F479541
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 760 | 368 | 638 | 226 |
Family's Representative Sequence
| Representative Sequence | 3300035112|Ga0373932_0001806|Ga0373932_0001806_3489_4184 |
| Length | 231 |
| Sequence | MKILMVLTSHNQLGNTGRKTGFWLEEFAAPYFVFRDAGVELTLASPKGGQPPIDPKSDLPENQTPAMERFKQDQAAQQALAQTVRLADMRAEDFDAIFYPGGHGPMWDLADNADSIALIEAFYNSGKPVAAVCHAPAVLHRVTYMGAPIVKGKHVTGFANSEEEAVQLTNVVPFLVEDELKRLGGRYEKAPDWESFAVVDGRLITGQNPASSTAAAQELLKLLQLMQRKAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 2 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 3 | 2547132181 | Kosakonia sacchari SP1 | Isolate | Stem |
| 4 | 2561511199 | Enterobacter sp. R4-368 | Isolate | Nodule |
| 5 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 6 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 7 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 8 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 9 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 10 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 11 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 12 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 13 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 14 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 15 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 16 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 17 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 18 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 19 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 20 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 21 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 22 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 23 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 24 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 25 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 26 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 27 | 2706794495 | Dickeya zeae ZJU1202 | Isolate | Unclassified |
| 28 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 29 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 30 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 31 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 32 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 33 | 2738541275 | Novosphingobium sp. GV027 | Isolate | Unclassified |
| 34 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 35 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 36 | 2738541301 | Novosphingobium sp. GV079 | Isolate | Unclassified |
| 37 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 38 | 2738541304 | Novosphingobium sp. GV061 | Isolate | Unclassified |
| 39 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 40 | 2738543022 | Novosphingobium sp. GV055 | Isolate | Unclassified |
| 41 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 42 | 2738543031 | Pleomorphomonas sp. CF100 | Isolate | Unclassified |
| 43 | 2738543033 | Novosphingobium sp. GV064 | Isolate | Unclassified |
| 44 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 45 | 2791354903 | Mangrovibacter phragmitis MP23 | Isolate | Unclassified |
| 46 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 47 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 48 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 49 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 50 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 51 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 52 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 53 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 54 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 55 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 56 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 57 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 58 | 2847085930 | Erwinia persicina B64 | Isolate | Bulb |
| 59 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 60 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 61 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 62 | 2854601825 | Dickeya dianthicola SS70 | Isolate | Stem Tuber |
| 63 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 64 | 2858950400 | Achromobacter sp. K91 | Isolate | Unclassified |
| 65 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 66 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 67 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 68 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 69 | 2904504865 | Serratia marcescens 1822 | Isolate | Unclassified |
| 70 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 71 | 2908669403 | Pantoea coffeiphila 1480 | Isolate | Rhizosphere |
| 72 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 73 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 74 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 75 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 76 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 77 | 2928100450 | Novosphingobium sp. 1529 | Isolate | Rhizosphere |
| 78 | 2928959182 | Novosphingobium capsulatum 1057 | Isolate | Unclassified |
| 79 | 2928972540 | Brevundimonas sp. 1080 | Isolate | Rhizosphere |
| 80 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 81 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 82 | 2935625433 | Kosakonia sp. 1610 | Isolate | Rhizosphere |
| 83 | 2939607340 | Leclercia sp. 1548 | Isolate | Rhizosphere |
| 84 | 2939617950 | Kosakonia cowanii 2056 | Isolate | Rhizosphere |
| 85 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 86 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 87 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 88 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 89 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 90 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 91 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 92 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 93 | 2974435778 | Kosakonia cowanii SORGH_AS 304 | Isolate | Unclassified |
| 94 | 2977240413 | Brevundimonas vesicularis SORGH_AS 431 | Isolate | Unclassified |
| 95 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 96 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 97 | 2987605356 | Stenotrophomonas sp. ATCM1_4 | Isolate | Unclassified |
| 98 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 99 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 100 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 101 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 102 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 103 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 104 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 105 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 106 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 107 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 108 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 109 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 110 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 111 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 112 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 113 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 114 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 115 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 116 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 117 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 118 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 119 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 120 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 126 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 127 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 128 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 131 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 132 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 133 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 134 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 135 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 136 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 137 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 138 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 146 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 147 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 148 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 149 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 150 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 151 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 152 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 153 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 154 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 155 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 156 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 158 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 164 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 166 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 168 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 170 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 171 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 172 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 176 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 196 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 200 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 201 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 203 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 204 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 205 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 208 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 209 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 212 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 213 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 214 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 215 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 216 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 217 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 218 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 219 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 220 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 221 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 222 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 223 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 225 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 226 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 227 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 228 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 229 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 230 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 231 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 232 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 233 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 234 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 235 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 236 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 237 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 238 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 239 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 240 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 241 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 242 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 317 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 318 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 319 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 320 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 321 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 322 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 323 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 324 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 325 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 326 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 327 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 328 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 329 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 330 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 331 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 332 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 333 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 334 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 335 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 336 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 337 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 338 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 342 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 343 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 344 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 346 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 347 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 348 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 349 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 350 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 351 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 352 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 353 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 354 | 8019504834 | Atlantibacter hermannii 1903 | Isolate | Rhizosphere |
| 355 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 356 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 357 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 358 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 359 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 360 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 361 | 8055087960 | Silvania hatchlandensis H19S6 | Isolate | Rhizosphere |
| 362 | 8055092621 | Silvania confinis H4N4 | Isolate | Rhizosphere |
| 363 | 8055097453 | Leclercia tamurae H6W5 | Isolate | Rhizosphere |
| 364 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 365 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 366 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 367 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 368 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 83.82 |
| Metatranscriptomes | 0.13 |
| Isolates | 16.05 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.26 |
| Bulb | 0.13 |
| Endosphere | 6.84 |
| Nodule | 1.05 |
| Rhizoplane | 3.95 |
| Rhizosphere | 67.76 |
| Stem | 0.13 |
| Stem Tuber | 0.13 |
| Unclassified | 19.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25162J39368_1000001 | 3300002737 | Bacteria | 740113 |
| 2 | JGI25163J39215_1001830 | 3300002771 | Bacteria | 2850 |
| 3 | JGI25164J39214_1005280 | 3300002772 | Bacteria | 1411 |
| 4 | JGI25165J46597_1000001 | 3300003214 | Bacteria | 1111887 |
| 5 | Ga0055538_1000001 | 3300003751 | Bacteria | 1111887 |
| 6 | Ga0055539_1000001 | 3300003752 | Bacteria | 1111887 |
| 7 | Ga0055539_1000191 | 3300003752 | Bacteria | 50617 |
| 8 | Ga0055533_1000003 | 3300003756 | Bacteria | 1111887 |
| 9 | Ga0055533_1000191 | 3300003756 | Bacteria | 50617 |
| 10 | Ga0055532_1000194 | 3300003758 | Bacteria | 50617 |
| 11 | Ga0055525_1000003 | 3300003759 | Bacteria | 962094 |
| 12 | Ga0055525_1000258 | 3300003759 | Bacteria | 50617 |
| 13 | Ga0055535_1010693 | 3300003761 | Bacteria | 1493 |
| 14 | Ga0055530_10003277 | 3300003791 | Bacteria | 9410 |
| 15 | Ga0055540_1000008 | 3300003792 | Bacteria | 309635 |
| 16 | Ga0055531_10007799 | 3300003794 | Bacteria | 5765 |
| 17 | Ga0055541_1000001 | 3300003841 | Bacteria | 1111887 |
| 18 | Ga0055541_1000126 | 3300003841 | Bacteria | 50617 |
| 19 | Ga0058692_1012382 | 3300003856 | Bacteria | 2020 |
| 20 | Ga0065714_10152939 | 3300005288 | Bacteria | 1095 |
| 21 | Ga0065712_10067789 | 3300005290 | Bacteria | 35017 |
| 22 | Ga0065712_10067908 | 3300005290 | Bacteria | 21672 |
| 23 | Ga0065712_10071132 | 3300005290 | Bacteria | 5462 |
| 24 | Ga0070670_100000170 | 3300005331 | Bacteria | 58712 |
| 25 | Ga0070670_100002253 | 3300005331 | Bacteria | 15862 |
| 26 | Ga0070666_10035787 | 3300005335 | Bacteria | 3293 |
| 27 | Ga0070668_100002253 | 3300005347 | Bacteria | 14202 |
| 28 | Ga0070669_100000080 | 3300005353 | Bacteria | 92960 |
| 29 | Ga0070669_100001044 | 3300005353 | Bacteria | 20236 |
| 30 | Ga0070671_100008240 | 3300005355 | Bacteria | 8340 |
| 31 | Ga0070667_100000444 | 3300005367 | Bacteria | 43036 |
| 32 | Ga0070662_100002488 | 3300005457 | Bacteria | 11356 |
| 33 | Ga0068853_100030774 | 3300005539 | Bacteria | 4535 |
| 34 | Ga0070665_100242686 | 3300005548 | Bacteria | 1802 |
| 35 | Ga0070665_100438837 | 3300005548 | Bacteria | 1315 |
| 36 | Ga0070665_100613998 | 3300005548 | Bacteria | 1100 |
| 37 | Ga0070664_100000996 | 3300005564 | Bacteria | 22200 |
| 38 | Ga0070664_100094527 | 3300005564 | Bacteria | 2592 |
| 39 | Ga0070664_100806361 | 3300005564 | Bacteria | 878 |
| 40 | Ga0068854_100023606 | 3300005578 | Bacteria | 4203 |
| 41 | Ga0068851_10000188 | 3300005834 | Bacteria | 30806 |
| 42 | Ga0068862_100037700 | 3300005844 | Bacteria | 4097 |
| 43 | Ga0075364_10020814 | 3300006051 | Bacteria | 4129 |
| 44 | Ga0070712_100032616 | 3300006175 | Bacteria | 3518 |
| 45 | Ga0079104_1003500 | 3300006946 | Bacteria | 7255 |
| 46 | Ga0105251_10000032 | 3300009011 | Bacteria | 120825 |
| 47 | Ga0105251_10001241 | 3300009011 | Bacteria | 22093 |
| 48 | Ga0105251_10009128 | 3300009011 | Bacteria | 5897 |
| 49 | Ga0105251_10009385 | 3300009011 | Bacteria | 5780 |
| 50 | Ga0105251_10015206 | 3300009011 | Bacteria | 4217 |
| 51 | Ga0105251_10081919 | 3300009011 | Bacteria | 1491 |
| 52 | Ga0105244_10000602 | 3300009036 | Bacteria | 32010 |
| 53 | Ga0105244_10000976 | 3300009036 | Bacteria | 24019 |
| 54 | Ga0105244_10002117 | 3300009036 | Bacteria | 15258 |
| 55 | Ga0105244_10002606 | 3300009036 | Bacteria | 13512 |
| 56 | Ga0105244_10006696 | 3300009036 | Bacteria | 7417 |
| 57 | Ga0105244_10012286 | 3300009036 | Bacteria | 5066 |
| 58 | Ga0105250_10000001 | 3300009092 | Bacteria | 617357 |
| 59 | Ga0105250_10000436 | 3300009092 | Bacteria | 30500 |
| 60 | Ga0105250_10003333 | 3300009092 | Bacteria | 7642 |
| 61 | Ga0105250_10009894 | 3300009092 | Bacteria | 4001 |
| 62 | Ga0105250_10023997 | 3300009092 | Bacteria | 2458 |
| 63 | Ga0105250_10040304 | 3300009092 | Bacteria | 1873 |
| 64 | Ga0105250_10075737 | 3300009092 | Bacteria | 1361 |
| 65 | Ga0105243_10000098 | 3300009148 | Bacteria | 99914 |
| 66 | Ga0105243_10072120 | 3300009148 | Bacteria | 2794 |
| 67 | Ga0105242_10008357 | 3300009176 | Bacteria | 7954 |
| 68 | Ga0105248_10116580 | 3300009177 | Bacteria | 3012 |
| 69 | Ga0105248_10253803 | 3300009177 | Bacteria | 1979 |
| 70 | Ga0105237_10002317 | 3300009545 | Bacteria | 23663 |
| 71 | Ga0105249_10029770 | 3300009553 | Bacteria | 4933 |
| 72 | Ga0105246_10006218 | 3300011119 | Bacteria | 7289 |
| 73 | Ga0105246_10025397 | 3300011119 | Bacteria | 3861 |
| 74 | Ga0157345_1000004 | 3300012498 | Bacteria | 80365 |
| 75 | Ga0157373_10000039 | 3300013100 | Bacteria | 117160 |
| 76 | Ga0157373_10000472 | 3300013100 | Bacteria | 31894 |
| 77 | Ga0157373_10003468 | 3300013100 | Bacteria | 11925 |
| 78 | Ga0157373_10006500 | 3300013100 | Bacteria | 8721 |
| 79 | Ga0157373_10013426 | 3300013100 | Bacteria | 6008 |
| 80 | Ga0157373_10031912 | 3300013100 | Bacteria | 3793 |
| 81 | Ga0157373_10043785 | 3300013100 | Bacteria | 3197 |
| 82 | Ga0157371_10000064 | 3300013102 | Bacteria | 169056 |
| 83 | Ga0157371_10056553 | 3300013102 | Bacteria | 2783 |
| 84 | Ga0157371_10196289 | 3300013102 | Bacteria | 1446 |
| 85 | Ga0157371_10199583 | 3300013102 | Bacteria | 1434 |
| 86 | Ga0157370_10024106 | 3300013104 | Bacteria | 6031 |
| 87 | Ga0157370_10029111 | 3300013104 | Bacteria | 5426 |
| 88 | Ga0157370_10032098 | 3300013104 | Bacteria | 5131 |
| 89 | Ga0157370_10058293 | 3300013104 | Bacteria | 3670 |
| 90 | Ga0157369_10002223 | 3300013105 | Bacteria | 23363 |
| 91 | Ga0157369_10003854 | 3300013105 | Bacteria | 17824 |
| 92 | Ga0157369_10004302 | 3300013105 | Bacteria | 16817 |
| 93 | Ga0157369_10007619 | 3300013105 | Bacteria | 12454 |
| 94 | Ga0157369_10017064 | 3300013105 | Bacteria | 8157 |
| 95 | Ga0157369_10018100 | 3300013105 | Bacteria | 7903 |
| 96 | Ga0157369_10145343 | 3300013105 | Bacteria | 2507 |
| 97 | Ga0157369_10201156 | 3300013105 | Bacteria | 2091 |
| 98 | Ga0163162_10000067 | 3300013306 | Bacteria | 99435 |
| 99 | Ga0163162_10010004 | 3300013306 | Bacteria | 9222 |
| 100 | Ga0163162_10180491 | 3300013306 | Bacteria | 2237 |
| 101 | Ga0157372_10008278 | 3300013307 | Bacteria | 11056 |
| 102 | Ga0157372_10460778 | 3300013307 | Bacteria | 1482 |
| 103 | Ga0157375_10000101 | 3300013308 | Bacteria | 87397 |
| 104 | Ga0157375_10067982 | 3300013308 | Bacteria | 3562 |
| 105 | Ga0157375_10094774 | 3300013308 | Bacteria | 3055 |
| 106 | Ga0157375_10207364 | 3300013308 | Bacteria | 2117 |
| 107 | Ga0182008_10000243 | 3300014497 | Bacteria | 42328 |
| 108 | Ga0182008_10000445 | 3300014497 | Bacteria | 31422 |
| 109 | Ga0182008_10038572 | 3300014497 | Bacteria | 2389 |
| 110 | Ga0182008_10041082 | 3300014497 | Bacteria | 2307 |
| 111 | Ga0182006_1005224 | 3300015261 | Bacteria | 6221 |
| 112 | Ga0182006_1012598 | 3300015261 | Bacteria | 3698 |
| 113 | Ga0182006_1045592 | 3300015261 | Bacteria | 1705 |
| 114 | Ga0182007_10000418 | 3300015262 | Bacteria | 25999 |
| 115 | Ga0182007_10012714 | 3300015262 | Bacteria | 3231 |
| 116 | Ga0182007_10034839 | 3300015262 | Bacteria | 1698 |
| 117 | Ga0163161_10000577 | 3300017792 | Bacteria | 29489 |
| 118 | Ga0163161_10067644 | 3300017792 | Bacteria | 2609 |
| 119 | Ga0163161_10078484 | 3300017792 | Bacteria | 2427 |
| 120 | Ga0163161_10147089 | 3300017792 | Bacteria | 1788 |
| 121 | Ga0163161_10159777 | 3300017792 | Bacteria | 1718 |
| 122 | Ga0209435_105207 | 3300025206 | Bacteria | 1458 |
| 123 | Ga0209760_100917 | 3300025207 | Bacteria | 3670 |
| 124 | Ga0209784_100004 | 3300025224 | Bacteria | 1378156 |
| 125 | Ga0209784_100161 | 3300025224 | Bacteria | 58895 |
| 126 | Ga0209566_100004 | 3300025225 | Bacteria | 1531866 |
| 127 | Ga0209566_100213 | 3300025225 | Bacteria | 58895 |
| 128 | Ga0209674_100006 | 3300025226 | Bacteria | 1531866 |
| 129 | Ga0209674_100208 | 3300025226 | Bacteria | 58895 |
| 130 | Ga0209147_100021 | 3300025229 | Bacteria | 464719 |
| 131 | Ga0209147_100249 | 3300025229 | Bacteria | 51703 |
| 132 | Ga0209563_100009 | 3300025230 | Bacteria | 1378156 |
| 133 | Ga0209563_100159 | 3300025230 | Bacteria | 58895 |
| 134 | Ga0209563_101175 | 3300025230 | Bacteria | 7357 |
| 135 | Ga0207427_100347 | 3300025231 | Bacteria | 29881 |
| 136 | Ga0209437_100004 | 3300025233 | Bacteria | 1378156 |
| 137 | Ga0209258_100438 | 3300025242 | Bacteria | 47519 |
| 138 | Ga0209646_1000676 | 3300025246 | Bacteria | 12429 |
| 139 | Ga0209677_100005 | 3300025253 | Bacteria | 1378156 |
| 140 | Ga0209677_100163 | 3300025253 | Bacteria | 58895 |
| 141 | Ga0209129_1000015 | 3300025258 | Bacteria | 487967 |
| 142 | Ga0209233_1000005 | 3300025261 | Bacteria | 1531866 |
| 143 | Ga0209675_1011653 | 3300025291 | Bacteria | 2899 |
| 144 | Ga0209676_1000002 | 3300025292 | Bacteria | 1732948 |
| 145 | Ga0209676_1000120 | 3300025292 | Bacteria | 200565 |
| 146 | Ga0209050_1000006 | 3300025298 | Bacteria | 1359702 |
| 147 | Ga0209051_1000001 | 3300025303 | Bacteria | 1732974 |
| 148 | Ga0209257_1000029 | 3300025304 | Bacteria | 695617 |
| 149 | Ga0207696_1000028 | 3300025711 | Bacteria | 400424 |
| 150 | Ga0207696_1000297 | 3300025711 | Bacteria | 57833 |
| 151 | Ga0207696_1003396 | 3300025711 | Bacteria | 7279 |
| 152 | Ga0207696_1004507 | 3300025711 | Bacteria | 5991 |
| 153 | Ga0207696_1005537 | 3300025711 | Bacteria | 5222 |
| 154 | Ga0207696_1086665 | 3300025711 | Bacteria | 861 |
| 155 | Ga0207655_1000022 | 3300025728 | Bacteria | 483933 |
| 156 | Ga0207655_1000080 | 3300025728 | Bacteria | 214570 |
| 157 | Ga0207655_1000335 | 3300025728 | Bacteria | 68481 |
| 158 | Ga0207655_1000713 | 3300025728 | Bacteria | 38012 |
| 159 | Ga0207655_1002903 | 3300025728 | Bacteria | 13211 |
| 160 | Ga0207655_1012121 | 3300025728 | Bacteria | 5068 |
| 161 | Ga0207655_1014224 | 3300025728 | Bacteria | 4512 |
| 162 | Ga0207713_1000020 | 3300025735 | Bacteria | 359258 |
| 163 | Ga0207713_1001431 | 3300025735 | Bacteria | 19090 |
| 164 | Ga0207713_1002128 | 3300025735 | Bacteria | 14758 |
| 165 | Ga0207713_1003149 | 3300025735 | Bacteria | 11436 |
| 166 | Ga0207713_1003256 | 3300025735 | Bacteria | 11190 |
| 167 | Ga0207713_1005501 | 3300025735 | Bacteria | 7903 |
| 168 | Ga0207713_1032999 | 3300025735 | Bacteria | 2266 |
| 169 | Ga0207671_10001843 | 3300025914 | Bacteria | 23655 |
| 170 | Ga0207693_10032275 | 3300025915 | Bacteria | 4133 |
| 171 | Ga0207657_10289587 | 3300025919 | Bacteria | 1299 |
| 172 | Ga0207649_10000088 | 3300025920 | Bacteria | 77105 |
| 173 | Ga0207681_10000049 | 3300025923 | Bacteria | 120296 |
| 174 | Ga0207650_10000077 | 3300025925 | Bacteria | 132010 |
| 175 | Ga0207650_10000357 | 3300025925 | Bacteria | 44045 |
| 176 | Ga0207644_10006600 | 3300025931 | Bacteria | 7561 |
| 177 | Ga0207706_10005849 | 3300025933 | Bacteria | 11438 |
| 178 | Ga0207686_10005334 | 3300025934 | Bacteria | 6892 |
| 179 | Ga0207709_10000011 | 3300025935 | Bacteria | 552881 |
| 180 | Ga0207711_10121834 | 3300025941 | Bacteria | 2329 |
| 181 | Ga0207711_10386083 | 3300025941 | Bacteria | 1300 |
| 182 | Ga0207679_10000034 | 3300025945 | Bacteria | 147162 |
| 183 | Ga0207668_10001920 | 3300025972 | Bacteria | 12170 |
| 184 | Ga0207640_10072973 | 3300025981 | Bacteria | 2317 |
| 185 | Ga0207658_10000656 | 3300025986 | Bacteria | 30188 |
| 186 | Ga0207639_10014840 | 3300026041 | Bacteria | 5486 |
| 187 | Ga0209281_1001747 | 3300027111 | Bacteria | 11135 |
| 188 | Ga0209281_1003329 | 3300027111 | Bacteria | 5397 |
| 189 | Ga0209371_1000056 | 3300027312 | Bacteria | 242255 |
| 190 | Ga0209371_1001494 | 3300027312 | Bacteria | 15582 |
| 191 | Ga0268266_10358201 | 3300028379 | Bacteria | 1372 |
| 192 | Ga0268265_10404609 | 3300028380 | Bacteria | 1263 |
| 193 | Ga0307517_10060915 | 3300028786 | Bacteria | 3581 |
| 194 | Ga0307517_10131655 | 3300028786 | Bacteria | 1798 |
| 195 | Ga0307515_10083315 | 3300028794 | Bacteria | 4124 |
| 196 | Ga0268256_1000003 | 3300030500 | Bacteria | 1289401 |
| 197 | Ga0268256_1002134 | 3300030500 | Bacteria | 10541 |
| 198 | Ga0316178_1017657 | 3300030735 | Bacteria | 15507 |
| 199 | Ga0316182_1222951 | 3300030745 | Bacteria | 1708 |
| 200 | Ga0265327_10136074 | 3300031251 | Bacteria | 1152 |
| 201 | Ga0307513_10117282 | 3300031456 | Bacteria | 2640 |
| 202 | Ga0307408_100000018 | 3300031548 | Bacteria | 346872 |
| 203 | Ga0307408_100017613 | 3300031548 | Bacteria | 4783 |
| 204 | Ga0307408_100036436 | 3300031548 | Bacteria | 3458 |
| 205 | Ga0307516_10201429 | 3300031730 | Bacteria | 1710 |
| 206 | Ga0307405_10000340 | 3300031731 | Bacteria | 17412 |
| 207 | Ga0307405_10550548 | 3300031731 | Bacteria | 933 |
| 208 | Ga0307412_10405197 | 3300031911 | Bacteria | 1111 |
| 209 | Ga0307409_100191945 | 3300031995 | Bacteria | 1819 |
| 210 | Ga0307414_10371417 | 3300032004 | Bacteria | 1234 |
| 211 | Ga0307414_10594727 | 3300032004 | Bacteria | 991 |
| 212 | Ga0307411_10030929 | 3300032005 | Bacteria | 3287 |
| 213 | Ga0307510_10000324 | 3300033180 | Bacteria | 44451 |
| 214 | Ga0373950_0013087 | 3300034818 | Bacteria | 1379 |
| 215 | Ga0373959_0001896 | 3300034820 | Bacteria | 3338 |
| 216 | Ga0373928_0001402 | 3300035084 | Bacteria | 4703 |
| 217 | Ga0373940_0028158 | 3300035088 | Bacteria | 1481 |
| 218 | Ga0373951_0016233 | 3300035091 | Bacteria | 1679 |
| 219 | Ga0373932_0001806 | 3300035112 | Bacteria | 5759 |
| 220 | Ga0373939_0000105 | 3300035114 | Bacteria | 25682 |
| 221 | Ga0373960_0000729 | 3300035121 | Bacteria | 6860 |
| 222 | Ga0316574_0176362 | 3300035398 | Bacteria | 1376 |
| 223 | Ga0373931_0047621 | 3300035691 | Bacteria | 2270 |
| 224 | Ga0237819_03077 | 3300038705 | Bacteria | 3072 |
| 225 | Ga0439438_000441 | 3300041405 | Bacteria | 18789 |
| 226 | Ga0439438_000790 | 3300041405 | Bacteria | 14091 |
| 227 | Ga0439438_003039 | 3300041405 | Bacteria | 6907 |
| 228 | Ga0439447_009204 | 3300041407 | Bacteria | 3009 |
| 229 | Ga0439447_052524 | 3300041407 | Bacteria | 970 |
| 230 | Ga0439466_0018988 | 3300041411 | Bacteria | 2462 |
| 231 | Ga0439445_0056506 | 3300042004 | Bacteria | 1067 |
| 232 | Ga0439432_000028 | 3300042006 | Bacteria | 48652 |
| 233 | Ga0439432_000324 | 3300042006 | Bacteria | 17319 |
| 234 | Ga0439432_033735 | 3300042006 | Bacteria | 1646 |
| 235 | Ga0439449_0030067 | 3300042007 | Bacteria | 2024 |
| 236 | Ga0439452_000024 | 3300042010 | Bacteria | 230396 |
| 237 | Ga0439452_000029 | 3300042010 | Bacteria | 197977 |
| 238 | Ga0439452_025785 | 3300042010 | Bacteria | 1488 |
| 239 | Ga0439456_002852 | 3300042013 | Bacteria | 3486 |
| 240 | Ga0439463_006748 | 3300042016 | Bacteria | 2839 |
| 241 | Ga0450911_000030 | 3300042115 | Bacteria | 75536 |
| 242 | Ga0450894_002755 | 3300042131 | Bacteria | 2330 |
| 243 | Ga0450898_002908 | 3300042134 | Bacteria | 2413 |
| 244 | Ga0450904_001668 | 3300042139 | Bacteria | 2979 |
| 245 | Ga0450906_000016 | 3300042145 | Bacteria | 32476 |
| 246 | Ga0439464_0002834 | 3300042439 | Bacteria | 4309 |
| 247 | Ga0451577_0233955 | 3300042876 | Bacteria | 1662 |
| 248 | Ga0466967_0004162 | 3300045976 | Bacteria | 9681 |
| 249 | Ga0495617_000026 | 3300046452 | Bacteria | 157675 |
| 250 | Ga0495617_003345 | 3300046452 | Bacteria | 6058 |
| 251 | Ga0495617_003358 | 3300046452 | Bacteria | 6042 |
| 252 | Ga0495617_005955 | 3300046452 | Bacteria | 4302 |
| 253 | Ga0495617_012833 | 3300046452 | Bacteria | 2856 |
| 254 | Ga0495617_029468 | 3300046452 | Bacteria | 1845 |
| 255 | Ga0495617_086270 | 3300046452 | Bacteria | 1026 |
| 256 | Ga0495627_000083 | 3300046453 | Bacteria | 113227 |
| 257 | Ga0495627_000101 | 3300046453 | Bacteria | 105414 |
| 258 | Ga0495627_000133 | 3300046453 | Bacteria | 89977 |
| 259 | Ga0495627_000371 | 3300046453 | Bacteria | 41727 |
| 260 | Ga0495627_001842 | 3300046453 | Bacteria | 11261 |
| 261 | Ga0495627_002851 | 3300046453 | Bacteria | 7984 |
| 262 | Ga0495592_0138586 | 3300046454 | Bacteria | 1694 |
| 263 | Ga0495590_0009296 | 3300046457 | Bacteria | 3727 |
| 264 | Ga0495590_0029738 | 3300046457 | Bacteria | 1914 |
| 265 | Ga0495590_0052974 | 3300046457 | Bacteria | 1417 |
| 266 | Ga0495591_000037 | 3300046458 | Bacteria | 158323 |
| 267 | Ga0495591_000082 | 3300046458 | Bacteria | 107579 |
| 268 | Ga0495591_000120 | 3300046458 | Bacteria | 86214 |
| 269 | Ga0495591_000358 | 3300046458 | Bacteria | 39879 |
| 270 | Ga0495591_001584 | 3300046458 | Bacteria | 13797 |
| 271 | Ga0495591_001966 | 3300046458 | Bacteria | 12009 |
| 272 | Ga0495591_008363 | 3300046458 | Bacteria | 4247 |
| 273 | Ga0495591_023667 | 3300046458 | Bacteria | 1962 |
| 274 | Ga0495591_045496 | 3300046458 | Bacteria | 1223 |
| 275 | Ga0495629_0000928 | 3300046459 | Bacteria | 23569 |
| 276 | Ga0495638_0001204 | 3300046460 | Bacteria | 24721 |
| 277 | Ga0495638_0298373 | 3300046460 | Bacteria | 869 |
| 278 | Ga0495651_0004310 | 3300046462 | Bacteria | 10903 |
| 279 | Ga0495653_0000875 | 3300046463 | Bacteria | 23233 |
| 280 | Ga0495653_0019451 | 3300046463 | Bacteria | 5507 |
| 281 | Ga0495653_0129853 | 3300046463 | Bacteria | 1785 |
| 282 | Ga0495650_0005155 | 3300046471 | Bacteria | 8614 |
| 283 | Ga0495650_0007800 | 3300046471 | Bacteria | 6365 |
| 284 | Ga0495650_0009649 | 3300046471 | Bacteria | 5470 |
| 285 | Ga0495580_0095101 | 3300046472 | Bacteria | 2072 |
| 286 | Ga0495582_0166441 | 3300046473 | Bacteria | 1255 |
| 287 | Ga0495605_0000147 | 3300046474 | Bacteria | 90988 |
| 288 | Ga0495605_0003156 | 3300046474 | Bacteria | 9916 |
| 289 | Ga0495605_0003158 | 3300046474 | Bacteria | 9910 |
| 290 | Ga0495605_0005186 | 3300046474 | Bacteria | 7592 |
| 291 | Ga0495605_0027271 | 3300046474 | Bacteria | 2960 |
| 292 | Ga0495605_0051103 | 3300046474 | Bacteria | 2014 |
| 293 | Ga0495584_0001704 | 3300046491 | Bacteria | 12887 |
| 294 | Ga0495584_0041941 | 3300046491 | Bacteria | 2309 |
| 295 | Ga0495584_0072755 | 3300046491 | Bacteria | 1727 |
| 296 | Ga0495585_0000234 | 3300046492 | Bacteria | 57324 |
| 297 | Ga0495585_0000272 | 3300046492 | Bacteria | 51707 |
| 298 | Ga0495585_0000897 | 3300046492 | Bacteria | 25232 |
| 299 | Ga0495585_0003956 | 3300046492 | Bacteria | 9783 |
| 300 | Ga0495585_0008632 | 3300046492 | Bacteria | 6166 |
| 301 | Ga0495585_0011868 | 3300046492 | Bacteria | 5146 |
| 302 | Ga0495594_0144283 | 3300046499 | Bacteria | 1351 |
| 303 | Ga0495596_0004877 | 3300046500 | Bacteria | 6437 |
| 304 | Ga0495596_0009074 | 3300046500 | Bacteria | 4397 |
| 305 | Ga0495596_0014050 | 3300046500 | Bacteria | 3377 |
| 306 | Ga0495596_0023356 | 3300046500 | Bacteria | 2510 |
| 307 | Ga0495607_0000209 | 3300046501 | Bacteria | 62350 |
| 308 | Ga0495607_0000596 | 3300046501 | Bacteria | 35234 |
| 309 | Ga0495607_0004369 | 3300046501 | Bacteria | 10415 |
| 310 | Ga0495607_0019160 | 3300046501 | Bacteria | 4351 |
| 311 | Ga0495607_0020451 | 3300046501 | Bacteria | 4184 |
| 312 | Ga0495607_0023373 | 3300046501 | Bacteria | 3870 |
| 313 | Ga0495607_0080689 | 3300046501 | Bacteria | 1788 |
| 314 | Ga0495607_0147517 | 3300046501 | Bacteria | 1207 |
| 315 | Ga0495607_0183965 | 3300046501 | Bacteria | 1046 |
| 316 | Ga0495583_0000477 | 3300046506 | Bacteria | 58703 |
| 317 | Ga0495583_0000818 | 3300046506 | Bacteria | 38087 |
| 318 | Ga0495583_0006074 | 3300046506 | Bacteria | 7987 |
| 319 | Ga0495583_0151118 | 3300046506 | Bacteria | 962 |
| 320 | Ga0495606_0000339 | 3300046507 | Bacteria | 80460 |
| 321 | Ga0495606_0001660 | 3300046507 | Bacteria | 28914 |
| 322 | Ga0495606_0003705 | 3300046507 | Bacteria | 15962 |
| 323 | Ga0495606_0008227 | 3300046507 | Bacteria | 9112 |
| 324 | Ga0495606_0009414 | 3300046507 | Bacteria | 8270 |
| 325 | Ga0495606_0024052 | 3300046507 | Bacteria | 4401 |
| 326 | Ga0495606_0078394 | 3300046507 | Bacteria | 2060 |
| 327 | Ga0495608_0009003 | 3300046511 | Bacteria | 6981 |
| 328 | Ga0495608_0013634 | 3300046511 | Bacteria | 5638 |
| 329 | Ga0495610_0000133 | 3300046512 | Bacteria | 82356 |
| 330 | Ga0495610_0000173 | 3300046512 | Bacteria | 72402 |
| 331 | Ga0495610_0002135 | 3300046512 | Bacteria | 16832 |
| 332 | Ga0495610_0022878 | 3300046512 | Bacteria | 3407 |
| 333 | Ga0495616_0000041 | 3300046513 | Bacteria | 122413 |
| 334 | Ga0495616_0000166 | 3300046513 | Bacteria | 57340 |
| 335 | Ga0495616_0000352 | 3300046513 | Bacteria | 36004 |
| 336 | Ga0495616_0002057 | 3300046513 | Bacteria | 13519 |
| 337 | Ga0495616_0004061 | 3300046513 | Bacteria | 9297 |
| 338 | Ga0495618_0015325 | 3300046514 | Bacteria | 4678 |
| 339 | Ga0495620_0000257 | 3300046515 | Bacteria | 39311 |
| 340 | Ga0495620_0000785 | 3300046515 | Bacteria | 19455 |
| 341 | Ga0495620_0004067 | 3300046515 | Bacteria | 8297 |
| 342 | Ga0495620_0004298 | 3300046515 | Bacteria | 8055 |
| 343 | Ga0495620_0038289 | 3300046515 | Bacteria | 2129 |
| 344 | Ga0495620_0127822 | 3300046515 | Bacteria | 998 |
| 345 | Ga0495628_0004445 | 3300046516 | Bacteria | 12438 |
| 346 | Ga0495628_0005405 | 3300046516 | Bacteria | 11194 |
| 347 | Ga0495628_0025539 | 3300046516 | Bacteria | 4825 |
| 348 | Ga0495631_0000013 | 3300046518 | Bacteria | 109794 |
| 349 | Ga0495631_0015016 | 3300046518 | Bacteria | 3722 |
| 350 | Ga0495631_0022628 | 3300046518 | Bacteria | 2921 |
| 351 | Ga0495631_0183372 | 3300046518 | Bacteria | 897 |
| 352 | Ga0495632_0000051 | 3300046519 | Bacteria | 133522 |
| 353 | Ga0495632_0000097 | 3300046519 | Bacteria | 88746 |
| 354 | Ga0495632_0000794 | 3300046519 | Bacteria | 28049 |
| 355 | Ga0495632_0003006 | 3300046519 | Bacteria | 12308 |
| 356 | Ga0495632_0021519 | 3300046519 | Bacteria | 3474 |
| 357 | Ga0495632_0039706 | 3300046519 | Bacteria | 2373 |
| 358 | Ga0495632_0050398 | 3300046519 | Bacteria | 2053 |
| 359 | Ga0495632_0167679 | 3300046519 | Bacteria | 1010 |
| 360 | Ga0495637_0000831 | 3300046520 | Bacteria | 20399 |
| 361 | Ga0495637_0001392 | 3300046520 | Bacteria | 14426 |
| 362 | Ga0495637_0002731 | 3300046520 | Bacteria | 9607 |
| 363 | Ga0495637_0005671 | 3300046520 | Bacteria | 6332 |
| 364 | Ga0495637_0017389 | 3300046520 | Bacteria | 3351 |
| 365 | Ga0495637_0043843 | 3300046520 | Bacteria | 1907 |
| 366 | Ga0495643_0000625 | 3300046522 | Bacteria | 42011 |
| 367 | Ga0495643_0002569 | 3300046522 | Bacteria | 14183 |
| 368 | Ga0495643_0008701 | 3300046522 | Bacteria | 6403 |
| 369 | Ga0495643_0081026 | 3300046522 | Bacteria | 1688 |
| 370 | Ga0495644_0023559 | 3300046523 | Bacteria | 2343 |
| 371 | Ga0495644_0157913 | 3300046523 | Bacteria | 869 |
| 372 | Ga0495648_0000062 | 3300046524 | Bacteria | 150125 |
| 373 | Ga0495648_0000172 | 3300046524 | Bacteria | 74485 |
| 374 | Ga0495648_0000259 | 3300046524 | Bacteria | 59999 |
| 375 | Ga0495648_0000408 | 3300046524 | Bacteria | 47397 |
| 376 | Ga0495648_0002220 | 3300046524 | Bacteria | 18185 |
| 377 | Ga0495648_0005676 | 3300046524 | Bacteria | 10325 |
| 378 | Ga0495648_0146175 | 3300046524 | Bacteria | 1238 |
| 379 | Ga0495663_0010799 | 3300046525 | Bacteria | 2541 |
| 380 | Ga0495666_0073382 | 3300046526 | Bacteria | 1624 |
| 381 | Ga0495642_0001946 | 3300046528 | Bacteria | 8707 |
| 382 | Ga0495652_0162565 | 3300046529 | Bacteria | 1731 |
| 383 | Ga0495654_0000050 | 3300046530 | Bacteria | 146814 |
| 384 | Ga0495654_0000106 | 3300046530 | Bacteria | 94076 |
| 385 | Ga0495654_0000864 | 3300046530 | Bacteria | 22846 |
| 386 | Ga0495654_0003905 | 3300046530 | Bacteria | 9002 |
| 387 | Ga0495654_0019273 | 3300046530 | Bacteria | 3570 |
| 388 | Ga0495654_0072858 | 3300046530 | Bacteria | 1625 |
| 389 | Ga0495654_0077249 | 3300046530 | Bacteria | 1567 |
| 390 | Ga0495654_0093052 | 3300046530 | Bacteria | 1396 |
| 391 | Ga0495654_0145194 | 3300046530 | Bacteria | 1054 |
| 392 | Ga0495654_0169530 | 3300046530 | Bacteria | 952 |
| 393 | Ga0495654_0216729 | 3300046530 | Bacteria | 811 |
| 394 | Ga0495665_0008463 | 3300046531 | Bacteria | 5582 |
| 395 | Ga0495609_0000286 | 3300046538 | Bacteria | 46726 |
| 396 | Ga0495609_0001870 | 3300046538 | Bacteria | 13457 |
| 397 | Ga0495609_0043450 | 3300046538 | Bacteria | 2018 |
| 398 | Ga0495609_0057663 | 3300046538 | Bacteria | 1718 |
| 399 | Ga0495597_0000101 | 3300046542 | Bacteria | 77799 |
| 400 | Ga0495597_0000117 | 3300046542 | Bacteria | 71911 |
| 401 | Ga0495597_0001419 | 3300046542 | Bacteria | 17283 |
| 402 | Ga0495597_0002964 | 3300046542 | Bacteria | 10285 |
| 403 | Ga0495645_0274103 | 3300046543 | Bacteria | 1112 |
| 404 | Ga0495622_0000047 | 3300046557 | Bacteria | 109638 |
| 405 | Ga0495622_0038878 | 3300046557 | Bacteria | 2215 |
| 406 | Ga0495633_0000564 | 3300046558 | Bacteria | 36203 |
| 407 | Ga0495633_0083429 | 3300046558 | Bacteria | 1487 |
| 408 | Ga0495656_0169602 | 3300046615 | Bacteria | 1066 |
| 409 | Ga0495668_0000461 | 3300046616 | Bacteria | 51894 |
| 410 | Ga0495668_0004483 | 3300046616 | Bacteria | 9891 |
| 411 | Ga0495668_0014143 | 3300046616 | Bacteria | 4689 |
| 412 | Ga0495668_0046629 | 3300046616 | Bacteria | 2407 |
| 413 | Ga0495668_0127975 | 3300046616 | Bacteria | 1390 |
| 414 | Ga0495611_0000024 | 3300046648 | Bacteria | 118898 |
| 415 | Ga0495611_0002828 | 3300046648 | Bacteria | 7761 |
| 416 | Ga0495611_0013715 | 3300046648 | Bacteria | 3454 |
| 417 | Ga0495611_0014015 | 3300046648 | Bacteria | 3420 |
| 418 | Ga0495611_0052701 | 3300046648 | Bacteria | 1836 |
| 419 | Ga0495611_0061678 | 3300046648 | Bacteria | 1704 |
| 420 | Ga0495625_0000103 | 3300046660 | Bacteria | 136109 |
| 421 | Ga0495625_0000861 | 3300046660 | Bacteria | 41279 |
| 422 | Ga0495625_0071000 | 3300046660 | Bacteria | 2444 |
| 423 | Ga0495625_0119653 | 3300046660 | Bacteria | 1793 |
| 424 | Ga0495635_0206774 | 3300046663 | Bacteria | 1330 |
| 425 | Ga0495661_0000376 | 3300046665 | Bacteria | 48234 |
| 426 | Ga0495661_0000475 | 3300046665 | Bacteria | 42461 |
| 427 | Ga0495661_0000586 | 3300046665 | Bacteria | 37643 |
| 428 | Ga0495661_0006158 | 3300046665 | Bacteria | 8442 |
| 429 | Ga0495661_0010237 | 3300046665 | Bacteria | 6408 |
| 430 | Ga0495661_0011594 | 3300046665 | Bacteria | 5976 |
| 431 | Ga0495661_0140677 | 3300046665 | Bacteria | 1313 |
| 432 | Ga0495588_0102852 | 3300046674 | Bacteria | 1502 |
| 433 | Ga0495657_0227822 | 3300046675 | Bacteria | 1128 |
| 434 | Ga0495599_0040607 | 3300046678 | Bacteria | 2921 |
| 435 | Ga0495623_0006021 | 3300046679 | Bacteria | 7888 |
| 436 | Ga0495646_0000811 | 3300046680 | Bacteria | 17505 |
| 437 | Ga0495646_0035106 | 3300046680 | Bacteria | 3111 |
| 438 | Ga0495613_0003376 | 3300046689 | Bacteria | 11931 |
| 439 | Ga0495613_0043596 | 3300046689 | Bacteria | 3319 |
| 440 | Ga0495624_0000913 | 3300046690 | Bacteria | 23368 |
| 441 | Ga0495624_0028970 | 3300046690 | Bacteria | 3614 |
| 442 | Ga0495624_0059728 | 3300046690 | Bacteria | 2392 |
| 443 | Ga0495670_0000020 | 3300046691 | Bacteria | 110171 |
| 444 | Ga0495670_0055731 | 3300046691 | Bacteria | 1982 |
| 445 | Ga0495671_0000950 | 3300046692 | Bacteria | 20380 |
| 446 | Ga0495671_0002769 | 3300046692 | Bacteria | 10976 |
| 447 | Ga0495671_0003268 | 3300046692 | Bacteria | 10053 |
| 448 | Ga0495671_0003818 | 3300046692 | Bacteria | 9159 |
| 449 | Ga0495671_0022905 | 3300046692 | Bacteria | 3266 |
| 450 | Ga0495671_0154388 | 3300046692 | Bacteria | 1117 |
| 451 | Ga0495671_0258273 | 3300046692 | Bacteria | 840 |
| 452 | Ga0495649_0000108 | 3300046694 | Bacteria | 73708 |
| 453 | Ga0495649_0000894 | 3300046694 | Bacteria | 23680 |
| 454 | Ga0495649_0011685 | 3300046694 | Bacteria | 5139 |
| 455 | Ga0495649_0011847 | 3300046694 | Bacteria | 5098 |
| 456 | Ga0495649_0072362 | 3300046694 | Bacteria | 1848 |
| 457 | Ga0495589_0000167 | 3300046794 | Bacteria | 59964 |
| 458 | Ga0495589_0000500 | 3300046794 | Bacteria | 27714 |
| 459 | Ga0495589_0010260 | 3300046794 | Bacteria | 4868 |
| 460 | Ga0495589_0069412 | 3300046794 | Bacteria | 1723 |
| 461 | Ga0495589_0102961 | 3300046794 | Bacteria | 1380 |
| 462 | Ga0495600_0356482 | 3300046809 | Bacteria | 915 |
| 463 | Ga0495660_0000136 | 3300046810 | Bacteria | 79750 |
| 464 | Ga0495660_0000703 | 3300046810 | Bacteria | 25661 |
| 465 | Ga0495660_0000798 | 3300046810 | Bacteria | 23611 |
| 466 | Ga0495660_0001687 | 3300046810 | Bacteria | 14790 |
| 467 | Ga0495660_0003014 | 3300046810 | Bacteria | 10508 |
| 468 | Ga0495660_0003488 | 3300046810 | Bacteria | 9703 |
| 469 | Ga0495660_0003565 | 3300046810 | Bacteria | 9599 |
| 470 | Ga0495660_0013569 | 3300046810 | Bacteria | 4721 |
| 471 | Ga0495660_0018570 | 3300046810 | Bacteria | 3998 |
| 472 | Ga0495660_0123155 | 3300046810 | Bacteria | 1309 |
| 473 | Ga0495604_0010000 | 3300047317 | Bacteria | 7510 |
| 474 | Ga0495674_0051344 | 3300047319 | Bacteria | 3635 |
| 475 | Ga0495672_0000022 | 3300047320 | Bacteria | 420632 |
| 476 | Ga0495672_0008202 | 3300047320 | Bacteria | 7746 |
| 477 | Ga0495672_0017163 | 3300047320 | Bacteria | 4847 |
| 478 | Ga0495672_0047689 | 3300047320 | Bacteria | 2546 |
| 479 | Ga0495672_0070761 | 3300047320 | Bacteria | 1975 |
| 480 | Ga0495676_0000058 | 3300047321 | Bacteria | 86045 |
| 481 | Ga0495676_0153344 | 3300047321 | Bacteria | 1637 |
| 482 | Ga0495680_0001006 | 3300047322 | Bacteria | 31332 |
| 483 | Ga0495683_0002241 | 3300047323 | Bacteria | 11822 |
| 484 | Ga0495683_0002655 | 3300047323 | Bacteria | 10669 |
| 485 | Ga0495683_0073096 | 3300047323 | Bacteria | 1682 |
| 486 | Ga0495677_0001377 | 3300047445 | Bacteria | 9714 |
| 487 | Ga0495677_0186823 | 3300047445 | Bacteria | 804 |
| 488 | Ga0495679_000157 | 3300047446 | Bacteria | 61342 |
| 489 | Ga0495679_000191 | 3300047446 | Bacteria | 54219 |
| 490 | Ga0495679_000440 | 3300047446 | Bacteria | 30708 |
| 491 | Ga0495679_000507 | 3300047446 | Bacteria | 27686 |
| 492 | Ga0495679_000569 | 3300047446 | Bacteria | 25611 |
| 493 | Ga0495679_000945 | 3300047446 | Bacteria | 18048 |
| 494 | Ga0495673_0002300 | 3300047469 | Bacteria | 13669 |
| 495 | Ga0495673_0003865 | 3300047469 | Bacteria | 9655 |
| 496 | Ga0495673_0007062 | 3300047469 | Bacteria | 6513 |
| 497 | Ga0495673_0008300 | 3300047469 | Bacteria | 5856 |
| 498 | Ga0495681_0002512 | 3300047470 | Bacteria | 13070 |
| 499 | Ga0495681_0003605 | 3300047470 | Bacteria | 10769 |
| 500 | Ga0495681_0004978 | 3300047470 | Bacteria | 8961 |
| 501 | Ga0495681_0007877 | 3300047470 | Bacteria | 6737 |
| 502 | Ga0495681_0029087 | 3300047470 | Bacteria | 2833 |
| 503 | Ga0495681_0099862 | 3300047470 | Bacteria | 1270 |
| 504 | Ga0495686_0000266 | 3300047472 | Bacteria | 93781 |
| 505 | Ga0495686_0002582 | 3300047472 | Bacteria | 16852 |
| 506 | Ga0495626_0000074 | 3300048091 | Bacteria | 132552 |
| 507 | Ga0495626_0000972 | 3300048091 | Bacteria | 24732 |
| 508 | Ga0495626_0001407 | 3300048091 | Bacteria | 19231 |
| 509 | Ga0495626_0002709 | 3300048091 | Bacteria | 11964 |
| 510 | Ga0495626_0118182 | 3300048091 | Bacteria | 1142 |
| 511 | Ga0496100_0023094 | 3300048903 | Bacteria | 3773 |
| 512 | Ga0496100_0060536 | 3300048903 | Bacteria | 2492 |
| 513 | Ga0496101_0001241 | 3300048904 | Bacteria | 15241 |
| 514 | Ga0496101_0031094 | 3300048904 | Bacteria | 3750 |
| 515 | Ga0496102_0002156 | 3300048905 | Bacteria | 16901 |
| 516 | Ga0496102_0011646 | 3300048905 | Bacteria | 7590 |
| 517 | Ga0496103_0000021 | 3300048906 | Bacteria | 229062 |
| 518 | Ga0496104_0000715 | 3300048907 | Bacteria | 28541 |
| 519 | Ga0496105_0000151 | 3300048908 | Bacteria | 45925 |
| 520 | Ga0496106_0088103 | 3300048909 | Bacteria | 2392 |
| 521 | Ga0496106_0181488 | 3300048909 | Bacteria | 1671 |
| 522 | Ga0496107_0040363 | 3300048910 | Bacteria | 3350 |
| 523 | Ga0496112_0005821 | 3300048915 | Bacteria | 10731 |
| 524 | Ga0496113_0000102 | 3300048916 | Bacteria | 36206 |
| 525 | Ga0496115_0728392 | 3300048918 | Bacteria | 777 |
| 526 | Ga0496116_0000180 | 3300048919 | Bacteria | 126589 |
| 527 | Ga0496116_0000255 | 3300048919 | Bacteria | 94048 |
| 528 | Ga0496116_0002015 | 3300048919 | Bacteria | 21833 |
| 529 | Ga0496116_0004044 | 3300048919 | Bacteria | 14193 |
| 530 | Ga0496116_0019846 | 3300048919 | Bacteria | 5130 |
| 531 | Ga0496116_0054651 | 3300048919 | Bacteria | 2628 |
| 532 | Ga0496116_0063758 | 3300048919 | Bacteria | 2372 |
| 533 | Ga0496116_0117351 | 3300048919 | Bacteria | 1549 |
| 534 | Ga0496116_0179898 | 3300048919 | Bacteria | 1134 |
| 535 | Ga0496117_0000284 | 3300048920 | Bacteria | 92675 |
| 536 | Ga0496117_0000475 | 3300048920 | Bacteria | 66690 |
| 537 | Ga0496117_0000790 | 3300048920 | Bacteria | 49640 |
| 538 | Ga0496117_0001907 | 3300048920 | Bacteria | 27984 |
| 539 | Ga0496117_0014070 | 3300048920 | Bacteria | 6920 |
| 540 | Ga0496117_0024319 | 3300048920 | Bacteria | 4794 |
| 541 | Ga0496117_0164130 | 3300048920 | Bacteria | 1297 |
| 542 | Ga0496117_0168377 | 3300048920 | Bacteria | 1274 |
| 543 | Ga0496117_0262348 | 3300048920 | Bacteria | 935 |
| 544 | Ga0496118_0000482 | 3300048921 | Bacteria | 66218 |
| 545 | Ga0496118_0002095 | 3300048921 | Bacteria | 28029 |
| 546 | Ga0496118_0019428 | 3300048921 | Bacteria | 6072 |
| 547 | Ga0496118_0043806 | 3300048921 | Bacteria | 3513 |
| 548 | Ga0496118_0052116 | 3300048921 | Bacteria | 3124 |
| 549 | Ga0496118_0077991 | 3300048921 | Bacteria | 2346 |
| 550 | Ga0496118_0172050 | 3300048921 | Bacteria | 1321 |
| 551 | Ga0496119_0000056 | 3300048922 | Bacteria | 174042 |
| 552 | Ga0496119_0000077 | 3300048922 | Bacteria | 143108 |
| 553 | Ga0496119_0001020 | 3300048922 | Bacteria | 35864 |
| 554 | Ga0496119_0003742 | 3300048922 | Bacteria | 15562 |
| 555 | Ga0496119_0010114 | 3300048922 | Bacteria | 7970 |
| 556 | Ga0496119_0018013 | 3300048922 | Bacteria | 5280 |
| 557 | Ga0496119_0054734 | 3300048922 | Bacteria | 2428 |
| 558 | Ga0496120_0000046 | 3300048923 | Bacteria | 190675 |
| 559 | Ga0496120_0000063 | 3300048923 | Bacteria | 170325 |
| 560 | Ga0496120_0001205 | 3300048923 | Bacteria | 32763 |
| 561 | Ga0496120_0006488 | 3300048923 | Bacteria | 8969 |
| 562 | Ga0496120_0009589 | 3300048923 | Bacteria | 6845 |
| 563 | Ga0496120_0017015 | 3300048923 | Bacteria | 4729 |
| 564 | Ga0496120_0088856 | 3300048923 | Bacteria | 1655 |
| 565 | Ga0496121_0004669 | 3300048924 | Bacteria | 18191 |
| 566 | Ga0496121_0008008 | 3300048924 | Bacteria | 12613 |
| 567 | Ga0496121_0141185 | 3300048924 | Bacteria | 1786 |
| 568 | Ga0496122_0002034 | 3300048925 | Bacteria | 30017 |
| 569 | Ga0496122_0002380 | 3300048925 | Bacteria | 26920 |
| 570 | Ga0496122_0002939 | 3300048925 | Bacteria | 23250 |
| 571 | Ga0496122_0005020 | 3300048925 | Bacteria | 16009 |
| 572 | Ga0496122_0005255 | 3300048925 | Bacteria | 15519 |
| 573 | Ga0496122_0014836 | 3300048925 | Bacteria | 7502 |
| 574 | Ga0496122_0024893 | 3300048925 | Bacteria | 5223 |
| 575 | Ga0496122_0055580 | 3300048925 | Bacteria | 2960 |
| 576 | Ga0496122_0056498 | 3300048925 | Bacteria | 2925 |
| 577 | Ga0496122_0171583 | 3300048925 | Bacteria | 1306 |
| 578 | Ga0496122_0187620 | 3300048925 | Bacteria | 1224 |
| 579 | Ga0496123_0000666 | 3300048926 | Bacteria | 56742 |
| 580 | Ga0496123_0000927 | 3300048926 | Bacteria | 45829 |
| 581 | Ga0496123_0001027 | 3300048926 | Bacteria | 42422 |
| 582 | Ga0496123_0001803 | 3300048926 | Bacteria | 28188 |
| 583 | Ga0496123_0001897 | 3300048926 | Bacteria | 27276 |
| 584 | Ga0496123_0007003 | 3300048926 | Bacteria | 10752 |
| 585 | Ga0496123_0008081 | 3300048926 | Bacteria | 9730 |
| 586 | Ga0496123_0011923 | 3300048926 | Bacteria | 7466 |
| 587 | Ga0496123_0053328 | 3300048926 | Bacteria | 2673 |
| 588 | Ga0496123_0055730 | 3300048926 | Bacteria | 2590 |
| 589 | Ga0496123_0075157 | 3300048926 | Bacteria | 2086 |
| 590 | Ga0496124_0000944 | 3300048927 | Bacteria | 46593 |
| 591 | Ga0496124_0001415 | 3300048927 | Bacteria | 35637 |
| 592 | Ga0496124_0001563 | 3300048927 | Bacteria | 33097 |
| 593 | Ga0496124_0023165 | 3300048927 | Bacteria | 5675 |
| 594 | Ga0496124_0033436 | 3300048927 | Bacteria | 4523 |
| 595 | Ga0496124_0036563 | 3300048927 | Bacteria | 4282 |
| 596 | Ga0496124_0099493 | 3300048927 | Bacteria | 2358 |
| 597 | Ga0496124_0112846 | 3300048927 | Bacteria | 2185 |
| 598 | Ga0496125_0000038 | 3300048928 | Bacteria | 328120 |
| 599 | Ga0496125_0000414 | 3300048928 | Bacteria | 79745 |
| 600 | Ga0496125_0001808 | 3300048928 | Bacteria | 29539 |
| 601 | Ga0496125_0001993 | 3300048928 | Bacteria | 27694 |
| 602 | Ga0496125_0003412 | 3300048928 | Bacteria | 19318 |
| 603 | Ga0496125_0003434 | 3300048928 | Bacteria | 19207 |
| 604 | Ga0496125_0011396 | 3300048928 | Bacteria | 8896 |
| 605 | Ga0496125_0013069 | 3300048928 | Bacteria | 8187 |
| 606 | Ga0496125_0027722 | 3300048928 | Bacteria | 5127 |
| 607 | Ga0496125_0071751 | 3300048928 | Bacteria | 2703 |
| 608 | Ga0496125_0144589 | 3300048928 | Bacteria | 1646 |
| 609 | Ga0496125_0299637 | 3300048928 | Bacteria | 985 |
| 610 | Ga0496125_0340039 | 3300048928 | Bacteria | 901 |
| 611 | Ga0496126_0000175 | 3300048929 | Bacteria | 146389 |
| 612 | Ga0496126_0000817 | 3300048929 | Bacteria | 55573 |
| 613 | Ga0496126_0006838 | 3300048929 | Bacteria | 12646 |
| 614 | Ga0496126_0007003 | 3300048929 | Bacteria | 12454 |
| 615 | Ga0496126_0011789 | 3300048929 | Bacteria | 8998 |
| 616 | Ga0496126_0045365 | 3300048929 | Bacteria | 4040 |
| 617 | Ga0496126_0047834 | 3300048929 | Bacteria | 3914 |
| 618 | Ga0495678_000359 | 3300049459 | Bacteria | 46686 |
| 619 | Ga0495678_001048 | 3300049459 | Bacteria | 23397 |
| 620 | Ga0495678_001784 | 3300049459 | Bacteria | 15918 |
| 621 | Ga0495678_002659 | 3300049459 | Bacteria | 11838 |
| 622 | Ga0495678_041350 | 3300049459 | Bacteria | 1845 |
| 623 | Ga0495678_045203 | 3300049459 | Bacteria | 1738 |
| 624 | Ga0495682_0000085 | 3300049460 | Bacteria | 81879 |
| 625 | Ga0495682_0062703 | 3300049460 | Bacteria | 1341 |
| 626 | Ga0501319_004774 | 3300049535 | Bacteria | 952 |
| 627 | Ga0501240_003553 | 3300049673 | Bacteria | 1749 |
| 628 | Ga0501241_000395 | 3300049758 | Bacteria | 9570 |
| 629 | Ga0501269_002059 | 3300049766 | Bacteria | 2529 |
| 630 | Ga0495601_0019067 | 3300053077 | Bacteria | 4180 |
| 631 | Ga0500650_0147984 | 3300053098 | Bacteria | 1087 |
| 632 | Ga0500572_000082 | 3300053111 | Bacteria | 30125 |
| 633 | Ga0500595_010171 | 3300053119 | Bacteria | 3750 |
| 634 | Ga0500621_014165 | 3300053126 | Bacteria | 2897 |
| 635 | Ga0500573_0001991 | 3300053140 | Bacteria | 10007 |
| 636 | Ga0500586_008184 | 3300053145 | Bacteria | 2835 |
| 637 | Ga0500619_000306 | 3300053154 | Bacteria | 9686 |
| 638 | Ga0500634_0000413 | 3300053161 | Bacteria | 13802 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009092 | Ga0105250_10040304 | Ga0105250_100403042 | 210 |
| 2 | 3300025711 | Ga0207696_1003396 | Ga0207696_10033965 | 210 |
| 3 | 3300046474 | Ga0495605_0027271 | Ga0495605_0027271_1137_1832 | 214 |
| 4 | iso_pu_bacteria | 2561511199 | 2562464141 | 217 |
| 5 | iso_pu_bacteria | 2826581358 | 2826583109 | 217 |
| 6 | iso_pu_bacteria | 2826581358 | 2826584810 | 217 |
| 7 | iso_pu_bacteria | 2842815866 | 2842816365 | 217 |
| 8 | iso_pu_bacteria | 2842815866 | 2842818747 | 217 |
| 9 | iso_pu_bacteria | 2842843487 | 2842843506 | 217 |
| 10 | iso_pu_bacteria | 2852657418 | 2852657445 | 217 |
| 11 | iso_pu_bacteria | 2878029506 | 2878032127 | 217 |
| 12 | iso_pu_bacteria | 2880230671 | 2880233460 | 217 |
| 13 | iso_pu_bacteria | 2919063839 | 2919068776 | 217 |
| 14 | iso_pu_bacteria | 2931390751 | 2931393197 | 217 |
| 15 | 3300046530 | Ga0495654_0145194 | Ga0495654_0145194_334_1011 | 219 |
| 16 | 3300009092 | Ga0105250_10000436 | Ga0105250_1000043611 | 221 |
| 17 | 3300011119 | Ga0105246_10006218 | Ga0105246_100062187 | 221 |
| 18 | 3300042006 | Ga0439432_000028 | Ga0439432_000028_11194_11859 | 221 |
| 19 | 3300046454 | Ga0495592_0138586 | Ga0495592_0138586_195_860 | 221 |
| 20 | 3300046463 | Ga0495653_0129853 | Ga0495653_0129853_194_859 | 221 |
| 21 | 3300046471 | Ga0495650_0005155 | Ga0495650_0005155_1345_2013 | 221 |
| 22 | 3300046506 | Ga0495583_0000818 | Ga0495583_0000818_2027_2695 | 221 |
| 23 | 3300046511 | Ga0495608_0009003 | Ga0495608_0009003_3095_3760 | 221 |
| 24 | 3300046512 | Ga0495610_0002135 | Ga0495610_0002135_11934_12599 | 221 |
| 25 | 3300046516 | Ga0495628_0025539 | Ga0495628_0025539_331_996 | 221 |
| 26 | 3300046519 | Ga0495632_0000051 | Ga0495632_0000051_106569_107237 | 221 |
| 27 | 3300046520 | Ga0495637_0017389 | Ga0495637_0017389_255_923 | 221 |
| 28 | 3300046529 | Ga0495652_0162565 | Ga0495652_0162565_736_1401 | 221 |
| 29 | 3300046530 | Ga0495654_0003905 | Ga0495654_0003905_1835_2500 | 221 |
| 30 | 3300046663 | Ga0495635_0206774 | Ga0495635_0206774_528_1193 | 221 |
| 31 | 3300046665 | Ga0495661_0000475 | Ga0495661_0000475_26689_27357 | 221 |
| 32 | 3300046678 | Ga0495599_0040607 | Ga0495599_0040607_236_901 | 221 |
| 33 | 3300046680 | Ga0495646_0035106 | Ga0495646_0035106_210_875 | 221 |
| 34 | 3300046694 | Ga0495649_0072362 | Ga0495649_0072362_1051_1716 | 221 |
| 35 | 3300046809 | Ga0495600_0356482 | Ga0495600_0356482_200_865 | 221 |
| 36 | 3300046810 | Ga0495660_0001687 | Ga0495660_0001687_8646_9311 | 221 |
| 37 | 3300047317 | Ga0495604_0010000 | Ga0495604_0010000_4706_5371 | 221 |
| 38 | 3300047446 | Ga0495679_000157 | Ga0495679_000157_48674_49339 | 221 |
| 39 | 3300048919 | Ga0496116_0000180 | Ga0496116_0000180_101986_102654 | 221 |
| 40 | 3300048922 | Ga0496119_0018013 | Ga0496119_0018013_779_1447 | 221 |
| 41 | 3300048923 | Ga0496120_0000046 | Ga0496120_0000046_166006_166674 | 221 |
| 42 | 3300048927 | Ga0496124_0036563 | Ga0496124_0036563_2661_3326 | 221 |
| 43 | 3300053077 | Ga0495601_0019067 | Ga0495601_0019067_196_861 | 221 |
| 44 | 3300053154 | Ga0500619_000306 | Ga0500619_000306_5573_6238 | 221 |
| 45 | iso_pu_bacteria | 2511231023 | 2511368975 | 221 |
| 46 | iso_pu_bacteria | 2511231023 | 2511368984 | 221 |
| 47 | iso_pu_bacteria | 2511231031 | 2511414480 | 221 |
| 48 | iso_pu_bacteria | 2547132181 | 2547698000 | 221 |
| 49 | iso_pu_bacteria | 2597489888 | 2597863466 | 221 |
| 50 | iso_pu_bacteria | 2597489889 | 2597870563 | 221 |
| 51 | iso_pu_bacteria | 2599185167 | 2599399402 | 221 |
| 52 | iso_pu_bacteria | 2599185179 | 2599454182 | 221 |
| 53 | iso_pu_bacteria | 2599185189 | 2599510483 | 221 |
| 54 | iso_pu_bacteria | 2599185190 | 2599513892 | 221 |
| 55 | iso_pu_bacteria | 2599185191 | 2599519073 | 221 |
| 56 | iso_pu_bacteria | 2599185239 | 2599739119 | 221 |
| 57 | iso_pu_bacteria | 2599185288 | 2599883919 | 221 |
| 58 | iso_pu_bacteria | 2599185290 | 2599892949 | 221 |
| 59 | iso_pu_bacteria | 2599185303 | 2599951143 | 221 |
| 60 | iso_pu_bacteria | 2600254954 | 2600446600 | 221 |
| 61 | iso_pu_bacteria | 2600255296 | 2601689184 | 221 |
| 62 | iso_pu_bacteria | 2600255318 | 2601799237 | 221 |
| 63 | iso_pu_bacteria | 2600255389 | 2602010955 | 221 |
| 64 | iso_pu_bacteria | 2603880185 | 2606078533 | 221 |
| 65 | iso_pu_bacteria | 2603880199 | 2606130641 | 221 |
| 66 | iso_pu_bacteria | 2619619299 | 2621299119 | 221 |
| 67 | iso_pu_bacteria | 2623620443 | 2624480215 | 221 |
| 68 | iso_pu_bacteria | 2643221571 | 2643871717 | 221 |
| 69 | iso_pu_bacteria | 2643221713 | 2644620786 | 221 |
| 70 | iso_pu_bacteria | 2675903420 | 2677899231 | 221 |
| 71 | iso_pu_bacteria | 2706794495 | 2707098879 | 221 |
| 72 | iso_pu_bacteria | 2713897148 | 2715753132 | 221 |
| 73 | iso_pu_bacteria | 2713897149 | 2715758547 | 221 |
| 74 | iso_pu_bacteria | 2718217725 | 2718634519 | 221 |
| 75 | iso_pu_bacteria | 2721755607 | 2723248272 | 221 |
| 76 | iso_pu_bacteria | 2738541265 | 2738672276 | 221 |
| 77 | iso_pu_bacteria | 2738541275 | 2738711071 | 221 |
| 78 | iso_pu_bacteria | 2738541282 | 2738750669 | 221 |
| 79 | iso_pu_bacteria | 2738541294 | 2738812311 | 221 |
| 80 | iso_pu_bacteria | 2738541301 | 2738849496 | 221 |
| 81 | iso_pu_bacteria | 2738541303 | 2738859710 | 221 |
| 82 | iso_pu_bacteria | 2738541304 | 2738865225 | 221 |
| 83 | iso_pu_bacteria | 2738541309 | 2738899633 | 221 |
| 84 | iso_pu_bacteria | 2738543022 | 2739297743 | 221 |
| 85 | iso_pu_bacteria | 2738543025 | 2739313197 | 221 |
| 86 | iso_pu_bacteria | 2738543031 | 2739348484 | 221 |
| 87 | iso_pu_bacteria | 2738543033 | 2739359421 | 221 |
| 88 | iso_pu_bacteria | 2784132063 | 2784264474 | 221 |
| 89 | iso_pu_bacteria | 2791354903 | 2791924500 | 221 |
| 90 | iso_pu_bacteria | 2808606385 | 2808980996 | 221 |
| 91 | iso_pu_bacteria | 2808606388 | 2808996531 | 221 |
| 92 | iso_pu_bacteria | 2816332298 | 2817491799 | 221 |
| 93 | iso_pu_bacteria | 2818991456 | 2819658845 | 221 |
| 94 | iso_pu_bacteria | 2834028612 | 2834030382 | 221 |
| 95 | iso_pu_bacteria | 2842826826 | 2842830463 | 221 |
| 96 | iso_pu_bacteria | 2842832357 | 2842834765 | 221 |
| 97 | iso_pu_bacteria | 2842837860 | 2842842021 | 221 |
| 98 | iso_pu_bacteria | 2842849001 | 2842849959 | 221 |
| 99 | iso_pu_bacteria | 2842849001 | 2842850631 | 221 |
| 100 | iso_pu_bacteria | 2847085930 | 2847088415 | 221 |
| 101 | iso_pu_bacteria | 2852612431 | 2852618775 | 221 |
| 102 | iso_pu_bacteria | 2852667396 | 2852672582 | 221 |
| 103 | iso_pu_bacteria | 2854601825 | 2854606097 | 221 |
| 104 | iso_pu_bacteria | 2858950400 | 2858952831 | 221 |
| 105 | iso_pu_bacteria | 2860867994 | 2860870168 | 221 |
| 106 | iso_pu_bacteria | 2904504865 | 2904507419 | 221 |
| 107 | iso_pu_bacteria | 2908446538 | 2908450280 | 221 |
| 108 | iso_pu_bacteria | 2908669403 | 2908673449 | 221 |
| 109 | iso_pu_bacteria | 2919125081 | 2919126654 | 221 |
| 110 | iso_pu_bacteria | 2919385768 | 2919387095 | 221 |
| 111 | iso_pu_bacteria | 2919476304 | 2919477151 | 221 |
| 112 | iso_pu_bacteria | 2919487758 | 2919489038 | 221 |
| 113 | iso_pu_bacteria | 2928100450 | 2928103683 | 221 |
| 114 | iso_pu_bacteria | 2928959182 | 2928961304 | 221 |
| 115 | iso_pu_bacteria | 2928972540 | 2928975358 | 221 |
| 116 | iso_pu_bacteria | 2929189879 | 2929192080 | 221 |
| 117 | iso_pu_bacteria | 2935625433 | 2935627416 | 221 |
| 118 | iso_pu_bacteria | 2939607340 | 2939608224 | 221 |
| 119 | iso_pu_bacteria | 2939617950 | 2939621434 | 221 |
| 120 | iso_pu_bacteria | 2945928738 | 2945933986 | 221 |
| 121 | iso_pu_bacteria | 2945961074 | 2945962848 | 221 |
| 122 | iso_pu_bacteria | 2946006987 | 2946009285 | 221 |
| 123 | iso_pu_bacteria | 2946027586 | 2946030399 | 221 |
| 124 | iso_pu_bacteria | 2947233263 | 2947237295 | 221 |
| 125 | iso_pu_bacteria | 2969304461 | 2969307048 | 221 |
| 126 | iso_pu_bacteria | 2974289157 | 2974290830 | 221 |
| 127 | iso_pu_bacteria | 2974298342 | 2974301071 | 221 |
| 128 | iso_pu_bacteria | 2974435778 | 2974437661 | 221 |
| 129 | iso_pu_bacteria | 2977240413 | 2977241654 | 221 |
| 130 | iso_pu_bacteria | 2984499530 | 2984503545 | 221 |
| 131 | iso_pu_bacteria | 2984504281 | 2984505146 | 221 |
| 132 | iso_pu_bacteria | 2987605356 | 2987606575 | 221 |
| 133 | iso_pu_bacteria | 2998139840 | 2998142979 | 221 |
| 134 | iso_pu_bacteria | 3007718800 | 3007721993 | 221 |
| 135 | iso_pu_bacteria | 3007855910 | 3007856982 | 221 |
| 136 | iso_pu_bacteria | 3007861166 | 3007862045 | 221 |
| 137 | iso_pu_bacteria | 8016728285 | 8016732992 | 221 |
| 138 | iso_pu_bacteria | 8019504834 | 8019508424 | 221 |
| 139 | iso_pu_bacteria | 8021120328 | 8021125891 | 221 |
| 140 | iso_pu_bacteria | 8029995093 | 8029997808 | 221 |
| 141 | iso_pu_bacteria | 8034962539 | 8034963669 | 221 |
| 142 | iso_pu_bacteria | 8054285046 | 8054287199 | 221 |
| 143 | iso_pu_bacteria | 8054347763 | 8054351564 | 221 |
| 144 | iso_pu_bacteria | 8054503363 | 8054505666 | 221 |
| 145 | iso_pu_bacteria | 8055087960 | 8055090372 | 221 |
| 146 | iso_pu_bacteria | 8055092621 | 8055094730 | 221 |
| 147 | iso_pu_bacteria | 8055097453 | 8055099367 | 221 |
| 148 | iso_pu_bacteria | 8055817908 | 8055821724 | 221 |
| 149 | iso_pu_bacteria | 8056131705 | 8056134268 | 221 |
| 150 | iso_pu_bacteria | 8056148874 | 8056154155 | 221 |
| 151 | iso_pu_bacteria | 8056161164 | 8056166620 | 221 |
| 152 | iso_pu_bacteria | 8056166840 | 8056168213 | 221 |
| 153 | iso_pu_bacteria | 2857564685 | 2857569167 | 222 |
| 154 | iso_pu_bacteria | 2888373701 | 2888378252 | 222 |
| 155 | 3300035084 | Ga0373928_0001402 | Ga0373928_0001402_891_1586 | 223 |
| 156 | 3300035112 | Ga0373932_0001806 | Ga0373932_0001806_3489_4184 | 223 |
| 157 | 3300042876 | Ga0451577_0233955 | Ga0451577_0233955_306_1010 | 224 |
| 158 | 3300048929 | Ga0496126_0006838 | Ga0496126_0006838_1355_2029 | 224 |
| 159 | 3300002737 | JGI25162J39368_1000001 | JGI25162J39368_1000001569 | 225 |
| 160 | 3300002771 | JGI25163J39215_1001830 | JGI25163J39215_10018303 | 225 |
| 161 | 3300002772 | JGI25164J39214_1005280 | JGI25164J39214_10052802 | 225 |
| 162 | 3300003214 | JGI25165J46597_1000001 | JGI25165J46597_1000001557 | 225 |
| 163 | 3300003751 | Ga0055538_1000001 | Ga0055538_1000001477 | 225 |
| 164 | 3300003752 | Ga0055539_1000001 | Ga0055539_1000001477 | 225 |
| 165 | 3300003752 | Ga0055539_1000191 | Ga0055539_100019120 | 225 |
| 166 | 3300003756 | Ga0055533_1000003 | Ga0055533_1000003557 | 225 |
| 167 | 3300003756 | Ga0055533_1000191 | Ga0055533_100019120 | 225 |
| 168 | 3300003758 | Ga0055532_1000194 | Ga0055532_100019420 | 225 |
| 169 | 3300003759 | Ga0055525_1000003 | Ga0055525_1000003557 | 225 |
| 170 | 3300003759 | Ga0055525_1000258 | Ga0055525_100025820 | 225 |
| 171 | 3300003761 | Ga0055535_1010693 | Ga0055535_10106932 | 225 |
| 172 | 3300003791 | Ga0055530_10003277 | Ga0055530_100032774 | 225 |
| 173 | 3300003792 | Ga0055540_1000008 | Ga0055540_10000085 | 225 |
| 174 | 3300003794 | Ga0055531_10007799 | Ga0055531_100077994 | 225 |
| 175 | 3300003841 | Ga0055541_1000001 | Ga0055541_1000001557 | 225 |
| 176 | 3300003841 | Ga0055541_1000126 | Ga0055541_100012621 | 225 |
| 177 | 3300003856 | Ga0058692_1012382 | Ga0058692_10123822 | 225 |
| 178 | 3300005288 | Ga0065714_10152939 | Ga0065714_101529392 | 225 |
| 179 | 3300005290 | Ga0065712_10067789 | Ga0065712_1006778927 | 225 |
| 180 | 3300005290 | Ga0065712_10067908 | Ga0065712_100679089 | 225 |
| 181 | 3300005290 | Ga0065712_10071132 | Ga0065712_100711322 | 225 |
| 182 | 3300005331 | Ga0070670_100000170 | Ga0070670_10000017027 | 225 |
| 183 | 3300005331 | Ga0070670_100002253 | Ga0070670_1000022537 | 225 |
| 184 | 3300005335 | Ga0070666_10035787 | Ga0070666_100357873 | 225 |
| 185 | 3300005347 | Ga0070668_100002253 | Ga0070668_1000022535 | 225 |
| 186 | 3300005353 | Ga0070669_100000080 | Ga0070669_10000008032 | 225 |
| 187 | 3300005353 | Ga0070669_100001044 | Ga0070669_1000010447 | 225 |
| 188 | 3300005355 | Ga0070671_100008240 | Ga0070671_1000082407 | 225 |
| 189 | 3300005367 | Ga0070667_100000444 | Ga0070667_10000044421 | 225 |
| 190 | 3300005457 | Ga0070662_100002488 | Ga0070662_1000024889 | 225 |
| 191 | 3300005539 | Ga0068853_100030774 | Ga0068853_1000307744 | 225 |
| 192 | 3300005548 | Ga0070665_100242686 | Ga0070665_1002426862 | 225 |
| 193 | 3300005548 | Ga0070665_100438837 | Ga0070665_1004388372 | 225 |
| 194 | 3300005548 | Ga0070665_100613998 | Ga0070665_1006139982 | 225 |
| 195 | 3300005564 | Ga0070664_100000996 | Ga0070664_10000099611 | 225 |
| 196 | 3300005564 | Ga0070664_100094527 | Ga0070664_1000945271 | 225 |
| 197 | 3300005564 | Ga0070664_100806361 | Ga0070664_1008063612 | 225 |
| 198 | 3300005578 | Ga0068854_100023606 | Ga0068854_1000236062 | 225 |
| 199 | 3300005834 | Ga0068851_10000188 | Ga0068851_1000018817 | 225 |
| 200 | 3300005844 | Ga0068862_100037700 | Ga0068862_1000377004 | 225 |
| 201 | 3300006051 | Ga0075364_10020814 | Ga0075364_100208145 | 225 |
| 202 | 3300006175 | Ga0070712_100032616 | Ga0070712_1000326162 | 225 |
| 203 | 3300006946 | Ga0079104_1003500 | Ga0079104_10035004 | 225 |
| 204 | 3300009011 | Ga0105251_10000032 | Ga0105251_10000032119 | 225 |
| 205 | 3300009011 | Ga0105251_10001241 | Ga0105251_100012414 | 225 |
| 206 | 3300009011 | Ga0105251_10009128 | Ga0105251_100091282 | 225 |
| 207 | 3300009011 | Ga0105251_10009385 | Ga0105251_100093856 | 225 |
| 208 | 3300009011 | Ga0105251_10015206 | Ga0105251_100152064 | 225 |
| 209 | 3300009011 | Ga0105251_10081919 | Ga0105251_100819191 | 225 |
| 210 | 3300009036 | Ga0105244_10000602 | Ga0105244_100006026 | 225 |
| 211 | 3300009036 | Ga0105244_10000976 | Ga0105244_1000097611 | 225 |
| 212 | 3300009036 | Ga0105244_10002117 | Ga0105244_100021178 | 225 |
| 213 | 3300009036 | Ga0105244_10002606 | Ga0105244_100026062 | 225 |
| 214 | 3300009036 | Ga0105244_10006696 | Ga0105244_100066965 | 225 |
| 215 | 3300009036 | Ga0105244_10012286 | Ga0105244_100122862 | 225 |
| 216 | 3300009092 | Ga0105250_10000001 | Ga0105250_10000001347 | 225 |
| 217 | 3300009092 | Ga0105250_10003333 | Ga0105250_100033333 | 225 |
| 218 | 3300009092 | Ga0105250_10009894 | Ga0105250_100098944 | 225 |
| 219 | 3300009092 | Ga0105250_10023997 | Ga0105250_100239972 | 225 |
| 220 | 3300009092 | Ga0105250_10075737 | Ga0105250_100757372 | 225 |
| 221 | 3300009148 | Ga0105243_10000098 | Ga0105243_1000009854 | 225 |
| 222 | 3300009148 | Ga0105243_10072120 | Ga0105243_100721202 | 225 |
| 223 | 3300009176 | Ga0105242_10008357 | Ga0105242_100083572 | 225 |
| 224 | 3300009177 | Ga0105248_10116580 | Ga0105248_101165803 | 225 |
| 225 | 3300009177 | Ga0105248_10253803 | Ga0105248_102538032 | 225 |
| 226 | 3300009545 | Ga0105237_10002317 | Ga0105237_100023172 | 225 |
| 227 | 3300009553 | Ga0105249_10029770 | Ga0105249_100297704 | 225 |
| 228 | 3300011119 | Ga0105246_10025397 | Ga0105246_100253973 | 225 |
| 229 | 3300012498 | Ga0157345_1000004 | Ga0157345_100000430 | 225 |
| 230 | 3300013100 | Ga0157373_10000039 | Ga0157373_1000003947 | 225 |
| 231 | 3300013100 | Ga0157373_10000472 | Ga0157373_1000047220 | 225 |
| 232 | 3300013100 | Ga0157373_10003468 | Ga0157373_1000346810 | 225 |
| 233 | 3300013100 | Ga0157373_10006500 | Ga0157373_100065003 | 225 |
| 234 | 3300013100 | Ga0157373_10013426 | Ga0157373_100134265 | 225 |
| 235 | 3300013100 | Ga0157373_10031912 | Ga0157373_100319123 | 225 |
| 236 | 3300013100 | Ga0157373_10043785 | Ga0157373_100437852 | 225 |
| 237 | 3300013102 | Ga0157371_10000064 | Ga0157371_1000006475 | 225 |
| 238 | 3300013102 | Ga0157371_10056553 | Ga0157371_100565532 | 225 |
| 239 | 3300013102 | Ga0157371_10196289 | Ga0157371_101962891 | 225 |
| 240 | 3300013102 | Ga0157371_10199583 | Ga0157371_101995832 | 225 |
| 241 | 3300013104 | Ga0157370_10024106 | Ga0157370_100241062 | 225 |
| 242 | 3300013104 | Ga0157370_10029111 | Ga0157370_100291114 | 225 |
| 243 | 3300013104 | Ga0157370_10032098 | Ga0157370_100320984 | 225 |
| 244 | 3300013104 | Ga0157370_10058293 | Ga0157370_100582933 | 225 |
| 245 | 3300013105 | Ga0157369_10002223 | Ga0157369_1000222314 | 225 |
| 246 | 3300013105 | Ga0157369_10003854 | Ga0157369_100038548 | 225 |
| 247 | 3300013105 | Ga0157369_10004302 | Ga0157369_100043022 | 225 |
| 248 | 3300013105 | Ga0157369_10007619 | Ga0157369_100076193 | 225 |
| 249 | 3300013105 | Ga0157369_10017064 | Ga0157369_100170647 | 225 |
| 250 | 3300013105 | Ga0157369_10018100 | Ga0157369_100181003 | 225 |
| 251 | 3300013105 | Ga0157369_10145343 | Ga0157369_101453433 | 225 |
| 252 | 3300013105 | Ga0157369_10201156 | Ga0157369_102011563 | 225 |
| 253 | 3300013306 | Ga0163162_10000067 | Ga0163162_1000006750 | 225 |
| 254 | 3300013306 | Ga0163162_10010004 | Ga0163162_100100045 | 225 |
| 255 | 3300013306 | Ga0163162_10180491 | Ga0163162_101804913 | 225 |
| 256 | 3300013307 | Ga0157372_10008278 | Ga0157372_100082783 | 225 |
| 257 | 3300013307 | Ga0157372_10460778 | Ga0157372_104607782 | 225 |
| 258 | 3300013308 | Ga0157375_10000101 | Ga0157375_1000010159 | 225 |
| 259 | 3300013308 | Ga0157375_10067982 | Ga0157375_100679823 | 225 |
| 260 | 3300013308 | Ga0157375_10094774 | Ga0157375_100947743 | 225 |
| 261 | 3300013308 | Ga0157375_10207364 | Ga0157375_102073643 | 225 |
| 262 | 3300014497 | Ga0182008_10000243 | Ga0182008_1000024330 | 225 |
| 263 | 3300014497 | Ga0182008_10000445 | Ga0182008_1000044530 | 225 |
| 264 | 3300014497 | Ga0182008_10038572 | Ga0182008_100385723 | 225 |
| 265 | 3300014497 | Ga0182008_10041082 | Ga0182008_100410822 | 225 |
| 266 | 3300015261 | Ga0182006_1005224 | Ga0182006_10052247 | 225 |
| 267 | 3300015261 | Ga0182006_1012598 | Ga0182006_10125982 | 225 |
| 268 | 3300015261 | Ga0182006_1045592 | Ga0182006_10455922 | 225 |
| 269 | 3300015262 | Ga0182007_10000418 | Ga0182007_100004188 | 225 |
| 270 | 3300015262 | Ga0182007_10012714 | Ga0182007_100127143 | 225 |
| 271 | 3300015262 | Ga0182007_10034839 | Ga0182007_100348392 | 225 |
| 272 | 3300017792 | Ga0163161_10000577 | Ga0163161_1000057719 | 225 |
| 273 | 3300017792 | Ga0163161_10067644 | Ga0163161_100676442 | 225 |
| 274 | 3300017792 | Ga0163161_10078484 | Ga0163161_100784843 | 225 |
| 275 | 3300017792 | Ga0163161_10147089 | Ga0163161_101470893 | 225 |
| 276 | 3300017792 | Ga0163161_10159777 | Ga0163161_101597772 | 225 |
| 277 | 3300025206 | Ga0209435_105207 | Ga0209435_1052072 | 225 |
| 278 | 3300025207 | Ga0209760_100917 | Ga0209760_1009175 | 225 |
| 279 | 3300025224 | Ga0209784_100004 | Ga0209784_100004552 | 225 |
| 280 | 3300025224 | Ga0209784_100161 | Ga0209784_10016130 | 225 |
| 281 | 3300025225 | Ga0209566_100004 | Ga0209566_100004709 | 225 |
| 282 | 3300025225 | Ga0209566_100213 | Ga0209566_10021330 | 225 |
| 283 | 3300025226 | Ga0209674_100006 | Ga0209674_100006709 | 225 |
| 284 | 3300025226 | Ga0209674_100208 | Ga0209674_10020830 | 225 |
| 285 | 3300025229 | Ga0209147_100021 | Ga0209147_10002185 | 225 |
| 286 | 3300025229 | Ga0209147_100249 | Ga0209147_10024921 | 225 |
| 287 | 3300025230 | Ga0209563_100009 | Ga0209563_100009552 | 225 |
| 288 | 3300025230 | Ga0209563_100159 | Ga0209563_10015930 | 225 |
| 289 | 3300025230 | Ga0209563_101175 | Ga0209563_1011754 | 225 |
| 290 | 3300025231 | Ga0207427_100347 | Ga0207427_10034727 | 225 |
| 291 | 3300025233 | Ga0209437_100004 | Ga0209437_100004552 | 225 |
| 292 | 3300025242 | Ga0209258_100438 | Ga0209258_10043820 | 225 |
| 293 | 3300025246 | Ga0209646_1000676 | Ga0209646_10006769 | 225 |
| 294 | 3300025253 | Ga0209677_100005 | Ga0209677_100005552 | 225 |
| 295 | 3300025253 | Ga0209677_100163 | Ga0209677_10016330 | 225 |
| 296 | 3300025258 | Ga0209129_1000015 | Ga0209129_1000015450 | 225 |
| 297 | 3300025261 | Ga0209233_1000005 | Ga0209233_1000005709 | 225 |
| 298 | 3300025291 | Ga0209675_1011653 | Ga0209675_10116532 | 225 |
| 299 | 3300025292 | Ga0209676_1000002 | Ga0209676_10000021566 | 225 |
| 300 | 3300025292 | Ga0209676_1000120 | Ga0209676_100012028 | 225 |
| 301 | 3300025298 | Ga0209050_1000006 | Ga0209050_10000065 | 225 |
| 302 | 3300025303 | Ga0209051_1000001 | Ga0209051_10000011566 | 225 |
| 303 | 3300025304 | Ga0209257_1000029 | Ga0209257_10000295 | 225 |
| 304 | 3300025711 | Ga0207696_1000028 | Ga0207696_1000028337 | 225 |
| 305 | 3300025711 | Ga0207696_1000297 | Ga0207696_100029723 | 225 |
| 306 | 3300025711 | Ga0207696_1004507 | Ga0207696_10045072 | 225 |
| 307 | 3300025711 | Ga0207696_1005537 | Ga0207696_10055373 | 225 |
| 308 | 3300025711 | Ga0207696_1086665 | Ga0207696_10866651 | 225 |
| 309 | 3300025728 | Ga0207655_1000022 | Ga0207655_100002250 | 225 |
| 310 | 3300025728 | Ga0207655_1000080 | Ga0207655_1000080112 | 225 |
| 311 | 3300025728 | Ga0207655_1000335 | Ga0207655_10003352 | 225 |
| 312 | 3300025728 | Ga0207655_1000713 | Ga0207655_100071321 | 225 |
| 313 | 3300025728 | Ga0207655_1002903 | Ga0207655_10029035 | 225 |
| 314 | 3300025728 | Ga0207655_1012121 | Ga0207655_10121212 | 225 |
| 315 | 3300025728 | Ga0207655_1014224 | Ga0207655_10142244 | 225 |
| 316 | 3300025735 | Ga0207713_1000020 | Ga0207713_1000020339 | 225 |
| 317 | 3300025735 | Ga0207713_1001431 | Ga0207713_10014314 | 225 |
| 318 | 3300025735 | Ga0207713_1002128 | Ga0207713_10021288 | 225 |
| 319 | 3300025735 | Ga0207713_1003149 | Ga0207713_10031497 | 225 |
| 320 | 3300025735 | Ga0207713_1003256 | Ga0207713_10032567 | 225 |
| 321 | 3300025735 | Ga0207713_1005501 | Ga0207713_10055014 | 225 |
| 322 | 3300025735 | Ga0207713_1032999 | Ga0207713_10329992 | 225 |
| 323 | 3300025914 | Ga0207671_10001843 | Ga0207671_1000184322 | 225 |
| 324 | 3300025915 | Ga0207693_10032275 | Ga0207693_100322752 | 225 |
| 325 | 3300025919 | Ga0207657_10289587 | Ga0207657_102895872 | 225 |
| 326 | 3300025920 | Ga0207649_10000088 | Ga0207649_1000008811 | 225 |
| 327 | 3300025923 | Ga0207681_10000049 | Ga0207681_1000004952 | 225 |
| 328 | 3300025925 | Ga0207650_10000077 | Ga0207650_1000007747 | 225 |
| 329 | 3300025925 | Ga0207650_10000357 | Ga0207650_1000035712 | 225 |
| 330 | 3300025931 | Ga0207644_10006600 | Ga0207644_100066002 | 225 |
| 331 | 3300025933 | Ga0207706_10005849 | Ga0207706_100058499 | 225 |
| 332 | 3300025934 | Ga0207686_10005334 | Ga0207686_100053342 | 225 |
| 333 | 3300025935 | Ga0207709_10000011 | Ga0207709_1000001154 | 225 |
| 334 | 3300025941 | Ga0207711_10121834 | Ga0207711_101218342 | 225 |
| 335 | 3300025941 | Ga0207711_10386083 | Ga0207711_103860832 | 225 |
| 336 | 3300025945 | Ga0207679_10000034 | Ga0207679_10000034121 | 225 |
| 337 | 3300025972 | Ga0207668_10001920 | Ga0207668_1000192011 | 225 |
| 338 | 3300025981 | Ga0207640_10072973 | Ga0207640_100729733 | 225 |
| 339 | 3300025986 | Ga0207658_10000656 | Ga0207658_1000065621 | 225 |
| 340 | 3300026041 | Ga0207639_10014840 | Ga0207639_100148406 | 225 |
| 341 | 3300027111 | Ga0209281_1001747 | Ga0209281_10017473 | 225 |
| 342 | 3300027111 | Ga0209281_1003329 | Ga0209281_10033294 | 225 |
| 343 | 3300027312 | Ga0209371_1000056 | Ga0209371_100005681 | 225 |
| 344 | 3300027312 | Ga0209371_1001494 | Ga0209371_10014946 | 225 |
| 345 | 3300028379 | Ga0268266_10358201 | Ga0268266_103582012 | 225 |
| 346 | 3300028380 | Ga0268265_10404609 | Ga0268265_104046092 | 225 |
| 347 | 3300028786 | Ga0307517_10060915 | Ga0307517_100609152 | 225 |
| 348 | 3300028786 | Ga0307517_10131655 | Ga0307517_101316552 | 225 |
| 349 | 3300028794 | Ga0307515_10083315 | Ga0307515_100833152 | 225 |
| 350 | 3300030500 | Ga0268256_1000003 | Ga0268256_1000003491 | 225 |
| 351 | 3300030500 | Ga0268256_1002134 | Ga0268256_10021342 | 225 |
| 352 | 3300030735 | Ga0316178_1017657 | Ga0316178_10176578 | 225 |
| 353 | 3300030745 | Ga0316182_1222951 | Ga0316182_12229512 | 225 |
| 354 | 3300031251 | Ga0265327_10136074 | Ga0265327_101360742 | 225 |
| 355 | 3300031456 | Ga0307513_10117282 | Ga0307513_101172823 | 225 |
| 356 | 3300031548 | Ga0307408_100000018 | Ga0307408_100000018320 | 225 |
| 357 | 3300031548 | Ga0307408_100017613 | Ga0307408_1000176134 | 225 |
| 358 | 3300031548 | Ga0307408_100036436 | Ga0307408_1000364361 | 225 |
| 359 | 3300031730 | Ga0307516_10201429 | Ga0307516_102014291 | 225 |
| 360 | 3300031731 | Ga0307405_10000340 | Ga0307405_1000034010 | 225 |
| 361 | 3300031731 | Ga0307405_10550548 | Ga0307405_105505481 | 225 |
| 362 | 3300031911 | Ga0307412_10405197 | Ga0307412_104051971 | 225 |
| 363 | 3300031995 | Ga0307409_100191945 | Ga0307409_1001919452 | 225 |
| 364 | 3300032004 | Ga0307414_10371417 | Ga0307414_103714171 | 225 |
| 365 | 3300032004 | Ga0307414_10594727 | Ga0307414_105947271 | 225 |
| 366 | 3300032005 | Ga0307411_10030929 | Ga0307411_100309293 | 225 |
| 367 | 3300033180 | Ga0307510_10000324 | Ga0307510_1000032414 | 225 |
| 368 | 3300034818 | Ga0373950_0013087 | Ga0373950_0013087_81_761 | 225 |
| 369 | 3300034820 | Ga0373959_0001896 | Ga0373959_0001896_1882_2562 | 225 |
| 370 | 3300035088 | Ga0373940_0028158 | Ga0373940_0028158_262_942 | 225 |
| 371 | 3300035091 | Ga0373951_0016233 | Ga0373951_0016233_462_1142 | 225 |
| 372 | 3300035114 | Ga0373939_0000105 | Ga0373939_0000105_8437_9117 | 225 |
| 373 | 3300035121 | Ga0373960_0000729 | Ga0373960_0000729_1247_1927 | 225 |
| 374 | 3300035398 | Ga0316574_0176362 | Ga0316574_0176362_638_1315 | 225 |
| 375 | 3300035691 | Ga0373931_0047621 | Ga0373931_0047621_40_720 | 225 |
| 376 | 3300038705 | Ga0237819_03077 | Ga0237819_03077_1712_2389 | 225 |
| 377 | 3300041405 | Ga0439438_000441 | Ga0439438_000441_4757_5434 | 225 |
| 378 | 3300041405 | Ga0439438_000790 | Ga0439438_000790_167_844 | 225 |
| 379 | 3300041405 | Ga0439438_003039 | Ga0439438_003039_1228_1908 | 225 |
| 380 | 3300041407 | Ga0439447_009204 | Ga0439447_009204_790_1470 | 225 |
| 381 | 3300041407 | Ga0439447_052524 | Ga0439447_052524_213_890 | 225 |
| 382 | 3300041411 | Ga0439466_0018988 | Ga0439466_0018988_977_1654 | 225 |
| 383 | 3300042004 | Ga0439445_0056506 | Ga0439445_0056506_272_949 | 225 |
| 384 | 3300042006 | Ga0439432_000324 | Ga0439432_000324_9229_9906 | 225 |
| 385 | 3300042006 | Ga0439432_033735 | Ga0439432_033735_749_1426 | 225 |
| 386 | 3300042007 | Ga0439449_0030067 | Ga0439449_0030067_827_1504 | 225 |
| 387 | 3300042010 | Ga0439452_000024 | Ga0439452_000024_104945_105622 | 225 |
| 388 | 3300042010 | Ga0439452_000029 | Ga0439452_000029_179061_179741 | 225 |
| 389 | 3300042010 | Ga0439452_025785 | Ga0439452_025785_253_930 | 225 |
| 390 | 3300042013 | Ga0439456_002852 | Ga0439456_002852_1342_2019 | 225 |
| 391 | 3300042016 | Ga0439463_006748 | Ga0439463_006748_1205_1882 | 225 |
| 392 | 3300042115 | Ga0450911_000030 | Ga0450911_000030_48894_49571 | 225 |
| 393 | 3300042131 | Ga0450894_002755 | Ga0450894_002755_349_1026 | 225 |
| 394 | 3300042134 | Ga0450898_002908 | Ga0450898_002908_857_1534 | 225 |
| 395 | 3300042139 | Ga0450904_001668 | Ga0450904_001668_1380_2057 | 225 |
| 396 | 3300042145 | Ga0450906_000016 | Ga0450906_000016_24767_25444 | 225 |
| 397 | 3300042439 | Ga0439464_0002834 | Ga0439464_0002834_2400_3077 | 225 |
| 398 | 3300045976 | Ga0466967_0004162 | Ga0466967_0004162_4834_5514 | 225 |
| 399 | 3300046452 | Ga0495617_000026 | Ga0495617_000026_15100_15780 | 225 |
| 400 | 3300046452 | Ga0495617_003345 | Ga0495617_003345_2575_3252 | 225 |
| 401 | 3300046452 | Ga0495617_003358 | Ga0495617_003358_17_694 | 225 |
| 402 | 3300046452 | Ga0495617_005955 | Ga0495617_005955_2804_3481 | 225 |
| 403 | 3300046452 | Ga0495617_012833 | Ga0495617_012833_560_1237 | 225 |
| 404 | 3300046452 | Ga0495617_029468 | Ga0495617_029468_176_853 | 225 |
| 405 | 3300046452 | Ga0495617_086270 | Ga0495617_086270_22_699 | 225 |
| 406 | 3300046453 | Ga0495627_000083 | Ga0495627_000083_14052_14729 | 225 |
| 407 | 3300046453 | Ga0495627_000101 | Ga0495627_000101_35453_36130 | 225 |
| 408 | 3300046453 | Ga0495627_000133 | Ga0495627_000133_76365_77132 | 225 |
| 409 | 3300046453 | Ga0495627_000371 | Ga0495627_000371_18473_19150 | 225 |
| 410 | 3300046453 | Ga0495627_001842 | Ga0495627_001842_868_1548 | 225 |
| 411 | 3300046453 | Ga0495627_002851 | Ga0495627_002851_65_742 | 225 |
| 412 | 3300046457 | Ga0495590_0009296 | Ga0495590_0009296_149_826 | 225 |
| 413 | 3300046457 | Ga0495590_0029738 | Ga0495590_0029738_1089_1766 | 225 |
| 414 | 3300046457 | Ga0495590_0052974 | Ga0495590_0052974_109_786 | 225 |
| 415 | 3300046458 | Ga0495591_000037 | Ga0495591_000037_102306_102983 | 225 |
| 416 | 3300046458 | Ga0495591_000082 | Ga0495591_000082_21844_22611 | 225 |
| 417 | 3300046458 | Ga0495591_000120 | Ga0495591_000120_74157_74834 | 225 |
| 418 | 3300046458 | Ga0495591_000358 | Ga0495591_000358_18463_19140 | 225 |
| 419 | 3300046458 | Ga0495591_001584 | Ga0495591_001584_4133_4810 | 225 |
| 420 | 3300046458 | Ga0495591_001966 | Ga0495591_001966_5302_5979 | 225 |
| 421 | 3300046458 | Ga0495591_008363 | Ga0495591_008363_3398_4075 | 225 |
| 422 | 3300046458 | Ga0495591_023667 | Ga0495591_023667_1136_1813 | 225 |
| 423 | 3300046458 | Ga0495591_045496 | Ga0495591_045496_113_790 | 225 |
| 424 | 3300046459 | Ga0495629_0000928 | Ga0495629_0000928_9826_10509 | 225 |
| 425 | 3300046460 | Ga0495638_0001204 | Ga0495638_0001204_16522_17199 | 225 |
| 426 | 3300046460 | Ga0495638_0298373 | Ga0495638_0298373_82_762 | 225 |
| 427 | 3300046462 | Ga0495651_0004310 | Ga0495651_0004310_5815_6492 | 225 |
| 428 | 3300046463 | Ga0495653_0000875 | Ga0495653_0000875_9789_10472 | 225 |
| 429 | 3300046463 | Ga0495653_0019451 | Ga0495653_0019451_2133_2810 | 225 |
| 430 | 3300046471 | Ga0495650_0007800 | Ga0495650_0007800_4505_5182 | 225 |
| 431 | 3300046471 | Ga0495650_0009649 | Ga0495650_0009649_393_1073 | 225 |
| 432 | 3300046472 | Ga0495580_0095101 | Ga0495580_0095101_403_1086 | 225 |
| 433 | 3300046473 | Ga0495582_0166441 | Ga0495582_0166441_268_951 | 225 |
| 434 | 3300046474 | Ga0495605_0000147 | Ga0495605_0000147_2908_3675 | 225 |
| 435 | 3300046474 | Ga0495605_0003156 | Ga0495605_0003156_504_1184 | 225 |
| 436 | 3300046474 | Ga0495605_0003158 | Ga0495605_0003158_1415_2092 | 225 |
| 437 | 3300046474 | Ga0495605_0005186 | Ga0495605_0005186_3772_4449 | 225 |
| 438 | 3300046474 | Ga0495605_0051103 | Ga0495605_0051103_940_1617 | 225 |
| 439 | 3300046491 | Ga0495584_0001704 | Ga0495584_0001704_1148_1825 | 225 |
| 440 | 3300046491 | Ga0495584_0041941 | Ga0495584_0041941_1156_1851 | 225 |
| 441 | 3300046491 | Ga0495584_0072755 | Ga0495584_0072755_839_1516 | 225 |
| 442 | 3300046492 | Ga0495585_0000234 | Ga0495585_0000234_5772_6449 | 225 |
| 443 | 3300046492 | Ga0495585_0000272 | Ga0495585_0000272_45906_46583 | 225 |
| 444 | 3300046492 | Ga0495585_0000897 | Ga0495585_0000897_15635_16312 | 225 |
| 445 | 3300046492 | Ga0495585_0003956 | Ga0495585_0003956_1945_2622 | 225 |
| 446 | 3300046492 | Ga0495585_0008632 | Ga0495585_0008632_4690_5457 | 225 |
| 447 | 3300046492 | Ga0495585_0011868 | Ga0495585_0011868_358_1038 | 225 |
| 448 | 3300046499 | Ga0495594_0144283 | Ga0495594_0144283_532_1209 | 225 |
| 449 | 3300046500 | Ga0495596_0004877 | Ga0495596_0004877_810_1487 | 225 |
| 450 | 3300046500 | Ga0495596_0009074 | Ga0495596_0009074_3327_4007 | 225 |
| 451 | 3300046500 | Ga0495596_0014050 | Ga0495596_0014050_64_741 | 225 |
| 452 | 3300046500 | Ga0495596_0023356 | Ga0495596_0023356_280_957 | 225 |
| 453 | 3300046501 | Ga0495607_0000209 | Ga0495607_0000209_15676_16353 | 225 |
| 454 | 3300046501 | Ga0495607_0000596 | Ga0495607_0000596_6183_6860 | 225 |
| 455 | 3300046501 | Ga0495607_0004369 | Ga0495607_0004369_504_1184 | 225 |
| 456 | 3300046501 | Ga0495607_0019160 | Ga0495607_0019160_2925_3692 | 225 |
| 457 | 3300046501 | Ga0495607_0020451 | Ga0495607_0020451_3422_4099 | 225 |
| 458 | 3300046501 | Ga0495607_0023373 | Ga0495607_0023373_2775_3452 | 225 |
| 459 | 3300046501 | Ga0495607_0080689 | Ga0495607_0080689_1026_1703 | 225 |
| 460 | 3300046501 | Ga0495607_0147517 | Ga0495607_0147517_390_1067 | 225 |
| 461 | 3300046501 | Ga0495607_0183965 | Ga0495607_0183965_302_997 | 225 |
| 462 | 3300046506 | Ga0495583_0000477 | Ga0495583_0000477_3920_4597 | 225 |
| 463 | 3300046506 | Ga0495583_0006074 | Ga0495583_0006074_265_942 | 225 |
| 464 | 3300046506 | Ga0495583_0151118 | Ga0495583_0151118_58_738 | 225 |
| 465 | 3300046507 | Ga0495606_0000339 | Ga0495606_0000339_44424_45101 | 225 |
| 466 | 3300046507 | Ga0495606_0001660 | Ga0495606_0001660_24323_25000 | 225 |
| 467 | 3300046507 | Ga0495606_0003705 | Ga0495606_0003705_4045_4722 | 225 |
| 468 | 3300046507 | Ga0495606_0008227 | Ga0495606_0008227_151_828 | 225 |
| 469 | 3300046507 | Ga0495606_0009414 | Ga0495606_0009414_1334_2011 | 225 |
| 470 | 3300046507 | Ga0495606_0024052 | Ga0495606_0024052_2840_3517 | 225 |
| 471 | 3300046507 | Ga0495606_0078394 | Ga0495606_0078394_738_1415 | 225 |
| 472 | 3300046511 | Ga0495608_0013634 | Ga0495608_0013634_1553_2230 | 225 |
| 473 | 3300046512 | Ga0495610_0000133 | Ga0495610_0000133_73014_73691 | 225 |
| 474 | 3300046512 | Ga0495610_0000173 | Ga0495610_0000173_59497_60174 | 225 |
| 475 | 3300046512 | Ga0495610_0022878 | Ga0495610_0022878_706_1383 | 225 |
| 476 | 3300046513 | Ga0495616_0000041 | Ga0495616_0000041_99076_99843 | 225 |
| 477 | 3300046513 | Ga0495616_0000166 | Ga0495616_0000166_7597_8274 | 225 |
| 478 | 3300046513 | Ga0495616_0000352 | Ga0495616_0000352_21437_22114 | 225 |
| 479 | 3300046513 | Ga0495616_0002057 | Ga0495616_0002057_12757_13434 | 225 |
| 480 | 3300046513 | Ga0495616_0004061 | Ga0495616_0004061_8400_9077 | 225 |
| 481 | 3300046514 | Ga0495618_0015325 | Ga0495618_0015325_1855_2532 | 225 |
| 482 | 3300046515 | Ga0495620_0000257 | Ga0495620_0000257_29794_30471 | 225 |
| 483 | 3300046515 | Ga0495620_0000785 | Ga0495620_0000785_11319_11996 | 225 |
| 484 | 3300046515 | Ga0495620_0004067 | Ga0495620_0004067_3138_3905 | 225 |
| 485 | 3300046515 | Ga0495620_0004298 | Ga0495620_0004298_86_763 | 225 |
| 486 | 3300046515 | Ga0495620_0038289 | Ga0495620_0038289_213_890 | 225 |
| 487 | 3300046515 | Ga0495620_0127822 | Ga0495620_0127822_158_835 | 225 |
| 488 | 3300046516 | Ga0495628_0004445 | Ga0495628_0004445_10814_11491 | 225 |
| 489 | 3300046516 | Ga0495628_0005405 | Ga0495628_0005405_10003_10686 | 225 |
| 490 | 3300046518 | Ga0495631_0000013 | Ga0495631_0000013_69561_70238 | 225 |
| 491 | 3300046518 | Ga0495631_0015016 | Ga0495631_0015016_1404_2099 | 225 |
| 492 | 3300046518 | Ga0495631_0022628 | Ga0495631_0022628_1849_2529 | 225 |
| 493 | 3300046518 | Ga0495631_0183372 | Ga0495631_0183372_20_697 | 225 |
| 494 | 3300046519 | Ga0495632_0000097 | Ga0495632_0000097_55721_56398 | 225 |
| 495 | 3300046519 | Ga0495632_0000794 | Ga0495632_0000794_9089_9766 | 225 |
| 496 | 3300046519 | Ga0495632_0003006 | Ga0495632_0003006_3612_4379 | 225 |
| 497 | 3300046519 | Ga0495632_0021519 | Ga0495632_0021519_1988_2665 | 225 |
| 498 | 3300046519 | Ga0495632_0039706 | Ga0495632_0039706_645_1322 | 225 |
| 499 | 3300046519 | Ga0495632_0050398 | Ga0495632_0050398_1033_1710 | 225 |
| 500 | 3300046519 | Ga0495632_0167679 | Ga0495632_0167679_117_794 | 225 |
| 501 | 3300046520 | Ga0495637_0000831 | Ga0495637_0000831_3019_3696 | 225 |
| 502 | 3300046520 | Ga0495637_0001392 | Ga0495637_0001392_21_698 | 225 |
| 503 | 3300046520 | Ga0495637_0002731 | Ga0495637_0002731_8910_9587 | 225 |
| 504 | 3300046520 | Ga0495637_0005671 | Ga0495637_0005671_5503_6180 | 225 |
| 505 | 3300046520 | Ga0495637_0043843 | Ga0495637_0043843_85_762 | 225 |
| 506 | 3300046522 | Ga0495643_0000625 | Ga0495643_0000625_30258_30935 | 225 |
| 507 | 3300046522 | Ga0495643_0002569 | Ga0495643_0002569_4629_5306 | 225 |
| 508 | 3300046522 | Ga0495643_0008701 | Ga0495643_0008701_2434_3111 | 225 |
| 509 | 3300046522 | Ga0495643_0081026 | Ga0495643_0081026_312_1007 | 225 |
| 510 | 3300046523 | Ga0495644_0023559 | Ga0495644_0023559_1490_2167 | 225 |
| 511 | 3300046523 | Ga0495644_0157913 | Ga0495644_0157913_180_857 | 225 |
| 512 | 3300046524 | Ga0495648_0000062 | Ga0495648_0000062_99559_100236 | 225 |
| 513 | 3300046524 | Ga0495648_0000172 | Ga0495648_0000172_53251_53928 | 225 |
| 514 | 3300046524 | Ga0495648_0000259 | Ga0495648_0000259_45867_46544 | 225 |
| 515 | 3300046524 | Ga0495648_0000408 | Ga0495648_0000408_10139_10816 | 225 |
| 516 | 3300046524 | Ga0495648_0002220 | Ga0495648_0002220_3891_4658 | 225 |
| 517 | 3300046524 | Ga0495648_0005676 | Ga0495648_0005676_504_1184 | 225 |
| 518 | 3300046524 | Ga0495648_0146175 | Ga0495648_0146175_549_1226 | 225 |
| 519 | 3300046525 | Ga0495663_0010799 | Ga0495663_0010799_23_700 | 225 |
| 520 | 3300046526 | Ga0495666_0073382 | Ga0495666_0073382_193_876 | 225 |
| 521 | 3300046528 | Ga0495642_0001946 | Ga0495642_0001946_7224_7904 | 225 |
| 522 | 3300046530 | Ga0495654_0000050 | Ga0495654_0000050_126769_127536 | 225 |
| 523 | 3300046530 | Ga0495654_0000106 | Ga0495654_0000106_68450_69127 | 225 |
| 524 | 3300046530 | Ga0495654_0000864 | Ga0495654_0000864_7777_8454 | 225 |
| 525 | 3300046530 | Ga0495654_0019273 | Ga0495654_0019273_2444_3121 | 225 |
| 526 | 3300046530 | Ga0495654_0072858 | Ga0495654_0072858_890_1567 | 225 |
| 527 | 3300046530 | Ga0495654_0077249 | Ga0495654_0077249_109_786 | 225 |
| 528 | 3300046530 | Ga0495654_0093052 | Ga0495654_0093052_49_726 | 225 |
| 529 | 3300046530 | Ga0495654_0169530 | Ga0495654_0169530_86_763 | 225 |
| 530 | 3300046530 | Ga0495654_0216729 | Ga0495654_0216729_51_728 | 225 |
| 531 | 3300046531 | Ga0495665_0008463 | Ga0495665_0008463_961_1644 | 225 |
| 532 | 3300046538 | Ga0495609_0000286 | Ga0495609_0000286_44998_45675 | 225 |
| 533 | 3300046538 | Ga0495609_0001870 | Ga0495609_0001870_11960_12637 | 225 |
| 534 | 3300046538 | Ga0495609_0043450 | Ga0495609_0043450_1020_1700 | 225 |
| 535 | 3300046538 | Ga0495609_0057663 | Ga0495609_0057663_821_1498 | 225 |
| 536 | 3300046542 | Ga0495597_0000101 | Ga0495597_0000101_71546_72223 | 225 |
| 537 | 3300046542 | Ga0495597_0000117 | Ga0495597_0000117_57239_57916 | 225 |
| 538 | 3300046542 | Ga0495597_0001419 | Ga0495597_0001419_16291_16971 | 225 |
| 539 | 3300046542 | Ga0495597_0002964 | Ga0495597_0002964_3155_3844 | 225 |
| 540 | 3300046543 | Ga0495645_0274103 | Ga0495645_0274103_234_911 | 225 |
| 541 | 3300046557 | Ga0495622_0000047 | Ga0495622_0000047_69392_70069 | 225 |
| 542 | 3300046557 | Ga0495622_0038878 | Ga0495622_0038878_639_1316 | 225 |
| 543 | 3300046558 | Ga0495633_0000564 | Ga0495633_0000564_14980_15657 | 225 |
| 544 | 3300046558 | Ga0495633_0083429 | Ga0495633_0083429_650_1330 | 225 |
| 545 | 3300046615 | Ga0495656_0169602 | Ga0495656_0169602_361_1038 | 225 |
| 546 | 3300046616 | Ga0495668_0000461 | Ga0495668_0000461_45961_46638 | 225 |
| 547 | 3300046616 | Ga0495668_0004483 | Ga0495668_0004483_504_1184 | 225 |
| 548 | 3300046616 | Ga0495668_0014143 | Ga0495668_0014143_1206_1883 | 225 |
| 549 | 3300046616 | Ga0495668_0046629 | Ga0495668_0046629_1000_1677 | 225 |
| 550 | 3300046616 | Ga0495668_0127975 | Ga0495668_0127975_668_1363 | 225 |
| 551 | 3300046648 | Ga0495611_0000024 | Ga0495611_0000024_45971_46648 | 225 |
| 552 | 3300046648 | Ga0495611_0002828 | Ga0495611_0002828_3101_3778 | 225 |
| 553 | 3300046648 | Ga0495611_0013715 | Ga0495611_0013715_339_1016 | 225 |
| 554 | 3300046648 | Ga0495611_0014015 | Ga0495611_0014015_2657_3337 | 225 |
| 555 | 3300046648 | Ga0495611_0052701 | Ga0495611_0052701_425_1102 | 225 |
| 556 | 3300046648 | Ga0495611_0061678 | Ga0495611_0061678_695_1390 | 225 |
| 557 | 3300046660 | Ga0495625_0000103 | Ga0495625_0000103_21884_22651 | 225 |
| 558 | 3300046660 | Ga0495625_0000861 | Ga0495625_0000861_38177_38854 | 225 |
| 559 | 3300046660 | Ga0495625_0071000 | Ga0495625_0071000_1324_2001 | 225 |
| 560 | 3300046660 | Ga0495625_0119653 | Ga0495625_0119653_638_1315 | 225 |
| 561 | 3300046665 | Ga0495661_0000376 | Ga0495661_0000376_18474_19151 | 225 |
| 562 | 3300046665 | Ga0495661_0000586 | Ga0495661_0000586_29450_30127 | 225 |
| 563 | 3300046665 | Ga0495661_0006158 | Ga0495661_0006158_556_1233 | 225 |
| 564 | 3300046665 | Ga0495661_0010237 | Ga0495661_0010237_3657_4334 | 225 |
| 565 | 3300046665 | Ga0495661_0011594 | Ga0495661_0011594_76_753 | 225 |
| 566 | 3300046665 | Ga0495661_0140677 | Ga0495661_0140677_475_1152 | 225 |
| 567 | 3300046674 | Ga0495588_0102852 | Ga0495588_0102852_153_830 | 225 |
| 568 | 3300046675 | Ga0495657_0227822 | Ga0495657_0227822_396_1073 | 225 |
| 569 | 3300046679 | Ga0495623_0006021 | Ga0495623_0006021_4878_5555 | 225 |
| 570 | 3300046680 | Ga0495646_0000811 | Ga0495646_0000811_13043_13726 | 225 |
| 571 | 3300046689 | Ga0495613_0003376 | Ga0495613_0003376_4294_4971 | 225 |
| 572 | 3300046689 | Ga0495613_0043596 | Ga0495613_0043596_2106_2789 | 225 |
| 573 | 3300046690 | Ga0495624_0000913 | Ga0495624_0000913_12860_13543 | 225 |
| 574 | 3300046690 | Ga0495624_0028970 | Ga0495624_0028970_2003_2680 | 225 |
| 575 | 3300046690 | Ga0495624_0059728 | Ga0495624_0059728_321_998 | 225 |
| 576 | 3300046691 | Ga0495670_0000020 | Ga0495670_0000020_69994_70671 | 225 |
| 577 | 3300046691 | Ga0495670_0055731 | Ga0495670_0055731_180_860 | 225 |
| 578 | 3300046692 | Ga0495671_0000950 | Ga0495671_0000950_13606_14373 | 225 |
| 579 | 3300046692 | Ga0495671_0002769 | Ga0495671_0002769_7038_7715 | 225 |
| 580 | 3300046692 | Ga0495671_0003268 | Ga0495671_0003268_8870_9550 | 225 |
| 581 | 3300046692 | Ga0495671_0003818 | Ga0495671_0003818_4732_5409 | 225 |
| 582 | 3300046692 | Ga0495671_0022905 | Ga0495671_0022905_2169_2846 | 225 |
| 583 | 3300046692 | Ga0495671_0154388 | Ga0495671_0154388_47_724 | 225 |
| 584 | 3300046692 | Ga0495671_0258273 | Ga0495671_0258273_88_765 | 225 |
| 585 | 3300046694 | Ga0495649_0000108 | Ga0495649_0000108_2993_3760 | 225 |
| 586 | 3300046694 | Ga0495649_0000894 | Ga0495649_0000894_8438_9115 | 225 |
| 587 | 3300046694 | Ga0495649_0011685 | Ga0495649_0011685_298_975 | 225 |
| 588 | 3300046694 | Ga0495649_0011847 | Ga0495649_0011847_4237_4914 | 225 |
| 589 | 3300046794 | Ga0495589_0000167 | Ga0495589_0000167_57062_57739 | 225 |
| 590 | 3300046794 | Ga0495589_0000500 | Ga0495589_0000500_18798_19475 | 225 |
| 591 | 3300046794 | Ga0495589_0010260 | Ga0495589_0010260_4068_4745 | 225 |
| 592 | 3300046794 | Ga0495589_0069412 | Ga0495589_0069412_673_1353 | 225 |
| 593 | 3300046794 | Ga0495589_0102961 | Ga0495589_0102961_639_1316 | 225 |
| 594 | 3300046810 | Ga0495660_0000136 | Ga0495660_0000136_5908_6585 | 225 |
| 595 | 3300046810 | Ga0495660_0000703 | Ga0495660_0000703_19899_20576 | 225 |
| 596 | 3300046810 | Ga0495660_0000798 | Ga0495660_0000798_7398_8075 | 225 |
| 597 | 3300046810 | Ga0495660_0003014 | Ga0495660_0003014_2859_3536 | 225 |
| 598 | 3300046810 | Ga0495660_0003488 | Ga0495660_0003488_7781_8458 | 225 |
| 599 | 3300046810 | Ga0495660_0003565 | Ga0495660_0003565_4116_4793 | 225 |
| 600 | 3300046810 | Ga0495660_0013569 | Ga0495660_0013569_1345_2112 | 225 |
| 601 | 3300046810 | Ga0495660_0018570 | Ga0495660_0018570_3056_3733 | 225 |
| 602 | 3300046810 | Ga0495660_0123155 | Ga0495660_0123155_446_1138 | 225 |
| 603 | 3300047319 | Ga0495674_0051344 | Ga0495674_0051344_442_1125 | 225 |
| 604 | 3300047320 | Ga0495672_0000022 | Ga0495672_0000022_233657_234442 | 225 |
| 605 | 3300047320 | Ga0495672_0008202 | Ga0495672_0008202_7023_7700 | 225 |
| 606 | 3300047320 | Ga0495672_0017163 | Ga0495672_0017163_1146_1823 | 225 |
| 607 | 3300047320 | Ga0495672_0047689 | Ga0495672_0047689_499_1176 | 225 |
| 608 | 3300047320 | Ga0495672_0070761 | Ga0495672_0070761_153_830 | 225 |
| 609 | 3300047321 | Ga0495676_0000058 | Ga0495676_0000058_19933_20610 | 225 |
| 610 | 3300047321 | Ga0495676_0153344 | Ga0495676_0153344_659_1342 | 225 |
| 611 | 3300047322 | Ga0495680_0001006 | Ga0495680_0001006_2534_3211 | 225 |
| 612 | 3300047323 | Ga0495683_0002241 | Ga0495683_0002241_7277_7954 | 225 |
| 613 | 3300047323 | Ga0495683_0002655 | Ga0495683_0002655_7211_7888 | 225 |
| 614 | 3300047323 | Ga0495683_0073096 | Ga0495683_0073096_701_1468 | 225 |
| 615 | 3300047445 | Ga0495677_0001377 | Ga0495677_0001377_8711_9391 | 225 |
| 616 | 3300047445 | Ga0495677_0186823 | Ga0495677_0186823_29_724 | 225 |
| 617 | 3300047446 | Ga0495679_000191 | Ga0495679_000191_11579_12256 | 225 |
| 618 | 3300047446 | Ga0495679_000440 | Ga0495679_000440_16292_17059 | 225 |
| 619 | 3300047446 | Ga0495679_000507 | Ga0495679_000507_18785_19462 | 225 |
| 620 | 3300047446 | Ga0495679_000569 | Ga0495679_000569_792_1469 | 225 |
| 621 | 3300047446 | Ga0495679_000945 | Ga0495679_000945_1108_1785 | 225 |
| 622 | 3300047469 | Ga0495673_0002300 | Ga0495673_0002300_3087_3854 | 225 |
| 623 | 3300047469 | Ga0495673_0003865 | Ga0495673_0003865_7719_8396 | 225 |
| 624 | 3300047469 | Ga0495673_0007062 | Ga0495673_0007062_957_1652 | 225 |
| 625 | 3300047469 | Ga0495673_0008300 | Ga0495673_0008300_1900_2577 | 225 |
| 626 | 3300047470 | Ga0495681_0002512 | Ga0495681_0002512_66_743 | 225 |
| 627 | 3300047470 | Ga0495681_0003605 | Ga0495681_0003605_9654_10334 | 225 |
| 628 | 3300047470 | Ga0495681_0004978 | Ga0495681_0004978_4408_5085 | 225 |
| 629 | 3300047470 | Ga0495681_0007877 | Ga0495681_0007877_5820_6497 | 225 |
| 630 | 3300047470 | Ga0495681_0029087 | Ga0495681_0029087_1440_2207 | 225 |
| 631 | 3300047470 | Ga0495681_0099862 | Ga0495681_0099862_195_875 | 225 |
| 632 | 3300047472 | Ga0495686_0000266 | Ga0495686_0000266_24887_25564 | 225 |
| 633 | 3300047472 | Ga0495686_0002582 | Ga0495686_0002582_12513_13190 | 225 |
| 634 | 3300048091 | Ga0495626_0000074 | Ga0495626_0000074_109901_110668 | 225 |
| 635 | 3300048091 | Ga0495626_0000972 | Ga0495626_0000972_3636_4313 | 225 |
| 636 | 3300048091 | Ga0495626_0001407 | Ga0495626_0001407_13487_14164 | 225 |
| 637 | 3300048091 | Ga0495626_0002709 | Ga0495626_0002709_10618_11295 | 225 |
| 638 | 3300048091 | Ga0495626_0118182 | Ga0495626_0118182_201_896 | 225 |
| 639 | 3300048903 | Ga0496100_0023094 | Ga0496100_0023094_102_779 | 225 |
| 640 | 3300048903 | Ga0496100_0060536 | Ga0496100_0060536_661_1341 | 225 |
| 641 | 3300048904 | Ga0496101_0001241 | Ga0496101_0001241_5784_6506 | 225 |
| 642 | 3300048904 | Ga0496101_0031094 | Ga0496101_0031094_1881_2561 | 225 |
| 643 | 3300048905 | Ga0496102_0002156 | Ga0496102_0002156_1936_2658 | 225 |
| 644 | 3300048905 | Ga0496102_0011646 | Ga0496102_0011646_6168_6848 | 225 |
| 645 | 3300048906 | Ga0496103_0000021 | Ga0496103_0000021_167093_167815 | 225 |
| 646 | 3300048907 | Ga0496104_0000715 | Ga0496104_0000715_9086_9808 | 225 |
| 647 | 3300048908 | Ga0496105_0000151 | Ga0496105_0000151_41362_42084 | 225 |
| 648 | 3300048909 | Ga0496106_0088103 | Ga0496106_0088103_210_887 | 225 |
| 649 | 3300048909 | Ga0496106_0181488 | Ga0496106_0181488_210_932 | 225 |
| 650 | 3300048910 | Ga0496107_0040363 | Ga0496107_0040363_722_1444 | 225 |
| 651 | 3300048915 | Ga0496112_0005821 | Ga0496112_0005821_9103_9825 | 225 |
| 652 | 3300048916 | Ga0496113_0000102 | Ga0496113_0000102_22145_22867 | 225 |
| 653 | 3300048918 | Ga0496115_0728392 | Ga0496115_0728392_38_760 | 225 |
| 654 | 3300048919 | Ga0496116_0000255 | Ga0496116_0000255_3730_4407 | 225 |
| 655 | 3300048919 | Ga0496116_0002015 | Ga0496116_0002015_3891_4568 | 225 |
| 656 | 3300048919 | Ga0496116_0004044 | Ga0496116_0004044_10714_11391 | 225 |
| 657 | 3300048919 | Ga0496116_0019846 | Ga0496116_0019846_4291_4968 | 225 |
| 658 | 3300048919 | Ga0496116_0054651 | Ga0496116_0054651_1427_2107 | 225 |
| 659 | 3300048919 | Ga0496116_0063758 | Ga0496116_0063758_851_1573 | 225 |
| 660 | 3300048919 | Ga0496116_0117351 | Ga0496116_0117351_423_1106 | 225 |
| 661 | 3300048919 | Ga0496116_0179898 | Ga0496116_0179898_305_982 | 225 |
| 662 | 3300048920 | Ga0496117_0000284 | Ga0496117_0000284_85052_85774 | 225 |
| 663 | 3300048920 | Ga0496117_0000475 | Ga0496117_0000475_3895_4572 | 225 |
| 664 | 3300048920 | Ga0496117_0000790 | Ga0496117_0000790_21001_21678 | 225 |
| 665 | 3300048920 | Ga0496117_0001907 | Ga0496117_0001907_16302_16982 | 225 |
| 666 | 3300048920 | Ga0496117_0014070 | Ga0496117_0014070_5464_6141 | 225 |
| 667 | 3300048920 | Ga0496117_0024319 | Ga0496117_0024319_966_1643 | 225 |
| 668 | 3300048920 | Ga0496117_0164130 | Ga0496117_0164130_102_782 | 225 |
| 669 | 3300048920 | Ga0496117_0168377 | Ga0496117_0168377_112_789 | 225 |
| 670 | 3300048920 | Ga0496117_0262348 | Ga0496117_0262348_102_782 | 225 |
| 671 | 3300048921 | Ga0496118_0000482 | Ga0496118_0000482_3959_4636 | 225 |
| 672 | 3300048921 | Ga0496118_0002095 | Ga0496118_0002095_9097_9777 | 225 |
| 673 | 3300048921 | Ga0496118_0019428 | Ga0496118_0019428_2731_3408 | 225 |
| 674 | 3300048921 | Ga0496118_0043806 | Ga0496118_0043806_698_1375 | 225 |
| 675 | 3300048921 | Ga0496118_0052116 | Ga0496118_0052116_2033_2710 | 225 |
| 676 | 3300048921 | Ga0496118_0077991 | Ga0496118_0077991_1408_2085 | 225 |
| 677 | 3300048921 | Ga0496118_0172050 | Ga0496118_0172050_552_1232 | 225 |
| 678 | 3300048922 | Ga0496119_0000056 | Ga0496119_0000056_149768_150448 | 225 |
| 679 | 3300048922 | Ga0496119_0000077 | Ga0496119_0000077_94259_94981 | 225 |
| 680 | 3300048922 | Ga0496119_0001020 | Ga0496119_0001020_29591_30271 | 225 |
| 681 | 3300048922 | Ga0496119_0003742 | Ga0496119_0003742_7645_8322 | 225 |
| 682 | 3300048922 | Ga0496119_0010114 | Ga0496119_0010114_1075_1752 | 225 |
| 683 | 3300048922 | Ga0496119_0054734 | Ga0496119_0054734_337_1014 | 225 |
| 684 | 3300048923 | Ga0496120_0000063 | Ga0496120_0000063_143567_144247 | 225 |
| 685 | 3300048923 | Ga0496120_0001205 | Ga0496120_0001205_3842_4564 | 225 |
| 686 | 3300048923 | Ga0496120_0006488 | Ga0496120_0006488_1114_1791 | 225 |
| 687 | 3300048923 | Ga0496120_0009589 | Ga0496120_0009589_1814_2491 | 225 |
| 688 | 3300048923 | Ga0496120_0017015 | Ga0496120_0017015_768_1448 | 225 |
| 689 | 3300048923 | Ga0496120_0088856 | Ga0496120_0088856_270_947 | 225 |
| 690 | 3300048924 | Ga0496121_0004669 | Ga0496121_0004669_2744_3466 | 225 |
| 691 | 3300048924 | Ga0496121_0008008 | Ga0496121_0008008_9125_9802 | 225 |
| 692 | 3300048924 | Ga0496121_0141185 | Ga0496121_0141185_255_932 | 225 |
| 693 | 3300048925 | Ga0496122_0002034 | Ga0496122_0002034_15196_15918 | 225 |
| 694 | 3300048925 | Ga0496122_0002380 | Ga0496122_0002380_4008_4685 | 225 |
| 695 | 3300048925 | Ga0496122_0002939 | Ga0496122_0002939_3240_3917 | 225 |
| 696 | 3300048925 | Ga0496122_0005020 | Ga0496122_0005020_4763_5446 | 225 |
| 697 | 3300048925 | Ga0496122_0005255 | Ga0496122_0005255_12101_12778 | 225 |
| 698 | 3300048925 | Ga0496122_0014836 | Ga0496122_0014836_2911_3588 | 225 |
| 699 | 3300048925 | Ga0496122_0024893 | Ga0496122_0024893_3286_3963 | 225 |
| 700 | 3300048925 | Ga0496122_0055580 | Ga0496122_0055580_956_1633 | 225 |
| 701 | 3300048925 | Ga0496122_0056498 | Ga0496122_0056498_1049_1726 | 225 |
| 702 | 3300048925 | Ga0496122_0171583 | Ga0496122_0171583_525_1205 | 225 |
| 703 | 3300048925 | Ga0496122_0187620 | Ga0496122_0187620_102_782 | 225 |
| 704 | 3300048926 | Ga0496123_0000666 | Ga0496123_0000666_36728_37405 | 225 |
| 705 | 3300048926 | Ga0496123_0000927 | Ga0496123_0000927_34159_34842 | 225 |
| 706 | 3300048926 | Ga0496123_0001027 | Ga0496123_0001027_39054_39731 | 225 |
| 707 | 3300048926 | Ga0496123_0001803 | Ga0496123_0001803_22857_23579 | 225 |
| 708 | 3300048926 | Ga0496123_0001897 | Ga0496123_0001897_26531_27208 | 225 |
| 709 | 3300048926 | Ga0496123_0007003 | Ga0496123_0007003_543_1223 | 225 |
| 710 | 3300048926 | Ga0496123_0008081 | Ga0496123_0008081_6357_7034 | 225 |
| 711 | 3300048926 | Ga0496123_0011923 | Ga0496123_0011923_266_943 | 225 |
| 712 | 3300048926 | Ga0496123_0053328 | Ga0496123_0053328_1092_1769 | 225 |
| 713 | 3300048926 | Ga0496123_0055730 | Ga0496123_0055730_1083_1760 | 225 |
| 714 | 3300048926 | Ga0496123_0075157 | Ga0496123_0075157_861_1538 | 225 |
| 715 | 3300048927 | Ga0496124_0000944 | Ga0496124_0000944_27094_27771 | 225 |
| 716 | 3300048927 | Ga0496124_0001415 | Ga0496124_0001415_20683_21363 | 225 |
| 717 | 3300048927 | Ga0496124_0001563 | Ga0496124_0001563_13856_14545 | 225 |
| 718 | 3300048927 | Ga0496124_0023165 | Ga0496124_0023165_2623_3300 | 225 |
| 719 | 3300048927 | Ga0496124_0033436 | Ga0496124_0033436_1210_1932 | 225 |
| 720 | 3300048927 | Ga0496124_0099493 | Ga0496124_0099493_469_1146 | 225 |
| 721 | 3300048927 | Ga0496124_0112846 | Ga0496124_0112846_212_889 | 225 |
| 722 | 3300048928 | Ga0496125_0000038 | Ga0496125_0000038_156875_157552 | 225 |
| 723 | 3300048928 | Ga0496125_0000414 | Ga0496125_0000414_42203_42880 | 225 |
| 724 | 3300048928 | Ga0496125_0001808 | Ga0496125_0001808_7857_8534 | 225 |
| 725 | 3300048928 | Ga0496125_0001993 | Ga0496125_0001993_21689_22411 | 225 |
| 726 | 3300048928 | Ga0496125_0003412 | Ga0496125_0003412_924_1601 | 225 |
| 727 | 3300048928 | Ga0496125_0003434 | Ga0496125_0003434_9496_10173 | 225 |
| 728 | 3300048928 | Ga0496125_0011396 | Ga0496125_0011396_1059_1736 | 225 |
| 729 | 3300048928 | Ga0496125_0013069 | Ga0496125_0013069_2456_3133 | 225 |
| 730 | 3300048928 | Ga0496125_0027722 | Ga0496125_0027722_3812_4489 | 225 |
| 731 | 3300048928 | Ga0496125_0071751 | Ga0496125_0071751_553_1230 | 225 |
| 732 | 3300048928 | Ga0496125_0144589 | Ga0496125_0144589_865_1545 | 225 |
| 733 | 3300048928 | Ga0496125_0299637 | Ga0496125_0299637_204_884 | 225 |
| 734 | 3300048928 | Ga0496125_0340039 | Ga0496125_0340039_20_697 | 225 |
| 735 | 3300048929 | Ga0496126_0000175 | Ga0496126_0000175_61194_61916 | 225 |
| 736 | 3300048929 | Ga0496126_0000817 | Ga0496126_0000817_5572_6249 | 225 |
| 737 | 3300048929 | Ga0496126_0007003 | Ga0496126_0007003_9591_10268 | 225 |
| 738 | 3300048929 | Ga0496126_0011789 | Ga0496126_0011789_2742_3419 | 225 |
| 739 | 3300048929 | Ga0496126_0045365 | Ga0496126_0045365_148_828 | 225 |
| 740 | 3300048929 | Ga0496126_0047834 | Ga0496126_0047834_1125_1802 | 225 |
| 741 | 3300049459 | Ga0495678_000359 | Ga0495678_000359_39544_40221 | 225 |
| 742 | 3300049459 | Ga0495678_001048 | Ga0495678_001048_13487_14254 | 225 |
| 743 | 3300049459 | Ga0495678_001784 | Ga0495678_001784_3188_3865 | 225 |
| 744 | 3300049459 | Ga0495678_002659 | Ga0495678_002659_1059_1736 | 225 |
| 745 | 3300049459 | Ga0495678_041350 | Ga0495678_041350_852_1529 | 225 |
| 746 | 3300049459 | Ga0495678_045203 | Ga0495678_045203_780_1547 | 225 |
| 747 | 3300049460 | Ga0495682_0000085 | Ga0495682_0000085_39259_39936 | 225 |
| 748 | 3300049460 | Ga0495682_0062703 | Ga0495682_0062703_275_952 | 225 |
| 749 | 3300049535 | Ga0501319_004774 | Ga0501319_004774_71_748 | 225 |
| 750 | 3300049673 | Ga0501240_003553 | Ga0501240_003553_870_1547 | 225 |
| 751 | 3300049758 | Ga0501241_000395 | Ga0501241_000395_7374_8051 | 225 |
| 752 | 3300049766 | Ga0501269_002059 | Ga0501269_002059_1838_2515 | 225 |
| 753 | 3300053098 | Ga0500650_0147984 | Ga0500650_0147984_383_1060 | 225 |
| 754 | 3300053111 | Ga0500572_000082 | Ga0500572_000082_18931_19608 | 225 |
| 755 | 3300053119 | Ga0500595_010171 | Ga0500595_010171_192_869 | 225 |
| 756 | 3300053126 | Ga0500621_014165 | Ga0500621_014165_1484_2161 | 225 |
| 757 | 3300053140 | Ga0500573_0001991 | Ga0500573_0001991_4971_5648 | 225 |
| 758 | 3300053145 | Ga0500586_008184 | Ga0500586_008184_155_832 | 225 |
| 759 | 3300053161 | Ga0500634_0000413 | Ga0500634_0000413_11105_11782 | 225 |
| 760 | iso_pu_bacteria | 3007614139 | 3007619260 | 225 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4p5p-assembly1.cif.gz_A | x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 | 0.9628 | 2 | 225 |
| 1u9c-assembly1.cif.gz_A | crystallographic structure of apc35852 | 0.9419 | 2 | 224 |
| 4qyx-assembly1.cif.gz_A | crystal structure of ydr533cp | 0.9353 | 2 | 225 |
| 1qvv-assembly1.cif.gz_D-2 | crystal structure of the s. cerevisiae ydr533c protein | 0.9345 | 1 | 224 |
| 1qvz-assembly1.cif.gz_B | crystal structure of the s. cerevisiae ydr533c protein | 0.9325 | 2 | 224 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4p5pA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9625 | 2 | 225 | 3.40.50.880 |
| af_Q54W12_1_221_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9623 | 1 | 220 | 3.40.50.880 |
| 4p5pA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9458 | 2 | 225 | 3.40.50.880 |
| af_Q54W12_1_221_3.40.50.880 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9454 | 1 | 220 | 3.40.50.880 |
| 1u9cA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain | 0.9401 | 2 | 224 | 3.40.50.880 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A455U1L9-F1-model_v4 | DJ-1/PfpI domain-containing protein | 1.002 | 136 | 225 |
GO:0005737
GO:0019172 GO:0019243 |
| AF-A0A377NFH9-F1-model_v4 | Chaperone protein HchA | 1.001 | 1 | 224 |
GO:0005737
GO:0019172 GO:0019243 |
| AF-A0A5B9FLA3-F1-model_v4 | Type 1 glutamine amidotransferase domain-containing protein | 1.001 | 1 | 223 |
GO:0005737
GO:0016740 GO:0019172 GO:0019243 |
| AF-Q5H3X0-F1-model_v4 | NonF-related protein | 1.001 | 1 | 223 |
GO:0005737
GO:0019172 GO:0019243 |
| AF-A0A349P5K1-F1-model_v4 | deleted | 1.001 | 95 | 225 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar