F479571

General Info

Members Datasets Scaffolds Average Seq Length
761 405 761 59

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10500555|Ga0099794_105005552
Length 69
Sequence VNAMSLGTSLEMSLGPYASFIVTAYLAATVVVAVLIAWIAIDYRSQTHRLRALDESGVVRRSGRGATEL

Samples

Sample ID Description Type Environment
1 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
4 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
42 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
43 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
44 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
62 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
63 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
64 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
71 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
94 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
95 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
96 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
100 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
101 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
102 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
104 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
105 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
107 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
108 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
151 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
152 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
153 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
154 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
155 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
156 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
157 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
158 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
159 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
160 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
161 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
162 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
163 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
164 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
165 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
166 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
167 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
168 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
169 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
170 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
171 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
172 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
173 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
174 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
175 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
176 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
177 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
178 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
179 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
180 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
181 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
182 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
183 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
184 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
185 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
190 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
191 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
192 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
193 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
194 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
195 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
196 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
197 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
198 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
199 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
200 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
201 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
202 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
203 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
204 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
205 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
206 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
207 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
210 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
211 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
212 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
213 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
214 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
215 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
216 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
217 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
218 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
219 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
220 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
221 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
222 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
223 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
224 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
225 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
226 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
230 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
237 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
238 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
239 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
240 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
241 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
242 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
243 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
244 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
245 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
246 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
247 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
248 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
249 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
250 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
251 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
254 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
255 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
256 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
257 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
258 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
259 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
260 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
261 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
262 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
263 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
266 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
267 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
268 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
269 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
270 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
271 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
272 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
273 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
274 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
275 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
276 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
277 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
278 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
279 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
280 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
281 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
282 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
283 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
284 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
285 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
288 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
289 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
290 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
291 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
306 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
307 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
308 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
309 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
310 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
311 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
312 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
317 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
318 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
322 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
323 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
324 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
325 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
328 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
330 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
331 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
332 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
333 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
334 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
335 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
336 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
341 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
342 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
343 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
344 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
345 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
346 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
350 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
351 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
352 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
353 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
354 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
355 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
356 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
357 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
358 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
359 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
360 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
361 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
362 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
363 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
364 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
365 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
366 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
367 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
368 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
369 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
370 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
371 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
372 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
373 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
374 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
375 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
376 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
377 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
378 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
379 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
380 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
381 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
382 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
383 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
384 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
385 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
386 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
387 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
388 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
389 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
390 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
391 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
392 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
393 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
394 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
395 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
396 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
397 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
398 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
399 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
400 3300053723 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 endosphere Metagenome Endosphere
401 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
402 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
403 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
404 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
405 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.34
Metatranscriptomes 0.66
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.27
Nodule 0
Rhizoplane 5.12
Rhizosphere 76.35
Stem 0
Stem Tuber 0
Unclassified 5.26

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25153J46596_10008562 3300003215 Bacteria 4875
2 JGI25404J52841_10028662 3300003659 Bacteria 1195
3 JGI25404J52841_10058670 3300003659 Bacteria 807
4 Ga0055542_1013126 3300003762 Bacteria 1404
5 Ga0055529_1028398 3300003763 Bacteria 689
6 Ga0070658_11080274 3300005327 Bacteria 698
7 Ga0070683_100037044 3300005329 Bacteria 4464
8 Ga0070677_10759471 3300005333 Bacteria 551
9 Ga0070680_100117410 3300005336 Bacteria 2218
10 Ga0070680_100140998 3300005336 Bacteria 2021
11 Ga0070680_100590734 3300005336 Bacteria 953
12 Ga0070680_101253046 3300005336 Bacteria 642
13 Ga0070682_100084056 3300005337 Bacteria 2067
14 Ga0070682_100623510 3300005337 Bacteria 855
15 Ga0070682_101443476 3300005337 Bacteria 590
16 Ga0070660_100158914 3300005339 Bacteria 1820
17 Ga0070689_101611093 3300005340 Bacteria 590
18 Ga0070691_10082325 3300005341 Bacteria 1578
19 Ga0070691_10341589 3300005341 Bacteria 829
20 Ga0070691_10911095 3300005341 Bacteria 543
21 Ga0070661_100037794 3300005344 Bacteria 3513
22 Ga0070661_100821582 3300005344 Bacteria 764
23 Ga0070668_100301498 3300005347 Bacteria 1344
24 Ga0070668_101898410 3300005347 Bacteria 548
25 Ga0070671_100127930 3300005355 Bacteria 2139
26 Ga0070674_100362098 3300005356 Bacteria 1175
27 Ga0070674_100746463 3300005356 Bacteria 841
28 Ga0070714_100070525 3300005435 Bacteria 3021
29 Ga0070714_100739113 3300005435 Bacteria 951
30 Ga0070714_100971817 3300005435 Bacteria 826
31 Ga0070713_100037902 3300005436 Bacteria 3901
32 Ga0070713_100235418 3300005436 Bacteria 1666
33 Ga0070710_10646984 3300005437 Bacteria 741
34 Ga0070710_11394923 3300005437 Bacteria 524
35 Ga0070710_11429009 3300005437 Bacteria 518
36 Ga0070711_100004422 3300005439 Bacteria 8294
37 Ga0070711_100013801 3300005439 Bacteria 5081
38 Ga0070711_100585970 3300005439 Bacteria 929
39 Ga0070711_101045403 3300005439 Bacteria 702
40 Ga0070711_101611461 3300005439 Bacteria 568
41 Ga0070700_101911325 3300005441 Bacteria 513
42 Ga0070663_100034129 3300005455 Bacteria 3521
43 Ga0070663_100255829 3300005455 Bacteria 1387
44 Ga0070663_100399998 3300005455 Bacteria 1122
45 Ga0070663_100427434 3300005455 Bacteria 1088
46 Ga0070663_100662746 3300005455 Bacteria 884
47 Ga0070663_100907133 3300005455 Bacteria 761
48 Ga0070678_100118683 3300005456 Bacteria 2082
49 Ga0070678_102212541 3300005456 Bacteria 521
50 Ga0070681_10001077 3300005458 Bacteria 23275
51 Ga0070681_10067755 3300005458 Bacteria 3537
52 Ga0070681_10138614 3300005458 Bacteria 2362
53 Ga0070681_10202596 3300005458 Bacteria 1902
54 Ga0068867_100443955 3300005459 Bacteria 1104
55 Ga0070685_11001738 3300005466 Bacteria 627
56 Ga0070706_101350705 3300005467 Bacteria 653
57 Ga0070699_101360571 3300005518 Bacteria 651
58 Ga0070679_100074727 3300005530 Bacteria 3379
59 Ga0070679_100137816 3300005530 Bacteria 2421
60 Ga0070679_100210300 3300005530 Bacteria 1909
61 Ga0070679_101845088 3300005530 Bacteria 553
62 Ga0070679_102041598 3300005530 Bacteria 522
63 Ga0070684_100014169 3300005535 Bacteria 6449
64 Ga0070684_100062962 3300005535 Bacteria 3250
65 Ga0070684_100134499 3300005535 Bacteria 2232
66 Ga0070684_100258132 3300005535 Bacteria 1594
67 Ga0070697_100932647 3300005536 Bacteria 771
68 Ga0070697_101244284 3300005536 Bacteria 664
69 Ga0068853_100050798 3300005539 Bacteria 3567
70 Ga0068853_100738271 3300005539 Bacteria 940
71 Ga0068853_100894012 3300005539 Bacteria 853
72 Ga0068853_100991068 3300005539 Bacteria 809
73 Ga0070672_100626023 3300005543 Bacteria 939
74 Ga0070695_101341023 3300005545 Bacteria 592
75 Ga0070696_101648826 3300005546 Bacteria 552
76 Ga0070693_100155781 3300005547 Bacteria 1451
77 Ga0070665_100113166 3300005548 Bacteria 2716
78 Ga0070665_101238078 3300005548 Bacteria 757
79 Ga0070665_101508950 3300005548 Bacteria 680
80 Ga0068855_100234941 3300005563 Bacteria 2050
81 Ga0068855_100325036 3300005563 Bacteria 1699
82 Ga0070664_100337346 3300005564 Bacteria 1368
83 Ga0070664_100701948 3300005564 Bacteria 943
84 Ga0070664_100794046 3300005564 Bacteria 885
85 Ga0070664_101071009 3300005564 Bacteria 759
86 Ga0068857_100033406 3300005577 Bacteria 4550
87 Ga0068857_100278299 3300005577 Bacteria 1539
88 Ga0068857_100484269 3300005577 Bacteria 1160
89 Ga0068854_100446137 3300005578 Bacteria 1080
90 Ga0068854_100733195 3300005578 Bacteria 856
91 Ga0068854_101365078 3300005578 Bacteria 640
92 Ga0068856_100000883 3300005614 Bacteria 32112
93 Ga0068856_100185359 3300005614 Bacteria 2095
94 Ga0068856_102130367 3300005614 Bacteria 570
95 Ga0068856_102155659 3300005614 Bacteria 567
96 Ga0070702_100771141 3300005615 Bacteria 741
97 Ga0068852_100137945 3300005616 Bacteria 2254
98 Ga0068852_101144966 3300005616 Bacteria 799
99 Ga0068852_101236745 3300005616 Bacteria 768
100 Ga0068864_100697192 3300005618 Bacteria 992
101 Ga0068866_11170866 3300005718 Bacteria 554
102 Ga0068861_100102538 3300005719 Bacteria 2278
103 Ga0068851_10030531 3300005834 Bacteria 2673
104 Ga0068851_10272978 3300005834 Bacteria 965
105 Ga0068863_100609883 3300005841 Bacteria 1081
106 Ga0068858_102225665 3300005842 Bacteria 542
107 Ga0068860_100302277 3300005843 Bacteria 1568
108 Ga0081455_10050780 3300005937 Bacteria 3563
109 Ga0081540_1005580 3300005983 Bacteria 9369
110 Ga0081540_1011553 3300005983 Bacteria 5898
111 Ga0081540_1036340 3300005983 Bacteria 2628
112 Ga0081539_10031076 3300005985 Bacteria 3299
113 Ga0070717_10010596 3300006028 Bacteria 6965
114 Ga0070717_10707160 3300006028 Bacteria 915
115 Ga0070717_10973001 3300006028 Bacteria 773
116 Ga0075365_10043435 3300006038 Bacteria 2942
117 Ga0075365_10337527 3300006038 Bacteria 1062
118 Ga0075365_10395277 3300006038 Bacteria 975
119 Ga0075365_10649289 3300006038 Bacteria 746
120 Ga0075363_100114480 3300006048 Bacteria 1501
121 Ga0075363_100246140 3300006048 Bacteria 1029
122 Ga0075364_10099785 3300006051 Bacteria 1933
123 Ga0075364_10669110 3300006051 Bacteria 709
124 Ga0075364_10695549 3300006051 Bacteria 694
125 Ga0075364_11132101 3300006051 Bacteria 531
126 Ga0070715_10114301 3300006163 Bacteria 1278
127 Ga0070716_100636588 3300006173 Bacteria 807
128 Ga0070716_100815104 3300006173 Bacteria 724
129 Ga0070716_101249910 3300006173 Bacteria 598
130 Ga0070716_101526249 3300006173 Bacteria 547
131 Ga0070712_100069559 3300006175 Bacteria 2511
132 Ga0070712_100169236 3300006175 Bacteria 1694
133 Ga0070712_100973289 3300006175 Bacteria 733
134 Ga0070712_101093769 3300006175 Bacteria 692
135 Ga0075362_10638160 3300006177 Bacteria 552
136 Ga0075367_10088967 3300006178 Bacteria 1877
137 Ga0075369_10172646 3300006186 Bacteria 993
138 Ga0097621_101076806 3300006237 Bacteria 754
139 Ga0097621_101125780 3300006237 Bacteria 738
140 Ga0097621_101735319 3300006237 Bacteria 595
141 Ga0097621_102389613 3300006237 Bacteria 506
142 Ga0075370_10141709 3300006353 Bacteria 1405
143 Ga0075370_10269892 3300006353 Bacteria 1010
144 Ga0075370_10411781 3300006353 Bacteria 812
145 Ga0068871_100989737 3300006358 Bacteria 783
146 Ga0075433_11306457 3300006852 Bacteria 628
147 Ga0075434_100106463 3300006871 Bacteria 2814
148 Ga0075429_100129121 3300006880 Bacteria 2211
149 Ga0068865_100649218 3300006881 Bacteria 897
150 Ga0075435_100017556 3300007076 Bacteria 5420
151 Ga0075435_100250082 3300007076 Bacteria 1509
152 Ga0099794_10500555 3300007265 Bacteria 639
153 Ga0105250_10131028 3300009092 Bacteria 1035
154 Ga0105240_10082975 3300009093 Bacteria 3935
155 Ga0105240_10103958 3300009093 Bacteria 3449
156 Ga0105240_11261316 3300009093 Bacteria 781
157 Ga0105247_10422786 3300009101 Bacteria 954
158 Ga0105247_10464656 3300009101 Bacteria 915
159 Ga0105243_10807452 3300009148 Bacteria 925
160 Ga0105243_11357155 3300009148 Bacteria 730
161 Ga0105243_11410672 3300009148 Bacteria 717
162 Ga0105241_10345784 3300009174 Bacteria 1290
163 Ga0105242_10991626 3300009176 Bacteria 847
164 Ga0105248_10374595 3300009177 Bacteria 1603
165 Ga0105248_11283825 3300009177 Bacteria 828
166 Ga0105237_10035449 3300009545 Bacteria 5049
167 Ga0105237_10251441 3300009545 Bacteria 1770
168 Ga0105237_10255792 3300009545 Bacteria 1753
169 Ga0105237_10383874 3300009545 Bacteria 1410
170 Ga0105237_11925135 3300009545 Bacteria 599
171 Ga0105238_10055393 3300009551 Bacteria 3980
172 Ga0105238_10224258 3300009551 Bacteria 1856
173 Ga0105238_11142189 3300009551 Bacteria 802
174 Ga0105238_11728046 3300009551 Bacteria 657
175 Ga0105238_12403090 3300009551 Bacteria 563
176 Ga0105249_10120137 3300009553 Bacteria 2496
177 Ga0105249_12278030 3300009553 Bacteria 614
178 Ga0099796_10313878 3300010159 Bacteria 667
179 Ga0105239_10149716 3300010375 Bacteria 2604
180 Ga0105239_10957711 3300010375 Bacteria 983
181 Ga0105239_10983446 3300010375 Bacteria 970
182 Ga0105239_13161928 3300010375 Bacteria 536
183 Ga0157319_1008774 3300012497 Bacteria 781
184 Ga0157370_10448664 3300013104 Bacteria 1186
185 Ga0157370_11422785 3300013104 Bacteria 624
186 Ga0157370_11719075 3300013104 Bacteria 563
187 Ga0157369_10002556 3300013105 Bacteria 21777
188 Ga0157369_10096664 3300013105 Bacteria 3151
189 Ga0157369_10690186 3300013105 Bacteria 1052
190 Ga0157369_12547113 3300013105 Bacteria 518
191 Ga0157378_10676467 3300013297 Bacteria 1050
192 Ga0157378_11512605 3300013297 Bacteria 716
193 Ga0163162_10208356 3300013306 Bacteria 2084
194 Ga0163162_11968248 3300013306 Bacteria 669
195 Ga0157372_10931208 3300013307 Bacteria 1007
196 Ga0157375_11203541 3300013308 Bacteria 889
197 Ga0163163_13340787 3300014325 Bacteria 500
198 Ga0157380_10409237 3300014326 Bacteria 1290
199 Ga0182008_10107413 3300014497 Bacteria 1381
200 Ga0157379_11985808 3300014968 Bacteria 575
201 Ga0157376_11476046 3300014969 Bacteria 713
202 Ga0157376_12221419 3300014969 Bacteria 588
203 Ga0157376_12340798 3300014969 Bacteria 573
204 Ga0157376_12882820 3300014969 Bacteria 520
205 Ga0163161_10343350 3300017792 Bacteria 1185
206 Ga0197907_10041262 3300020069 Bacteria 989
207 Ga0206356_10043115 3300020070 Bacteria 971
208 Ga0206354_10901948 3300020081 Bacteria 1519
209 Ga0206353_10873863 3300020082 Bacteria 639
210 Ga0213872_10102891 3300021361 Bacteria 1272
211 Ga0213871_10063168 3300021441 Bacteria 1034
212 Ga0209148_1000295 3300025254 Bacteria 73660
213 Ga0209233_1007194 3300025261 Bacteria 3542
214 Ga0209455_1003242 3300025272 Bacteria 5866
215 Ga0209758_1001013 3300025297 Bacteria 37209
216 Ga0209758_1003254 3300025297 Bacteria 15064
217 Ga0209758_1052492 3300025297 Bacteria 1409
218 Ga0207697_10128727 3300025315 Bacteria 1093
219 Ga0207656_10016861 3300025321 Bacteria 2850
220 Ga0207692_10366829 3300025898 Bacteria 891
221 Ga0207692_10403852 3300025898 Bacteria 852
222 Ga0207692_10767106 3300025898 Bacteria 629
223 Ga0207642_10080069 3300025899 Bacteria 1583
224 Ga0207685_10066599 3300025905 Bacteria 1446
225 Ga0207685_10622233 3300025905 Bacteria 581
226 Ga0207699_10010872 3300025906 Bacteria 4583
227 Ga0207705_10049390 3300025909 Bacteria 3028
228 Ga0207705_10414138 3300025909 Bacteria 1043
229 Ga0207707_10001830 3300025912 Bacteria 19505
230 Ga0207707_10008128 3300025912 Bacteria 9110
231 Ga0207707_10059002 3300025912 Bacteria 3338
232 Ga0207707_10093659 3300025912 Bacteria 2624
233 Ga0207707_10170982 3300025912 Bacteria 1899
234 Ga0207695_10069402 3300025913 Bacteria 3606
235 Ga0207695_11022785 3300025913 Bacteria 706
236 Ga0207695_11351961 3300025913 Bacteria 593
237 Ga0207671_10276376 3300025914 Bacteria 1324
238 Ga0207671_11199470 3300025914 Bacteria 594
239 Ga0207693_10025107 3300025915 Bacteria 4728
240 Ga0207693_10137110 3300025915 Bacteria 1924
241 Ga0207693_10629760 3300025915 Bacteria 834
242 Ga0207663_10079167 3300025916 Bacteria 2145
243 Ga0207663_10207923 3300025916 Bacteria 1416
244 Ga0207663_10693315 3300025916 Bacteria 806
245 Ga0207663_11646587 3300025916 Bacteria 516
246 Ga0207660_10008461 3300025917 Bacteria 6656
247 Ga0207660_10017636 3300025917 Bacteria 4746
248 Ga0207660_10164607 3300025917 Bacteria 1713
249 Ga0207660_10189206 3300025917 Bacteria 1602
250 Ga0207660_10955152 3300025917 Bacteria 699
251 Ga0207657_10022795 3300025919 Bacteria 5847
252 Ga0207649_10122254 3300025920 Bacteria 1756
253 Ga0207649_10155073 3300025920 Bacteria 1581
254 Ga0207652_10018784 3300025921 Bacteria 5674
255 Ga0207652_10048787 3300025921 Bacteria 3621
256 Ga0207652_10076567 3300025921 Bacteria 2918
257 Ga0207652_10078201 3300025921 Bacteria 2888
258 Ga0207652_11403618 3300025921 Bacteria 602
259 Ga0207694_10025727 3300025924 Bacteria 4474
260 Ga0207694_10163685 3300025924 Bacteria 1798
261 Ga0207694_10461323 3300025924 Bacteria 1061
262 Ga0207694_11530553 3300025924 Bacteria 563
263 Ga0207700_10031127 3300025928 Bacteria 3787
264 Ga0207700_10221842 3300025928 Bacteria 1603
265 Ga0207664_10091181 3300025929 Bacteria 2499
266 Ga0207690_10331349 3300025932 Bacteria 1199
267 Ga0207706_10194624 3300025933 Bacteria 1779
268 Ga0207706_10968838 3300025933 Bacteria 716
269 Ga0207709_10573293 3300025935 Bacteria 890
270 Ga0207709_10817494 3300025935 Bacteria 753
271 Ga0207669_11180070 3300025937 Bacteria 648
272 Ga0207669_11272110 3300025937 Bacteria 624
273 Ga0207665_10028702 3300025939 Bacteria 3677
274 Ga0207665_10491769 3300025939 Bacteria 947
275 Ga0207665_10796180 3300025939 Bacteria 747
276 Ga0207665_11121513 3300025939 Bacteria 627
277 Ga0207691_10070200 3300025940 Bacteria 3163
278 Ga0207661_10004360 3300025944 Bacteria 9917
279 Ga0207661_10017144 3300025944 Bacteria 5353
280 Ga0207661_10041208 3300025944 Bacteria 3634
281 Ga0207679_10222756 3300025945 Bacteria 1588
282 Ga0207679_10585848 3300025945 Bacteria 1004
283 Ga0207679_10744386 3300025945 Bacteria 891
284 Ga0207679_12075607 3300025945 Bacteria 517
285 Ga0207667_10046395 3300025949 Bacteria 4600
286 Ga0207667_10086452 3300025949 Bacteria 3245
287 Ga0207667_10221432 3300025949 Bacteria 1939
288 Ga0207667_11722931 3300025949 Bacteria 593
289 Ga0207667_12107007 3300025949 Bacteria 522
290 Ga0207668_10446952 3300025972 Bacteria 1102
291 Ga0207668_10948418 3300025972 Bacteria 767
292 Ga0207668_11178023 3300025972 Bacteria 688
293 Ga0207640_10522392 3300025981 Bacteria 992
294 Ga0207639_10084729 3300026041 Bacteria 2518
295 Ga0207639_10293443 3300026041 Bacteria 1434
296 Ga0207639_10787979 3300026041 Bacteria 885
297 Ga0207678_10004213 3300026067 Bacteria 12909
298 Ga0207678_10522643 3300026067 Bacteria 1036
299 Ga0207678_10615552 3300026067 Bacteria 953
300 Ga0207678_11512877 3300026067 Bacteria 592
301 Ga0207708_10440067 3300026075 Bacteria 1084
302 Ga0207702_10000318 3300026078 Bacteria 55209
303 Ga0207702_10314263 3300026078 Bacteria 1490
304 Ga0207702_10469132 3300026078 Bacteria 1224
305 Ga0207702_10633721 3300026078 Bacteria 1051
306 Ga0207702_11237301 3300026078 Bacteria 741
307 Ga0207702_11350149 3300026078 Bacteria 707
308 Ga0207641_10551532 3300026088 Bacteria 1124
309 Ga0207641_11512971 3300026088 Bacteria 673
310 Ga0207648_10380350 3300026089 Bacteria 1276
311 Ga0207676_10653774 3300026095 Bacteria 1015
312 Ga0207674_10100669 3300026116 Bacteria 2871
313 Ga0207674_10117297 3300026116 Bacteria 2632
314 Ga0207674_10543883 3300026116 Bacteria 1122
315 Ga0207674_11649813 3300026116 Bacteria 609
316 Ga0207683_10927454 3300026121 Bacteria 809
317 Ga0207698_10187729 3300026142 Bacteria 1837
318 Ga0207698_12248129 3300026142 Bacteria 558
319 Ga0268266_10213070 3300028379 Bacteria 1772
320 Ga0268266_11077111 3300028379 Bacteria 778
321 Ga0307515_10191546 3300028794 Bacteria 1953
322 Ga0265328_10130440 3300031239 Bacteria 941
323 Ga0265339_10355550 3300031249 Bacteria 690
324 Ga0307513_10931616 3300031456 Bacteria 577
325 Ga0307408_102239940 3300031548 Bacteria 528
326 Ga0307508_10000045 3300031616 Bacteria 142824
327 Ga0307508_10024470 3300031616 Bacteria 5479
328 Ga0307508_10691212 3300031616 Bacteria 629
329 Ga0265314_10151721 3300031711 Bacteria 1420
330 Ga0307405_10514475 3300031731 Bacteria 962
331 Ga0307405_10614393 3300031731 Bacteria 889
332 Ga0307413_10995885 3300031824 Bacteria 718
333 Ga0307413_11977996 3300031824 Bacteria 525
334 Ga0326468_10024312 3300031889 Bacteria 752
335 Ga0307406_10923955 3300031901 Bacteria 744
336 Ga0307412_10032668 3300031911 Bacteria 3301
337 Ga0307412_10708243 3300031911 Bacteria 865
338 Ga0307412_11477899 3300031911 Bacteria 617
339 Ga0307409_100312813 3300031995 Bacteria 1466
340 Ga0307409_100473334 3300031995 Bacteria 1214
341 Ga0307416_100417733 3300032002 Bacteria 1384
342 Ga0307416_100484234 3300032002 Bacteria 1298
343 Ga0307416_101206065 3300032002 Bacteria 862
344 Ga0307411_11002459 3300032005 Bacteria 748
345 Ga0307411_11213109 3300032005 Bacteria 684
346 Ga0307411_11502652 3300032005 Bacteria 619
347 Ga0307415_101010633 3300032126 Bacteria 773
348 Ga0307415_101076124 3300032126 Bacteria 751
349 Ga0373934_0033081 3300035086 Bacteria 2029
350 Ga0373944_0108551 3300035089 Bacteria 945
351 Ga0373923_0050361 3300035111 Bacteria 1744
352 Ga0373923_0052729 3300035111 Bacteria 1709
353 Ga0373936_0041380 3300035113 Bacteria 1848
354 Ga0373945_0156028 3300035116 Bacteria 928
355 Ga0373953_0018502 3300035117 Bacteria 2579
356 Ga0373953_0018581 3300035117 Bacteria 2574
357 Ga0373954_0006969 3300035118 Bacteria 4934
358 Ga0373954_0007810 3300035118 Bacteria 4685
359 Ga0373954_0023461 3300035118 Bacteria 2805
360 Ga0373956_0088528 3300035119 Bacteria 1426
361 Ga0373957_0052286 3300035120 Bacteria 1564
362 Ga0373957_0101302 3300035120 Bacteria 1153
363 Ga0373943_0009727 3300035170 Bacteria 4307
364 Ga0373955_0002799 3300035172 Bacteria 7662
365 Ga0373955_0056100 3300035172 Bacteria 2160
366 Ga0373955_0401811 3300035172 Bacteria 832
367 Ga0373924_0041454 3300035410 Bacteria 1886
368 Ga0373924_0045145 3300035410 Bacteria 1812
369 Ga0373924_0136808 3300035410 Bacteria 1067
370 Ga0373931_0829866 3300035691 Bacteria 618
371 Ga0373935_0117792 3300035692 Bacteria 1771
372 Ga0373935_0128647 3300035692 Bacteria 1699
373 Ga0373935_1243793 3300035692 Bacteria 555
374 Ga0373927_0090551 3300035695 Bacteria 1986
375 Ga0373933_0513536 3300035724 Bacteria 785
376 Ga0373933_0640520 3300035724 Bacteria 698
377 Ga0373947_0034346 3300035725 Bacteria 2998
378 Ga0373937_0019726 3300036401 Bacteria 6038
379 Ga0373937_0029464 3300036401 Bacteria 4971
380 Ga0373937_0046562 3300036401 Bacteria 3966
381 Ga0372808_000548 3300036459 Bacteria 3087
382 Ga0373925_0012279 3300037068 Bacteria 6197
383 Ga0373925_0110821 3300037068 Bacteria 2120
384 Ga0373925_1511270 3300037068 Bacteria 549
385 Ga0395899_0191736 3300037312 Bacteria 1430
386 Ga0395900_0977528 3300037418 Bacteria 767
387 Ga0395898_1303842 3300037466 Bacteria 655
388 Ga0395901_0267112 3300038443 Bacteria 1780
389 Ga0436365_0422270 3300039437 Bacteria 2007
390 Ga0436365_1865258 3300039437 Bacteria 3199
391 Ga0436360_0035660 3300039438 Bacteria 2190
392 Ga0436361_0034753 3300039447 Bacteria 2945
393 Ga0436361_0208430 3300039447 Bacteria 864
394 Ga0436363_0976239 3300039450 Bacteria 1038
395 Ga0436363_1632720 3300039450 Bacteria 920
396 Ga0436362_0798067 3300039453 Bacteria 5843
397 Ga0451800_1499558 3300041459 Bacteria 761
398 Ga0451804_0609357 3300041463 Bacteria 701
399 Ga0451839_0628551 3300041496 Bacteria 634
400 Ga0451841_1157327 3300041498 Bacteria 643
401 Ga0439459_0046903 3300042438 Bacteria 937
402 Ga0466966_0056008 3300044684 Bacteria 2495
403 Ga0466966_0669967 3300044684 Bacteria 625
404 Ga0466961_0190673 3300044693 Bacteria 1270
405 Ga0466963_0082044 3300044694 Bacteria 2185
406 Ga0466964_0076656 3300044706 Bacteria 1426
407 Ga0466970_0142879 3300044765 Bacteria 1319
408 Ga0466970_0330453 3300044765 Bacteria 863
409 Ga0466957_0107372 3300044842 Bacteria 1767
410 Ga0466957_0777719 3300044842 Bacteria 679
411 Ga0466959_0014935 3300045049 Bacteria 5658
412 Ga0466959_0063742 3300045049 Bacteria 2676
413 Ga0466958_0316935 3300045836 Bacteria 1002
414 Ga0466967_0281578 3300045976 Bacteria 1595
415 Ga0466967_0515142 3300045976 Bacteria 1175
416 Ga0466967_1794918 3300045976 Bacteria 610
417 Ga0495592_0026198 3300046454 Bacteria 4423
418 Ga0495592_0076532 3300046454 Bacteria 2427
419 Ga0495592_0144855 3300046454 Bacteria 1648
420 Ga0495592_0247576 3300046454 Bacteria 1180
421 Ga0495603_0155244 3300046455 Bacteria 1328
422 Ga0495603_0545228 3300046455 Bacteria 664
423 Ga0495591_092469 3300046458 Bacteria 758
424 Ga0495629_0017285 3300046459 Bacteria 5171
425 Ga0495629_0072839 3300046459 Bacteria 2399
426 Ga0495638_0088791 3300046460 Bacteria 1865
427 Ga0495638_0230549 3300046460 Bacteria 1030
428 Ga0495638_0351035 3300046460 Bacteria 779
429 Ga0495638_0494309 3300046460 Bacteria 617
430 Ga0495638_0583231 3300046460 Bacteria 551
431 Ga0495641_0115962 3300046461 Bacteria 1195
432 Ga0495641_0490904 3300046461 Bacteria 560
433 Ga0495651_0034650 3300046462 Bacteria 3934
434 Ga0495651_0210693 3300046462 Bacteria 1352
435 Ga0495651_0313441 3300046462 Bacteria 1048
436 Ga0495653_0011881 3300046463 Bacteria 7112
437 Ga0495653_0105939 3300046463 Bacteria 2029
438 Ga0495653_0149079 3300046463 Bacteria 1636
439 Ga0495580_0001981 3300046472 Bacteria 18011
440 Ga0495582_0007153 3300046473 Bacteria 6200
441 Ga0495605_0306434 3300046474 Bacteria 671
442 Ga0495639_0004165 3300046475 Bacteria 6200
443 Ga0495639_0068928 3300046475 Bacteria 1631
444 Ga0495662_0343618 3300046476 Bacteria 734
445 Ga0495664_0004612 3300046477 Bacteria 7535
446 Ga0495664_0080946 3300046477 Bacteria 1947
447 Ga0495585_0275274 3300046492 Bacteria 833
448 Ga0495594_0218284 3300046499 Bacteria 1087
449 Ga0495596_0330591 3300046500 Bacteria 593
450 Ga0495607_0195714 3300046501 Bacteria 1004
451 Ga0495607_0267908 3300046501 Bacteria 815
452 Ga0495583_0071868 3300046506 Bacteria 1519
453 Ga0495606_0047553 3300046507 Bacteria 2827
454 Ga0495608_0017638 3300046511 Bacteria 4936
455 Ga0495608_0070418 3300046511 Bacteria 2282
456 Ga0495608_0698872 3300046511 Bacteria 603
457 Ga0495610_0013962 3300046512 Bacteria 4746
458 Ga0495610_0277186 3300046512 Bacteria 654
459 Ga0495618_0014329 3300046514 Bacteria 4830
460 Ga0495618_0162324 3300046514 Bacteria 1424
461 Ga0495618_0251260 3300046514 Bacteria 1109
462 Ga0495620_0028200 3300046515 Bacteria 2614
463 Ga0495620_0063536 3300046515 Bacteria 1530
464 Ga0495628_0025951 3300046516 Bacteria 4783
465 Ga0495628_0543998 3300046516 Bacteria 834
466 Ga0495630_0110073 3300046517 Bacteria 2086
467 Ga0495630_0808351 3300046517 Bacteria 716
468 Ga0495631_0036994 3300046518 Bacteria 2176
469 Ga0495631_0043066 3300046518 Bacteria 1992
470 Ga0495631_0445304 3300046518 Bacteria 551
471 Ga0495632_0131004 3300046519 Bacteria 1167
472 Ga0495637_0055392 3300046520 Bacteria 1644
473 Ga0495643_0237461 3300046522 Bacteria 857
474 Ga0495643_0249730 3300046522 Bacteria 828
475 Ga0495644_0022208 3300046523 Bacteria 2419
476 Ga0495648_0059255 3300046524 Bacteria 2285
477 Ga0495648_0324809 3300046524 Bacteria 712
478 Ga0495663_0073680 3300046525 Bacteria 1091
479 Ga0495652_0021450 3300046529 Bacteria 5742
480 Ga0495652_0112657 3300046529 Bacteria 2185
481 Ga0495652_0687475 3300046529 Bacteria 689
482 Ga0495652_0854281 3300046529 Bacteria 603
483 Ga0495665_0545974 3300046531 Bacteria 582
484 Ga0495640_0018260 3300046533 Bacteria 5208
485 Ga0495640_0057123 3300046533 Bacteria 2664
486 Ga0495640_0092748 3300046533 Bacteria 1991
487 Ga0495586_0562142 3300046535 Bacteria 659
488 Ga0495587_0009714 3300046536 Bacteria 6152
489 Ga0495587_0317659 3300046536 Bacteria 870
490 Ga0495587_0720322 3300046536 Bacteria 546
491 Ga0495598_0103970 3300046537 Bacteria 943
492 Ga0495609_0051495 3300046538 Bacteria 1833
493 Ga0495609_0352142 3300046538 Bacteria 594
494 Ga0495609_0415617 3300046538 Bacteria 537
495 Ga0495621_0052498 3300046539 Bacteria 1461
496 Ga0495645_0010485 3300046543 Bacteria 6499
497 Ga0495645_0093242 3300046543 Bacteria 2149
498 Ga0495622_0205987 3300046557 Bacteria 875
499 Ga0495633_0236593 3300046558 Bacteria 834
500 Ga0495667_0003525 3300046559 Bacteria 10504
501 Ga0495667_0209891 3300046559 Bacteria 1244
502 Ga0495656_0372079 3300046615 Bacteria 743
503 Ga0495668_0101673 3300046616 Bacteria 1572
504 Ga0495634_0032414 3300046642 Bacteria 3594
505 Ga0495634_0051141 3300046642 Bacteria 2773
506 Ga0495634_0542737 3300046642 Bacteria 678
507 Ga0495611_0067172 3300046648 Bacteria 1636
508 Ga0495611_0175393 3300046648 Bacteria 1002
509 Ga0495625_0153563 3300046660 Bacteria 1546
510 Ga0495625_0621295 3300046660 Bacteria 646
511 Ga0495635_0007981 3300046663 Bacteria 7400
512 Ga0495635_0054013 3300046663 Bacteria 2767
513 Ga0495635_0112152 3300046663 Bacteria 1862
514 Ga0495661_0194607 3300046665 Bacteria 1065
515 Ga0495588_0267626 3300046674 Bacteria 900
516 Ga0495657_0004913 3300046675 Bacteria 10635
517 Ga0495657_0232602 3300046675 Bacteria 1114
518 Ga0495599_0429059 3300046678 Bacteria 784
519 Ga0495623_0041079 3300046679 Bacteria 2951
520 Ga0495623_0068214 3300046679 Bacteria 2218
521 Ga0495623_0517828 3300046679 Bacteria 628
522 Ga0495646_0069394 3300046680 Bacteria 2079
523 Ga0495646_0127658 3300046680 Bacteria 1434
524 Ga0495646_0291614 3300046680 Bacteria 865
525 Ga0495647_0012555 3300046681 Bacteria 2919
526 Ga0495658_0046528 3300046683 Bacteria 2439
527 Ga0495669_0172397 3300046684 Bacteria 1029
528 Ga0495613_0132279 3300046689 Bacteria 1786
529 Ga0495613_0980907 3300046689 Bacteria 543
530 Ga0495670_0063201 3300046691 Bacteria 1863
531 Ga0495671_0395721 3300046692 Bacteria 661
532 Ga0495589_0121939 3300046794 Bacteria 1255
533 Ga0495589_0532145 3300046794 Bacteria 536
534 Ga0495600_0020007 3300046809 Bacteria 4279
535 Ga0495600_0196043 3300046809 Bacteria 1298
536 Ga0495600_0284244 3300046809 Bacteria 1046
537 Ga0495660_0113626 3300046810 Bacteria 1379
538 Ga0495581_0713450 3300047315 Bacteria 578
539 Ga0495581_0910227 3300047315 Bacteria 502
540 Ga0495604_0002900 3300047317 Bacteria 13743
541 Ga0495604_0106518 3300047317 Bacteria 2051
542 Ga0495674_0031429 3300047319 Bacteria 4823
543 Ga0495674_0098054 3300047319 Bacteria 2496
544 Ga0495674_0170502 3300047319 Bacteria 1816
545 Ga0495672_0222555 3300047320 Bacteria 931
546 Ga0495672_0334975 3300047320 Bacteria 707
547 Ga0495676_0066265 3300047321 Bacteria 2800
548 Ga0495680_0025446 3300047322 Bacteria 4897
549 Ga0495680_0052112 3300047322 Bacteria 3191
550 Ga0495680_0450725 3300047322 Bacteria 881
551 Ga0495675_0061451 3300047444 Bacteria 2379
552 Ga0495675_0137244 3300047444 Bacteria 1517
553 Ga0495677_0117234 3300047445 Bacteria 1014
554 Ga0495677_0158174 3300047445 Bacteria 874
555 Ga0495685_150004 3300047447 Bacteria 757
556 Ga0495673_0273062 3300047469 Bacteria 612
557 Ga0495681_0064308 3300047470 Bacteria 1681
558 Ga0495684_0034017 3300047471 Bacteria 3910
559 Ga0495684_0295214 3300047471 Bacteria 1165
560 Ga0495686_0090210 3300047472 Bacteria 1862
561 Ga0495686_0106625 3300047472 Bacteria 1684
562 Ga0495593_0003761 3300047673 Bacteria 9064
563 Ga0495593_0017042 3300047673 Bacteria 4089
564 Ga0495602_0058849 3300048088 Bacteria 3360
565 Ga0495602_0111824 3300048088 Bacteria 2217
566 Ga0495614_0112116 3300048089 Bacteria 1198
567 Ga0495614_0137626 3300048089 Bacteria 1084
568 Ga0496100_0084827 3300048903 Bacteria 2148
569 Ga0496100_0164023 3300048903 Bacteria 1595
570 Ga0496100_0404472 3300048903 Bacteria 1040
571 Ga0496100_1541450 3300048903 Bacteria 525
572 Ga0496101_0109901 3300048904 Bacteria 2074
573 Ga0496101_0161922 3300048904 Bacteria 1716
574 Ga0496101_0192059 3300048904 Bacteria 1576
575 Ga0496104_1006856 3300048907 Bacteria 737
576 Ga0496104_1057227 3300048907 Bacteria 715
577 Ga0496105_0487389 3300048908 Bacteria 969
578 Ga0496105_0619756 3300048908 Bacteria 838
579 Ga0496106_0001943 3300048909 Bacteria 15501
580 Ga0496106_1221753 3300048909 Bacteria 586
581 Ga0496106_1342121 3300048909 Bacteria 554
582 Ga0496107_0008009 3300048910 Bacteria 7293
583 Ga0496107_0365946 3300048910 Bacteria 1072
584 Ga0496107_0594152 3300048910 Bacteria 818
585 Ga0496108_0000927 3300048911 Bacteria 22857
586 Ga0496108_1298051 3300048911 Bacteria 612
587 Ga0496109_0000229 3300048912 Bacteria 54733
588 Ga0496109_0098872 3300048912 Bacteria 2706
589 Ga0496109_1273344 3300048912 Bacteria 671
590 Ga0496110_0138835 3300048913 Bacteria 2197
591 Ga0496111_0027253 3300048914 Bacteria 4041
592 Ga0496111_0200167 3300048914 Bacteria 1485
593 Ga0496112_0001343 3300048915 Bacteria 18708
594 Ga0496113_0751627 3300048916 Bacteria 776
595 Ga0496114_0118033 3300048917 Bacteria 2279
596 Ga0496114_0287126 3300048917 Bacteria 1451
597 Ga0496114_0395961 3300048917 Bacteria 1223
598 Ga0496114_0428277 3300048917 Bacteria 1172
599 Ga0496114_1081221 3300048917 Bacteria 687
600 Ga0496114_1782771 3300048917 Bacteria 504
601 Ga0496115_0119448 3300048918 Bacteria 2168
602 Ga0496115_0263705 3300048918 Bacteria 1416
603 Ga0496115_0410826 3300048918 Bacteria 1097
604 Ga0496115_0504336 3300048918 Bacteria 972
605 Ga0496116_0001930 3300048919 Bacteria 22336
606 Ga0496116_0059236 3300048919 Bacteria 2492
607 Ga0496117_0032761 3300048920 Bacteria 3942
608 Ga0496117_0059473 3300048920 Bacteria 2639
609 Ga0496118_0040566 3300048921 Bacteria 3699
610 Ga0496118_0055065 3300048921 Bacteria 3005
611 Ga0496118_0135281 3300048921 Bacteria 1574
612 Ga0496119_0061944 3300048922 Bacteria 2231
613 Ga0496119_0244834 3300048922 Bacteria 906
614 Ga0496119_0509803 3300048922 Bacteria 558
615 Ga0496120_0318030 3300048923 Bacteria 708
616 Ga0496121_0083960 3300048924 Bacteria 2512
617 Ga0496121_0622525 3300048924 Bacteria 662
618 Ga0496122_0020170 3300048925 Bacteria 6043
619 Ga0496122_0071255 3300048925 Bacteria 2478
620 Ga0496123_0009028 3300048926 Bacteria 9040
621 Ga0496124_0115166 3300048927 Bacteria 2158
622 Ga0496124_0520535 3300048927 Bacteria 792
623 Ga0496124_0668359 3300048927 Bacteria 664
624 Ga0496125_0000843 3300048928 Bacteria 49244
625 Ga0496125_0003929 3300048928 Bacteria 17533
626 Ga0496125_0045135 3300048928 Bacteria 3714
627 Ga0496126_0047419 3300048929 Bacteria 3933
628 Ga0496126_0183069 3300048929 Bacteria 1778
629 Ga0496126_0553651 3300048929 Bacteria 912
630 Ga0496126_0600145 3300048929 Bacteria 867
631 Ga0496126_0665375 3300048929 Bacteria 813
632 Ga0496126_0807366 3300048929 Bacteria 719
633 Ga0495678_154079 3300049459 Bacteria 740
634 Ga0501031_0014869 3300049568 Bacteria 5057
635 Ga0501032_0010617 3300049569 Bacteria 6631
636 Ga0501032_0136848 3300049569 Bacteria 1614
637 Ga0501033_0002710 3300049570 Bacteria 14858
638 Ga0501034_0894827 3300049571 Bacteria 776
639 Ga0501036_0047626 3300049572 Bacteria 3630
640 Ga0501036_0703829 3300049572 Bacteria 835
641 Ga0501037_0001298 3300049573 Bacteria 18369
642 Ga0501037_0131156 3300049573 Bacteria 1797
643 Ga0501038_0012835 3300049574 Bacteria 7648
644 Ga0501038_0102205 3300049574 Bacteria 2385
645 Ga0501039_0044276 3300049575 Bacteria 3437
646 Ga0501039_0090146 3300049575 Bacteria 2389
647 Ga0501041_0593984 3300049577 Bacteria 706
648 Ga0501042_0072752 3300049578 Bacteria 2459
649 Ga0501042_0479930 3300049578 Bacteria 902
650 Ga0501042_1133925 3300049578 Bacteria 570
651 Ga0501043_0096194 3300049579 Bacteria 2327
652 Ga0501046_0030078 3300049580 Bacteria 4410
653 Ga0501046_0168371 3300049580 Bacteria 1645
654 Ga0501067_0809440 3300049583 Bacteria 528
655 Ga0501067_0849530 3300049583 Bacteria 515
656 Ga0501068_0059540 3300049584 Bacteria 2319
657 Ga0501068_0842041 3300049584 Bacteria 602
658 Ga0501069_0614158 3300049585 Bacteria 653
659 Ga0501075_1005296 3300049591 Bacteria 634
660 Ga0501076_0551364 3300049592 Bacteria 950
661 Ga0501079_0389431 3300049741 Bacteria 1093
662 Ga0501079_1187996 3300049741 Bacteria 601
663 Ga0501080_0874368 3300049742 Bacteria 785
664 Ga0501081_0871311 3300049743 Bacteria 679
665 Ga0501035_0001311 3300049822 Bacteria 25709
666 Ga0501044_0048874 3300049823 Bacteria 4367
667 Ga0501044_0966445 3300049823 Bacteria 724
668 Ga0501045_0246868 3300049824 Bacteria 1329
669 nmdc:mga03n38_195895_c1 3300050490 Bacteria 1043
670 nmdc:mga00v17_558334_c1 3300050491 Bacteria 740
671 nmdc:mga00v17_704219_c1 3300050491 Bacteria 647
672 nmdc:mga0yw44_248904_c1 3300050492 Bacteria 1182
673 nmdc:mga0yw44_280364_c1 3300050492 Bacteria 1114
674 nmdc:mga0yw44_468936_c1 3300050492 Bacteria 854
675 nmdc:mga0yw44_476959_c1 3300050492 Bacteria 846
676 nmdc:mga06z11_73926_c1 3300050494 Bacteria 1811
677 nmdc:mga07m45_129657_c1 3300050496 Bacteria 1459
678 nmdc:mga05p37_72116_c1 3300050507 Bacteria 4249
679 nmdc:mga06r32_469230_c1 3300050510 Bacteria 1237
680 nmdc:mga0n895_101162_c1 3300050512 Bacteria 2892
681 nmdc:mga0n895_435306_c1 3300050512 Bacteria 1325
682 nmdc:mga0rr50_150317_c1 3300050513 Bacteria 1881
683 nmdc:mga0a205_1260416_c1 3300050515 Bacteria 587
684 nmdc:mga0sz30_162434_c1 3300050516 Bacteria 990
685 Ga0495601_0025408 3300053077 Bacteria 3652
686 Ga0495601_0199611 3300053077 Bacteria 1307
687 Ga0495601_0245791 3300053077 Bacteria 1168
688 Ga0495612_0020737 3300053078 Bacteria 2635
689 Ga0495612_0538014 3300053078 Bacteria 537
690 Ga0500635_0022200 3300053080 Bacteria 1965
691 Ga0495595_0001339 3300053084 Bacteria 9565
692 Ga0495595_0029009 3300053084 Bacteria 2473
693 Ga0495619_0008552 3300053085 Bacteria 6477
694 Ga0495619_0725857 3300053085 Bacteria 675
695 Ga0495619_0866902 3300053085 Bacteria 608
696 Ga0495619_0874259 3300053085 Bacteria 605
697 Ga0500578_0244440 3300053086 Bacteria 1083
698 Ga0500643_152494 3300053087 Bacteria 620
699 Ga0500643_181162 3300053087 Bacteria 565
700 Ga0500581_111615 3300053089 Bacteria 1331
701 Ga0500646_0018789 3300053090 Bacteria 1824
702 Ga0500646_0357082 3300053090 Bacteria 533
703 Ga0500647_0451632 3300053091 Bacteria 508
704 Ga0500583_0252970 3300053092 Bacteria 869
705 Ga0500566_0000107 3300053094 Bacteria 42130
706 Ga0500640_106878 3300053095 Bacteria 1146
707 Ga0500641_0010703 3300053096 Bacteria 3321
708 Ga0500641_0013776 3300053096 Bacteria 2974
709 Ga0500641_0027147 3300053096 Bacteria 2228
710 Ga0500650_0000245 3300053098 Bacteria 13194
711 Ga0500654_184684 3300053099 Bacteria 658
712 Ga0500555_063634 3300053103 Bacteria 987
713 Ga0500556_0000006 3300053104 Bacteria 453982
714 Ga0500556_0393604 3300053104 Bacteria 532
715 Ga0500557_061553 3300053105 Bacteria 1220
716 Ga0500562_024724 3300053108 Bacteria 1570
717 Ga0500569_027511 3300053109 Bacteria 1567
718 Ga0500572_065685 3300053111 Bacteria 1111
719 Ga0500592_023880 3300053116 Bacteria 985
720 Ga0500593_093751 3300053117 Bacteria 1266
721 Ga0500594_0051380 3300053118 Bacteria 1162
722 Ga0500594_0060471 3300053118 Bacteria 1091
723 Ga0500607_129470 3300053121 Bacteria 1206
724 Ga0500608_110319 3300053122 Bacteria 1262
725 Ga0500614_047140 3300053123 Bacteria 1118
726 Ga0500642_0000004 3300053130 Bacteria 433122
727 Ga0500642_0288666 3300053130 Bacteria 743
728 Ga0500642_0451871 3300053130 Bacteria 551
729 Ga0500652_000294 3300053131 Bacteria 18164
730 Ga0500658_0055005 3300053134 Bacteria 1637
731 Ga0500658_0524803 3300053134 Bacteria 534
732 Ga0500559_0044825 3300053136 Bacteria 1935
733 Ga0500559_0181246 3300053136 Bacteria 992
734 Ga0500568_0006383 3300053139 Bacteria 5923
735 Ga0500573_0548928 3300053140 Bacteria 512
736 Ga0500577_0001713 3300053142 Bacteria 5614
737 Ga0500577_0404478 3300053142 Bacteria 597
738 Ga0500586_001899 3300053145 Bacteria 4547
739 Ga0500588_0139664 3300053146 Bacteria 869
740 Ga0500588_0145174 3300053146 Bacteria 855
741 Ga0500589_082946 3300053147 Bacteria 1427
742 Ga0500590_068212 3300053148 Bacteria 1773
743 Ga0500603_002672 3300053150 Bacteria 3884
744 Ga0500604_0012314 3300053151 Bacteria 2308
745 Ga0500604_0107466 3300053151 Bacteria 924
746 Ga0500616_0000022 3300053153 Bacteria 460463
747 Ga0500619_030737 3300053154 Bacteria 1634
748 Ga0500630_230444 3300053159 Bacteria 682
749 Ga0500633_0050696 3300053160 Bacteria 1431
750 Ga0500634_0080584 3300053161 Bacteria 1679
751 Ga0500634_0204184 3300053161 Bacteria 864
752 Ga0500638_310618 3300053162 Bacteria 603
753 Ga0500639_032775 3300053163 Bacteria 2745
754 Ga0500639_214051 3300053163 Bacteria 812
755 Ga0500637_0280048 3300053178 Bacteria 918
756 Ga0500567_139228 3300053723 Bacteria 932
757 Ga0500570_144382 3300053724 Bacteria 865
758 Ga0500645_014664 3300053730 Bacteria 2493
759 Ga0500609_066175 3300053731 Bacteria 507
760 Ga0500596_003754 3300053735 Bacteria 2850
761 Ga0500601_011934 3300053737 Bacteria 978

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005983 Ga0081540_1011553 Ga0081540_10115536 55
2 3300003215 JGI25153J46596_10008562 JGI25153J46596_100085623 58
3 3300003659 JGI25404J52841_10028662 JGI25404J52841_100286621 58
4 3300003659 JGI25404J52841_10058670 JGI25404J52841_100586702 58
5 3300003762 Ga0055542_1013126 Ga0055542_10131261 58
6 3300003763 Ga0055529_1028398 Ga0055529_10283982 58
7 3300005327 Ga0070658_11080274 Ga0070658_110802742 58
8 3300005329 Ga0070683_100037044 Ga0070683_1000370446 58
9 3300005333 Ga0070677_10759471 Ga0070677_107594712 58
10 3300005336 Ga0070680_100117410 Ga0070680_1001174103 58
11 3300005336 Ga0070680_100140998 Ga0070680_1001409984 58
12 3300005336 Ga0070680_100590734 Ga0070680_1005907342 58
13 3300005336 Ga0070680_101253046 Ga0070680_1012530461 58
14 3300005337 Ga0070682_100084056 Ga0070682_1000840564 58
15 3300005337 Ga0070682_100623510 Ga0070682_1006235102 58
16 3300005337 Ga0070682_101443476 Ga0070682_1014434762 58
17 3300005339 Ga0070660_100158914 Ga0070660_1001589142 58
18 3300005340 Ga0070689_101611093 Ga0070689_1016110931 58
19 3300005341 Ga0070691_10082325 Ga0070691_100823252 58
20 3300005341 Ga0070691_10341589 Ga0070691_103415892 58
21 3300005341 Ga0070691_10911095 Ga0070691_109110952 58
22 3300005344 Ga0070661_100037794 Ga0070661_1000377944 58
23 3300005344 Ga0070661_100821582 Ga0070661_1008215822 58
24 3300005347 Ga0070668_100301498 Ga0070668_1003014982 58
25 3300005347 Ga0070668_101898410 Ga0070668_1018984102 58
26 3300005355 Ga0070671_100127930 Ga0070671_1001279304 58
27 3300005356 Ga0070674_100362098 Ga0070674_1003620982 58
28 3300005356 Ga0070674_100746463 Ga0070674_1007464632 58
29 3300005435 Ga0070714_100070525 Ga0070714_1000705253 58
30 3300005435 Ga0070714_100739113 Ga0070714_1007391132 58
31 3300005435 Ga0070714_100971817 Ga0070714_1009718172 58
32 3300005436 Ga0070713_100037902 Ga0070713_1000379024 58
33 3300005436 Ga0070713_100235418 Ga0070713_1002354183 58
34 3300005437 Ga0070710_10646984 Ga0070710_106469842 58
35 3300005437 Ga0070710_11394923 Ga0070710_113949232 58
36 3300005437 Ga0070710_11429009 Ga0070710_114290091 58
37 3300005439 Ga0070711_100004422 Ga0070711_1000044228 58
38 3300005439 Ga0070711_100013801 Ga0070711_1000138015 58
39 3300005439 Ga0070711_100585970 Ga0070711_1005859702 58
40 3300005439 Ga0070711_101045403 Ga0070711_1010454032 58
41 3300005439 Ga0070711_101611461 Ga0070711_1016114611 58
42 3300005441 Ga0070700_101911325 Ga0070700_1019113251 58
43 3300005455 Ga0070663_100034129 Ga0070663_1000341294 58
44 3300005455 Ga0070663_100255829 Ga0070663_1002558292 58
45 3300005455 Ga0070663_100399998 Ga0070663_1003999982 58
46 3300005455 Ga0070663_100427434 Ga0070663_1004274342 58
47 3300005455 Ga0070663_100662746 Ga0070663_1006627462 58
48 3300005455 Ga0070663_100907133 Ga0070663_1009071332 58
49 3300005456 Ga0070678_100118683 Ga0070678_1001186832 58
50 3300005456 Ga0070678_102212541 Ga0070678_1022125411 58
51 3300005458 Ga0070681_10001077 Ga0070681_1000107711 58
52 3300005458 Ga0070681_10067755 Ga0070681_100677552 58
53 3300005458 Ga0070681_10138614 Ga0070681_101386143 58
54 3300005458 Ga0070681_10202596 Ga0070681_102025962 58
55 3300005459 Ga0068867_100443955 Ga0068867_1004439552 58
56 3300005466 Ga0070685_11001738 Ga0070685_110017382 58
57 3300005467 Ga0070706_101350705 Ga0070706_1013507052 58
58 3300005518 Ga0070699_101360571 Ga0070699_1013605712 58
59 3300005530 Ga0070679_100074727 Ga0070679_1000747274 58
60 3300005530 Ga0070679_100137816 Ga0070679_1001378163 58
61 3300005530 Ga0070679_100210300 Ga0070679_1002103002 58
62 3300005530 Ga0070679_101845088 Ga0070679_1018450882 58
63 3300005530 Ga0070679_102041598 Ga0070679_1020415981 58
64 3300005535 Ga0070684_100014169 Ga0070684_1000141693 58
65 3300005535 Ga0070684_100062962 Ga0070684_1000629623 58
66 3300005535 Ga0070684_100134499 Ga0070684_1001344993 58
67 3300005535 Ga0070684_100258132 Ga0070684_1002581321 58
68 3300005536 Ga0070697_100932647 Ga0070697_1009326472 58
69 3300005536 Ga0070697_101244284 Ga0070697_1012442842 58
70 3300005539 Ga0068853_100050798 Ga0068853_1000507984 58
71 3300005539 Ga0068853_100738271 Ga0068853_1007382712 58
72 3300005539 Ga0068853_100894012 Ga0068853_1008940121 58
73 3300005539 Ga0068853_100991068 Ga0068853_1009910681 58
74 3300005543 Ga0070672_100626023 Ga0070672_1006260232 58
75 3300005545 Ga0070695_101341023 Ga0070695_1013410231 58
76 3300005546 Ga0070696_101648826 Ga0070696_1016488262 58
77 3300005547 Ga0070693_100155781 Ga0070693_1001557813 58
78 3300005548 Ga0070665_100113166 Ga0070665_1001131665 58
79 3300005548 Ga0070665_101238078 Ga0070665_1012380782 58
80 3300005548 Ga0070665_101508950 Ga0070665_1015089502 58
81 3300005563 Ga0068855_100234941 Ga0068855_1002349413 58
82 3300005563 Ga0068855_100325036 Ga0068855_1003250362 58
83 3300005564 Ga0070664_100337346 Ga0070664_1003373462 58
84 3300005564 Ga0070664_100701948 Ga0070664_1007019482 58
85 3300005564 Ga0070664_100794046 Ga0070664_1007940462 58
86 3300005564 Ga0070664_101071009 Ga0070664_1010710092 58
87 3300005577 Ga0068857_100033406 Ga0068857_1000334064 58
88 3300005577 Ga0068857_100278299 Ga0068857_1002782992 58
89 3300005577 Ga0068857_100484269 Ga0068857_1004842692 58
90 3300005578 Ga0068854_100446137 Ga0068854_1004461372 58
91 3300005578 Ga0068854_100733195 Ga0068854_1007331952 58
92 3300005578 Ga0068854_101365078 Ga0068854_1013650782 58
93 3300005614 Ga0068856_100000883 Ga0068856_10000088317 58
94 3300005614 Ga0068856_100185359 Ga0068856_1001853591 58
95 3300005614 Ga0068856_102130367 Ga0068856_1021303672 58
96 3300005614 Ga0068856_102155659 Ga0068856_1021556592 58
97 3300005615 Ga0070702_100771141 Ga0070702_1007711412 58
98 3300005616 Ga0068852_100137945 Ga0068852_1001379454 58
99 3300005616 Ga0068852_101144966 Ga0068852_1011449662 58
100 3300005616 Ga0068852_101236745 Ga0068852_1012367452 58
101 3300005618 Ga0068864_100697192 Ga0068864_1006971922 58
102 3300005718 Ga0068866_11170866 Ga0068866_111708662 58
103 3300005719 Ga0068861_100102538 Ga0068861_1001025384 58
104 3300005834 Ga0068851_10030531 Ga0068851_100305314 58
105 3300005834 Ga0068851_10272978 Ga0068851_102729782 58
106 3300005841 Ga0068863_100609883 Ga0068863_1006098832 58
107 3300005842 Ga0068858_102225665 Ga0068858_1022256651 58
108 3300005843 Ga0068860_100302277 Ga0068860_1003022773 58
109 3300005937 Ga0081455_10050780 Ga0081455_100507805 58
110 3300005983 Ga0081540_1005580 Ga0081540_10055806 58
111 3300005983 Ga0081540_1036340 Ga0081540_10363402 58
112 3300005985 Ga0081539_10031076 Ga0081539_100310763 58
113 3300006028 Ga0070717_10010596 Ga0070717_100105965 58
114 3300006028 Ga0070717_10707160 Ga0070717_107071602 58
115 3300006028 Ga0070717_10973001 Ga0070717_109730012 58
116 3300006038 Ga0075365_10043435 Ga0075365_100434354 58
117 3300006038 Ga0075365_10337527 Ga0075365_103375272 58
118 3300006038 Ga0075365_10395277 Ga0075365_103952772 58
119 3300006038 Ga0075365_10649289 Ga0075365_106492892 58
120 3300006048 Ga0075363_100114480 Ga0075363_1001144802 58
121 3300006048 Ga0075363_100246140 Ga0075363_1002461402 58
122 3300006051 Ga0075364_10099785 Ga0075364_100997854 58
123 3300006051 Ga0075364_10669110 Ga0075364_106691102 58
124 3300006051 Ga0075364_10695549 Ga0075364_106955492 58
125 3300006051 Ga0075364_11132101 Ga0075364_111321012 58
126 3300006163 Ga0070715_10114301 Ga0070715_101143012 58
127 3300006173 Ga0070716_100636588 Ga0070716_1006365882 58
128 3300006173 Ga0070716_100815104 Ga0070716_1008151042 58
129 3300006173 Ga0070716_101249910 Ga0070716_1012499102 58
130 3300006173 Ga0070716_101526249 Ga0070716_1015262492 58
131 3300006175 Ga0070712_100069559 Ga0070712_1000695594 58
132 3300006175 Ga0070712_100169236 Ga0070712_1001692363 58
133 3300006175 Ga0070712_100973289 Ga0070712_1009732892 58
134 3300006175 Ga0070712_101093769 Ga0070712_1010937692 58
135 3300006177 Ga0075362_10638160 Ga0075362_106381602 58
136 3300006178 Ga0075367_10088967 Ga0075367_100889672 58
137 3300006186 Ga0075369_10172646 Ga0075369_101726462 58
138 3300006237 Ga0097621_101076806 Ga0097621_1010768062 58
139 3300006237 Ga0097621_101125780 Ga0097621_1011257802 58
140 3300006237 Ga0097621_101735319 Ga0097621_1017353192 58
141 3300006237 Ga0097621_102389613 Ga0097621_1023896132 58
142 3300006353 Ga0075370_10141709 Ga0075370_101417093 58
143 3300006353 Ga0075370_10269892 Ga0075370_102698921 58
144 3300006353 Ga0075370_10411781 Ga0075370_104117812 58
145 3300006358 Ga0068871_100989737 Ga0068871_1009897372 58
146 3300006852 Ga0075433_11306457 Ga0075433_113064572 58
147 3300006871 Ga0075434_100106463 Ga0075434_1001064633 58
148 3300006880 Ga0075429_100129121 Ga0075429_1001291214 58
149 3300006881 Ga0068865_100649218 Ga0068865_1006492182 58
150 3300007076 Ga0075435_100017556 Ga0075435_1000175565 58
151 3300007076 Ga0075435_100250082 Ga0075435_1002500822 58
152 3300007265 Ga0099794_10500555 Ga0099794_105005552 58
153 3300009092 Ga0105250_10131028 Ga0105250_101310282 58
154 3300009093 Ga0105240_10082975 Ga0105240_100829755 58
155 3300009093 Ga0105240_10103958 Ga0105240_101039584 58
156 3300009093 Ga0105240_11261316 Ga0105240_112613162 58
157 3300009101 Ga0105247_10422786 Ga0105247_104227862 58
158 3300009101 Ga0105247_10464656 Ga0105247_104646562 58
159 3300009148 Ga0105243_10807452 Ga0105243_108074522 58
160 3300009148 Ga0105243_11357155 Ga0105243_113571552 58
161 3300009148 Ga0105243_11410672 Ga0105243_114106721 58
162 3300009174 Ga0105241_10345784 Ga0105241_103457842 58
163 3300009176 Ga0105242_10991626 Ga0105242_109916262 58
164 3300009177 Ga0105248_10374595 Ga0105248_103745952 58
165 3300009177 Ga0105248_11283825 Ga0105248_112838252 58
166 3300009545 Ga0105237_10035449 Ga0105237_100354492 58
167 3300009545 Ga0105237_10251441 Ga0105237_102514413 58
168 3300009545 Ga0105237_10255792 Ga0105237_102557923 58
169 3300009545 Ga0105237_10383874 Ga0105237_103838742 58
170 3300009545 Ga0105237_11925135 Ga0105237_119251352 58
171 3300009551 Ga0105238_10055393 Ga0105238_100553935 58
172 3300009551 Ga0105238_10224258 Ga0105238_102242582 58
173 3300009551 Ga0105238_11142189 Ga0105238_111421892 58
174 3300009551 Ga0105238_11728046 Ga0105238_117280462 58
175 3300009551 Ga0105238_12403090 Ga0105238_124030902 58
176 3300009553 Ga0105249_10120137 Ga0105249_101201374 58
177 3300009553 Ga0105249_12278030 Ga0105249_122780302 58
178 3300010159 Ga0099796_10313878 Ga0099796_103138782 58
179 3300010375 Ga0105239_10149716 Ga0105239_101497163 58
180 3300010375 Ga0105239_10957711 Ga0105239_109577111 58
181 3300010375 Ga0105239_10983446 Ga0105239_109834462 58
182 3300010375 Ga0105239_13161928 Ga0105239_131619281 58
183 3300012497 Ga0157319_1008774 Ga0157319_10087741 58
184 3300013104 Ga0157370_10448664 Ga0157370_104486642 58
185 3300013104 Ga0157370_11422785 Ga0157370_114227852 58
186 3300013104 Ga0157370_11719075 Ga0157370_117190752 58
187 3300013105 Ga0157369_10002556 Ga0157369_1000255618 58
188 3300013105 Ga0157369_10096664 Ga0157369_100966643 58
189 3300013105 Ga0157369_10690186 Ga0157369_106901861 58
190 3300013105 Ga0157369_12547113 Ga0157369_125471132 58
191 3300013297 Ga0157378_10676467 Ga0157378_106764672 58
192 3300013297 Ga0157378_11512605 Ga0157378_115126052 58
193 3300013306 Ga0163162_10208356 Ga0163162_102083562 58
194 3300013306 Ga0163162_11968248 Ga0163162_119682482 58
195 3300013307 Ga0157372_10931208 Ga0157372_109312082 58
196 3300013308 Ga0157375_11203541 Ga0157375_112035412 58
197 3300014325 Ga0163163_13340787 Ga0163163_133407872 58
198 3300014326 Ga0157380_10409237 Ga0157380_104092372 58
199 3300014497 Ga0182008_10107413 Ga0182008_101074132 58
200 3300014968 Ga0157379_11985808 Ga0157379_119858082 58
201 3300014969 Ga0157376_11476046 Ga0157376_114760462 58
202 3300014969 Ga0157376_12221419 Ga0157376_122214192 58
203 3300014969 Ga0157376_12340798 Ga0157376_123407981 58
204 3300014969 Ga0157376_12882820 Ga0157376_128828202 58
205 3300017792 Ga0163161_10343350 Ga0163161_103433502 58
206 3300020069 Ga0197907_10041262 Ga0197907_100412622 58
207 3300020070 Ga0206356_10043115 Ga0206356_100431152 58
208 3300020081 Ga0206354_10901948 Ga0206354_109019482 58
209 3300020082 Ga0206353_10873863 Ga0206353_108738632 58
210 3300021361 Ga0213872_10102891 Ga0213872_101028912 58
211 3300021441 Ga0213871_10063168 Ga0213871_100631682 58
212 3300025254 Ga0209148_1000295 Ga0209148_100029548 58
213 3300025261 Ga0209233_1007194 Ga0209233_10071944 58
214 3300025272 Ga0209455_1003242 Ga0209455_10032425 58
215 3300025297 Ga0209758_1001013 Ga0209758_100101317 58
216 3300025297 Ga0209758_1003254 Ga0209758_100325410 58
217 3300025297 Ga0209758_1052492 Ga0209758_10524923 58
218 3300025315 Ga0207697_10128727 Ga0207697_101287272 58
219 3300025321 Ga0207656_10016861 Ga0207656_100168612 58
220 3300025898 Ga0207692_10366829 Ga0207692_103668292 58
221 3300025898 Ga0207692_10403852 Ga0207692_104038522 58
222 3300025898 Ga0207692_10767106 Ga0207692_107671062 58
223 3300025899 Ga0207642_10080069 Ga0207642_100800692 58
224 3300025905 Ga0207685_10066599 Ga0207685_100665992 58
225 3300025905 Ga0207685_10622233 Ga0207685_106222332 58
226 3300025906 Ga0207699_10010872 Ga0207699_100108723 58
227 3300025909 Ga0207705_10049390 Ga0207705_100493903 58
228 3300025909 Ga0207705_10414138 Ga0207705_104141382 58
229 3300025912 Ga0207707_10001830 Ga0207707_1000183014 58
230 3300025912 Ga0207707_10008128 Ga0207707_100081285 58
231 3300025912 Ga0207707_10059002 Ga0207707_100590025 58
232 3300025912 Ga0207707_10093659 Ga0207707_100936593 58
233 3300025912 Ga0207707_10170982 Ga0207707_101709822 58
234 3300025913 Ga0207695_10069402 Ga0207695_100694023 58
235 3300025913 Ga0207695_11022785 Ga0207695_110227852 58
236 3300025913 Ga0207695_11351961 Ga0207695_113519612 58
237 3300025914 Ga0207671_10276376 Ga0207671_102763763 58
238 3300025914 Ga0207671_11199470 Ga0207671_111994702 58
239 3300025915 Ga0207693_10025107 Ga0207693_100251076 58
240 3300025915 Ga0207693_10137110 Ga0207693_101371103 58
241 3300025915 Ga0207693_10629760 Ga0207693_106297602 58
242 3300025916 Ga0207663_10079167 Ga0207663_100791672 58
243 3300025916 Ga0207663_10207923 Ga0207663_102079232 58
244 3300025916 Ga0207663_10693315 Ga0207663_106933152 58
245 3300025916 Ga0207663_11646587 Ga0207663_116465872 58
246 3300025917 Ga0207660_10008461 Ga0207660_100084614 58
247 3300025917 Ga0207660_10017636 Ga0207660_100176361 58
248 3300025917 Ga0207660_10164607 Ga0207660_101646073 58
249 3300025917 Ga0207660_10189206 Ga0207660_101892062 58
250 3300025917 Ga0207660_10955152 Ga0207660_109551522 58
251 3300025919 Ga0207657_10022795 Ga0207657_100227955 58
252 3300025920 Ga0207649_10122254 Ga0207649_101222542 58
253 3300025920 Ga0207649_10155073 Ga0207649_101550733 58
254 3300025921 Ga0207652_10018784 Ga0207652_100187845 58
255 3300025921 Ga0207652_10048787 Ga0207652_100487873 58
256 3300025921 Ga0207652_10076567 Ga0207652_100765673 58
257 3300025921 Ga0207652_10078201 Ga0207652_100782014 58
258 3300025921 Ga0207652_11403618 Ga0207652_114036182 58
259 3300025924 Ga0207694_10025727 Ga0207694_100257275 58
260 3300025924 Ga0207694_10163685 Ga0207694_101636852 58
261 3300025924 Ga0207694_10461323 Ga0207694_104613232 58
262 3300025924 Ga0207694_11530553 Ga0207694_115305532 58
263 3300025928 Ga0207700_10031127 Ga0207700_100311275 58
264 3300025928 Ga0207700_10221842 Ga0207700_102218423 58
265 3300025929 Ga0207664_10091181 Ga0207664_100911813 58
266 3300025932 Ga0207690_10331349 Ga0207690_103313492 58
267 3300025933 Ga0207706_10194624 Ga0207706_101946243 58
268 3300025933 Ga0207706_10968838 Ga0207706_109688382 58
269 3300025935 Ga0207709_10573293 Ga0207709_105732932 58
270 3300025935 Ga0207709_10817494 Ga0207709_108174942 58
271 3300025937 Ga0207669_11180070 Ga0207669_111800702 58
272 3300025937 Ga0207669_11272110 Ga0207669_112721102 58
273 3300025939 Ga0207665_10028702 Ga0207665_100287024 58
274 3300025939 Ga0207665_10491769 Ga0207665_104917692 58
275 3300025939 Ga0207665_10796180 Ga0207665_107961802 58
276 3300025939 Ga0207665_11121513 Ga0207665_111215132 58
277 3300025940 Ga0207691_10070200 Ga0207691_100702005 58
278 3300025944 Ga0207661_10004360 Ga0207661_100043606 58
279 3300025944 Ga0207661_10017144 Ga0207661_100171444 58
280 3300025944 Ga0207661_10041208 Ga0207661_100412085 58
281 3300025945 Ga0207679_10222756 Ga0207679_102227563 58
282 3300025945 Ga0207679_10585848 Ga0207679_105858482 58
283 3300025945 Ga0207679_10744386 Ga0207679_107443862 58
284 3300025945 Ga0207679_12075607 Ga0207679_120756072 58
285 3300025949 Ga0207667_10046395 Ga0207667_100463953 58
286 3300025949 Ga0207667_10086452 Ga0207667_100864523 58
287 3300025949 Ga0207667_10221432 Ga0207667_102214323 58
288 3300025949 Ga0207667_11722931 Ga0207667_117229312 58
289 3300025949 Ga0207667_12107007 Ga0207667_121070072 58
290 3300025972 Ga0207668_10446952 Ga0207668_104469522 58
291 3300025972 Ga0207668_10948418 Ga0207668_109484182 58
292 3300025972 Ga0207668_11178023 Ga0207668_111780231 58
293 3300025981 Ga0207640_10522392 Ga0207640_105223922 58
294 3300026041 Ga0207639_10084729 Ga0207639_100847293 58
295 3300026041 Ga0207639_10293443 Ga0207639_102934432 58
296 3300026041 Ga0207639_10787979 Ga0207639_107879792 58
297 3300026067 Ga0207678_10004213 Ga0207678_100042137 58
298 3300026067 Ga0207678_10522643 Ga0207678_105226432 58
299 3300026067 Ga0207678_10615552 Ga0207678_106155522 58
300 3300026067 Ga0207678_11512877 Ga0207678_115128772 58
301 3300026075 Ga0207708_10440067 Ga0207708_104400672 58
302 3300026078 Ga0207702_10000318 Ga0207702_1000031816 58
303 3300026078 Ga0207702_10314263 Ga0207702_103142633 58
304 3300026078 Ga0207702_10469132 Ga0207702_104691323 58
305 3300026078 Ga0207702_10633721 Ga0207702_106337212 58
306 3300026078 Ga0207702_11237301 Ga0207702_112373012 58
307 3300026078 Ga0207702_11350149 Ga0207702_113501492 58
308 3300026088 Ga0207641_10551532 Ga0207641_105515322 58
309 3300026088 Ga0207641_11512971 Ga0207641_115129712 58
310 3300026089 Ga0207648_10380350 Ga0207648_103803502 58
311 3300026095 Ga0207676_10653774 Ga0207676_106537742 58
312 3300026116 Ga0207674_10100669 Ga0207674_101006694 58
313 3300026116 Ga0207674_10117297 Ga0207674_101172973 58
314 3300026116 Ga0207674_10543883 Ga0207674_105438832 58
315 3300026116 Ga0207674_11649813 Ga0207674_116498131 58
316 3300026121 Ga0207683_10927454 Ga0207683_109274542 58
317 3300026142 Ga0207698_10187729 Ga0207698_101877292 58
318 3300026142 Ga0207698_12248129 Ga0207698_122481291 58
319 3300028379 Ga0268266_10213070 Ga0268266_102130702 58
320 3300028379 Ga0268266_11077111 Ga0268266_110771111 58
321 3300028794 Ga0307515_10191546 Ga0307515_101915463 58
322 3300031239 Ga0265328_10130440 Ga0265328_101304402 58
323 3300031249 Ga0265339_10355550 Ga0265339_103555502 58
324 3300031456 Ga0307513_10931616 Ga0307513_109316162 58
325 3300031548 Ga0307408_102239940 Ga0307408_1022399402 58
326 3300031616 Ga0307508_10000045 Ga0307508_1000004546 58
327 3300031616 Ga0307508_10024470 Ga0307508_100244704 58
328 3300031616 Ga0307508_10691212 Ga0307508_106912122 58
329 3300031711 Ga0265314_10151721 Ga0265314_101517212 58
330 3300031731 Ga0307405_10514475 Ga0307405_105144751 58
331 3300031731 Ga0307405_10614393 Ga0307405_106143932 58
332 3300031824 Ga0307413_10995885 Ga0307413_109958852 58
333 3300031824 Ga0307413_11977996 Ga0307413_119779962 58
334 3300031889 Ga0326468_10024312 Ga0326468_100243121 58
335 3300031901 Ga0307406_10923955 Ga0307406_109239552 58
336 3300031911 Ga0307412_10032668 Ga0307412_100326684 58
337 3300031911 Ga0307412_10708243 Ga0307412_107082432 58
338 3300031911 Ga0307412_11477899 Ga0307412_114778992 58
339 3300031995 Ga0307409_100312813 Ga0307409_1003128132 58
340 3300031995 Ga0307409_100473334 Ga0307409_1004733342 58
341 3300032002 Ga0307416_100417733 Ga0307416_1004177331 58
342 3300032002 Ga0307416_100484234 Ga0307416_1004842342 58
343 3300032002 Ga0307416_101206065 Ga0307416_1012060652 58
344 3300032005 Ga0307411_11002459 Ga0307411_110024592 58
345 3300032005 Ga0307411_11213109 Ga0307411_112131092 58
346 3300032005 Ga0307411_11502652 Ga0307411_115026522 58
347 3300032126 Ga0307415_101010633 Ga0307415_1010106332 58
348 3300032126 Ga0307415_101076124 Ga0307415_1010761241 58
349 3300035086 Ga0373934_0033081 Ga0373934_0033081_944_1123 58
350 3300035089 Ga0373944_0108551 Ga0373944_0108551_510_689 58
351 3300035111 Ga0373923_0050361 Ga0373923_0050361_577_756 58
352 3300035111 Ga0373923_0052729 Ga0373923_0052729_846_1025 58
353 3300035113 Ga0373936_0041380 Ga0373936_0041380_492_671 58
354 3300035116 Ga0373945_0156028 Ga0373945_0156028_32_211 58
355 3300035117 Ga0373953_0018502 Ga0373953_0018502_1140_1319 58
356 3300035117 Ga0373953_0018581 Ga0373953_0018581_1588_1767 58
357 3300035118 Ga0373954_0006969 Ga0373954_0006969_864_1043 58
358 3300035118 Ga0373954_0007810 Ga0373954_0007810_4122_4301 58
359 3300035118 Ga0373954_0023461 Ga0373954_0023461_279_458 58
360 3300035119 Ga0373956_0088528 Ga0373956_0088528_711_890 58
361 3300035120 Ga0373957_0052286 Ga0373957_0052286_1040_1219 58
362 3300035120 Ga0373957_0101302 Ga0373957_0101302_678_857 58
363 3300035170 Ga0373943_0009727 Ga0373943_0009727_618_797 58
364 3300035172 Ga0373955_0002799 Ga0373955_0002799_1019_1198 58
365 3300035172 Ga0373955_0056100 Ga0373955_0056100_1156_1335 58
366 3300035172 Ga0373955_0401811 Ga0373955_0401811_32_211 58
367 3300035410 Ga0373924_0041454 Ga0373924_0041454_1181_1360 58
368 3300035410 Ga0373924_0045145 Ga0373924_0045145_1383_1562 58
369 3300035410 Ga0373924_0136808 Ga0373924_0136808_462_641 58
370 3300035691 Ga0373931_0829866 Ga0373931_0829866_269_448 58
371 3300035692 Ga0373935_0117792 Ga0373935_0117792_984_1163 58
372 3300035692 Ga0373935_0128647 Ga0373935_0128647_523_702 58
373 3300035692 Ga0373935_1243793 Ga0373935_1243793_176_355 58
374 3300035695 Ga0373927_0090551 Ga0373927_0090551_1130_1309 58
375 3300035724 Ga0373933_0513536 Ga0373933_0513536_193_372 58
376 3300035724 Ga0373933_0640520 Ga0373933_0640520_171_350 58
377 3300035725 Ga0373947_0034346 Ga0373947_0034346_1654_1833 58
378 3300036401 Ga0373937_0019726 Ga0373937_0019726_2134_2313 58
379 3300036401 Ga0373937_0029464 Ga0373937_0029464_3770_3949 58
380 3300036401 Ga0373937_0046562 Ga0373937_0046562_1780_1959 58
381 3300036459 Ga0372808_000548 Ga0372808_000548_2126_2302 58
382 3300037068 Ga0373925_0012279 Ga0373925_0012279_283_462 58
383 3300037068 Ga0373925_0110821 Ga0373925_0110821_139_318 58
384 3300037068 Ga0373925_1511270 Ga0373925_1511270_187_363 58
385 3300037312 Ga0395899_0191736 Ga0395899_0191736_1073_1252 58
386 3300037418 Ga0395900_0977528 Ga0395900_0977528_110_289 58
387 3300037466 Ga0395898_1303842 Ga0395898_1303842_372_551 58
388 3300038443 Ga0395901_0267112 Ga0395901_0267112_908_1087 58
389 3300039437 Ga0436365_0422270 Ga0436365_0422270_64_240 58
390 3300039437 Ga0436365_1865258 Ga0436365_1865258_858_1037 58
391 3300039438 Ga0436360_0035660 Ga0436360_0035660_813_992 58
392 3300039447 Ga0436361_0034753 Ga0436361_0034753_2014_2193 58
393 3300039447 Ga0436361_0208430 Ga0436361_0208430_489_668 58
394 3300039450 Ga0436363_0976239 Ga0436363_0976239_771_950 58
395 3300039450 Ga0436363_1632720 Ga0436363_1632720_661_843 58
396 3300039453 Ga0436362_0798067 Ga0436362_0798067_3263_3442 58
397 3300041459 Ga0451800_1499558 Ga0451800_1499558_115_291 58
398 3300041463 Ga0451804_0609357 Ga0451804_0609357_298_477 58
399 3300041496 Ga0451839_0628551 Ga0451839_0628551_75_251 58
400 3300041498 Ga0451841_1157327 Ga0451841_1157327_419_598 58
401 3300042438 Ga0439459_0046903 Ga0439459_0046903_441_617 58
402 3300044684 Ga0466966_0056008 Ga0466966_0056008_991_1170 58
403 3300044684 Ga0466966_0669967 Ga0466966_0669967_312_491 58
404 3300044693 Ga0466961_0190673 Ga0466961_0190673_603_782 58
405 3300044694 Ga0466963_0082044 Ga0466963_0082044_722_901 58
406 3300044706 Ga0466964_0076656 Ga0466964_0076656_293_472 58
407 3300044765 Ga0466970_0142879 Ga0466970_0142879_823_1002 58
408 3300044765 Ga0466970_0330453 Ga0466970_0330453_139_318 58
409 3300044842 Ga0466957_0107372 Ga0466957_0107372_1084_1263 58
410 3300044842 Ga0466957_0777719 Ga0466957_0777719_429_608 58
411 3300045049 Ga0466959_0014935 Ga0466959_0014935_4718_4897 58
412 3300045049 Ga0466959_0063742 Ga0466959_0063742_1995_2174 58
413 3300045836 Ga0466958_0316935 Ga0466958_0316935_597_776 58
414 3300045976 Ga0466967_0281578 Ga0466967_0281578_35_214 58
415 3300045976 Ga0466967_0515142 Ga0466967_0515142_649_828 58
416 3300045976 Ga0466967_1794918 Ga0466967_1794918_139_318 58
417 3300046454 Ga0495592_0026198 Ga0495592_0026198_489_668 58
418 3300046454 Ga0495592_0076532 Ga0495592_0076532_872_1051 58
419 3300046454 Ga0495592_0144855 Ga0495592_0144855_772_951 58
420 3300046454 Ga0495592_0247576 Ga0495592_0247576_247_426 58
421 3300046455 Ga0495603_0155244 Ga0495603_0155244_195_371 58
422 3300046455 Ga0495603_0545228 Ga0495603_0545228_432_611 58
423 3300046458 Ga0495591_092469 Ga0495591_092469_173_349 58
424 3300046459 Ga0495629_0017285 Ga0495629_0017285_3854_4033 58
425 3300046459 Ga0495629_0072839 Ga0495629_0072839_290_469 58
426 3300046460 Ga0495638_0088791 Ga0495638_0088791_972_1151 58
427 3300046460 Ga0495638_0230549 Ga0495638_0230549_137_316 58
428 3300046460 Ga0495638_0351035 Ga0495638_0351035_116_295 58
429 3300046460 Ga0495638_0494309 Ga0495638_0494309_264_440 58
430 3300046460 Ga0495638_0583231 Ga0495638_0583231_142_321 58
431 3300046461 Ga0495641_0115962 Ga0495641_0115962_532_708 58
432 3300046461 Ga0495641_0490904 Ga0495641_0490904_192_371 58
433 3300046462 Ga0495651_0034650 Ga0495651_0034650_223_402 58
434 3300046462 Ga0495651_0210693 Ga0495651_0210693_905_1084 58
435 3300046462 Ga0495651_0313441 Ga0495651_0313441_82_261 58
436 3300046463 Ga0495653_0011881 Ga0495653_0011881_356_535 58
437 3300046463 Ga0495653_0105939 Ga0495653_0105939_1800_1979 58
438 3300046463 Ga0495653_0149079 Ga0495653_0149079_114_293 58
439 3300046472 Ga0495580_0001981 Ga0495580_0001981_2004_2183 58
440 3300046473 Ga0495582_0007153 Ga0495582_0007153_1917_2096 58
441 3300046474 Ga0495605_0306434 Ga0495605_0306434_386_562 58
442 3300046475 Ga0495639_0004165 Ga0495639_0004165_3951_4130 58
443 3300046475 Ga0495639_0068928 Ga0495639_0068928_219_395 58
444 3300046476 Ga0495662_0343618 Ga0495662_0343618_505_684 58
445 3300046477 Ga0495664_0004612 Ga0495664_0004612_2750_2929 58
446 3300046477 Ga0495664_0080946 Ga0495664_0080946_153_332 58
447 3300046492 Ga0495585_0275274 Ga0495585_0275274_552_728 58
448 3300046499 Ga0495594_0218284 Ga0495594_0218284_493_672 58
449 3300046500 Ga0495596_0330591 Ga0495596_0330591_131_307 58
450 3300046501 Ga0495607_0195714 Ga0495607_0195714_524_700 58
451 3300046501 Ga0495607_0267908 Ga0495607_0267908_295_474 58
452 3300046506 Ga0495583_0071868 Ga0495583_0071868_1284_1463 58
453 3300046507 Ga0495606_0047553 Ga0495606_0047553_1662_1841 58
454 3300046511 Ga0495608_0017638 Ga0495608_0017638_3371_3550 58
455 3300046511 Ga0495608_0070418 Ga0495608_0070418_535_714 58
456 3300046511 Ga0495608_0698872 Ga0495608_0698872_118_297 58
457 3300046512 Ga0495610_0013962 Ga0495610_0013962_2007_2186 58
458 3300046512 Ga0495610_0277186 Ga0495610_0277186_395_574 58
459 3300046514 Ga0495618_0014329 Ga0495618_0014329_2245_2424 58
460 3300046514 Ga0495618_0162324 Ga0495618_0162324_94_273 58
461 3300046514 Ga0495618_0251260 Ga0495618_0251260_823_1002 58
462 3300046515 Ga0495620_0028200 Ga0495620_0028200_2241_2420 58
463 3300046515 Ga0495620_0063536 Ga0495620_0063536_1116_1292 58
464 3300046516 Ga0495628_0025951 Ga0495628_0025951_4265_4444 58
465 3300046516 Ga0495628_0543998 Ga0495628_0543998_229_408 58
466 3300046517 Ga0495630_0110073 Ga0495630_0110073_645_824 58
467 3300046517 Ga0495630_0808351 Ga0495630_0808351_88_267 58
468 3300046518 Ga0495631_0036994 Ga0495631_0036994_378_557 58
469 3300046518 Ga0495631_0043066 Ga0495631_0043066_1718_1897 58
470 3300046518 Ga0495631_0445304 Ga0495631_0445304_101_277 58
471 3300046519 Ga0495632_0131004 Ga0495632_0131004_520_699 58
472 3300046520 Ga0495637_0055392 Ga0495637_0055392_81_260 58
473 3300046522 Ga0495643_0237461 Ga0495643_0237461_101_280 58
474 3300046522 Ga0495643_0249730 Ga0495643_0249730_633_812 58
475 3300046523 Ga0495644_0022208 Ga0495644_0022208_198_374 58
476 3300046524 Ga0495648_0059255 Ga0495648_0059255_878_1057 58
477 3300046524 Ga0495648_0324809 Ga0495648_0324809_302_478 58
478 3300046525 Ga0495663_0073680 Ga0495663_0073680_384_560 58
479 3300046529 Ga0495652_0021450 Ga0495652_0021450_2626_2805 58
480 3300046529 Ga0495652_0112657 Ga0495652_0112657_1663_1842 58
481 3300046529 Ga0495652_0687475 Ga0495652_0687475_149_328 58
482 3300046529 Ga0495652_0854281 Ga0495652_0854281_85_264 58
483 3300046531 Ga0495665_0545974 Ga0495665_0545974_32_211 58
484 3300046533 Ga0495640_0018260 Ga0495640_0018260_252_431 58
485 3300046533 Ga0495640_0057123 Ga0495640_0057123_1655_1834 58
486 3300046533 Ga0495640_0092748 Ga0495640_0092748_162_341 58
487 3300046535 Ga0495586_0562142 Ga0495586_0562142_259_438 58
488 3300046536 Ga0495587_0009714 Ga0495587_0009714_5202_5381 58
489 3300046536 Ga0495587_0317659 Ga0495587_0317659_389_568 58
490 3300046536 Ga0495587_0720322 Ga0495587_0720322_250_429 58
491 3300046537 Ga0495598_0103970 Ga0495598_0103970_133_309 58
492 3300046538 Ga0495609_0051495 Ga0495609_0051495_404_583 58
493 3300046538 Ga0495609_0352142 Ga0495609_0352142_168_344 58
494 3300046538 Ga0495609_0415617 Ga0495609_0415617_77_253 58
495 3300046539 Ga0495621_0052498 Ga0495621_0052498_609_785 58
496 3300046543 Ga0495645_0010485 Ga0495645_0010485_5648_5827 58
497 3300046543 Ga0495645_0093242 Ga0495645_0093242_289_468 58
498 3300046557 Ga0495622_0205987 Ga0495622_0205987_83_259 58
499 3300046558 Ga0495633_0236593 Ga0495633_0236593_563_739 58
500 3300046559 Ga0495667_0003525 Ga0495667_0003525_632_811 58
501 3300046559 Ga0495667_0209891 Ga0495667_0209891_286_465 58
502 3300046615 Ga0495656_0372079 Ga0495656_0372079_452_628 58
503 3300046616 Ga0495668_0101673 Ga0495668_0101673_744_920 58
504 3300046642 Ga0495634_0032414 Ga0495634_0032414_1949_2128 58
505 3300046642 Ga0495634_0051141 Ga0495634_0051141_2160_2339 58
506 3300046642 Ga0495634_0542737 Ga0495634_0542737_271_450 58
507 3300046648 Ga0495611_0067172 Ga0495611_0067172_1263_1442 58
508 3300046648 Ga0495611_0175393 Ga0495611_0175393_136_315 58
509 3300046660 Ga0495625_0153563 Ga0495625_0153563_1220_1399 58
510 3300046660 Ga0495625_0621295 Ga0495625_0621295_379_555 58
511 3300046663 Ga0495635_0007981 Ga0495635_0007981_5330_5509 58
512 3300046663 Ga0495635_0054013 Ga0495635_0054013_998_1177 58
513 3300046663 Ga0495635_0112152 Ga0495635_0112152_673_852 58
514 3300046665 Ga0495661_0194607 Ga0495661_0194607_593_772 58
515 3300046674 Ga0495588_0267626 Ga0495588_0267626_610_786 58
516 3300046675 Ga0495657_0004913 Ga0495657_0004913_762_941 58
517 3300046675 Ga0495657_0232602 Ga0495657_0232602_113_292 58
518 3300046678 Ga0495599_0429059 Ga0495599_0429059_484_663 58
519 3300046679 Ga0495623_0041079 Ga0495623_0041079_1740_1919 58
520 3300046679 Ga0495623_0068214 Ga0495623_0068214_1484_1663 58
521 3300046679 Ga0495623_0517828 Ga0495623_0517828_200_379 58
522 3300046680 Ga0495646_0069394 Ga0495646_0069394_924_1103 58
523 3300046680 Ga0495646_0127658 Ga0495646_0127658_145_324 58
524 3300046680 Ga0495646_0291614 Ga0495646_0291614_297_476 58
525 3300046681 Ga0495647_0012555 Ga0495647_0012555_1665_1844 58
526 3300046683 Ga0495658_0046528 Ga0495658_0046528_1814_1993 58
527 3300046684 Ga0495669_0172397 Ga0495669_0172397_147_323 58
528 3300046689 Ga0495613_0132279 Ga0495613_0132279_909_1088 58
529 3300046689 Ga0495613_0980907 Ga0495613_0980907_252_431 58
530 3300046691 Ga0495670_0063201 Ga0495670_0063201_722_901 58
531 3300046692 Ga0495671_0395721 Ga0495671_0395721_361_540 58
532 3300046794 Ga0495589_0121939 Ga0495589_0121939_421_597 58
533 3300046794 Ga0495589_0532145 Ga0495589_0532145_290_466 58
534 3300046809 Ga0495600_0020007 Ga0495600_0020007_3798_3977 58
535 3300046809 Ga0495600_0196043 Ga0495600_0196043_586_765 58
536 3300046809 Ga0495600_0284244 Ga0495600_0284244_292_471 58
537 3300046810 Ga0495660_0113626 Ga0495660_0113626_109_288 58
538 3300047315 Ga0495581_0713450 Ga0495581_0713450_329_508 58
539 3300047315 Ga0495581_0910227 Ga0495581_0910227_241_417 58
540 3300047317 Ga0495604_0002900 Ga0495604_0002900_1377_1556 58
541 3300047317 Ga0495604_0106518 Ga0495604_0106518_1631_1810 58
542 3300047319 Ga0495674_0031429 Ga0495674_0031429_94_273 58
543 3300047319 Ga0495674_0098054 Ga0495674_0098054_944_1123 58
544 3300047319 Ga0495674_0170502 Ga0495674_0170502_199_378 58
545 3300047320 Ga0495672_0222555 Ga0495672_0222555_310_489 58
546 3300047320 Ga0495672_0334975 Ga0495672_0334975_206_385 58
547 3300047321 Ga0495676_0066265 Ga0495676_0066265_1926_2102 58
548 3300047322 Ga0495680_0025446 Ga0495680_0025446_2498_2677 58
549 3300047322 Ga0495680_0052112 Ga0495680_0052112_1435_1614 58
550 3300047322 Ga0495680_0450725 Ga0495680_0450725_46_225 58
551 3300047444 Ga0495675_0061451 Ga0495675_0061451_1943_2122 58
552 3300047444 Ga0495675_0137244 Ga0495675_0137244_578_757 58
553 3300047445 Ga0495677_0117234 Ga0495677_0117234_341_517 58
554 3300047445 Ga0495677_0158174 Ga0495677_0158174_552_728 58
555 3300047447 Ga0495685_150004 Ga0495685_150004_13_189 58
556 3300047469 Ga0495673_0273062 Ga0495673_0273062_287_466 58
557 3300047470 Ga0495681_0064308 Ga0495681_0064308_86_265 58
558 3300047471 Ga0495684_0034017 Ga0495684_0034017_388_567 58
559 3300047471 Ga0495684_0295214 Ga0495684_0295214_559_738 58
560 3300047472 Ga0495686_0090210 Ga0495686_0090210_234_413 58
561 3300047472 Ga0495686_0106625 Ga0495686_0106625_1311_1490 58
562 3300047673 Ga0495593_0003761 Ga0495593_0003761_6442_6621 58
563 3300047673 Ga0495593_0017042 Ga0495593_0017042_1260_1439 58
564 3300048088 Ga0495602_0058849 Ga0495602_0058849_868_1047 58
565 3300048088 Ga0495602_0111824 Ga0495602_0111824_905_1084 58
566 3300048089 Ga0495614_0112116 Ga0495614_0112116_381_560 58
567 3300048089 Ga0495614_0137626 Ga0495614_0137626_169_348 58
568 3300048903 Ga0496100_0084827 Ga0496100_0084827_626_805 58
569 3300048903 Ga0496100_0164023 Ga0496100_0164023_120_299 58
570 3300048903 Ga0496100_0404472 Ga0496100_0404472_723_902 58
571 3300048903 Ga0496100_1541450 Ga0496100_1541450_83_262 58
572 3300048904 Ga0496101_0109901 Ga0496101_0109901_1385_1561 58
573 3300048904 Ga0496101_0161922 Ga0496101_0161922_1315_1494 58
574 3300048904 Ga0496101_0192059 Ga0496101_0192059_1321_1497 58
575 3300048907 Ga0496104_1006856 Ga0496104_1006856_237_413 58
576 3300048907 Ga0496104_1057227 Ga0496104_1057227_376_555 58
577 3300048908 Ga0496105_0487389 Ga0496105_0487389_433_609 58
578 3300048908 Ga0496105_0619756 Ga0496105_0619756_85_264 58
579 3300048909 Ga0496106_0001943 Ga0496106_0001943_8337_8516 58
580 3300048909 Ga0496106_1221753 Ga0496106_1221753_174_353 58
581 3300048909 Ga0496106_1342121 Ga0496106_1342121_311_490 58
582 3300048910 Ga0496107_0008009 Ga0496107_0008009_6760_6939 58
583 3300048910 Ga0496107_0365946 Ga0496107_0365946_716_895 58
584 3300048910 Ga0496107_0594152 Ga0496107_0594152_376_552 58
585 3300048911 Ga0496108_0000927 Ga0496108_0000927_7649_7828 58
586 3300048911 Ga0496108_1298051 Ga0496108_1298051_173_352 58
587 3300048912 Ga0496109_0000229 Ga0496109_0000229_4168_4347 58
588 3300048912 Ga0496109_0098872 Ga0496109_0098872_2418_2597 58
589 3300048912 Ga0496109_1273344 Ga0496109_1273344_262_438 58
590 3300048913 Ga0496110_0138835 Ga0496110_0138835_1791_1970 58
591 3300048914 Ga0496111_0027253 Ga0496111_0027253_653_832 58
592 3300048914 Ga0496111_0200167 Ga0496111_0200167_124_303 58
593 3300048915 Ga0496112_0001343 Ga0496112_0001343_3027_3206 58
594 3300048916 Ga0496113_0751627 Ga0496113_0751627_356_535 58
595 3300048917 Ga0496114_0118033 Ga0496114_0118033_1793_1972 58
596 3300048917 Ga0496114_0287126 Ga0496114_0287126_479_661 58
597 3300048917 Ga0496114_0395961 Ga0496114_0395961_702_881 58
598 3300048917 Ga0496114_0428277 Ga0496114_0428277_784_960 58
599 3300048917 Ga0496114_1081221 Ga0496114_1081221_135_314 58
600 3300048917 Ga0496114_1782771 Ga0496114_1782771_264_443 58
601 3300048918 Ga0496115_0119448 Ga0496115_0119448_1870_2049 58
602 3300048918 Ga0496115_0263705 Ga0496115_0263705_1007_1189 58
603 3300048918 Ga0496115_0410826 Ga0496115_0410826_258_437 58
604 3300048918 Ga0496115_0504336 Ga0496115_0504336_674_853 58
605 3300048919 Ga0496116_0001930 Ga0496116_0001930_20999_21178 58
606 3300048919 Ga0496116_0059236 Ga0496116_0059236_823_1002 58
607 3300048920 Ga0496117_0032761 Ga0496117_0032761_3018_3197 58
608 3300048920 Ga0496117_0059473 Ga0496117_0059473_2182_2361 58
609 3300048921 Ga0496118_0040566 Ga0496118_0040566_775_954 58
610 3300048921 Ga0496118_0055065 Ga0496118_0055065_977_1156 58
611 3300048921 Ga0496118_0135281 Ga0496118_0135281_10_189 58
612 3300048922 Ga0496119_0061944 Ga0496119_0061944_1171_1350 58
613 3300048922 Ga0496119_0244834 Ga0496119_0244834_215_394 58
614 3300048922 Ga0496119_0509803 Ga0496119_0509803_261_440 58
615 3300048923 Ga0496120_0318030 Ga0496120_0318030_210_389 58
616 3300048924 Ga0496121_0083960 Ga0496121_0083960_978_1157 58
617 3300048924 Ga0496121_0622525 Ga0496121_0622525_411_590 58
618 3300048925 Ga0496122_0020170 Ga0496122_0020170_5787_5966 58
619 3300048925 Ga0496122_0071255 Ga0496122_0071255_1330_1509 58
620 3300048926 Ga0496123_0009028 Ga0496123_0009028_6360_6539 58
621 3300048927 Ga0496124_0115166 Ga0496124_0115166_230_409 58
622 3300048927 Ga0496124_0520535 Ga0496124_0520535_49_228 58
623 3300048927 Ga0496124_0668359 Ga0496124_0668359_320_499 58
624 3300048928 Ga0496125_0000843 Ga0496125_0000843_46779_46958 58
625 3300048928 Ga0496125_0003929 Ga0496125_0003929_14696_14875 58
626 3300048928 Ga0496125_0045135 Ga0496125_0045135_1911_2090 58
627 3300048929 Ga0496126_0047419 Ga0496126_0047419_2008_2187 58
628 3300048929 Ga0496126_0183069 Ga0496126_0183069_264_443 58
629 3300048929 Ga0496126_0553651 Ga0496126_0553651_348_524 58
630 3300048929 Ga0496126_0600145 Ga0496126_0600145_630_809 58
631 3300048929 Ga0496126_0665375 Ga0496126_0665375_476_655 58
632 3300048929 Ga0496126_0807366 Ga0496126_0807366_312_491 58
633 3300049459 Ga0495678_154079 Ga0495678_154079_547_726 58
634 3300049568 Ga0501031_0014869 Ga0501031_0014869_3203_3382 58
635 3300049569 Ga0501032_0010617 Ga0501032_0010617_5155_5334 58
636 3300049569 Ga0501032_0136848 Ga0501032_0136848_990_1169 58
637 3300049570 Ga0501033_0002710 Ga0501033_0002710_3990_4169 58
638 3300049571 Ga0501034_0894827 Ga0501034_0894827_388_567 58
639 3300049572 Ga0501036_0047626 Ga0501036_0047626_133_312 58
640 3300049572 Ga0501036_0703829 Ga0501036_0703829_493_672 58
641 3300049573 Ga0501037_0001298 Ga0501037_0001298_17015_17194 58
642 3300049573 Ga0501037_0131156 Ga0501037_0131156_566_745 58
643 3300049574 Ga0501038_0012835 Ga0501038_0012835_6688_6867 58
644 3300049574 Ga0501038_0102205 Ga0501038_0102205_782_961 58
645 3300049575 Ga0501039_0044276 Ga0501039_0044276_2514_2693 58
646 3300049575 Ga0501039_0090146 Ga0501039_0090146_786_965 58
647 3300049577 Ga0501041_0593984 Ga0501041_0593984_375_554 58
648 3300049578 Ga0501042_0072752 Ga0501042_0072752_1141_1320 58
649 3300049578 Ga0501042_0479930 Ga0501042_0479930_547_726 58
650 3300049578 Ga0501042_1133925 Ga0501042_1133925_29_205 58
651 3300049579 Ga0501043_0096194 Ga0501043_0096194_921_1100 58
652 3300049580 Ga0501046_0030078 Ga0501046_0030078_2503_2682 58
653 3300049580 Ga0501046_0168371 Ga0501046_0168371_1213_1392 58
654 3300049583 Ga0501067_0809440 Ga0501067_0809440_183_359 58
655 3300049583 Ga0501067_0849530 Ga0501067_0849530_168_344 58
656 3300049584 Ga0501068_0059540 Ga0501068_0059540_903_1082 58
657 3300049584 Ga0501068_0842041 Ga0501068_0842041_339_518 58
658 3300049585 Ga0501069_0614158 Ga0501069_0614158_266_442 58
659 3300049591 Ga0501075_1005296 Ga0501075_1005296_237_413 58
660 3300049592 Ga0501076_0551364 Ga0501076_0551364_67_243 58
661 3300049741 Ga0501079_0389431 Ga0501079_0389431_482_661 58
662 3300049741 Ga0501079_1187996 Ga0501079_1187996_179_355 58
663 3300049742 Ga0501080_0874368 Ga0501080_0874368_17_193 58
664 3300049743 Ga0501081_0871311 Ga0501081_0871311_419_598 58
665 3300049822 Ga0501035_0001311 Ga0501035_0001311_2696_2875 58
666 3300049823 Ga0501044_0048874 Ga0501044_0048874_2961_3140 58
667 3300049823 Ga0501044_0966445 Ga0501044_0966445_92_271 58
668 3300049824 Ga0501045_0246868 Ga0501045_0246868_132_311 58
669 3300050490 nmdc:mga03n38_195895_c1 nmdc:mga03n38_195895_c1_448_627 58
670 3300050491 nmdc:mga00v17_558334_c1 nmdc:mga00v17_558334_c1_198_377 58
671 3300050491 nmdc:mga00v17_704219_c1 nmdc:mga00v17_704219_c1_386_565 58
672 3300050492 nmdc:mga0yw44_248904_c1 nmdc:mga0yw44_248904_c1_871_1050 58
673 3300050492 nmdc:mga0yw44_280364_c1 nmdc:mga0yw44_280364_c1_63_239 58
674 3300050492 nmdc:mga0yw44_468936_c1 nmdc:mga0yw44_468936_c1_600_779 58
675 3300050492 nmdc:mga0yw44_476959_c1 nmdc:mga0yw44_476959_c1_204_383 58
676 3300050494 nmdc:mga06z11_73926_c1 nmdc:mga06z11_73926_c1_938_1117 58
677 3300050496 nmdc:mga07m45_129657_c1 nmdc:mga07m45_129657_c1_415_591 58
678 3300050507 nmdc:mga05p37_72116_c1 nmdc:mga05p37_72116_c1_2115_2297 58
679 3300050510 nmdc:mga06r32_469230_c1 nmdc:mga06r32_469230_c1_553_735 58
680 3300050512 nmdc:mga0n895_101162_c1 nmdc:mga0n895_101162_c1_1020_1199 58
681 3300050512 nmdc:mga0n895_435306_c1 nmdc:mga0n895_435306_c1_829_1005 58
682 3300050513 nmdc:mga0rr50_150317_c1 nmdc:mga0rr50_150317_c1_330_506 58
683 3300050515 nmdc:mga0a205_1260416_c1 nmdc:mga0a205_1260416_c1_176_355 58
684 3300050516 nmdc:mga0sz30_162434_c1 nmdc:mga0sz30_162434_c1_187_366 58
685 3300053077 Ga0495601_0025408 Ga0495601_0025408_2472_2651 58
686 3300053077 Ga0495601_0199611 Ga0495601_0199611_989_1168 58
687 3300053077 Ga0495601_0245791 Ga0495601_0245791_483_662 58
688 3300053078 Ga0495612_0020737 Ga0495612_0020737_1771_1950 58
689 3300053078 Ga0495612_0538014 Ga0495612_0538014_246_425 58
690 3300053080 Ga0500635_0022200 Ga0500635_0022200_1141_1329 58
691 3300053084 Ga0495595_0001339 Ga0495595_0001339_9123_9302 58
692 3300053084 Ga0495595_0029009 Ga0495595_0029009_614_793 58
693 3300053085 Ga0495619_0008552 Ga0495619_0008552_3673_3852 58
694 3300053085 Ga0495619_0725857 Ga0495619_0725857_97_276 58
695 3300053085 Ga0495619_0866902 Ga0495619_0866902_328_507 58
696 3300053085 Ga0495619_0874259 Ga0495619_0874259_246_425 58
697 3300053086 Ga0500578_0244440 Ga0500578_0244440_205_384 58
698 3300053087 Ga0500643_152494 Ga0500643_152494_205_384 58
699 3300053087 Ga0500643_181162 Ga0500643_181162_342_521 58
700 3300053089 Ga0500581_111615 Ga0500581_111615_433_612 58
701 3300053090 Ga0500646_0018789 Ga0500646_0018789_95_271 58
702 3300053090 Ga0500646_0357082 Ga0500646_0357082_204_383 58
703 3300053091 Ga0500647_0451632 Ga0500647_0451632_303_482 58
704 3300053092 Ga0500583_0252970 Ga0500583_0252970_542_721 58
705 3300053094 Ga0500566_0000107 Ga0500566_0000107_1792_1971 58
706 3300053095 Ga0500640_106878 Ga0500640_106878_557_745 58
707 3300053096 Ga0500641_0010703 Ga0500641_0010703_326_502 58
708 3300053096 Ga0500641_0013776 Ga0500641_0013776_1340_1519 58
709 3300053096 Ga0500641_0027147 Ga0500641_0027147_1558_1734 58
710 3300053098 Ga0500650_0000245 Ga0500650_0000245_8422_8601 58
711 3300053099 Ga0500654_184684 Ga0500654_184684_455_634 58
712 3300053103 Ga0500555_063634 Ga0500555_063634_797_976 58
713 3300053104 Ga0500556_0000006 Ga0500556_0000006_216428_216607 58
714 3300053104 Ga0500556_0393604 Ga0500556_0393604_112_291 58
715 3300053105 Ga0500557_061553 Ga0500557_061553_577_756 58
716 3300053108 Ga0500562_024724 Ga0500562_024724_12_191 58
717 3300053109 Ga0500569_027511 Ga0500569_027511_16_195 58
718 3300053111 Ga0500572_065685 Ga0500572_065685_913_1101 58
719 3300053116 Ga0500592_023880 Ga0500592_023880_712_891 58
720 3300053117 Ga0500593_093751 Ga0500593_093751_279_458 58
721 3300053118 Ga0500594_0051380 Ga0500594_0051380_399_578 58
722 3300053118 Ga0500594_0060471 Ga0500594_0060471_794_973 58
723 3300053121 Ga0500607_129470 Ga0500607_129470_883_1062 58
724 3300053122 Ga0500608_110319 Ga0500608_110319_901_1080 58
725 3300053123 Ga0500614_047140 Ga0500614_047140_313_492 58
726 3300053130 Ga0500642_0000004 Ga0500642_0000004_266646_266825 58
727 3300053130 Ga0500642_0288666 Ga0500642_0288666_353_532 58
728 3300053130 Ga0500642_0451871 Ga0500642_0451871_34_210 58
729 3300053131 Ga0500652_000294 Ga0500652_000294_2456_2635 58
730 3300053134 Ga0500658_0055005 Ga0500658_0055005_195_374 58
731 3300053134 Ga0500658_0524803 Ga0500658_0524803_32_211 58
732 3300053136 Ga0500559_0044825 Ga0500559_0044825_1494_1682 58
733 3300053136 Ga0500559_0181246 Ga0500559_0181246_410_589 58
734 3300053139 Ga0500568_0006383 Ga0500568_0006383_3298_3477 58
735 3300053140 Ga0500573_0548928 Ga0500573_0548928_61_240 58
736 3300053142 Ga0500577_0001713 Ga0500577_0001713_3881_4060 58
737 3300053142 Ga0500577_0404478 Ga0500577_0404478_33_212 58
738 3300053145 Ga0500586_001899 Ga0500586_001899_530_709 58
739 3300053146 Ga0500588_0139664 Ga0500588_0139664_537_716 58
740 3300053146 Ga0500588_0145174 Ga0500588_0145174_458_637 58
741 3300053147 Ga0500589_082946 Ga0500589_082946_670_846 58
742 3300053148 Ga0500590_068212 Ga0500590_068212_820_1008 58
743 3300053150 Ga0500603_002672 Ga0500603_002672_468_647 58
744 3300053151 Ga0500604_0012314 Ga0500604_0012314_1226_1405 58
745 3300053151 Ga0500604_0107466 Ga0500604_0107466_254_430 58
746 3300053153 Ga0500616_0000022 Ga0500616_0000022_214851_215030 58
747 3300053154 Ga0500619_030737 Ga0500619_030737_1138_1317 58
748 3300053159 Ga0500630_230444 Ga0500630_230444_342_521 58
749 3300053160 Ga0500633_0050696 Ga0500633_0050696_228_407 58
750 3300053161 Ga0500634_0080584 Ga0500634_0080584_327_506 58
751 3300053161 Ga0500634_0204184 Ga0500634_0204184_504_683 58
752 3300053162 Ga0500638_310618 Ga0500638_310618_107_295 58
753 3300053163 Ga0500639_032775 Ga0500639_032775_2034_2222 58
754 3300053163 Ga0500639_214051 Ga0500639_214051_302_490 58
755 3300053178 Ga0500637_0280048 Ga0500637_0280048_444_632 58
756 3300053723 Ga0500567_139228 Ga0500567_139228_162_341 58
757 3300053724 Ga0500570_144382 Ga0500570_144382_161_340 58
758 3300053730 Ga0500645_014664 Ga0500645_014664_2071_2250 58
759 3300053731 Ga0500609_066175 Ga0500609_066175_200_379 58
760 3300053735 Ga0500596_003754 Ga0500596_003754_1264_1452 58
761 3300053737 Ga0500601_011934 Ga0500601_011934_174_362 58

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04995

CcmD

Heme exporter protein D (CcmD)

15

58

0.95

Feature Viewer

pLDDT pTM Quality
80.76 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map