_100649218 | Ga0068865_1006492182 | 58 |
| 150 | 3300007076 | Ga0075435_100017556 | Ga0075435_1000175565 | 58 |
| 151 | 3300007076 | Ga0075435_100250082 | Ga0075435_1002500822 | 58 |
| 152 | 3300007265 | Ga0099794_10500555 | Ga0099794_105005552 | 58 |
| 153 | 3300009092 | Ga0105250_10131028 | Ga0105250_101310282 | 58 |
| 154 | 3300009093 | Ga0105240_10082975 | Ga0105240_100829755 | 58 |
| 155 | 3300009093 | Ga0105240_10103958 | Ga0105240_101039584 | 58 |
| 156 | 3300009093 | Ga0105240_11261316 | Ga0105240_112613162 | 58 |
| 157 | 3300009101 | Ga0105247_10422786 | Ga0105247_104227862 | 58 |
| 158 | 3300009101 | Ga0105247_10464656 | Ga0105247_104646562 | 58 |
| 159 | 3300009148 | Ga0105243_10807452 | Ga0105243_108074522 | 58 |
| 160 | 3300009148 | Ga0105243_11357155 | Ga0105243_113571552 | 58 |
| 161 | 3300009148 | Ga0105243_11410672 | Ga0105243_114106721 | 58 |
| 162 | 3300009174 | Ga0105241_10345784 | Ga0105241_103457842 | 58 |
| 163 | 3300009176 | Ga0105242_10991626 | Ga0105242_109916262 | 58 |
| 164 | 3300009177 | Ga0105248_10374595 | Ga0105248_103745952 | 58 |
| 165 | 3300009177 | Ga0105248_11283825 | Ga0105248_112838252 | 58 |
| 166 | 3300009545 | Ga0105237_10035449 | Ga0105237_100354492 | 58 |
| 167 | 3300009545 | Ga0105237_10251441 | Ga0105237_102514413 | 58 |
| 168 | 3300009545 | Ga0105237_10255792 | Ga0105237_102557923 | 58 |
| 169 | 3300009545 | Ga0105237_10383874 | Ga0105237_103838742 | 58 |
| 170 | 3300009545 | Ga0105237_11925135 | Ga0105237_119251352 | 58 |
| 171 | 3300009551 | Ga0105238_10055393 | Ga0105238_100553935 | 58 |
| 172 | 3300009551 | Ga0105238_10224258 | Ga0105238_102242582 | 58 |
| 173 | 3300009551 | Ga0105238_11142189 | Ga0105238_111421892 | 58 |
| 174 | 3300009551 | Ga0105238_11728046 | Ga0105238_117280462 | 58 |
| 175 | 3300009551 | Ga0105238_12403090 | Ga0105238_124030902 | 58 |
| 176 | 3300009553 | Ga0105249_10120137 | Ga0105249_101201374 | 58 |
| 177 | 3300009553 | Ga0105249_12278030 | Ga0105249_122780302 | 58 |
| 178 | 3300010159 | Ga0099796_10313878 | Ga0099796_103138782 | 58 |
| 179 | 3300010375 | Ga0105239_10149716 | Ga0105239_101497163 | 58 |
| 180 | 3300010375 | Ga0105239_10957711 | Ga0105239_109577111 | 58 |
| 181 | 3300010375 | Ga0105239_10983446 | Ga0105239_109834462 | 58 |
| 182 | 3300010375 | Ga0105239_13161928 | Ga0105239_131619281 | 58 |
| 183 | 3300012497 | Ga0157319_1008774 | Ga0157319_10087741 | 58 |
| 184 | 3300013104 | Ga0157370_10448664 | Ga0157370_104486642 | 58 |
| 185 | 3300013104 | Ga0157370_11422785 | Ga0157370_114227852 | 58 |
| 186 | 3300013104 | Ga0157370_11719075 | Ga0157370_117190752 | 58 |
| 187 | 3300013105 | Ga0157369_10002556 | Ga0157369_1000255618 | 58 |
| 188 | 3300013105 | Ga0157369_10096664 | Ga0157369_100966643 | 58 |
| 189 | 3300013105 | Ga0157369_10690186 | Ga0157369_106901861 | 58 |
| 190 | 3300013105 | Ga0157369_12547113 | Ga0157369_125471132 | 58 |
| 191 | 3300013297 | Ga0157378_10676467 | Ga0157378_106764672 | 58 |
| 192 | 3300013297 | Ga0157378_11512605 | Ga0157378_115126052 | 58 |
| 193 | 3300013306 | Ga0163162_10208356 | Ga0163162_102083562 | 58 |
| 194 | 3300013306 | Ga0163162_11968248 | Ga0163162_119682482 | 58 |
| 195 | 3300013307 | Ga0157372_10931208 | Ga0157372_109312082 | 58 |
| 196 | 3300013308 | Ga0157375_11203541 | Ga0157375_112035412 | 58 |
| 197 | 3300014325 | Ga0163163_13340787 | Ga0163163_133407872 | 58 |
| 198 | 3300014326 | Ga0157380_10409237 | Ga0157380_104092372 | 58 |
| 199 | 3300014497 | Ga0182008_10107413 | Ga0182008_101074132 | 58 |
| 200 | 3300014968 | Ga0157379_11985808 | Ga0157379_119858082 | 58 |
| 201 | 3300014969 | Ga0157376_11476046 | Ga0157376_114760462 | 58 |
| 202 | 3300014969 | Ga0157376_12221419 | Ga0157376_122214192 | 58 |
| 203 | 3300014969 | Ga0157376_12340798 | Ga0157376_123407981 | 58 |
| 204 | 3300014969 | Ga0157376_12882820 | Ga0157376_128828202 | 58 |
| 205 | 3300017792 | Ga0163161_10343350 | Ga0163161_103433502 | 58 |
| 206 | 3300020069 | Ga0197907_10041262 | Ga0197907_100412622 | 58 |
| 207 | 3300020070 | Ga0206356_10043115 | Ga0206356_100431152 | 58 |
| 208 | 3300020081 | Ga0206354_10901948 | Ga0206354_109019482 | 58 |
| 209 | 3300020082 | Ga0206353_10873863 | Ga0206353_108738632 | 58 |
| 210 | 3300021361 | Ga0213872_10102891 | Ga0213872_101028912 | 58 |
| 211 | 3300021441 | Ga0213871_10063168 | Ga0213871_100631682 | 58 |
| 212 | 3300025254 | Ga0209148_1000295 | Ga0209148_100029548 | 58 |
| 213 | 3300025261 | Ga0209233_1007194 | Ga0209233_10071944 | 58 |
| 214 | 3300025272 | Ga0209455_1003242 | Ga0209455_10032425 | 58 |
| 215 | 3300025297 | Ga0209758_1001013 | Ga0209758_100101317 | 58 |
| 216 | 3300025297 | Ga0209758_1003254 | Ga0209758_100325410 | 58 |
| 217 | 3300025297 | Ga0209758_1052492 | Ga0209758_10524923 | 58 |
| 218 | 3300025315 | Ga0207697_10128727 | Ga0207697_101287272 | 58 |
| 219 | 3300025321 | Ga0207656_10016861 | Ga0207656_100168612 | 58 |
| 220 | 3300025898 | Ga0207692_10366829 | Ga0207692_103668292 | 58 |
| 221 | 3300025898 | Ga0207692_10403852 | Ga0207692_104038522 | 58 |
| 222 | 3300025898 | Ga0207692_10767106 | Ga0207692_107671062 | 58 |
| 223 | 3300025899 | Ga0207642_10080069 | Ga0207642_100800692 | 58 |
| 224 | 3300025905 | Ga0207685_10066599 | Ga0207685_100665992 | 58 |
| 225 | 3300025905 | Ga0207685_10622233 | Ga0207685_106222332 | 58 |
| 226 | 3300025906 | Ga0207699_10010872 | Ga0207699_100108723 | 58 |
| 227 | 3300025909 | Ga0207705_10049390 | Ga0207705_100493903 | 58 |
| 228 | 3300025909 | Ga0207705_10414138 | Ga0207705_104141382 | 58 |
| 229 | 3300025912 | Ga0207707_10001830 | Ga0207707_1000183014 | 58 |
| 230 | 3300025912 | Ga0207707_10008128 | Ga0207707_100081285 | 58 |
| 231 | 3300025912 | Ga0207707_10059002 | Ga0207707_100590025 | 58 |
| 232 | 3300025912 | Ga0207707_10093659 | Ga0207707_100936593 | 58 |
| 233 | 3300025912 | Ga0207707_10170982 | Ga0207707_101709822 | 58 |
| 234 | 3300025913 | Ga0207695_10069402 | Ga0207695_100694023 | 58 |
| 235 | 3300025913 | Ga0207695_11022785 | Ga0207695_110227852 | 58 |
| 236 | 3300025913 | Ga0207695_11351961 | Ga0207695_113519612 | 58 |
| 237 | 3300025914 | Ga0207671_10276376 | Ga0207671_102763763 | 58 |
| 238 | 3300025914 | Ga0207671_11199470 | Ga0207671_111994702 | 58 |
| 239 | 3300025915 | Ga0207693_10025107 | Ga0207693_100251076 | 58 |
| 240 | 3300025915 | Ga0207693_10137110 | Ga0207693_101371103 | 58 |
| 241 | 3300025915 | Ga0207693_10629760 | Ga0207693_106297602 | 58 |
| 242 | 3300025916 | Ga0207663_10079167 | Ga0207663_100791672 | 58 |
| 243 | 3300025916 | Ga0207663_10207923 | Ga0207663_102079232 | 58 |
| 244 | 3300025916 | Ga0207663_10693315 | Ga0207663_106933152 | 58 |
| 245 | 3300025916 | Ga0207663_11646587 | Ga0207663_116465872 | 58 |
| 246 | 3300025917 | Ga0207660_10008461 | Ga0207660_100084614 | 58 |
| 247 | 3300025917 | Ga0207660_10017636 | Ga0207660_100176361 | 58 |
| 248 | 3300025917 | Ga0207660_10164607 | Ga0207660_101646073 | 58 |
| 249 | 3300025917 | Ga0207660_10189206 | Ga0207660_101892062 | 58 |
| 250 | 3300025917 | Ga0207660_10955152 | Ga0207660_109551522 | 58 |
| 251 | 3300025919 | Ga0207657_10022795 | Ga0207657_100227955 | 58 |
| 252 | 3300025920 | Ga0207649_10122254 | Ga0207649_101222542 | 58 |
| 253 | 3300025920 | Ga0207649_10155073 | Ga0207649_101550733 | 58 |
| 254 | 3300025921 | Ga0207652_10018784 | Ga0207652_100187845 | 58 |
| 255 | 3300025921 | Ga0207652_10048787 | Ga0207652_100487873 | 58 |
| 256 | 3300025921 | Ga0207652_10076567 | Ga0207652_100765673 | 58 |
| 257 | 3300025921 | Ga0207652_10078201 | Ga0207652_100782014 | 58 |
| 258 | 3300025921 | Ga0207652_11403618 | Ga0207652_114036182 | 58 |
| 259 | 3300025924 | Ga0207694_10025727 | Ga0207694_100257275 | 58 |
| 260 | 3300025924 | Ga0207694_10163685 | Ga0207694_101636852 | 58 |
| 261 | 3300025924 | Ga0207694_10461323 | Ga0207694_104613232 | 58 |
| 262 | 3300025924 | Ga0207694_11530553 | Ga0207694_115305532 | 58 |
| 263 | 3300025928 | Ga0207700_10031127 | Ga0207700_100311275 | 58 |
| 264 | 3300025928 | Ga0207700_10221842 | Ga0207700_102218423 | 58 |
| 265 | 3300025929 | Ga0207664_10091181 | Ga0207664_100911813 | 58 |
| 266 | 3300025932 | Ga0207690_10331349 | Ga0207690_103313492 | 58 |
| 267 | 3300025933 | Ga0207706_10194624 | Ga0207706_101946243 | 58 |
| 268 | 3300025933 | Ga0207706_10968838 | Ga0207706_109688382 | 58 |
| 269 | 3300025935 | Ga0207709_10573293 | Ga0207709_105732932 | 58 |
| 270 | 3300025935 | Ga0207709_10817494 | Ga0207709_108174942 | 58 |
| 271 | 3300025937 | Ga0207669_11180070 | Ga0207669_111800702 | 58 |
| 272 | 3300025937 | Ga0207669_11272110 | Ga0207669_112721102 | 58 |
| 273 | 3300025939 | Ga0207665_10028702 | Ga0207665_100287024 | 58 |
| 274 | 3300025939 | Ga0207665_10491769 | Ga0207665_104917692 | 58 |
| 275 | 3300025939 | Ga0207665_10796180 | Ga0207665_107961802 | 58 |
| 276 | 3300025939 | Ga0207665_11121513 | Ga0207665_111215132 | 58 |
| 277 | 3300025940 | Ga0207691_10070200 | Ga0207691_100702005 | 58 |
| 278 | 3300025944 | Ga0207661_10004360 | Ga0207661_100043606 | 58 |
| 279 | 3300025944 | Ga0207661_10017144 | Ga0207661_100171444 | 58 |
| 280 | 3300025944 | Ga0207661_10041208 | Ga0207661_100412085 | 58 |
| 281 | 3300025945 | Ga0207679_10222756 | Ga0207679_102227563 | 58 |
| 282 | 3300025945 | Ga0207679_10585848 | Ga0207679_105858482 | 58 |
| 283 | 3300025945 | Ga0207679_10744386 | Ga0207679_107443862 | 58 |
| 284 | 3300025945 | Ga0207679_12075607 | Ga0207679_120756072 | 58 |
| 285 | 3300025949 | Ga0207667_10046395 | Ga0207667_100463953 | 58 |
| 286 | 3300025949 | Ga0207667_10086452 | Ga0207667_100864523 | 58 |
| 287 | 3300025949 | Ga0207667_10221432 | Ga0207667_102214323 | 58 |
| 288 | 3300025949 | Ga0207667_11722931 | Ga0207667_117229312 | 58 |
| 289 | 3300025949 | Ga0207667_12107007 | Ga0207667_121070072 | 58 |
| 290 | 3300025972 | Ga0207668_10446952 | Ga0207668_104469522 | 58 |
| 291 | 3300025972 | Ga0207668_10948418 | Ga0207668_109484182 | 58 |
| 292 | 3300025972 | Ga0207668_11178023 | Ga0207668_111780231 | 58 |
| 293 | 3300025981 | Ga0207640_10522392 | Ga0207640_105223922 | 58 |
| 294 | 3300026041 | Ga0207639_10084729 | Ga0207639_100847293 | 58 |
| 295 | 3300026041 | Ga0207639_10293443 | Ga0207639_102934432 | 58 |
| 296 | 3300026041 | Ga0207639_10787979 | Ga0207639_107879792 | 58 |
| 297 | 3300026067 | Ga0207678_10004213 | Ga0207678_100042137 | 58 |
| 298 | 3300026067 | Ga0207678_10522643 | Ga0207678_105226432 | 58 |
| 299 | 3300026067 | Ga0207678_10615552 | Ga0207678_106155522 | 58 |
| 300 | 3300026067 | Ga0207678_11512877 | Ga0207678_115128772 | 58 |
| 301 | 3300026075 | Ga0207708_10440067 | Ga0207708_104400672 | 58 |
| 302 | 3300026078 | Ga0207702_10000318 | Ga0207702_1000031816 | 58 |
| 303 | 3300026078 | Ga0207702_10314263 | Ga0207702_103142633 | 58 |
| 304 | 3300026078 | Ga0207702_10469132 | Ga0207702_104691323 | 58 |
| 305 | 3300026078 | Ga0207702_10633721 | Ga0207702_106337212 | 58 |
| 306 | 3300026078 | Ga0207702_11237301 | Ga0207702_112373012 | 58 |
| 307 | 3300026078 | Ga0207702_11350149 | Ga0207702_113501492 | 58 |
| 308 | 3300026088 | Ga0207641_10551532 | Ga0207641_105515322 | 58 |
| 309 | 3300026088 | Ga0207641_11512971 | Ga0207641_115129712 | 58 |
| 310 | 3300026089 | Ga0207648_10380350 | Ga0207648_103803502 | 58 |
| 311 | 3300026095 | Ga0207676_10653774 | Ga0207676_106537742 | 58 |
| 312 | 3300026116 | Ga0207674_10100669 | Ga0207674_101006694 | 58 |
| 313 | 3300026116 | Ga0207674_10117297 | Ga0207674_101172973 | 58 |
| 314 | 3300026116 | Ga0207674_10543883 | Ga0207674_105438832 | 58 |
| 315 | 3300026116 | Ga0207674_11649813 | Ga0207674_116498131 | 58 |
| 316 | 3300026121 | Ga0207683_10927454 | Ga0207683_109274542 | 58 |
| 317 | 3300026142 | Ga0207698_10187729 | Ga0207698_101877292 | 58 |
| 318 | 3300026142 | Ga0207698_12248129 | Ga0207698_122481291 | 58 |
| 319 | 3300028379 | Ga0268266_10213070 | Ga0268266_102130702 | 58 |
| 320 | 3300028379 | Ga0268266_11077111 | Ga0268266_110771111 | 58 |
| 321 | 3300028794 | Ga0307515_10191546 | Ga0307515_101915463 | 58 |
| 322 | 3300031239 | Ga0265328_10130440 | Ga0265328_101304402 | 58 |
| 323 | 3300031249 | Ga0265339_10355550 | Ga0265339_103555502 | 58 |
| 324 | 3300031456 | Ga0307513_10931616 | Ga0307513_109316162 | 58 |
| 325 | 3300031548 | Ga0307408_102239940 | Ga0307408_1022399402 | 58 |
| 326 | 3300031616 | Ga0307508_10000045 | Ga0307508_1000004546 | 58 |
| 327 | 3300031616 | Ga0307508_10024470 | Ga0307508_100244704 | 58 |
| 328 | 3300031616 | Ga0307508_10691212 | Ga0307508_106912122 | 58 |
| 329 | 3300031711 | Ga0265314_10151721 | Ga0265314_101517212 | 58 |
| 330 | 3300031731 | Ga0307405_10514475 | Ga0307405_105144751 | 58 |
| 331 | 3300031731 | Ga0307405_10614393 | Ga0307405_106143932 | 58 |
| 332 | 3300031824 | Ga0307413_10995885 | Ga0307413_109958852 | 58 |
| 333 | 3300031824 | Ga0307413_11977996 | Ga0307413_119779962 | 58 |
| 334 | 3300031889 | Ga0326468_10024312 | Ga0326468_100243121 | 58 |
| 335 | 3300031901 | Ga0307406_10923955 | Ga0307406_109239552 | 58 |
| 336 | 3300031911 | Ga0307412_10032668 | Ga0307412_100326684 | 58 |
| 337 | 3300031911 | Ga0307412_10708243 | Ga0307412_107082432 | 58 |
| 338 | 3300031911 | Ga0307412_11477899 | Ga0307412_114778992 | 58 |
| 339 | 3300031995 | Ga0307409_100312813 | Ga0307409_1003128132 | 58 |
| 340 | 3300031995 | Ga0307409_100473334 | Ga0307409_1004733342 | 58 |
| 341 | 3300032002 | Ga0307416_100417733 | Ga0307416_1004177331 | 58 |
| 342 | 3300032002 | Ga0307416_100484234 | Ga0307416_1004842342 | 58 |
| 343 | 3300032002 | Ga0307416_101206065 | Ga0307416_1012060652 | 58 |
| 344 | 3300032005 | Ga0307411_11002459 | Ga0307411_110024592 | 58 |
| 345 | 3300032005 | Ga0307411_11213109 | Ga0307411_112131092 | 58 |
| 346 | 3300032005 | Ga0307411_11502652 | Ga0307411_115026522 | 58 |
| 347 | 3300032126 | Ga0307415_101010633 | Ga0307415_1010106332 | 58 |
| 348 | 3300032126 | Ga0307415_101076124 | Ga0307415_1010761241 | 58 |
| 349 | 3300035086 | Ga0373934_0033081 | Ga0373934_0033081_944_1123 | 58 |
| 350 | 3300035089 | Ga0373944_0108551 | Ga0373944_0108551_510_689 | 58 |
| 351 | 3300035111 | Ga0373923_0050361 | Ga0373923_0050361_577_756 | 58 |
| 352 | 3300035111 | Ga0373923_0052729 | Ga0373923_0052729_846_1025 | 58 |
| 353 | 3300035113 | Ga0373936_0041380 | Ga0373936_0041380_492_671 | 58 |
| 354 | 3300035116 | Ga0373945_0156028 | Ga0373945_0156028_32_211 | 58 |
| 355 | 3300035117 | Ga0373953_0018502 | Ga0373953_0018502_1140_1319 | 58 |
| 356 | 3300035117 | Ga0373953_0018581 | Ga0373953_0018581_1588_1767 | 58 |
| 357 | 3300035118 | Ga0373954_0006969 | Ga0373954_0006969_864_1043 | 58 |
| 358 | 3300035118 | Ga0373954_0007810 | Ga0373954_0007810_4122_4301 | 58 |
| 359 | 3300035118 | Ga0373954_0023461 | Ga0373954_0023461_279_458 | 58 |
| 360 | 3300035119 | Ga0373956_0088528 | Ga0373956_0088528_711_890 | 58 |
| 361 | 3300035120 | Ga0373957_0052286 | Ga0373957_0052286_1040_1219 | 58 |
| 362 | 3300035120 | Ga0373957_0101302 | Ga0373957_0101302_678_857 | 58 |
| 363 | 3300035170 | Ga0373943_0009727 | Ga0373943_0009727_618_797 | 58 |
| 364 | 3300035172 | Ga0373955_0002799 | Ga0373955_0002799_1019_1198 | 58 |
| 365 | 3300035172 | Ga0373955_0056100 | Ga0373955_0056100_1156_1335 | 58 |
| 366 | 3300035172 | Ga0373955_0401811 | Ga0373955_0401811_32_211 | 58 |
| 367 | 3300035410 | Ga0373924_0041454 | Ga0373924_0041454_1181_1360 | 58 |
| 368 | 3300035410 | Ga0373924_0045145 | Ga0373924_0045145_1383_1562 | 58 |
| 369 | 3300035410 | Ga0373924_0136808 | Ga0373924_0136808_462_641 | 58 |
| 370 | 3300035691 | Ga0373931_0829866 | Ga0373931_0829866_269_448 | 58 |
| 371 | 3300035692 | Ga0373935_0117792 | Ga0373935_0117792_984_1163 | 58 |
| 372 | 3300035692 | Ga0373935_0128647 | Ga0373935_0128647_523_702 | 58 |
| 373 | 3300035692 | Ga0373935_1243793 | Ga0373935_1243793_176_355 | 58 |
| 374 | 3300035695 | Ga0373927_0090551 | Ga0373927_0090551_1130_1309 | 58 |
| 375 | 3300035724 | Ga0373933_0513536 | Ga0373933_0513536_193_372 | 58 |
| 376 | 3300035724 | Ga0373933_0640520 | Ga0373933_0640520_171_350 | 58 |
| 377 | 3300035725 | Ga0373947_0034346 | Ga0373947_0034346_1654_1833 | 58 |
| 378 | 3300036401 | Ga0373937_0019726 | Ga0373937_0019726_2134_2313 | 58 |
| 379 | 3300036401 | Ga0373937_0029464 | Ga0373937_0029464_3770_3949 | 58 |
| 380 | 3300036401 | Ga0373937_0046562 | Ga0373937_0046562_1780_1959 | 58 |
| 381 | 3300036459 | Ga0372808_000548 | Ga0372808_000548_2126_2302 | 58 |
| 382 | 3300037068 | Ga0373925_0012279 | Ga0373925_0012279_283_462 | 58 |
| 383 | 3300037068 | Ga0373925_0110821 | Ga0373925_0110821_139_318 | 58 |
| 384 | 3300037068 | Ga0373925_1511270 | Ga0373925_1511270_187_363 | 58 |
| 385 | 3300037312 | Ga0395899_0191736 | Ga0395899_0191736_1073_1252 | 58 |
| 386 | 3300037418 | Ga0395900_0977528 | Ga0395900_0977528_110_289 | 58 |
| 387 | 3300037466 | Ga0395898_1303842 | Ga0395898_1303842_372_551 | 58 |
| 388 | 3300038443 | Ga0395901_0267112 | Ga0395901_0267112_908_1087 | 58 |
| 389 | 3300039437 | Ga0436365_0422270 | Ga0436365_0422270_64_240 | 58 |
| 390 | 3300039437 | Ga0436365_1865258 | Ga0436365_1865258_858_1037 | 58 |
| 391 | 3300039438 | Ga0436360_0035660 | Ga0436360_0035660_813_992 | 58 |
| 392 | 3300039447 | Ga0436361_0034753 | Ga0436361_0034753_2014_2193 | 58 |
| 393 | 3300039447 | Ga0436361_0208430 | Ga0436361_0208430_489_668 | 58 |
| 394 | 3300039450 | Ga0436363_0976239 | Ga0436363_0976239_771_950 | 58 |
| 395 | 3300039450 | Ga0436363_1632720 | Ga0436363_1632720_661_843 | 58 |
| 396 | 3300039453 | Ga0436362_0798067 | Ga0436362_0798067_3263_3442 | 58 |
| 397 | 3300041459 | Ga0451800_1499558 | Ga0451800_1499558_115_291 | 58 |
| 398 | 3300041463 | Ga0451804_0609357 | Ga0451804_0609357_298_477 | 58 |
| 399 | 3300041496 | Ga0451839_0628551 | Ga0451839_0628551_75_251 | 58 |
| 400 | 3300041498 | Ga0451841_1157327 | Ga0451841_1157327_419_598 | 58 |
| 401 | 3300042438 | Ga0439459_0046903 | Ga0439459_0046903_441_617 | 58 |
| 402 | 3300044684 | Ga0466966_0056008 | Ga0466966_0056008_991_1170 | 58 |
| 403 | 3300044684 | Ga0466966_0669967 | Ga0466966_0669967_312_491 | 58 |
| 404 | 3300044693 | Ga0466961_0190673 | Ga0466961_0190673_603_782 | 58 |
| 405 | 3300044694 | Ga0466963_0082044 | Ga0466963_0082044_722_901 | 58 |
| 406 | 3300044706 | Ga0466964_0076656 | Ga0466964_0076656_293_472 | 58 |
| 407 | 3300044765 | Ga0466970_0142879 | Ga0466970_0142879_823_1002 | 58 |
| 408 | 3300044765 | Ga0466970_0330453 | Ga0466970_0330453_139_318 | 58 |
| 409 | 3300044842 | Ga0466957_0107372 | Ga0466957_0107372_1084_1263 | 58 |
| 410 | 3300044842 | Ga0466957_0777719 | Ga0466957_0777719_429_608 | 58 |
| 411 | 3300045049 | Ga0466959_0014935 | Ga0466959_0014935_4718_4897 | 58 |
| 412 | 3300045049 | Ga0466959_0063742 | Ga0466959_0063742_1995_2174 | 58 |
| 413 | 3300045836 | Ga0466958_0316935 | Ga0466958_0316935_597_776 | 58 |
| 414 | 3300045976 | Ga0466967_0281578 | Ga0466967_0281578_35_214 | 58 |
| 415 | 3300045976 | Ga0466967_0515142 | Ga0466967_0515142_649_828 | 58 |
| 416 | 3300045976 | Ga0466967_1794918 | Ga0466967_1794918_139_318 | 58 |
| 417 | 3300046454 | Ga0495592_0026198 | Ga0495592_0026198_489_668 | 58 |
| 418 | 3300046454 | Ga0495592_0076532 | Ga0495592_0076532_872_1051 | 58 |
| 419 | 3300046454 | Ga0495592_0144855 | Ga0495592_0144855_772_951 | 58 |
| 420 | 3300046454 | Ga0495592_0247576 | Ga0495592_0247576_247_426 | 58 |
| 421 | 3300046455 | Ga0495603_0155244 | Ga0495603_0155244_195_371 | 58 |
| 422 | 3300046455 | Ga0495603_0545228 | Ga0495603_0545228_432_611 | 58 |
| 423 | 3300046458 | Ga0495591_092469 | Ga0495591_092469_173_349 | 58 |
| 424 | 3300046459 | Ga0495629_0017285 | Ga0495629_0017285_3854_4033 | 58 |
| 425 | 3300046459 | Ga0495629_0072839 | Ga0495629_0072839_290_469 | 58 |
| 426 | 3300046460 | Ga0495638_0088791 | Ga0495638_0088791_972_1151 | 58 |
| 427 | 3300046460 | Ga0495638_0230549 | Ga0495638_0230549_137_316 | 58 |
| 428 | 3300046460 | Ga0495638_0351035 | Ga0495638_0351035_116_295 | 58 |
| 429 | 3300046460 | Ga0495638_0494309 | Ga0495638_0494309_264_440 | 58 |
| 430 | 3300046460 | Ga0495638_0583231 | Ga0495638_0583231_142_321 | 58 |
| 431 | 3300046461 | Ga0495641_0115962 | Ga0495641_0115962_532_708 | 58 |
| 432 | 3300046461 | Ga0495641_0490904 | Ga0495641_0490904_192_371 | 58 |
| 433 | 3300046462 | Ga0495651_0034650 | Ga0495651_0034650_223_402 | 58 |
| 434 | 3300046462 | Ga0495651_0210693 | Ga0495651_0210693_905_1084 | 58 |
| 435 | 3300046462 | Ga0495651_0313441 | Ga0495651_0313441_82_261 | 58 |
| 436 | 3300046463 | Ga0495653_0011881 | Ga0495653_0011881_356_535 | 58 |
| 437 | 3300046463 | Ga0495653_0105939 | Ga0495653_0105939_1800_1979 | 58 |
| 438 | 3300046463 | Ga0495653_0149079 | Ga0495653_0149079_114_293 | 58 |
| 439 | 3300046472 | Ga0495580_0001981 | Ga0495580_0001981_2004_2183 | 58 |
| 440 | 3300046473 | Ga0495582_0007153 | Ga0495582_0007153_1917_2096 | 58 |
| 441 | 3300046474 | Ga0495605_0306434 | Ga0495605_0306434_386_562 | 58 |
| 442 | 3300046475 | Ga0495639_0004165 | Ga0495639_0004165_3951_4130 | 58 |
| 443 | 3300046475 | Ga0495639_0068928 | Ga0495639_0068928_219_395 | 58 |
| 444 | 3300046476 | Ga0495662_0343618 | Ga0495662_0343618_505_684 | 58 |
| 445 | 3300046477 | Ga0495664_0004612 | Ga0495664_0004612_2750_2929 | 58 |
| 446 | 3300046477 | Ga0495664_0080946 | Ga0495664_0080946_153_332 | 58 |
| 447 | 3300046492 | Ga0495585_0275274 | Ga0495585_0275274_552_728 | 58 |
| 448 | 3300046499 | Ga0495594_0218284 | Ga0495594_0218284_493_672 | 58 |
| 449 | 3300046500 | Ga0495596_0330591 | Ga0495596_0330591_131_307 | 58 |
| 450 | 3300046501 | Ga0495607_0195714 | Ga0495607_0195714_524_700 | 58 |
| 451 | 3300046501 | Ga0495607_0267908 | Ga0495607_0267908_295_474 | 58 |
| 452 | 3300046506 | Ga0495583_0071868 | Ga0495583_0071868_1284_1463 | 58 |
| 453 | 3300046507 | Ga0495606_0047553 | Ga0495606_0047553_1662_1841 | 58 |
| 454 | 3300046511 | Ga0495608_0017638 | Ga0495608_0017638_3371_3550 | 58 |
| 455 | 3300046511 | Ga0495608_0070418 | Ga0495608_0070418_535_714 | 58 |
| 456 | 3300046511 | Ga0495608_0698872 | Ga0495608_0698872_118_297 | 58 |
| 457 | 3300046512 | Ga0495610_0013962 | Ga0495610_0013962_2007_2186 | 58 |
| 458 | 3300046512 | Ga0495610_0277186 | Ga0495610_0277186_395_574 | 58 |
| 459 | 3300046514 | Ga0495618_0014329 | Ga0495618_0014329_2245_2424 | 58 |
| 460 | 3300046514 | Ga0495618_0162324 | Ga0495618_0162324_94_273 | 58 |
| 461 | 3300046514 | Ga0495618_0251260 | Ga0495618_0251260_823_1002 | 58 |
| 462 | 3300046515 | Ga0495620_0028200 | Ga0495620_0028200_2241_2420 | 58 |
| 463 | 3300046515 | Ga0495620_0063536 | Ga0495620_0063536_1116_1292 | 58 |
| 464 | 3300046516 | Ga0495628_0025951 | Ga0495628_0025951_4265_4444 | 58 |
| 465 | 3300046516 | Ga0495628_0543998 | Ga0495628_0543998_229_408 | 58 |
| 466 | 3300046517 | Ga0495630_0110073 | Ga0495630_0110073_645_824 | 58 |
| 467 | 3300046517 | Ga0495630_0808351 | Ga0495630_0808351_88_267 | 58 |
| 468 | 3300046518 | Ga0495631_0036994 | Ga0495631_0036994_378_557 | 58 |
| 469 | 3300046518 | Ga0495631_0043066 | Ga0495631_0043066_1718_1897 | 58 |
| 470 | 3300046518 | Ga0495631_0445304 | Ga0495631_0445304_101_277 | 58 |
| 471 | 3300046519 | Ga0495632_0131004 | Ga0495632_0131004_520_699 | 58 |
| 472 | 3300046520 | Ga0495637_0055392 | Ga0495637_0055392_81_260 | 58 |
| 473 | 3300046522 | Ga0495643_0237461 | Ga0495643_0237461_101_280 | 58 |
| 474 | 3300046522 | Ga0495643_0249730 | Ga0495643_0249730_633_812 | 58 |
| 475 | 3300046523 | Ga0495644_0022208 | Ga0495644_0022208_198_374 | 58 |
| 476 | 3300046524 | Ga0495648_0059255 | Ga0495648_0059255_878_1057 | 58 |
| 477 | 3300046524 | Ga0495648_0324809 | Ga0495648_0324809_302_478 | 58 |
| 478 | 3300046525 | Ga0495663_0073680 | Ga0495663_0073680_384_560 | 58 |
| 479 | 3300046529 | Ga0495652_0021450 | Ga0495652_0021450_2626_2805 | 58 |
| 480 | 3300046529 | Ga0495652_0112657 | Ga0495652_0112657_1663_1842 | 58 |
| 481 | 3300046529 | Ga0495652_0687475 | Ga0495652_0687475_149_328 | 58 |
| 482 | 3300046529 | Ga0495652_0854281 | Ga0495652_0854281_85_264 | 58 |
| 483 | 3300046531 | Ga0495665_0545974 | Ga0495665_0545974_32_211 | 58 |
| 484 | 3300046533 | Ga0495640_0018260 | Ga0495640_0018260_252_431 | 58 |
| 485 | 3300046533 | Ga0495640_0057123 | Ga0495640_0057123_1655_1834 | 58 |
| 486 | 3300046533 | Ga0495640_0092748 | Ga0495640_0092748_162_341 | 58 |
| 487 | 3300046535 | Ga0495586_0562142 | Ga0495586_0562142_259_438 | 58 |
| 488 | 3300046536 | Ga0495587_0009714 | Ga0495587_0009714_5202_5381 | 58 |
| 489 | 3300046536 | Ga0495587_0317659 | Ga0495587_0317659_389_568 | 58 |
| 490 | 3300046536 | Ga0495587_0720322 | Ga0495587_0720322_250_429 | 58 |
| 491 | 3300046537 | Ga0495598_0103970 | Ga0495598_0103970_133_309 | 58 |
| 492 | 3300046538 | Ga0495609_0051495 | Ga0495609_0051495_404_583 | 58 |
| 493 | 3300046538 | Ga0495609_0352142 | Ga0495609_0352142_168_344 | 58 |
| 494 | 3300046538 | Ga0495609_0415617 | Ga0495609_0415617_77_253 | 58 |
| 495 | 3300046539 | Ga0495621_0052498 | Ga0495621_0052498_609_785 | 58 |
| 496 | 3300046543 | Ga0495645_0010485 | Ga0495645_0010485_5648_5827 | 58 |
| 497 | 3300046543 | Ga0495645_0093242 | Ga0495645_0093242_289_468 | 58 |
| 498 | 3300046557 | Ga0495622_0205987 | Ga0495622_0205987_83_259 | 58 |
| 499 | 3300046558 | Ga0495633_0236593 | Ga0495633_0236593_563_739 | 58 |
| 500 | 3300046559 | Ga0495667_0003525 | Ga0495667_0003525_632_811 | 58 |
| 501 | 3300046559 | Ga0495667_0209891 | Ga0495667_0209891_286_465 | 58 |
| 502 | 3300046615 | Ga0495656_0372079 | Ga0495656_0372079_452_628 | 58 |
| 503 | 3300046616 | Ga0495668_0101673 | Ga0495668_0101673_744_920 | 58 |
| 504 | 3300046642 | Ga0495634_0032414 | Ga0495634_0032414_1949_2128 | 58 |
| 505 | 3300046642 | Ga0495634_0051141 | Ga0495634_0051141_2160_2339 | 58 |
| 506 | 3300046642 | Ga0495634_0542737 | Ga0495634_0542737_271_450 | 58 |
| 507 | 3300046648 | Ga0495611_0067172 | Ga0495611_0067172_1263_1442 | 58 |
| 508 | 3300046648 | Ga0495611_0175393 | Ga0495611_0175393_136_315 | 58 |
| 509 | 3300046660 | Ga0495625_0153563 | Ga0495625_0153563_1220_1399 | 58 |
| 510 | 3300046660 | Ga0495625_0621295 | Ga0495625_0621295_379_555 | 58 |
| 511 | 3300046663 | Ga0495635_0007981 | Ga0495635_0007981_5330_5509 | 58 |
| 512 | 3300046663 | Ga0495635_0054013 | Ga0495635_0054013_998_1177 | 58 |
| 513 | 3300046663 | Ga0495635_0112152 | Ga0495635_0112152_673_852 | 58 |
| 514 | 3300046665 | Ga0495661_0194607 | Ga0495661_0194607_593_772 | 58 |
| 515 | 3300046674 | Ga0495588_0267626 | Ga0495588_0267626_610_786 | 58 |
| 516 | 3300046675 | Ga0495657_0004913 | Ga0495657_0004913_762_941 | 58 |
| 517 | 3300046675 | Ga0495657_0232602 | Ga0495657_0232602_113_292 | 58 |
| 518 | 3300046678 | Ga0495599_0429059 | Ga0495599_0429059_484_663 | 58 |
| 519 | 3300046679 | Ga0495623_0041079 | Ga0495623_0041079_1740_1919 | 58 |
| 520 | 3300046679 | Ga0495623_0068214 | Ga0495623_0068214_1484_1663 | 58 |
| 521 | 3300046679 | Ga0495623_0517828 | Ga0495623_0517828_200_379 | 58 |
| 522 | 3300046680 | Ga0495646_0069394 | Ga0495646_0069394_924_1103 | 58 |
| 523 | 3300046680 | Ga0495646_0127658 | Ga0495646_0127658_145_324 | 58 |
| 524 | 3300046680 | Ga0495646_0291614 | Ga0495646_0291614_297_476 | 58 |
| 525 | 3300046681 | Ga0495647_0012555 | Ga0495647_0012555_1665_1844 | 58 |
| 526 | 3300046683 | Ga0495658_0046528 | Ga0495658_0046528_1814_1993 | 58 |
| 527 | 3300046684 | Ga0495669_0172397 | Ga0495669_0172397_147_323 | 58 |
| 528 | 3300046689 | Ga0495613_0132279 | Ga0495613_0132279_909_1088 | 58 |
| 529 | 3300046689 | Ga0495613_0980907 | Ga0495613_0980907_252_431 | 58 |
| 530 | 3300046691 | Ga0495670_0063201 | Ga0495670_0063201_722_901 | 58 |
| 531 | 3300046692 | Ga0495671_0395721 | Ga0495671_0395721_361_540 | 58 |
| 532 | 3300046794 | Ga0495589_0121939 | Ga0495589_0121939_421_597 | 58 |
| 533 | 3300046794 | Ga0495589_0532145 | Ga0495589_0532145_290_466 | 58 |
| 534 | 3300046809 | Ga0495600_0020007 | Ga0495600_0020007_3798_3977 | 58 |
| 535 | 3300046809 | Ga0495600_0196043 | Ga0495600_0196043_586_765 | 58 |
| 536 | 3300046809 | Ga0495600_0284244 | Ga0495600_0284244_292_471 | 58 |
| 537 | 3300046810 | Ga0495660_0113626 | Ga0495660_0113626_109_288 | 58 |
| 538 | 3300047315 | Ga0495581_0713450 | Ga0495581_0713450_329_508 | 58 |
| 539 | 3300047315 | Ga0495581_0910227 | Ga0495581_0910227_241_417 | 58 |
| 540 | 3300047317 | Ga0495604_0002900 | Ga0495604_0002900_1377_1556 | 58 |
| 541 | 3300047317 | Ga0495604_0106518 | Ga0495604_0106518_1631_1810 | 58 |
| 542 | 3300047319 | Ga0495674_0031429 | Ga0495674_0031429_94_273 | 58 |
| 543 | 3300047319 | Ga0495674_0098054 | Ga0495674_0098054_944_1123 | 58 |
| 544 | 3300047319 | Ga0495674_0170502 | Ga0495674_0170502_199_378 | 58 |
| 545 | 3300047320 | Ga0495672_0222555 | Ga0495672_0222555_310_489 | 58 |
| 546 | 3300047320 | Ga0495672_0334975 | Ga0495672_0334975_206_385 | 58 |
| 547 | 3300047321 | Ga0495676_0066265 | Ga0495676_0066265_1926_2102 | 58 |
| 548 | 3300047322 | Ga0495680_0025446 | Ga0495680_0025446_2498_2677 | 58 |
| 549 | 3300047322 | Ga0495680_0052112 | Ga0495680_0052112_1435_1614 | 58 |
| 550 | 3300047322 | Ga0495680_0450725 | Ga0495680_0450725_46_225 | 58 |
| 551 | 3300047444 | Ga0495675_0061451 | Ga0495675_0061451_1943_2122 | 58 |
| 552 | 3300047444 | Ga0495675_0137244 | Ga0495675_0137244_578_757 | 58 |
| 553 | 3300047445 | Ga0495677_0117234 | Ga0495677_0117234_341_517 | 58 |
| 554 | 3300047445 | Ga0495677_0158174 | Ga0495677_0158174_552_728 | 58 |
| 555 | 3300047447 | Ga0495685_150004 | Ga0495685_150004_13_189 | 58 |
| 556 | 3300047469 | Ga0495673_0273062 | Ga0495673_0273062_287_466 | 58 |
| 557 | 3300047470 | Ga0495681_0064308 | Ga0495681_0064308_86_265 | 58 |
| 558 | 3300047471 | Ga0495684_0034017 | Ga0495684_0034017_388_567 | 58 |
| 559 | 3300047471 | Ga0495684_0295214 | Ga0495684_0295214_559_738 | 58 |
| 560 | 3300047472 | Ga0495686_0090210 | Ga0495686_0090210_234_413 | 58 |
| 561 | 3300047472 | Ga0495686_0106625 | Ga0495686_0106625_1311_1490 | 58 |
| 562 | 3300047673 | Ga0495593_0003761 | Ga0495593_0003761_6442_6621 | 58 |
| 563 | 3300047673 | Ga0495593_0017042 | Ga0495593_0017042_1260_1439 | 58 |
| 564 | 3300048088 | Ga0495602_0058849 | Ga0495602_0058849_868_1047 | 58 |
| 565 | 3300048088 | Ga0495602_0111824 | Ga0495602_0111824_905_1084 | 58 |
| 566 | 3300048089 | Ga0495614_0112116 | Ga0495614_0112116_381_560 | 58 |
| 567 | 3300048089 | Ga0495614_0137626 | Ga0495614_0137626_169_348 | 58 |
| 568 | 3300048903 | Ga0496100_0084827 | Ga0496100_0084827_626_805 | 58 |
| 569 | 3300048903 | Ga0496100_0164023 | Ga0496100_0164023_120_299 | 58 |
| 570 | 3300048903 | Ga0496100_0404472 | Ga0496100_0404472_723_902 | 58 |
| 571 | 3300048903 | Ga0496100_1541450 | Ga0496100_1541450_83_262 | 58 |
| 572 | 3300048904 | Ga0496101_0109901 | Ga0496101_0109901_1385_1561 | 58 |
| 573 | 3300048904 | Ga0496101_0161922 | Ga0496101_0161922_1315_1494 | 58 |
| 574 | 3300048904 | Ga0496101_0192059 | Ga0496101_0192059_1321_1497 | 58 |
| 575 | 3300048907 | Ga0496104_1006856 | Ga0496104_1006856_237_413 | 58 |
| 576 | 3300048907 | Ga0496104_1057227 | Ga0496104_1057227_376_555 | 58 |
| 577 | 3300048908 | Ga0496105_0487389 | Ga0496105_0487389_433_609 | 58 |
| 578 | 3300048908 | Ga0496105_0619756 | Ga0496105_0619756_85_264 | 58 |
| 579 | 3300048909 | Ga0496106_0001943 | Ga0496106_0001943_8337_8516 | 58 |
| 580 | 3300048909 | Ga0496106_1221753 | Ga0496106_1221753_174_353 | 58 |
| 581 | 3300048909 | Ga0496106_1342121 | Ga0496106_1342121_311_490 | 58 |
| 582 | 3300048910 | Ga0496107_0008009 | Ga0496107_0008009_6760_6939 | 58 |
| 583 | 3300048910 | Ga0496107_0365946 | Ga0496107_0365946_716_895 | 58 |
| 584 | 3300048910 | Ga0496107_0594152 | Ga0496107_0594152_376_552 | 58 |
| 585 | 3300048911 | Ga0496108_0000927 | Ga0496108_0000927_7649_7828 | 58 |
| 586 | 3300048911 | Ga0496108_1298051 | Ga0496108_1298051_173_352 | 58 |
| 587 | 3300048912 | Ga0496109_0000229 | Ga0496109_0000229_4168_4347 | 58 |
| 588 | 3300048912 | Ga0496109_0098872 | Ga0496109_0098872_2418_2597 | 58 |
| 589 | 3300048912 | Ga0496109_1273344 | Ga0496109_1273344_262_438 | 58 |
| 590 | 3300048913 | Ga0496110_0138835 | Ga0496110_0138835_1791_1970 | 58 |
| 591 | 3300048914 | Ga0496111_0027253 | Ga0496111_0027253_653_832 | 58 |
| 592 | 3300048914 | Ga0496111_0200167 | Ga0496111_0200167_124_303 | 58 |
| 593 | 3300048915 | Ga0496112_0001343 | Ga0496112_0001343_3027_3206 | 58 |
| 594 | 3300048916 | Ga0496113_0751627 | Ga0496113_0751627_356_535 | 58 |
| 595 | 3300048917 | Ga0496114_0118033 | Ga0496114_0118033_1793_1972 | 58 |
| 596 | 3300048917 | Ga0496114_0287126 | Ga0496114_0287126_479_661 | 58 |
| 597 | 3300048917 | Ga0496114_0395961 | Ga0496114_0395961_702_881 | 58 |
| 598 | 3300048917 | Ga0496114_0428277 | Ga0496114_0428277_784_960 | 58 |
| 599 | 3300048917 | Ga0496114_1081221 | Ga0496114_1081221_135_314 | 58 |
| 600 | 3300048917 | Ga0496114_1782771 | Ga0496114_1782771_264_443 | 58 |
| 601 | 3300048918 | Ga0496115_0119448 | Ga0496115_0119448_1870_2049 | 58 |
| 602 | 3300048918 | Ga0496115_0263705 | Ga0496115_0263705_1007_1189 | 58 |
| 603 | 3300048918 | Ga0496115_0410826 | Ga0496115_0410826_258_437 | 58 |
| 604 | 3300048918 | Ga0496115_0504336 | Ga0496115_0504336_674_853 | 58 |
| 605 | 3300048919 | Ga0496116_0001930 | Ga0496116_0001930_20999_21178 | 58 |
| 606 | 3300048919 | Ga0496116_0059236 | Ga0496116_0059236_823_1002 | 58 |
| 607 | 3300048920 | Ga0496117_0032761 | Ga0496117_0032761_3018_3197 | 58 |
| 608 | 3300048920 | Ga0496117_0059473 | Ga0496117_0059473_2182_2361 | 58 |
| 609 | 3300048921 | Ga0496118_0040566 | Ga0496118_0040566_775_954 | 58 |
| 610 | 3300048921 | Ga0496118_0055065 | Ga0496118_0055065_977_1156 | 58 |
| 611 | 3300048921 | Ga0496118_0135281 | Ga0496118_0135281_10_189 | 58 |
| 612 | 3300048922 | Ga0496119_0061944 | Ga0496119_0061944_1171_1350 | 58 |
| 613 | 3300048922 | Ga0496119_0244834 | Ga0496119_0244834_215_394 | 58 |
| 614 | 3300048922 | Ga0496119_0509803 | Ga0496119_0509803_261_440 | 58 |
| 615 | 3300048923 | Ga0496120_0318030 | Ga0496120_0318030_210_389 | 58 |
| 616 | 3300048924 | Ga0496121_0083960 | Ga0496121_0083960_978_1157 | 58 |
| 617 | 3300048924 | Ga0496121_0622525 | Ga0496121_0622525_411_590 | 58 |
| 618 | 3300048925 | Ga0496122_0020170 | Ga0496122_0020170_5787_5966 | 58 |
| 619 | 3300048925 | Ga0496122_0071255 | Ga0496122_0071255_1330_1509 | 58 |
| 620 | 3300048926 | Ga0496123_0009028 | Ga0496123_0009028_6360_6539 | 58 |
| 621 | 3300048927 | Ga0496124_0115166 | Ga0496124_0115166_230_409 | 58 |
| 622 | 3300048927 | Ga0496124_0520535 | Ga0496124_0520535_49_228 | 58 |
| 623 | 3300048927 | Ga0496124_0668359 | Ga0496124_0668359_320_499 | 58 |
| 624 | 3300048928 | Ga0496125_0000843 | Ga0496125_0000843_46779_46958 | 58 |
| 625 | 3300048928 | Ga0496125_0003929 | Ga0496125_0003929_14696_14875 | 58 |
| 626 | 3300048928 | Ga0496125_0045135 | Ga0496125_0045135_1911_2090 | 58 |
| 627 | 3300048929 | Ga0496126_0047419 | Ga0496126_0047419_2008_2187 | 58 |
| 628 | 3300048929 | Ga0496126_0183069 | Ga0496126_0183069_264_443 | 58 |
| 629 | 3300048929 | Ga0496126_0553651 | Ga0496126_0553651_348_524 | 58 |
| 630 | 3300048929 | Ga0496126_0600145 | Ga0496126_0600145_630_809 | 58 |
| 631 | 3300048929 | Ga0496126_0665375 | Ga0496126_0665375_476_655 | 58 |
| 632 | 3300048929 | Ga0496126_0807366 | Ga0496126_0807366_312_491 | 58 |
| 633 | 3300049459 | Ga0495678_154079 | Ga0495678_154079_547_726 | 58 |
| 634 | 3300049568 | Ga0501031_0014869 | Ga0501031_0014869_3203_3382 | 58 |
| 635 | 3300049569 | Ga0501032_0010617 | Ga0501032_0010617_5155_5334 | 58 |
| 636 | 3300049569 | Ga0501032_0136848 | Ga0501032_0136848_990_1169 | 58 |
| 637 | 3300049570 | Ga0501033_0002710 | Ga0501033_0002710_3990_4169 | 58 |
| 638 | 3300049571 | Ga0501034_0894827 | Ga0501034_0894827_388_567 | 58 |
| 639 | 3300049572 | Ga0501036_0047626 | Ga0501036_0047626_133_312 | 58 |
| 640 | 3300049572 | Ga0501036_0703829 | Ga0501036_0703829_493_672 | 58 |
| 641 | 3300049573 | Ga0501037_0001298 | Ga0501037_0001298_17015_17194 | 58 |
| 642 | 3300049573 | Ga0501037_0131156 | Ga0501037_0131156_566_745 | 58 |
| 643 | 3300049574 | Ga0501038_0012835 | Ga0501038_0012835_6688_6867 | 58 |
| 644 | 3300049574 | Ga0501038_0102205 | Ga0501038_0102205_782_961 | 58 |
| 645 | 3300049575 | Ga0501039_0044276 | Ga0501039_0044276_2514_2693 | 58 |
| 646 | 3300049575 | Ga0501039_0090146 | Ga0501039_0090146_786_965 | 58 |
| 647 | 3300049577 | Ga0501041_0593984 | Ga0501041_0593984_375_554 | 58 |
| 648 | 3300049578 | Ga0501042_0072752 | Ga0501042_0072752_1141_1320 | 58 |
| 649 | 3300049578 | Ga0501042_0479930 | Ga0501042_0479930_547_726 | 58 |
| 650 | 3300049578 | Ga0501042_1133925 | Ga0501042_1133925_29_205 | 58 |
| 651 | 3300049579 | Ga0501043_0096194 | Ga0501043_0096194_921_1100 | 58 |
| 652 | 3300049580 | Ga0501046_0030078 | Ga0501046_0030078_2503_2682 | 58 |
| 653 | 3300049580 | Ga0501046_0168371 | Ga0501046_0168371_1213_1392 | 58 |
| 654 | 3300049583 | Ga0501067_0809440 | Ga0501067_0809440_183_359 | 58 |
| 655 | 3300049583 | Ga0501067_0849530 | Ga0501067_0849530_168_344 | 58 |
| 656 | 3300049584 | Ga0501068_0059540 | Ga0501068_0059540_903_1082 | 58 |
| 657 | 3300049584 | Ga0501068_0842041 | Ga0501068_0842041_339_518 | 58 |
| 658 | 3300049585 | Ga0501069_0614158 | Ga0501069_0614158_266_442 | 58 |
| 659 | 3300049591 | Ga0501075_1005296 | Ga0501075_1005296_237_413 | 58 |
| 660 | 3300049592 | Ga0501076_0551364 | Ga0501076_0551364_67_243 | 58 |
| 661 | 3300049741 | Ga0501079_0389431 | Ga0501079_0389431_482_661 | 58 |
| 662 | 3300049741 | Ga0501079_1187996 | Ga0501079_1187996_179_355 | 58 |
| 663 | 3300049742 | Ga0501080_0874368 | Ga0501080_0874368_17_193 | 58 |
| 664 | 3300049743 | Ga0501081_0871311 | Ga0501081_0871311_419_598 | 58 |
| 665 | 3300049822 | Ga0501035_0001311 | Ga0501035_0001311_2696_2875 | 58 |
| 666 | 3300049823 | Ga0501044_0048874 | Ga0501044_0048874_2961_3140 | 58 |
| 667 | 3300049823 | Ga0501044_0966445 | Ga0501044_0966445_92_271 | 58 |
| 668 | 3300049824 | Ga0501045_0246868 | Ga0501045_0246868_132_311 | 58 |
| 669 | 3300050490 | nmdc:mga03n38_195895_c1 | nmdc:mga03n38_195895_c1_448_627 | 58 |
| 670 | 3300050491 | nmdc:mga00v17_558334_c1 | nmdc:mga00v17_558334_c1_198_377 | 58 |
| 671 | 3300050491 | nmdc:mga00v17_704219_c1 | nmdc:mga00v17_704219_c1_386_565 | 58 |
| 672 | 3300050492 | nmdc:mga0yw44_248904_c1 | nmdc:mga0yw44_248904_c1_871_1050 | 58 |
| 673 | 3300050492 | nmdc:mga0yw44_280364_c1 | nmdc:mga0yw44_280364_c1_63_239 | 58 |
| 674 | 3300050492 | nmdc:mga0yw44_468936_c1 | nmdc:mga0yw44_468936_c1_600_779 | 58 |
| 675 | 3300050492 | nmdc:mga0yw44_476959_c1 | nmdc:mga0yw44_476959_c1_204_383 | 58 |
| 676 | 3300050494 | nmdc:mga06z11_73926_c1 | nmdc:mga06z11_73926_c1_938_1117 | 58 |
| 677 | 3300050496 | nmdc:mga07m45_129657_c1 | nmdc:mga07m45_129657_c1_415_591 | 58 |
| 678 | 3300050507 | nmdc:mga05p37_72116_c1 | nmdc:mga05p37_72116_c1_2115_2297 | 58 |
| 679 | 3300050510 | nmdc:mga06r32_469230_c1 | nmdc:mga06r32_469230_c1_553_735 | 58 |
| 680 | 3300050512 | nmdc:mga0n895_101162_c1 | nmdc:mga0n895_101162_c1_1020_1199 | 58 |
| 681 | 3300050512 | nmdc:mga0n895_435306_c1 | nmdc:mga0n895_435306_c1_829_1005 | 58 |
| 682 | 3300050513 | nmdc:mga0rr50_150317_c1 | nmdc:mga0rr50_150317_c1_330_506 | 58 |
| 683 | 3300050515 | nmdc:mga0a205_1260416_c1 | nmdc:mga0a205_1260416_c1_176_355 | 58 |
| 684 | 3300050516 | nmdc:mga0sz30_162434_c1 | nmdc:mga0sz30_162434_c1_187_366 | 58 |
| 685 | 3300053077 | Ga0495601_0025408 | Ga0495601_0025408_2472_2651 | 58 |
| 686 | 3300053077 | Ga0495601_0199611 | Ga0495601_0199611_989_1168 | 58 |
| 687 | 3300053077 | Ga0495601_0245791 | Ga0495601_0245791_483_662 | 58 |
| 688 | 3300053078 | Ga0495612_0020737 | Ga0495612_0020737_1771_1950 | 58 |
| 689 | 3300053078 | Ga0495612_0538014 | Ga0495612_0538014_246_425 | 58 |
| 690 | 3300053080 | Ga0500635_0022200 | Ga0500635_0022200_1141_1329 | 58 |
| 691 | 3300053084 | Ga0495595_0001339 | Ga0495595_0001339_9123_9302 | 58 |
| 692 | 3300053084 | Ga0495595_0029009 | Ga0495595_0029009_614_793 | 58 |
| 693 | 3300053085 | Ga0495619_0008552 | Ga0495619_0008552_3673_3852 | 58 |
| 694 | 3300053085 | Ga0495619_0725857 | Ga0495619_0725857_97_276 | 58 |
| 695 | 3300053085 | Ga0495619_0866902 | Ga0495619_0866902_328_507 | 58 |
| 696 | 3300053085 | Ga0495619_0874259 | Ga0495619_0874259_246_425 | 58 |
| 697 | 3300053086 | Ga0500578_0244440 | Ga0500578_0244440_205_384 | 58 |
| 698 | 3300053087 | Ga0500643_152494 | Ga0500643_152494_205_384 | 58 |
| 699 | 3300053087 | Ga0500643_181162 | Ga0500643_181162_342_521 | 58 |
| 700 | 3300053089 | Ga0500581_111615 | Ga0500581_111615_433_612 | 58 |
| 701 | 3300053090 | Ga0500646_0018789 | Ga0500646_0018789_95_271 | 58 |
| 702 | 3300053090 | Ga0500646_0357082 | Ga0500646_0357082_204_383 | 58 |
| 703 | 3300053091 | Ga0500647_0451632 | Ga0500647_0451632_303_482 | 58 |
| 704 | 3300053092 | Ga0500583_0252970 | Ga0500583_0252970_542_721 | 58 |
| 705 | 3300053094 | Ga0500566_0000107 | Ga0500566_0000107_1792_1971 | 58 |
| 706 | 3300053095 | Ga0500640_106878 | Ga0500640_106878_557_745 | 58 |
| 707 | 3300053096 | Ga0500641_0010703 | Ga0500641_0010703_326_502 | 58 |
| 708 | 3300053096 | Ga0500641_0013776 | Ga0500641_0013776_1340_1519 | 58 |
| 709 | 3300053096 | Ga0500641_0027147 | Ga0500641_0027147_1558_1734 | 58 |
| 710 | 3300053098 | Ga0500650_0000245 | Ga0500650_0000245_8422_8601 | 58 |
| 711 | 3300053099 | Ga0500654_184684 | Ga0500654_184684_455_634 | 58 |
| 712 | 3300053103 | Ga0500555_063634 | Ga0500555_063634_797_976 | 58 |
| 713 | 3300053104 | Ga0500556_0000006 | Ga0500556_0000006_216428_216607 | 58 |
| 714 | 3300053104 | Ga0500556_0393604 | Ga0500556_0393604_112_291 | 58 |
| 715 | 3300053105 | Ga0500557_061553 | Ga0500557_061553_577_756 | 58 |
| 716 | 3300053108 | Ga0500562_024724 | Ga0500562_024724_12_191 | 58 |
| 717 | 3300053109 | Ga0500569_027511 | Ga0500569_027511_16_195 | 58 |
| 718 | 3300053111 | Ga0500572_065685 | Ga0500572_065685_913_1101 | 58 |
| 719 | 3300053116 | Ga0500592_023880 | Ga0500592_023880_712_891 | 58 |
| 720 | 3300053117 | Ga0500593_093751 | Ga0500593_093751_279_458 | 58 |
| 721 | 3300053118 | Ga0500594_0051380 | Ga0500594_0051380_399_578 | 58 |
| 722 | 3300053118 | Ga0500594_0060471 | Ga0500594_0060471_794_973 | 58 |
| 723 | 3300053121 | Ga0500607_129470 | Ga0500607_129470_883_1062 | 58 |
| 724 | 3300053122 | Ga0500608_110319 | Ga0500608_110319_901_1080 | 58 |
| 725 | 3300053123 | Ga0500614_047140 | Ga0500614_047140_313_492 | 58 |
| 726 | 3300053130 | Ga0500642_0000004 | Ga0500642_0000004_266646_266825 | 58 |
| 727 | 3300053130 | Ga0500642_0288666 | Ga0500642_0288666_353_532 | 58 |
| 728 | 3300053130 | Ga0500642_0451871 | Ga0500642_0451871_34_210 | 58 |
| 729 | 3300053131 | Ga0500652_000294 | Ga0500652_000294_2456_2635 | 58 |
| 730 | 3300053134 | Ga0500658_0055005 | Ga0500658_0055005_195_374 | 58 |
| 731 | 3300053134 | Ga0500658_0524803 | Ga0500658_0524803_32_211 | 58 |
| 732 | 3300053136 | Ga0500559_0044825 | Ga0500559_0044825_1494_1682 | 58 |
| 733 | 3300053136 | Ga0500559_0181246 | Ga0500559_0181246_410_589 | 58 |
| 734 | 3300053139 | Ga0500568_0006383 | Ga0500568_0006383_3298_3477 | 58 |
| 735 | 3300053140 | Ga0500573_0548928 | Ga0500573_0548928_61_240 | 58 |
| 736 | 3300053142 | Ga0500577_0001713 | Ga0500577_0001713_3881_4060 | 58 |
| 737 | 3300053142 | Ga0500577_0404478 | Ga0500577_0404478_33_212 | 58 |
| 738 | 3300053145 | Ga0500586_001899 | Ga0500586_001899_530_709 | 58 |
| 739 | 3300053146 | Ga0500588_0139664 | Ga0500588_0139664_537_716 | 58 |
| 740 | 3300053146 | Ga0500588_0145174 | Ga0500588_0145174_458_637 | 58 |
| 741 | 3300053147 | Ga0500589_082946 | Ga0500589_082946_670_846 | 58 |
| 742 | 3300053148 | Ga0500590_068212 | Ga0500590_068212_820_1008 | 58 |
| 743 | 3300053150 | Ga0500603_002672 | Ga0500603_002672_468_647 | 58 |
| 744 | 3300053151 | Ga0500604_0012314 | Ga0500604_0012314_1226_1405 | 58 |
| 745 | 3300053151 | Ga0500604_0107466 | Ga0500604_0107466_254_430 | 58 |
| 746 | 3300053153 | Ga0500616_0000022 | Ga0500616_0000022_214851_215030 | 58 |
| 747 | 3300053154 | Ga0500619_030737 | Ga0500619_030737_1138_1317 | 58 |
| 748 | 3300053159 | Ga0500630_230444 | Ga0500630_230444_342_521 | 58 |
| 749 | 3300053160 | Ga0500633_0050696 | Ga0500633_0050696_228_407 | 58 |
| 750 | 3300053161 | Ga0500634_0080584 | Ga0500634_0080584_327_506 | 58 |
| 751 | 3300053161 | Ga0500634_0204184 | Ga0500634_0204184_504_683 | 58 |
| 752 | 3300053162 | Ga0500638_310618 | Ga0500638_310618_107_295 | 58 |
| 753 | 3300053163 | Ga0500639_032775 | Ga0500639_032775_2034_2222 | 58 |
| 754 | 3300053163 | Ga0500639_214051 | Ga0500639_214051_302_490 | 58 |
| 755 | 3300053178 | Ga0500637_0280048 | Ga0500637_0280048_444_632 | 58 |
| 756 | 3300053723 | Ga0500567_139228 | Ga0500567_139228_162_341 | 58 |
| 757 | 3300053724 | Ga0500570_144382 | Ga0500570_144382_161_340 | 58 |
| 758 | 3300053730 | Ga0500645_014664 | Ga0500645_014664_2071_2250 | 58 |
| 759 | 3300053731 | Ga0500609_066175 | Ga0500609_066175_200_379 | 58 |
| 760 | 3300053735 | Ga0500596_003754 | Ga0500596_003754_1264_1452 | 58 |
| 761 | 3300053737 | Ga0500601_011934 | Ga0500601_011934_174_362 | 58 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar