F479541

General Info

Members Datasets Scaffolds Average Seq Length
760 368 638 226

Family's Representative Sequence

Representative Sequence 3300035112|Ga0373932_0001806|Ga0373932_0001806_3489_4184
Length 231
Sequence MKILMVLTSHNQLGNTGRKTGFWLEEFAAPYFVFRDAGVELTLASPKGGQPPIDPKSDLPENQTPAMERFKQDQAAQQALAQTVRLADMRAEDFDAIFYPGGHGPMWDLADNADSIALIEAFYNSGKPVAAVCHAPAVLHRVTYMGAPIVKGKHVTGFANSEEEAVQLTNVVPFLVEDELKRLGGRYEKAPDWESFAVVDGRLITGQNPASSTAAAQELLKLLQLMQRKAA

Samples

Sample ID Description Type Environment
1 2511231023 Pseudomonas sp. GM80 Isolate Nodule
2 2511231031 Pseudomonas sp. GM16 Isolate Nodule
3 2547132181 Kosakonia sacchari SP1 Isolate Stem
4 2561511199 Enterobacter sp. R4-368 Isolate Nodule
5 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
6 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
7 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
8 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
9 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
10 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
11 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
12 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
13 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
14 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
15 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
16 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
17 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
18 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
19 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
20 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
21 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
22 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
23 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
24 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
25 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
26 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
27 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
28 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
29 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
30 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
31 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
32 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
33 2738541275 Novosphingobium sp. GV027 Isolate Unclassified
34 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
35 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
36 2738541301 Novosphingobium sp. GV079 Isolate Unclassified
37 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
38 2738541304 Novosphingobium sp. GV061 Isolate Unclassified
39 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
40 2738543022 Novosphingobium sp. GV055 Isolate Unclassified
41 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
42 2738543031 Pleomorphomonas sp. CF100 Isolate Unclassified
43 2738543033 Novosphingobium sp. GV064 Isolate Unclassified
44 2784132063 Pseudomonas sp. 424 Isolate Unclassified
45 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
46 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
47 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
48 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
49 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
50 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
51 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
52 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
53 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
54 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
55 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
56 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
57 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
58 2847085930 Erwinia persicina B64 Isolate Bulb
59 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
60 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
61 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
62 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
63 2857564685 Duganella sp. R-74599 Isolate Unclassified
64 2858950400 Achromobacter sp. K91 Isolate Unclassified
65 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
66 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
67 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
68 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
69 2904504865 Serratia marcescens 1822 Isolate Unclassified
70 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
71 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
72 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
73 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
74 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
75 2919476304 Duganella sp. 3397 Isolate Unclassified
76 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
77 2928100450 Novosphingobium sp. 1529 Isolate Rhizosphere
78 2928959182 Novosphingobium capsulatum 1057 Isolate Unclassified
79 2928972540 Brevundimonas sp. 1080 Isolate Rhizosphere
80 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
81 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
82 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
83 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
84 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
85 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
86 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
87 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
88 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
89 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
90 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
91 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
92 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
93 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
94 2977240413 Brevundimonas vesicularis SORGH_AS 431 Isolate Unclassified
95 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
96 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
97 2987605356 Stenotrophomonas sp. ATCM1_4 Isolate Unclassified
98 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
99 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
100 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
101 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
102 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
103 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
104 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
105 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
106 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
107 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
108 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
109 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
110 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
111 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
112 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
113 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
114 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
115 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
116 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
117 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
118 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
119 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
120 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
121 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
122 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
123 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
124 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
125 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
126 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
127 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
128 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
129 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
130 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
131 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
132 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
133 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
134 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
135 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
136 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
137 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
138 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
139 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
144 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
145 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
146 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
147 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
148 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
149 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
150 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
151 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
152 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
153 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
154 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
155 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
156 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
157 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
158 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
159 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
162 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
163 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
164 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
165 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
166 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
167 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
168 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
169 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
170 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
171 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
172 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
176 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
196 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
202 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
203 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
204 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
205 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
214 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
215 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
216 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
217 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
220 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
221 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
222 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
223 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
224 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
225 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
226 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
227 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
228 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
229 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
230 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
231 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
232 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
233 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
234 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
235 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
236 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
237 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
238 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
239 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
240 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
243 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
244 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
245 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
246 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
247 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
248 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
249 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
250 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
251 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
252 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
253 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
254 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
255 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
256 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
257 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
258 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
259 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
260 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
261 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
262 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
266 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
267 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
268 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
269 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
270 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
271 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
272 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
273 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
274 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
275 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
276 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
277 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
278 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
279 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
280 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
281 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
282 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
283 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
284 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
285 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
286 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
287 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
288 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
293 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
294 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
297 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
298 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
302 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
303 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
304 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
305 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
306 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
310 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
311 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
312 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
313 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
314 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
315 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
316 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
317 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
318 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
319 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
320 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
321 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
322 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
323 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
324 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
325 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
326 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
327 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
328 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
329 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
330 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
331 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
332 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
333 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
334 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
335 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
336 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
337 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
338 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
339 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
340 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
342 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
343 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
344 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
345 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
346 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
347 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
348 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
349 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
350 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
351 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
352 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
353 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
354 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
355 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
356 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
357 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
358 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
359 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
360 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
361 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
362 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
363 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
364 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
365 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
366 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
367 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
368 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.82
Metatranscriptomes 0.13
Isolates 16.05

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0.13
Endosphere 6.84
Nodule 1.05
Rhizoplane 3.95
Rhizosphere 67.76
Stem 0.13
Stem Tuber 0.13
Unclassified 19.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25162J39368_1000001 3300002737 Bacteria 740113
2 JGI25163J39215_1001830 3300002771 Bacteria 2850
3 JGI25164J39214_1005280 3300002772 Bacteria 1411
4 JGI25165J46597_1000001 3300003214 Bacteria 1111887
5 Ga0055538_1000001 3300003751 Bacteria 1111887
6 Ga0055539_1000001 3300003752 Bacteria 1111887
7 Ga0055539_1000191 3300003752 Bacteria 50617
8 Ga0055533_1000003 3300003756 Bacteria 1111887
9 Ga0055533_1000191 3300003756 Bacteria 50617
10 Ga0055532_1000194 3300003758 Bacteria 50617
11 Ga0055525_1000003 3300003759 Bacteria 962094
12 Ga0055525_1000258 3300003759 Bacteria 50617
13 Ga0055535_1010693 3300003761 Bacteria 1493
14 Ga0055530_10003277 3300003791 Bacteria 9410
15 Ga0055540_1000008 3300003792 Bacteria 309635
16 Ga0055531_10007799 3300003794 Bacteria 5765
17 Ga0055541_1000001 3300003841 Bacteria 1111887
18 Ga0055541_1000126 3300003841 Bacteria 50617
19 Ga0058692_1012382 3300003856 Bacteria 2020
20 Ga0065714_10152939 3300005288 Bacteria 1095
21 Ga0065712_10067789 3300005290 Bacteria 35017
22 Ga0065712_10067908 3300005290 Bacteria 21672
23 Ga0065712_10071132 3300005290 Bacteria 5462
24 Ga0070670_100000170 3300005331 Bacteria 58712
25 Ga0070670_100002253 3300005331 Bacteria 15862
26 Ga0070666_10035787 3300005335 Bacteria 3293
27 Ga0070668_100002253 3300005347 Bacteria 14202
28 Ga0070669_100000080 3300005353 Bacteria 92960
29 Ga0070669_100001044 3300005353 Bacteria 20236
30 Ga0070671_100008240 3300005355 Bacteria 8340
31 Ga0070667_100000444 3300005367 Bacteria 43036
32 Ga0070662_100002488 3300005457 Bacteria 11356
33 Ga0068853_100030774 3300005539 Bacteria 4535
34 Ga0070665_100242686 3300005548 Bacteria 1802
35 Ga0070665_100438837 3300005548 Bacteria 1315
36 Ga0070665_100613998 3300005548 Bacteria 1100
37 Ga0070664_100000996 3300005564 Bacteria 22200
38 Ga0070664_100094527 3300005564 Bacteria 2592
39 Ga0070664_100806361 3300005564 Bacteria 878
40 Ga0068854_100023606 3300005578 Bacteria 4203
41 Ga0068851_10000188 3300005834 Bacteria 30806
42 Ga0068862_100037700 3300005844 Bacteria 4097
43 Ga0075364_10020814 3300006051 Bacteria 4129
44 Ga0070712_100032616 3300006175 Bacteria 3518
45 Ga0079104_1003500 3300006946 Bacteria 7255
46 Ga0105251_10000032 3300009011 Bacteria 120825
47 Ga0105251_10001241 3300009011 Bacteria 22093
48 Ga0105251_10009128 3300009011 Bacteria 5897
49 Ga0105251_10009385 3300009011 Bacteria 5780
50 Ga0105251_10015206 3300009011 Bacteria 4217
51 Ga0105251_10081919 3300009011 Bacteria 1491
52 Ga0105244_10000602 3300009036 Bacteria 32010
53 Ga0105244_10000976 3300009036 Bacteria 24019
54 Ga0105244_10002117 3300009036 Bacteria 15258
55 Ga0105244_10002606 3300009036 Bacteria 13512
56 Ga0105244_10006696 3300009036 Bacteria 7417
57 Ga0105244_10012286 3300009036 Bacteria 5066
58 Ga0105250_10000001 3300009092 Bacteria 617357
59 Ga0105250_10000436 3300009092 Bacteria 30500
60 Ga0105250_10003333 3300009092 Bacteria 7642
61 Ga0105250_10009894 3300009092 Bacteria 4001
62 Ga0105250_10023997 3300009092 Bacteria 2458
63 Ga0105250_10040304 3300009092 Bacteria 1873
64 Ga0105250_10075737 3300009092 Bacteria 1361
65 Ga0105243_10000098 3300009148 Bacteria 99914
66 Ga0105243_10072120 3300009148 Bacteria 2794
67 Ga0105242_10008357 3300009176 Bacteria 7954
68 Ga0105248_10116580 3300009177 Bacteria 3012
69 Ga0105248_10253803 3300009177 Bacteria 1979
70 Ga0105237_10002317 3300009545 Bacteria 23663
71 Ga0105249_10029770 3300009553 Bacteria 4933
72 Ga0105246_10006218 3300011119 Bacteria 7289
73 Ga0105246_10025397 3300011119 Bacteria 3861
74 Ga0157345_1000004 3300012498 Bacteria 80365
75 Ga0157373_10000039 3300013100 Bacteria 117160
76 Ga0157373_10000472 3300013100 Bacteria 31894
77 Ga0157373_10003468 3300013100 Bacteria 11925
78 Ga0157373_10006500 3300013100 Bacteria 8721
79 Ga0157373_10013426 3300013100 Bacteria 6008
80 Ga0157373_10031912 3300013100 Bacteria 3793
81 Ga0157373_10043785 3300013100 Bacteria 3197
82 Ga0157371_10000064 3300013102 Bacteria 169056
83 Ga0157371_10056553 3300013102 Bacteria 2783
84 Ga0157371_10196289 3300013102 Bacteria 1446
85 Ga0157371_10199583 3300013102 Bacteria 1434
86 Ga0157370_10024106 3300013104 Bacteria 6031
87 Ga0157370_10029111 3300013104 Bacteria 5426
88 Ga0157370_10032098 3300013104 Bacteria 5131
89 Ga0157370_10058293 3300013104 Bacteria 3670
90 Ga0157369_10002223 3300013105 Bacteria 23363
91 Ga0157369_10003854 3300013105 Bacteria 17824
92 Ga0157369_10004302 3300013105 Bacteria 16817
93 Ga0157369_10007619 3300013105 Bacteria 12454
94 Ga0157369_10017064 3300013105 Bacteria 8157
95 Ga0157369_10018100 3300013105 Bacteria 7903
96 Ga0157369_10145343 3300013105 Bacteria 2507
97 Ga0157369_10201156 3300013105 Bacteria 2091
98 Ga0163162_10000067 3300013306 Bacteria 99435
99 Ga0163162_10010004 3300013306 Bacteria 9222
100 Ga0163162_10180491 3300013306 Bacteria 2237
101 Ga0157372_10008278 3300013307 Bacteria 11056
102 Ga0157372_10460778 3300013307 Bacteria 1482
103 Ga0157375_10000101 3300013308 Bacteria 87397
104 Ga0157375_10067982 3300013308 Bacteria 3562
105 Ga0157375_10094774 3300013308 Bacteria 3055
106 Ga0157375_10207364 3300013308 Bacteria 2117
107 Ga0182008_10000243 3300014497 Bacteria 42328
108 Ga0182008_10000445 3300014497 Bacteria 31422
109 Ga0182008_10038572 3300014497 Bacteria 2389
110 Ga0182008_10041082 3300014497 Bacteria 2307
111 Ga0182006_1005224 3300015261 Bacteria 6221
112 Ga0182006_1012598 3300015261 Bacteria 3698
113 Ga0182006_1045592 3300015261 Bacteria 1705
114 Ga0182007_10000418 3300015262 Bacteria 25999
115 Ga0182007_10012714 3300015262 Bacteria 3231
116 Ga0182007_10034839 3300015262 Bacteria 1698
117 Ga0163161_10000577 3300017792 Bacteria 29489
118 Ga0163161_10067644 3300017792 Bacteria 2609
119 Ga0163161_10078484 3300017792 Bacteria 2427
120 Ga0163161_10147089 3300017792 Bacteria 1788
121 Ga0163161_10159777 3300017792 Bacteria 1718
122 Ga0209435_105207 3300025206 Bacteria 1458
123 Ga0209760_100917 3300025207 Bacteria 3670
124 Ga0209784_100004 3300025224 Bacteria 1378156
125 Ga0209784_100161 3300025224 Bacteria 58895
126 Ga0209566_100004 3300025225 Bacteria 1531866
127 Ga0209566_100213 3300025225 Bacteria 58895
128 Ga0209674_100006 3300025226 Bacteria 1531866
129 Ga0209674_100208 3300025226 Bacteria 58895
130 Ga0209147_100021 3300025229 Bacteria 464719
131 Ga0209147_100249 3300025229 Bacteria 51703
132 Ga0209563_100009 3300025230 Bacteria 1378156
133 Ga0209563_100159 3300025230 Bacteria 58895
134 Ga0209563_101175 3300025230 Bacteria 7357
135 Ga0207427_100347 3300025231 Bacteria 29881
136 Ga0209437_100004 3300025233 Bacteria 1378156
137 Ga0209258_100438 3300025242 Bacteria 47519
138 Ga0209646_1000676 3300025246 Bacteria 12429
139 Ga0209677_100005 3300025253 Bacteria 1378156
140 Ga0209677_100163 3300025253 Bacteria 58895
141 Ga0209129_1000015 3300025258 Bacteria 487967
142 Ga0209233_1000005 3300025261 Bacteria 1531866
143 Ga0209675_1011653 3300025291 Bacteria 2899
144 Ga0209676_1000002 3300025292 Bacteria 1732948
145 Ga0209676_1000120 3300025292 Bacteria 200565
146 Ga0209050_1000006 3300025298 Bacteria 1359702
147 Ga0209051_1000001 3300025303 Bacteria 1732974
148 Ga0209257_1000029 3300025304 Bacteria 695617
149 Ga0207696_1000028 3300025711 Bacteria 400424
150 Ga0207696_1000297 3300025711 Bacteria 57833
151 Ga0207696_1003396 3300025711 Bacteria 7279
152 Ga0207696_1004507 3300025711 Bacteria 5991
153 Ga0207696_1005537 3300025711 Bacteria 5222
154 Ga0207696_1086665 3300025711 Bacteria 861
155 Ga0207655_1000022 3300025728 Bacteria 483933
156 Ga0207655_1000080 3300025728 Bacteria 214570
157 Ga0207655_1000335 3300025728 Bacteria 68481
158 Ga0207655_1000713 3300025728 Bacteria 38012
159 Ga0207655_1002903 3300025728 Bacteria 13211
160 Ga0207655_1012121 3300025728 Bacteria 5068
161 Ga0207655_1014224 3300025728 Bacteria 4512
162 Ga0207713_1000020 3300025735 Bacteria 359258
163 Ga0207713_1001431 3300025735 Bacteria 19090
164 Ga0207713_1002128 3300025735 Bacteria 14758
165 Ga0207713_1003149 3300025735 Bacteria 11436
166 Ga0207713_1003256 3300025735 Bacteria 11190
167 Ga0207713_1005501 3300025735 Bacteria 7903
168 Ga0207713_1032999 3300025735 Bacteria 2266
169 Ga0207671_10001843 3300025914 Bacteria 23655
170 Ga0207693_10032275 3300025915 Bacteria 4133
171 Ga0207657_10289587 3300025919 Bacteria 1299
172 Ga0207649_10000088 3300025920 Bacteria 77105
173 Ga0207681_10000049 3300025923 Bacteria 120296
174 Ga0207650_10000077 3300025925 Bacteria 132010
175 Ga0207650_10000357 3300025925 Bacteria 44045
176 Ga0207644_10006600 3300025931 Bacteria 7561
177 Ga0207706_10005849 3300025933 Bacteria 11438
178 Ga0207686_10005334 3300025934 Bacteria 6892
179 Ga0207709_10000011 3300025935 Bacteria 552881
180 Ga0207711_10121834 3300025941 Bacteria 2329
181 Ga0207711_10386083 3300025941 Bacteria 1300
182 Ga0207679_10000034 3300025945 Bacteria 147162
183 Ga0207668_10001920 3300025972 Bacteria 12170
184 Ga0207640_10072973 3300025981 Bacteria 2317
185 Ga0207658_10000656 3300025986 Bacteria 30188
186 Ga0207639_10014840 3300026041 Bacteria 5486
187 Ga0209281_1001747 3300027111 Bacteria 11135
188 Ga0209281_1003329 3300027111 Bacteria 5397
189 Ga0209371_1000056 3300027312 Bacteria 242255
190 Ga0209371_1001494 3300027312 Bacteria 15582
191 Ga0268266_10358201 3300028379 Bacteria 1372
192 Ga0268265_10404609 3300028380 Bacteria 1263
193 Ga0307517_10060915 3300028786 Bacteria 3581
194 Ga0307517_10131655 3300028786 Bacteria 1798
195 Ga0307515_10083315 3300028794 Bacteria 4124
196 Ga0268256_1000003 3300030500 Bacteria 1289401
197 Ga0268256_1002134 3300030500 Bacteria 10541
198 Ga0316178_1017657 3300030735 Bacteria 15507
199 Ga0316182_1222951 3300030745 Bacteria 1708
200 Ga0265327_10136074 3300031251 Bacteria 1152
201 Ga0307513_10117282 3300031456 Bacteria 2640
202 Ga0307408_100000018 3300031548 Bacteria 346872
203 Ga0307408_100017613 3300031548 Bacteria 4783
204 Ga0307408_100036436 3300031548 Bacteria 3458
205 Ga0307516_10201429 3300031730 Bacteria 1710
206 Ga0307405_10000340 3300031731 Bacteria 17412
207 Ga0307405_10550548 3300031731 Bacteria 933
208 Ga0307412_10405197 3300031911 Bacteria 1111
209 Ga0307409_100191945 3300031995 Bacteria 1819
210 Ga0307414_10371417 3300032004 Bacteria 1234
211 Ga0307414_10594727 3300032004 Bacteria 991
212 Ga0307411_10030929 3300032005 Bacteria 3287
213 Ga0307510_10000324 3300033180 Bacteria 44451
214 Ga0373950_0013087 3300034818 Bacteria 1379
215 Ga0373959_0001896 3300034820 Bacteria 3338
216 Ga0373928_0001402 3300035084 Bacteria 4703
217 Ga0373940_0028158 3300035088 Bacteria 1481
218 Ga0373951_0016233 3300035091 Bacteria 1679
219 Ga0373932_0001806 3300035112 Bacteria 5759
220 Ga0373939_0000105 3300035114 Bacteria 25682
221 Ga0373960_0000729 3300035121 Bacteria 6860
222 Ga0316574_0176362 3300035398 Bacteria 1376
223 Ga0373931_0047621 3300035691 Bacteria 2270
224 Ga0237819_03077 3300038705 Bacteria 3072
225 Ga0439438_000441 3300041405 Bacteria 18789
226 Ga0439438_000790 3300041405 Bacteria 14091
227 Ga0439438_003039 3300041405 Bacteria 6907
228 Ga0439447_009204 3300041407 Bacteria 3009
229 Ga0439447_052524 3300041407 Bacteria 970
230 Ga0439466_0018988 3300041411 Bacteria 2462
231 Ga0439445_0056506 3300042004 Bacteria 1067
232 Ga0439432_000028 3300042006 Bacteria 48652
233 Ga0439432_000324 3300042006 Bacteria 17319
234 Ga0439432_033735 3300042006 Bacteria 1646
235 Ga0439449_0030067 3300042007 Bacteria 2024
236 Ga0439452_000024 3300042010 Bacteria 230396
237 Ga0439452_000029 3300042010 Bacteria 197977
238 Ga0439452_025785 3300042010 Bacteria 1488
239 Ga0439456_002852 3300042013 Bacteria 3486
240 Ga0439463_006748 3300042016 Bacteria 2839
241 Ga0450911_000030 3300042115 Bacteria 75536
242 Ga0450894_002755 3300042131 Bacteria 2330
243 Ga0450898_002908 3300042134 Bacteria 2413
244 Ga0450904_001668 3300042139 Bacteria 2979
245 Ga0450906_000016 3300042145 Bacteria 32476
246 Ga0439464_0002834 3300042439 Bacteria 4309
247 Ga0451577_0233955 3300042876 Bacteria 1662
248 Ga0466967_0004162 3300045976 Bacteria 9681
249 Ga0495617_000026 3300046452 Bacteria 157675
250 Ga0495617_003345 3300046452 Bacteria 6058
251 Ga0495617_003358 3300046452 Bacteria 6042
252 Ga0495617_005955 3300046452 Bacteria 4302
253 Ga0495617_012833 3300046452 Bacteria 2856
254 Ga0495617_029468 3300046452 Bacteria 1845
255 Ga0495617_086270 3300046452 Bacteria 1026
256 Ga0495627_000083 3300046453 Bacteria 113227
257 Ga0495627_000101 3300046453 Bacteria 105414
258 Ga0495627_000133 3300046453 Bacteria 89977
259 Ga0495627_000371 3300046453 Bacteria 41727
260 Ga0495627_001842 3300046453 Bacteria 11261
261 Ga0495627_002851 3300046453 Bacteria 7984
262 Ga0495592_0138586 3300046454 Bacteria 1694
263 Ga0495590_0009296 3300046457 Bacteria 3727
264 Ga0495590_0029738 3300046457 Bacteria 1914
265 Ga0495590_0052974 3300046457 Bacteria 1417
266 Ga0495591_000037 3300046458 Bacteria 158323
267 Ga0495591_000082 3300046458 Bacteria 107579
268 Ga0495591_000120 3300046458 Bacteria 86214
269 Ga0495591_000358 3300046458 Bacteria 39879
270 Ga0495591_001584 3300046458 Bacteria 13797
271 Ga0495591_001966 3300046458 Bacteria 12009
272 Ga0495591_008363 3300046458 Bacteria 4247
273 Ga0495591_023667 3300046458 Bacteria 1962
274 Ga0495591_045496 3300046458 Bacteria 1223
275 Ga0495629_0000928 3300046459 Bacteria 23569
276 Ga0495638_0001204 3300046460 Bacteria 24721
277 Ga0495638_0298373 3300046460 Bacteria 869
278 Ga0495651_0004310 3300046462 Bacteria 10903
279 Ga0495653_0000875 3300046463 Bacteria 23233
280 Ga0495653_0019451 3300046463 Bacteria 5507
281 Ga0495653_0129853 3300046463 Bacteria 1785
282 Ga0495650_0005155 3300046471 Bacteria 8614
283 Ga0495650_0007800 3300046471 Bacteria 6365
284 Ga0495650_0009649 3300046471 Bacteria 5470
285 Ga0495580_0095101 3300046472 Bacteria 2072
286 Ga0495582_0166441 3300046473 Bacteria 1255
287 Ga0495605_0000147 3300046474 Bacteria 90988
288 Ga0495605_0003156 3300046474 Bacteria 9916
289 Ga0495605_0003158 3300046474 Bacteria 9910
290 Ga0495605_0005186 3300046474 Bacteria 7592
291 Ga0495605_0027271 3300046474 Bacteria 2960
292 Ga0495605_0051103 3300046474 Bacteria 2014
293 Ga0495584_0001704 3300046491 Bacteria 12887
294 Ga0495584_0041941 3300046491 Bacteria 2309
295 Ga0495584_0072755 3300046491 Bacteria 1727
296 Ga0495585_0000234 3300046492 Bacteria 57324
297 Ga0495585_0000272 3300046492 Bacteria 51707
298 Ga0495585_0000897 3300046492 Bacteria 25232
299 Ga0495585_0003956 3300046492 Bacteria 9783
300 Ga0495585_0008632 3300046492 Bacteria 6166
301 Ga0495585_0011868 3300046492 Bacteria 5146
302 Ga0495594_0144283 3300046499 Bacteria 1351
303 Ga0495596_0004877 3300046500 Bacteria 6437
304 Ga0495596_0009074 3300046500 Bacteria 4397
305 Ga0495596_0014050 3300046500 Bacteria 3377
306 Ga0495596_0023356 3300046500 Bacteria 2510
307 Ga0495607_0000209 3300046501 Bacteria 62350
308 Ga0495607_0000596 3300046501 Bacteria 35234
309 Ga0495607_0004369 3300046501 Bacteria 10415
310 Ga0495607_0019160 3300046501 Bacteria 4351
311 Ga0495607_0020451 3300046501 Bacteria 4184
312 Ga0495607_0023373 3300046501 Bacteria 3870
313 Ga0495607_0080689 3300046501 Bacteria 1788
314 Ga0495607_0147517 3300046501 Bacteria 1207
315 Ga0495607_0183965 3300046501 Bacteria 1046
316 Ga0495583_0000477 3300046506 Bacteria 58703
317 Ga0495583_0000818 3300046506 Bacteria 38087
318 Ga0495583_0006074 3300046506 Bacteria 7987
319 Ga0495583_0151118 3300046506 Bacteria 962
320 Ga0495606_0000339 3300046507 Bacteria 80460
321 Ga0495606_0001660 3300046507 Bacteria 28914
322 Ga0495606_0003705 3300046507 Bacteria 15962
323 Ga0495606_0008227 3300046507 Bacteria 9112
324 Ga0495606_0009414 3300046507 Bacteria 8270
325 Ga0495606_0024052 3300046507 Bacteria 4401
326 Ga0495606_0078394 3300046507 Bacteria 2060
327 Ga0495608_0009003 3300046511 Bacteria 6981
328 Ga0495608_0013634 3300046511 Bacteria 5638
329 Ga0495610_0000133 3300046512 Bacteria 82356
330 Ga0495610_0000173 3300046512 Bacteria 72402
331 Ga0495610_0002135 3300046512 Bacteria 16832
332 Ga0495610_0022878 3300046512 Bacteria 3407
333 Ga0495616_0000041 3300046513 Bacteria 122413
334 Ga0495616_0000166 3300046513 Bacteria 57340
335 Ga0495616_0000352 3300046513 Bacteria 36004
336 Ga0495616_0002057 3300046513 Bacteria 13519
337 Ga0495616_0004061 3300046513 Bacteria 9297
338 Ga0495618_0015325 3300046514 Bacteria 4678
339 Ga0495620_0000257 3300046515 Bacteria 39311
340 Ga0495620_0000785 3300046515 Bacteria 19455
341 Ga0495620_0004067 3300046515 Bacteria 8297
342 Ga0495620_0004298 3300046515 Bacteria 8055
343 Ga0495620_0038289 3300046515 Bacteria 2129
344 Ga0495620_0127822 3300046515 Bacteria 998
345 Ga0495628_0004445 3300046516 Bacteria 12438
346 Ga0495628_0005405 3300046516 Bacteria 11194
347 Ga0495628_0025539 3300046516 Bacteria 4825
348 Ga0495631_0000013 3300046518 Bacteria 109794
349 Ga0495631_0015016 3300046518 Bacteria 3722
350 Ga0495631_0022628 3300046518 Bacteria 2921
351 Ga0495631_0183372 3300046518 Bacteria 897
352 Ga0495632_0000051 3300046519 Bacteria 133522
353 Ga0495632_0000097 3300046519 Bacteria 88746
354 Ga0495632_0000794 3300046519 Bacteria 28049
355 Ga0495632_0003006 3300046519 Bacteria 12308
356 Ga0495632_0021519 3300046519 Bacteria 3474
357 Ga0495632_0039706 3300046519 Bacteria 2373
358 Ga0495632_0050398 3300046519 Bacteria 2053
359 Ga0495632_0167679 3300046519 Bacteria 1010
360 Ga0495637_0000831 3300046520 Bacteria 20399
361 Ga0495637_0001392 3300046520 Bacteria 14426
362 Ga0495637_0002731 3300046520 Bacteria 9607
363 Ga0495637_0005671 3300046520 Bacteria 6332
364 Ga0495637_0017389 3300046520 Bacteria 3351
365 Ga0495637_0043843 3300046520 Bacteria 1907
366 Ga0495643_0000625 3300046522 Bacteria 42011
367 Ga0495643_0002569 3300046522 Bacteria 14183
368 Ga0495643_0008701 3300046522 Bacteria 6403
369 Ga0495643_0081026 3300046522 Bacteria 1688
370 Ga0495644_0023559 3300046523 Bacteria 2343
371 Ga0495644_0157913 3300046523 Bacteria 869
372 Ga0495648_0000062 3300046524 Bacteria 150125
373 Ga0495648_0000172 3300046524 Bacteria 74485
374 Ga0495648_0000259 3300046524 Bacteria 59999
375 Ga0495648_0000408 3300046524 Bacteria 47397
376 Ga0495648_0002220 3300046524 Bacteria 18185
377 Ga0495648_0005676 3300046524 Bacteria 10325
378 Ga0495648_0146175 3300046524 Bacteria 1238
379 Ga0495663_0010799 3300046525 Bacteria 2541
380 Ga0495666_0073382 3300046526 Bacteria 1624
381 Ga0495642_0001946 3300046528 Bacteria 8707
382 Ga0495652_0162565 3300046529 Bacteria 1731
383 Ga0495654_0000050 3300046530 Bacteria 146814
384 Ga0495654_0000106 3300046530 Bacteria 94076
385 Ga0495654_0000864 3300046530 Bacteria 22846
386 Ga0495654_0003905 3300046530 Bacteria 9002
387 Ga0495654_0019273 3300046530 Bacteria 3570
388 Ga0495654_0072858 3300046530 Bacteria 1625
389 Ga0495654_0077249 3300046530 Bacteria 1567
390 Ga0495654_0093052 3300046530 Bacteria 1396
391 Ga0495654_0145194 3300046530 Bacteria 1054
392 Ga0495654_0169530 3300046530 Bacteria 952
393 Ga0495654_0216729 3300046530 Bacteria 811
394 Ga0495665_0008463 3300046531 Bacteria 5582
395 Ga0495609_0000286 3300046538 Bacteria 46726
396 Ga0495609_0001870 3300046538 Bacteria 13457
397 Ga0495609_0043450 3300046538 Bacteria 2018
398 Ga0495609_0057663 3300046538 Bacteria 1718
399 Ga0495597_0000101 3300046542 Bacteria 77799
400 Ga0495597_0000117 3300046542 Bacteria 71911
401 Ga0495597_0001419 3300046542 Bacteria 17283
402 Ga0495597_0002964 3300046542 Bacteria 10285
403 Ga0495645_0274103 3300046543 Bacteria 1112
404 Ga0495622_0000047 3300046557 Bacteria 109638
405 Ga0495622_0038878 3300046557 Bacteria 2215
406 Ga0495633_0000564 3300046558 Bacteria 36203
407 Ga0495633_0083429 3300046558 Bacteria 1487
408 Ga0495656_0169602 3300046615 Bacteria 1066
409 Ga0495668_0000461 3300046616 Bacteria 51894
410 Ga0495668_0004483 3300046616 Bacteria 9891
411 Ga0495668_0014143 3300046616 Bacteria 4689
412 Ga0495668_0046629 3300046616 Bacteria 2407
413 Ga0495668_0127975 3300046616 Bacteria 1390
414 Ga0495611_0000024 3300046648 Bacteria 118898
415 Ga0495611_0002828 3300046648 Bacteria 7761
416 Ga0495611_0013715 3300046648 Bacteria 3454
417 Ga0495611_0014015 3300046648 Bacteria 3420
418 Ga0495611_0052701 3300046648 Bacteria 1836
419 Ga0495611_0061678 3300046648 Bacteria 1704
420 Ga0495625_0000103 3300046660 Bacteria 136109
421 Ga0495625_0000861 3300046660 Bacteria 41279
422 Ga0495625_0071000 3300046660 Bacteria 2444
423 Ga0495625_0119653 3300046660 Bacteria 1793
424 Ga0495635_0206774 3300046663 Bacteria 1330
425 Ga0495661_0000376 3300046665 Bacteria 48234
426 Ga0495661_0000475 3300046665 Bacteria 42461
427 Ga0495661_0000586 3300046665 Bacteria 37643
428 Ga0495661_0006158 3300046665 Bacteria 8442
429 Ga0495661_0010237 3300046665 Bacteria 6408
430 Ga0495661_0011594 3300046665 Bacteria 5976
431 Ga0495661_0140677 3300046665 Bacteria 1313
432 Ga0495588_0102852 3300046674 Bacteria 1502
433 Ga0495657_0227822 3300046675 Bacteria 1128
434 Ga0495599_0040607 3300046678 Bacteria 2921
435 Ga0495623_0006021 3300046679 Bacteria 7888
436 Ga0495646_0000811 3300046680 Bacteria 17505
437 Ga0495646_0035106 3300046680 Bacteria 3111
438 Ga0495613_0003376 3300046689 Bacteria 11931
439 Ga0495613_0043596 3300046689 Bacteria 3319
440 Ga0495624_0000913 3300046690 Bacteria 23368
441 Ga0495624_0028970 3300046690 Bacteria 3614
442 Ga0495624_0059728 3300046690 Bacteria 2392
443 Ga0495670_0000020 3300046691 Bacteria 110171
444 Ga0495670_0055731 3300046691 Bacteria 1982
445 Ga0495671_0000950 3300046692 Bacteria 20380
446 Ga0495671_0002769 3300046692 Bacteria 10976
447 Ga0495671_0003268 3300046692 Bacteria 10053
448 Ga0495671_0003818 3300046692 Bacteria 9159
449 Ga0495671_0022905 3300046692 Bacteria 3266
450 Ga0495671_0154388 3300046692 Bacteria 1117
451 Ga0495671_0258273 3300046692 Bacteria 840
452 Ga0495649_0000108 3300046694 Bacteria 73708
453 Ga0495649_0000894 3300046694 Bacteria 23680
454 Ga0495649_0011685 3300046694 Bacteria 5139
455 Ga0495649_0011847 3300046694 Bacteria 5098
456 Ga0495649_0072362 3300046694 Bacteria 1848
457 Ga0495589_0000167 3300046794 Bacteria 59964
458 Ga0495589_0000500 3300046794 Bacteria 27714
459 Ga0495589_0010260 3300046794 Bacteria 4868
460 Ga0495589_0069412 3300046794 Bacteria 1723
461 Ga0495589_0102961 3300046794 Bacteria 1380
462 Ga0495600_0356482 3300046809 Bacteria 915
463 Ga0495660_0000136 3300046810 Bacteria 79750
464 Ga0495660_0000703 3300046810 Bacteria 25661
465 Ga0495660_0000798 3300046810 Bacteria 23611
466 Ga0495660_0001687 3300046810 Bacteria 14790
467 Ga0495660_0003014 3300046810 Bacteria 10508
468 Ga0495660_0003488 3300046810 Bacteria 9703
469 Ga0495660_0003565 3300046810 Bacteria 9599
470 Ga0495660_0013569 3300046810 Bacteria 4721
471 Ga0495660_0018570 3300046810 Bacteria 3998
472 Ga0495660_0123155 3300046810 Bacteria 1309
473 Ga0495604_0010000 3300047317 Bacteria 7510
474 Ga0495674_0051344 3300047319 Bacteria 3635
475 Ga0495672_0000022 3300047320 Bacteria 420632
476 Ga0495672_0008202 3300047320 Bacteria 7746
477 Ga0495672_0017163 3300047320 Bacteria 4847
478 Ga0495672_0047689 3300047320 Bacteria 2546
479 Ga0495672_0070761 3300047320 Bacteria 1975
480 Ga0495676_0000058 3300047321 Bacteria 86045
481 Ga0495676_0153344 3300047321 Bacteria 1637
482 Ga0495680_0001006 3300047322 Bacteria 31332
483 Ga0495683_0002241 3300047323 Bacteria 11822
484 Ga0495683_0002655 3300047323 Bacteria 10669
485 Ga0495683_0073096 3300047323 Bacteria 1682
486 Ga0495677_0001377 3300047445 Bacteria 9714
487 Ga0495677_0186823 3300047445 Bacteria 804
488 Ga0495679_000157 3300047446 Bacteria 61342
489 Ga0495679_000191 3300047446 Bacteria 54219
490 Ga0495679_000440 3300047446 Bacteria 30708
491 Ga0495679_000507 3300047446 Bacteria 27686
492 Ga0495679_000569 3300047446 Bacteria 25611
493 Ga0495679_000945 3300047446 Bacteria 18048
494 Ga0495673_0002300 3300047469 Bacteria 13669
495 Ga0495673_0003865 3300047469 Bacteria 9655
496 Ga0495673_0007062 3300047469 Bacteria 6513
497 Ga0495673_0008300 3300047469 Bacteria 5856
498 Ga0495681_0002512 3300047470 Bacteria 13070
499 Ga0495681_0003605 3300047470 Bacteria 10769
500 Ga0495681_0004978 3300047470 Bacteria 8961
501 Ga0495681_0007877 3300047470 Bacteria 6737
502 Ga0495681_0029087 3300047470 Bacteria 2833
503 Ga0495681_0099862 3300047470 Bacteria 1270
504 Ga0495686_0000266 3300047472 Bacteria 93781
505 Ga0495686_0002582 3300047472 Bacteria 16852
506 Ga0495626_0000074 3300048091 Bacteria 132552
507 Ga0495626_0000972 3300048091 Bacteria 24732
508 Ga0495626_0001407 3300048091 Bacteria 19231
509 Ga0495626_0002709 3300048091 Bacteria 11964
510 Ga0495626_0118182 3300048091 Bacteria 1142
511 Ga0496100_0023094 3300048903 Bacteria 3773
512 Ga0496100_0060536 3300048903 Bacteria 2492
513 Ga0496101_0001241 3300048904 Bacteria 15241
514 Ga0496101_0031094 3300048904 Bacteria 3750
515 Ga0496102_0002156 3300048905 Bacteria 16901
516 Ga0496102_0011646 3300048905 Bacteria 7590
517 Ga0496103_0000021 3300048906 Bacteria 229062
518 Ga0496104_0000715 3300048907 Bacteria 28541
519 Ga0496105_0000151 3300048908 Bacteria 45925
520 Ga0496106_0088103 3300048909 Bacteria 2392
521 Ga0496106_0181488 3300048909 Bacteria 1671
522 Ga0496107_0040363 3300048910 Bacteria 3350
523 Ga0496112_0005821 3300048915 Bacteria 10731
524 Ga0496113_0000102 3300048916 Bacteria 36206
525 Ga0496115_0728392 3300048918 Bacteria 777
526 Ga0496116_0000180 3300048919 Bacteria 126589
527 Ga0496116_0000255 3300048919 Bacteria 94048
528 Ga0496116_0002015 3300048919 Bacteria 21833
529 Ga0496116_0004044 3300048919 Bacteria 14193
530 Ga0496116_0019846 3300048919 Bacteria 5130
531 Ga0496116_0054651 3300048919 Bacteria 2628
532 Ga0496116_0063758 3300048919 Bacteria 2372
533 Ga0496116_0117351 3300048919 Bacteria 1549
534 Ga0496116_0179898 3300048919 Bacteria 1134
535 Ga0496117_0000284 3300048920 Bacteria 92675
536 Ga0496117_0000475 3300048920 Bacteria 66690
537 Ga0496117_0000790 3300048920 Bacteria 49640
538 Ga0496117_0001907 3300048920 Bacteria 27984
539 Ga0496117_0014070 3300048920 Bacteria 6920
540 Ga0496117_0024319 3300048920 Bacteria 4794
541 Ga0496117_0164130 3300048920 Bacteria 1297
542 Ga0496117_0168377 3300048920 Bacteria 1274
543 Ga0496117_0262348 3300048920 Bacteria 935
544 Ga0496118_0000482 3300048921 Bacteria 66218
545 Ga0496118_0002095 3300048921 Bacteria 28029
546 Ga0496118_0019428 3300048921 Bacteria 6072
547 Ga0496118_0043806 3300048921 Bacteria 3513
548 Ga0496118_0052116 3300048921 Bacteria 3124
549 Ga0496118_0077991 3300048921 Bacteria 2346
550 Ga0496118_0172050 3300048921 Bacteria 1321
551 Ga0496119_0000056 3300048922 Bacteria 174042
552 Ga0496119_0000077 3300048922 Bacteria 143108
553 Ga0496119_0001020 3300048922 Bacteria 35864
554 Ga0496119_0003742 3300048922 Bacteria 15562
555 Ga0496119_0010114 3300048922 Bacteria 7970
556 Ga0496119_0018013 3300048922 Bacteria 5280
557 Ga0496119_0054734 3300048922 Bacteria 2428
558 Ga0496120_0000046 3300048923 Bacteria 190675
559 Ga0496120_0000063 3300048923 Bacteria 170325
560 Ga0496120_0001205 3300048923 Bacteria 32763
561 Ga0496120_0006488 3300048923 Bacteria 8969
562 Ga0496120_0009589 3300048923 Bacteria 6845
563 Ga0496120_0017015 3300048923 Bacteria 4729
564 Ga0496120_0088856 3300048923 Bacteria 1655
565 Ga0496121_0004669 3300048924 Bacteria 18191
566 Ga0496121_0008008 3300048924 Bacteria 12613
567 Ga0496121_0141185 3300048924 Bacteria 1786
568 Ga0496122_0002034 3300048925 Bacteria 30017
569 Ga0496122_0002380 3300048925 Bacteria 26920
570 Ga0496122_0002939 3300048925 Bacteria 23250
571 Ga0496122_0005020 3300048925 Bacteria 16009
572 Ga0496122_0005255 3300048925 Bacteria 15519
573 Ga0496122_0014836 3300048925 Bacteria 7502
574 Ga0496122_0024893 3300048925 Bacteria 5223
575 Ga0496122_0055580 3300048925 Bacteria 2960
576 Ga0496122_0056498 3300048925 Bacteria 2925
577 Ga0496122_0171583 3300048925 Bacteria 1306
578 Ga0496122_0187620 3300048925 Bacteria 1224
579 Ga0496123_0000666 3300048926 Bacteria 56742
580 Ga0496123_0000927 3300048926 Bacteria 45829
581 Ga0496123_0001027 3300048926 Bacteria 42422
582 Ga0496123_0001803 3300048926 Bacteria 28188
583 Ga0496123_0001897 3300048926 Bacteria 27276
584 Ga0496123_0007003 3300048926 Bacteria 10752
585 Ga0496123_0008081 3300048926 Bacteria 9730
586 Ga0496123_0011923 3300048926 Bacteria 7466
587 Ga0496123_0053328 3300048926 Bacteria 2673
588 Ga0496123_0055730 3300048926 Bacteria 2590
589 Ga0496123_0075157 3300048926 Bacteria 2086
590 Ga0496124_0000944 3300048927 Bacteria 46593
591 Ga0496124_0001415 3300048927 Bacteria 35637
592 Ga0496124_0001563 3300048927 Bacteria 33097
593 Ga0496124_0023165 3300048927 Bacteria 5675
594 Ga0496124_0033436 3300048927 Bacteria 4523
595 Ga0496124_0036563 3300048927 Bacteria 4282
596 Ga0496124_0099493 3300048927 Bacteria 2358
597 Ga0496124_0112846 3300048927 Bacteria 2185
598 Ga0496125_0000038 3300048928 Bacteria 328120
599 Ga0496125_0000414 3300048928 Bacteria 79745
600 Ga0496125_0001808 3300048928 Bacteria 29539
601 Ga0496125_0001993 3300048928 Bacteria 27694
602 Ga0496125_0003412 3300048928 Bacteria 19318
603 Ga0496125_0003434 3300048928 Bacteria 19207
604 Ga0496125_0011396 3300048928 Bacteria 8896
605 Ga0496125_0013069 3300048928 Bacteria 8187
606 Ga0496125_0027722 3300048928 Bacteria 5127
607 Ga0496125_0071751 3300048928 Bacteria 2703
608 Ga0496125_0144589 3300048928 Bacteria 1646
609 Ga0496125_0299637 3300048928 Bacteria 985
610 Ga0496125_0340039 3300048928 Bacteria 901
611 Ga0496126_0000175 3300048929 Bacteria 146389
612 Ga0496126_0000817 3300048929 Bacteria 55573
613 Ga0496126_0006838 3300048929 Bacteria 12646
614 Ga0496126_0007003 3300048929 Bacteria 12454
615 Ga0496126_0011789 3300048929 Bacteria 8998
616 Ga0496126_0045365 3300048929 Bacteria 4040
617 Ga0496126_0047834 3300048929 Bacteria 3914
618 Ga0495678_000359 3300049459 Bacteria 46686
619 Ga0495678_001048 3300049459 Bacteria 23397
620 Ga0495678_001784 3300049459 Bacteria 15918
621 Ga0495678_002659 3300049459 Bacteria 11838
622 Ga0495678_041350 3300049459 Bacteria 1845
623 Ga0495678_045203 3300049459 Bacteria 1738
624 Ga0495682_0000085 3300049460 Bacteria 81879
625 Ga0495682_0062703 3300049460 Bacteria 1341
626 Ga0501319_004774 3300049535 Bacteria 952
627 Ga0501240_003553 3300049673 Bacteria 1749
628 Ga0501241_000395 3300049758 Bacteria 9570
629 Ga0501269_002059 3300049766 Bacteria 2529
630 Ga0495601_0019067 3300053077 Bacteria 4180
631 Ga0500650_0147984 3300053098 Bacteria 1087
632 Ga0500572_000082 3300053111 Bacteria 30125
633 Ga0500595_010171 3300053119 Bacteria 3750
634 Ga0500621_014165 3300053126 Bacteria 2897
635 Ga0500573_0001991 3300053140 Bacteria 10007
636 Ga0500586_008184 3300053145 Bacteria 2835
637 Ga0500619_000306 3300053154 Bacteria 9686
638 Ga0500634_0000413 3300053161 Bacteria 13802

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009092 Ga0105250_10040304 Ga0105250_100403042 210
2 3300025711 Ga0207696_1003396 Ga0207696_10033965 210
3 3300046474 Ga0495605_0027271 Ga0495605_0027271_1137_1832 214
4 iso_pu_bacteria 2561511199 2562464141 217
5 iso_pu_bacteria 2826581358 2826583109 217
6 iso_pu_bacteria 2826581358 2826584810 217
7 iso_pu_bacteria 2842815866 2842816365 217
8 iso_pu_bacteria 2842815866 2842818747 217
9 iso_pu_bacteria 2842843487 2842843506 217
10 iso_pu_bacteria 2852657418 2852657445 217
11 iso_pu_bacteria 2878029506 2878032127 217
12 iso_pu_bacteria 2880230671 2880233460 217
13 iso_pu_bacteria 2919063839 2919068776 217
14 iso_pu_bacteria 2931390751 2931393197 217
15 3300046530 Ga0495654_0145194 Ga0495654_0145194_334_1011 219
16 3300009092 Ga0105250_10000436 Ga0105250_1000043611 221
17 3300011119 Ga0105246_10006218 Ga0105246_100062187 221
18 3300042006 Ga0439432_000028 Ga0439432_000028_11194_11859 221
19 3300046454 Ga0495592_0138586 Ga0495592_0138586_195_860 221
20 3300046463 Ga0495653_0129853 Ga0495653_0129853_194_859 221
21 3300046471 Ga0495650_0005155 Ga0495650_0005155_1345_2013 221
22 3300046506 Ga0495583_0000818 Ga0495583_0000818_2027_2695 221
23 3300046511 Ga0495608_0009003 Ga0495608_0009003_3095_3760 221
24 3300046512 Ga0495610_0002135 Ga0495610_0002135_11934_12599 221
25 3300046516 Ga0495628_0025539 Ga0495628_0025539_331_996 221
26 3300046519 Ga0495632_0000051 Ga0495632_0000051_106569_107237 221
27 3300046520 Ga0495637_0017389 Ga0495637_0017389_255_923 221
28 3300046529 Ga0495652_0162565 Ga0495652_0162565_736_1401 221
29 3300046530 Ga0495654_0003905 Ga0495654_0003905_1835_2500 221
30 3300046663 Ga0495635_0206774 Ga0495635_0206774_528_1193 221
31 3300046665 Ga0495661_0000475 Ga0495661_0000475_26689_27357 221
32 3300046678 Ga0495599_0040607 Ga0495599_0040607_236_901 221
33 3300046680 Ga0495646_0035106 Ga0495646_0035106_210_875 221
34 3300046694 Ga0495649_0072362 Ga0495649_0072362_1051_1716 221
35 3300046809 Ga0495600_0356482 Ga0495600_0356482_200_865 221
36 3300046810 Ga0495660_0001687 Ga0495660_0001687_8646_9311 221
37 3300047317 Ga0495604_0010000 Ga0495604_0010000_4706_5371 221
38 3300047446 Ga0495679_000157 Ga0495679_000157_48674_49339 221
39 3300048919 Ga0496116_0000180 Ga0496116_0000180_101986_102654 221
40 3300048922 Ga0496119_0018013 Ga0496119_0018013_779_1447 221
41 3300048923 Ga0496120_0000046 Ga0496120_0000046_166006_166674 221
42 3300048927 Ga0496124_0036563 Ga0496124_0036563_2661_3326 221
43 3300053077 Ga0495601_0019067 Ga0495601_0019067_196_861 221
44 3300053154 Ga0500619_000306 Ga0500619_000306_5573_6238 221
45 iso_pu_bacteria 2511231023 2511368975 221
46 iso_pu_bacteria 2511231023 2511368984 221
47 iso_pu_bacteria 2511231031 2511414480 221
48 iso_pu_bacteria 2547132181 2547698000 221
49 iso_pu_bacteria 2597489888 2597863466 221
50 iso_pu_bacteria 2597489889 2597870563 221
51 iso_pu_bacteria 2599185167 2599399402 221
52 iso_pu_bacteria 2599185179 2599454182 221
53 iso_pu_bacteria 2599185189 2599510483 221
54 iso_pu_bacteria 2599185190 2599513892 221
55 iso_pu_bacteria 2599185191 2599519073 221
56 iso_pu_bacteria 2599185239 2599739119 221
57 iso_pu_bacteria 2599185288 2599883919 221
58 iso_pu_bacteria 2599185290 2599892949 221
59 iso_pu_bacteria 2599185303 2599951143 221
60 iso_pu_bacteria 2600254954 2600446600 221
61 iso_pu_bacteria 2600255296 2601689184 221
62 iso_pu_bacteria 2600255318 2601799237 221
63 iso_pu_bacteria 2600255389 2602010955 221
64 iso_pu_bacteria 2603880185 2606078533 221
65 iso_pu_bacteria 2603880199 2606130641 221
66 iso_pu_bacteria 2619619299 2621299119 221
67 iso_pu_bacteria 2623620443 2624480215 221
68 iso_pu_bacteria 2643221571 2643871717 221
69 iso_pu_bacteria 2643221713 2644620786 221
70 iso_pu_bacteria 2675903420 2677899231 221
71 iso_pu_bacteria 2706794495 2707098879 221
72 iso_pu_bacteria 2713897148 2715753132 221
73 iso_pu_bacteria 2713897149 2715758547 221
74 iso_pu_bacteria 2718217725 2718634519 221
75 iso_pu_bacteria 2721755607 2723248272 221
76 iso_pu_bacteria 2738541265 2738672276 221
77 iso_pu_bacteria 2738541275 2738711071 221
78 iso_pu_bacteria 2738541282 2738750669 221
79 iso_pu_bacteria 2738541294 2738812311 221
80 iso_pu_bacteria 2738541301 2738849496 221
81 iso_pu_bacteria 2738541303 2738859710 221
82 iso_pu_bacteria 2738541304 2738865225 221
83 iso_pu_bacteria 2738541309 2738899633 221
84 iso_pu_bacteria 2738543022 2739297743 221
85 iso_pu_bacteria 2738543025 2739313197 221
86 iso_pu_bacteria 2738543031 2739348484 221
87 iso_pu_bacteria 2738543033 2739359421 221
88 iso_pu_bacteria 2784132063 2784264474 221
89 iso_pu_bacteria 2791354903 2791924500 221
90 iso_pu_bacteria 2808606385 2808980996 221
91 iso_pu_bacteria 2808606388 2808996531 221
92 iso_pu_bacteria 2816332298 2817491799 221
93 iso_pu_bacteria 2818991456 2819658845 221
94 iso_pu_bacteria 2834028612 2834030382 221
95 iso_pu_bacteria 2842826826 2842830463 221
96 iso_pu_bacteria 2842832357 2842834765 221
97 iso_pu_bacteria 2842837860 2842842021 221
98 iso_pu_bacteria 2842849001 2842849959 221
99 iso_pu_bacteria 2842849001 2842850631 221
100 iso_pu_bacteria 2847085930 2847088415 221
101 iso_pu_bacteria 2852612431 2852618775 221
102 iso_pu_bacteria 2852667396 2852672582 221
103 iso_pu_bacteria 2854601825 2854606097 221
104 iso_pu_bacteria 2858950400 2858952831 221
105 iso_pu_bacteria 2860867994 2860870168 221
106 iso_pu_bacteria 2904504865 2904507419 221
107 iso_pu_bacteria 2908446538 2908450280 221
108 iso_pu_bacteria 2908669403 2908673449 221
109 iso_pu_bacteria 2919125081 2919126654 221
110 iso_pu_bacteria 2919385768 2919387095 221
111 iso_pu_bacteria 2919476304 2919477151 221
112 iso_pu_bacteria 2919487758 2919489038 221
113 iso_pu_bacteria 2928100450 2928103683 221
114 iso_pu_bacteria 2928959182 2928961304 221
115 iso_pu_bacteria 2928972540 2928975358 221
116 iso_pu_bacteria 2929189879 2929192080 221
117 iso_pu_bacteria 2935625433 2935627416 221
118 iso_pu_bacteria 2939607340 2939608224 221
119 iso_pu_bacteria 2939617950 2939621434 221
120 iso_pu_bacteria 2945928738 2945933986 221
121 iso_pu_bacteria 2945961074 2945962848 221
122 iso_pu_bacteria 2946006987 2946009285 221
123 iso_pu_bacteria 2946027586 2946030399 221
124 iso_pu_bacteria 2947233263 2947237295 221
125 iso_pu_bacteria 2969304461 2969307048 221
126 iso_pu_bacteria 2974289157 2974290830 221
127 iso_pu_bacteria 2974298342 2974301071 221
128 iso_pu_bacteria 2974435778 2974437661 221
129 iso_pu_bacteria 2977240413 2977241654 221
130 iso_pu_bacteria 2984499530 2984503545 221
131 iso_pu_bacteria 2984504281 2984505146 221
132 iso_pu_bacteria 2987605356 2987606575 221
133 iso_pu_bacteria 2998139840 2998142979 221
134 iso_pu_bacteria 3007718800 3007721993 221
135 iso_pu_bacteria 3007855910 3007856982 221
136 iso_pu_bacteria 3007861166 3007862045 221
137 iso_pu_bacteria 8016728285 8016732992 221
138 iso_pu_bacteria 8019504834 8019508424 221
139 iso_pu_bacteria 8021120328 8021125891 221
140 iso_pu_bacteria 8029995093 8029997808 221
141 iso_pu_bacteria 8034962539 8034963669 221
142 iso_pu_bacteria 8054285046 8054287199 221
143 iso_pu_bacteria 8054347763 8054351564 221
144 iso_pu_bacteria 8054503363 8054505666 221
145 iso_pu_bacteria 8055087960 8055090372 221
146 iso_pu_bacteria 8055092621 8055094730 221
147 iso_pu_bacteria 8055097453 8055099367 221
148 iso_pu_bacteria 8055817908 8055821724 221
149 iso_pu_bacteria 8056131705 8056134268 221
150 iso_pu_bacteria 8056148874 8056154155 221
151 iso_pu_bacteria 8056161164 8056166620 221
152 iso_pu_bacteria 8056166840 8056168213 221
153 iso_pu_bacteria 2857564685 2857569167 222
154 iso_pu_bacteria 2888373701 2888378252 222
155 3300035084 Ga0373928_0001402 Ga0373928_0001402_891_1586 223
156 3300035112 Ga0373932_0001806 Ga0373932_0001806_3489_4184 223
157 3300042876 Ga0451577_0233955 Ga0451577_0233955_306_1010 224
158 3300048929 Ga0496126_0006838 Ga0496126_0006838_1355_2029 224
159 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001569 225
160 3300002771 JGI25163J39215_1001830 JGI25163J39215_10018303 225
161 3300002772 JGI25164J39214_1005280 JGI25164J39214_10052802 225
162 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001557 225
163 3300003751 Ga0055538_1000001 Ga0055538_1000001477 225
164 3300003752 Ga0055539_1000001 Ga0055539_1000001477 225
165 3300003752 Ga0055539_1000191 Ga0055539_100019120 225
166 3300003756 Ga0055533_1000003 Ga0055533_1000003557 225
167 3300003756 Ga0055533_1000191 Ga0055533_100019120 225
168 3300003758 Ga0055532_1000194 Ga0055532_100019420 225
169 3300003759 Ga0055525_1000003 Ga0055525_1000003557 225
170 3300003759 Ga0055525_1000258 Ga0055525_100025820 225
171 3300003761 Ga0055535_1010693 Ga0055535_10106932 225
172 3300003791 Ga0055530_10003277 Ga0055530_100032774 225
173 3300003792 Ga0055540_1000008 Ga0055540_10000085 225
174 3300003794 Ga0055531_10007799 Ga0055531_100077994 225
175 3300003841 Ga0055541_1000001 Ga0055541_1000001557 225
176 3300003841 Ga0055541_1000126 Ga0055541_100012621 225
177 3300003856 Ga0058692_1012382 Ga0058692_10123822 225
178 3300005288 Ga0065714_10152939 Ga0065714_101529392 225
179 3300005290 Ga0065712_10067789 Ga0065712_1006778927 225
180 3300005290 Ga0065712_10067908 Ga0065712_100679089 225
181 3300005290 Ga0065712_10071132 Ga0065712_100711322 225
182 3300005331 Ga0070670_100000170 Ga0070670_10000017027 225
183 3300005331 Ga0070670_100002253 Ga0070670_1000022537 225
184 3300005335 Ga0070666_10035787 Ga0070666_100357873 225
185 3300005347 Ga0070668_100002253 Ga0070668_1000022535 225
186 3300005353 Ga0070669_100000080 Ga0070669_10000008032 225
187 3300005353 Ga0070669_100001044 Ga0070669_1000010447 225
188 3300005355 Ga0070671_100008240 Ga0070671_1000082407 225
189 3300005367 Ga0070667_100000444 Ga0070667_10000044421 225
190 3300005457 Ga0070662_100002488 Ga0070662_1000024889 225
191 3300005539 Ga0068853_100030774 Ga0068853_1000307744 225
192 3300005548 Ga0070665_100242686 Ga0070665_1002426862 225
193 3300005548 Ga0070665_100438837 Ga0070665_1004388372 225
194 3300005548 Ga0070665_100613998 Ga0070665_1006139982 225
195 3300005564 Ga0070664_100000996 Ga0070664_10000099611 225
196 3300005564 Ga0070664_100094527 Ga0070664_1000945271 225
197 3300005564 Ga0070664_100806361 Ga0070664_1008063612 225
198 3300005578 Ga0068854_100023606 Ga0068854_1000236062 225
199 3300005834 Ga0068851_10000188 Ga0068851_1000018817 225
200 3300005844 Ga0068862_100037700 Ga0068862_1000377004 225
201 3300006051 Ga0075364_10020814 Ga0075364_100208145 225
202 3300006175 Ga0070712_100032616 Ga0070712_1000326162 225
203 3300006946 Ga0079104_1003500 Ga0079104_10035004 225
204 3300009011 Ga0105251_10000032 Ga0105251_10000032119 225
205 3300009011 Ga0105251_10001241 Ga0105251_100012414 225
206 3300009011 Ga0105251_10009128 Ga0105251_100091282 225
207 3300009011 Ga0105251_10009385 Ga0105251_100093856 225
208 3300009011 Ga0105251_10015206 Ga0105251_100152064 225
209 3300009011 Ga0105251_10081919 Ga0105251_100819191 225
210 3300009036 Ga0105244_10000602 Ga0105244_100006026 225
211 3300009036 Ga0105244_10000976 Ga0105244_1000097611 225
212 3300009036 Ga0105244_10002117 Ga0105244_100021178 225
213 3300009036 Ga0105244_10002606 Ga0105244_100026062 225
214 3300009036 Ga0105244_10006696 Ga0105244_100066965 225
215 3300009036 Ga0105244_10012286 Ga0105244_100122862 225
216 3300009092 Ga0105250_10000001 Ga0105250_10000001347 225
217 3300009092 Ga0105250_10003333 Ga0105250_100033333 225
218 3300009092 Ga0105250_10009894 Ga0105250_100098944 225
219 3300009092 Ga0105250_10023997 Ga0105250_100239972 225
220 3300009092 Ga0105250_10075737 Ga0105250_100757372 225
221 3300009148 Ga0105243_10000098 Ga0105243_1000009854 225
222 3300009148 Ga0105243_10072120 Ga0105243_100721202 225
223 3300009176 Ga0105242_10008357 Ga0105242_100083572 225
224 3300009177 Ga0105248_10116580 Ga0105248_101165803 225
225 3300009177 Ga0105248_10253803 Ga0105248_102538032 225
226 3300009545 Ga0105237_10002317 Ga0105237_100023172 225
227 3300009553 Ga0105249_10029770 Ga0105249_100297704 225
228 3300011119 Ga0105246_10025397 Ga0105246_100253973 225
229 3300012498 Ga0157345_1000004 Ga0157345_100000430 225
230 3300013100 Ga0157373_10000039 Ga0157373_1000003947 225
231 3300013100 Ga0157373_10000472 Ga0157373_1000047220 225
232 3300013100 Ga0157373_10003468 Ga0157373_1000346810 225
233 3300013100 Ga0157373_10006500 Ga0157373_100065003 225
234 3300013100 Ga0157373_10013426 Ga0157373_100134265 225
235 3300013100 Ga0157373_10031912 Ga0157373_100319123 225
236 3300013100 Ga0157373_10043785 Ga0157373_100437852 225
237 3300013102 Ga0157371_10000064 Ga0157371_1000006475 225
238 3300013102 Ga0157371_10056553 Ga0157371_100565532 225
239 3300013102 Ga0157371_10196289 Ga0157371_101962891 225
240 3300013102 Ga0157371_10199583 Ga0157371_101995832 225
241 3300013104 Ga0157370_10024106 Ga0157370_100241062 225
242 3300013104 Ga0157370_10029111 Ga0157370_100291114 225
243 3300013104 Ga0157370_10032098 Ga0157370_100320984 225
244 3300013104 Ga0157370_10058293 Ga0157370_100582933 225
245 3300013105 Ga0157369_10002223 Ga0157369_1000222314 225
246 3300013105 Ga0157369_10003854 Ga0157369_100038548 225
247 3300013105 Ga0157369_10004302 Ga0157369_100043022 225
248 3300013105 Ga0157369_10007619 Ga0157369_100076193 225
249 3300013105 Ga0157369_10017064 Ga0157369_100170647 225
250 3300013105 Ga0157369_10018100 Ga0157369_100181003 225
251 3300013105 Ga0157369_10145343 Ga0157369_101453433 225
252 3300013105 Ga0157369_10201156 Ga0157369_102011563 225
253 3300013306 Ga0163162_10000067 Ga0163162_1000006750 225
254 3300013306 Ga0163162_10010004 Ga0163162_100100045 225
255 3300013306 Ga0163162_10180491 Ga0163162_101804913 225
256 3300013307 Ga0157372_10008278 Ga0157372_100082783 225
257 3300013307 Ga0157372_10460778 Ga0157372_104607782 225
258 3300013308 Ga0157375_10000101 Ga0157375_1000010159 225
259 3300013308 Ga0157375_10067982 Ga0157375_100679823 225
260 3300013308 Ga0157375_10094774 Ga0157375_100947743 225
261 3300013308 Ga0157375_10207364 Ga0157375_102073643 225
262 3300014497 Ga0182008_10000243 Ga0182008_1000024330 225
263 3300014497 Ga0182008_10000445 Ga0182008_1000044530 225
264 3300014497 Ga0182008_10038572 Ga0182008_100385723 225
265 3300014497 Ga0182008_10041082 Ga0182008_100410822 225
266 3300015261 Ga0182006_1005224 Ga0182006_10052247 225
267 3300015261 Ga0182006_1012598 Ga0182006_10125982 225
268 3300015261 Ga0182006_1045592 Ga0182006_10455922 225
269 3300015262 Ga0182007_10000418 Ga0182007_100004188 225
270 3300015262 Ga0182007_10012714 Ga0182007_100127143 225
271 3300015262 Ga0182007_10034839 Ga0182007_100348392 225
272 3300017792 Ga0163161_10000577 Ga0163161_1000057719 225
273 3300017792 Ga0163161_10067644 Ga0163161_100676442 225
274 3300017792 Ga0163161_10078484 Ga0163161_100784843 225
275 3300017792 Ga0163161_10147089 Ga0163161_101470893 225
276 3300017792 Ga0163161_10159777 Ga0163161_101597772 225
277 3300025206 Ga0209435_105207 Ga0209435_1052072 225
278 3300025207 Ga0209760_100917 Ga0209760_1009175 225
279 3300025224 Ga0209784_100004 Ga0209784_100004552 225
280 3300025224 Ga0209784_100161 Ga0209784_10016130 225
281 3300025225 Ga0209566_100004 Ga0209566_100004709 225
282 3300025225 Ga0209566_100213 Ga0209566_10021330 225
283 3300025226 Ga0209674_100006 Ga0209674_100006709 225
284 3300025226 Ga0209674_100208 Ga0209674_10020830 225
285 3300025229 Ga0209147_100021 Ga0209147_10002185 225
286 3300025229 Ga0209147_100249 Ga0209147_10024921 225
287 3300025230 Ga0209563_100009 Ga0209563_100009552 225
288 3300025230 Ga0209563_100159 Ga0209563_10015930 225
289 3300025230 Ga0209563_101175 Ga0209563_1011754 225
290 3300025231 Ga0207427_100347 Ga0207427_10034727 225
291 3300025233 Ga0209437_100004 Ga0209437_100004552 225
292 3300025242 Ga0209258_100438 Ga0209258_10043820 225
293 3300025246 Ga0209646_1000676 Ga0209646_10006769 225
294 3300025253 Ga0209677_100005 Ga0209677_100005552 225
295 3300025253 Ga0209677_100163 Ga0209677_10016330 225
296 3300025258 Ga0209129_1000015 Ga0209129_1000015450 225
297 3300025261 Ga0209233_1000005 Ga0209233_1000005709 225
298 3300025291 Ga0209675_1011653 Ga0209675_10116532 225
299 3300025292 Ga0209676_1000002 Ga0209676_10000021566 225
300 3300025292 Ga0209676_1000120 Ga0209676_100012028 225
301 3300025298 Ga0209050_1000006 Ga0209050_10000065 225
302 3300025303 Ga0209051_1000001 Ga0209051_10000011566 225
303 3300025304 Ga0209257_1000029 Ga0209257_10000295 225
304 3300025711 Ga0207696_1000028 Ga0207696_1000028337 225
305 3300025711 Ga0207696_1000297 Ga0207696_100029723 225
306 3300025711 Ga0207696_1004507 Ga0207696_10045072 225
307 3300025711 Ga0207696_1005537 Ga0207696_10055373 225
308 3300025711 Ga0207696_1086665 Ga0207696_10866651 225
309 3300025728 Ga0207655_1000022 Ga0207655_100002250 225
310 3300025728 Ga0207655_1000080 Ga0207655_1000080112 225
311 3300025728 Ga0207655_1000335 Ga0207655_10003352 225
312 3300025728 Ga0207655_1000713 Ga0207655_100071321 225
313 3300025728 Ga0207655_1002903 Ga0207655_10029035 225
314 3300025728 Ga0207655_1012121 Ga0207655_10121212 225
315 3300025728 Ga0207655_1014224 Ga0207655_10142244 225
316 3300025735 Ga0207713_1000020 Ga0207713_1000020339 225
317 3300025735 Ga0207713_1001431 Ga0207713_10014314 225
318 3300025735 Ga0207713_1002128 Ga0207713_10021288 225
319 3300025735 Ga0207713_1003149 Ga0207713_10031497 225
320 3300025735 Ga0207713_1003256 Ga0207713_10032567 225
321 3300025735 Ga0207713_1005501 Ga0207713_10055014 225
322 3300025735 Ga0207713_1032999 Ga0207713_10329992 225
323 3300025914 Ga0207671_10001843 Ga0207671_1000184322 225
324 3300025915 Ga0207693_10032275 Ga0207693_100322752 225
325 3300025919 Ga0207657_10289587 Ga0207657_102895872 225
326 3300025920 Ga0207649_10000088 Ga0207649_1000008811 225
327 3300025923 Ga0207681_10000049 Ga0207681_1000004952 225
328 3300025925 Ga0207650_10000077 Ga0207650_1000007747 225
329 3300025925 Ga0207650_10000357 Ga0207650_1000035712 225
330 3300025931 Ga0207644_10006600 Ga0207644_100066002 225
331 3300025933 Ga0207706_10005849 Ga0207706_100058499 225
332 3300025934 Ga0207686_10005334 Ga0207686_100053342 225
333 3300025935 Ga0207709_10000011 Ga0207709_1000001154 225
334 3300025941 Ga0207711_10121834 Ga0207711_101218342 225
335 3300025941 Ga0207711_10386083 Ga0207711_103860832 225
336 3300025945 Ga0207679_10000034 Ga0207679_10000034121 225
337 3300025972 Ga0207668_10001920 Ga0207668_1000192011 225
338 3300025981 Ga0207640_10072973 Ga0207640_100729733 225
339 3300025986 Ga0207658_10000656 Ga0207658_1000065621 225
340 3300026041 Ga0207639_10014840 Ga0207639_100148406 225
341 3300027111 Ga0209281_1001747 Ga0209281_10017473 225
342 3300027111 Ga0209281_1003329 Ga0209281_10033294 225
343 3300027312 Ga0209371_1000056 Ga0209371_100005681 225
344 3300027312 Ga0209371_1001494 Ga0209371_10014946 225
345 3300028379 Ga0268266_10358201 Ga0268266_103582012 225
346 3300028380 Ga0268265_10404609 Ga0268265_104046092 225
347 3300028786 Ga0307517_10060915 Ga0307517_100609152 225
348 3300028786 Ga0307517_10131655 Ga0307517_101316552 225
349 3300028794 Ga0307515_10083315 Ga0307515_100833152 225
350 3300030500 Ga0268256_1000003 Ga0268256_1000003491 225
351 3300030500 Ga0268256_1002134 Ga0268256_10021342 225
352 3300030735 Ga0316178_1017657 Ga0316178_10176578 225
353 3300030745 Ga0316182_1222951 Ga0316182_12229512 225
354 3300031251 Ga0265327_10136074 Ga0265327_101360742 225
355 3300031456 Ga0307513_10117282 Ga0307513_101172823 225
356 3300031548 Ga0307408_100000018 Ga0307408_100000018320 225
357 3300031548 Ga0307408_100017613 Ga0307408_1000176134 225
358 3300031548 Ga0307408_100036436 Ga0307408_1000364361 225
359 3300031730 Ga0307516_10201429 Ga0307516_102014291 225
360 3300031731 Ga0307405_10000340 Ga0307405_1000034010 225
361 3300031731 Ga0307405_10550548 Ga0307405_105505481 225
362 3300031911 Ga0307412_10405197 Ga0307412_104051971 225
363 3300031995 Ga0307409_100191945 Ga0307409_1001919452 225
364 3300032004 Ga0307414_10371417 Ga0307414_103714171 225
365 3300032004 Ga0307414_10594727 Ga0307414_105947271 225
366 3300032005 Ga0307411_10030929 Ga0307411_100309293 225
367 3300033180 Ga0307510_10000324 Ga0307510_1000032414 225
368 3300034818 Ga0373950_0013087 Ga0373950_0013087_81_761 225
369 3300034820 Ga0373959_0001896 Ga0373959_0001896_1882_2562 225
370 3300035088 Ga0373940_0028158 Ga0373940_0028158_262_942 225
371 3300035091 Ga0373951_0016233 Ga0373951_0016233_462_1142 225
372 3300035114 Ga0373939_0000105 Ga0373939_0000105_8437_9117 225
373 3300035121 Ga0373960_0000729 Ga0373960_0000729_1247_1927 225
374 3300035398 Ga0316574_0176362 Ga0316574_0176362_638_1315 225
375 3300035691 Ga0373931_0047621 Ga0373931_0047621_40_720 225
376 3300038705 Ga0237819_03077 Ga0237819_03077_1712_2389 225
377 3300041405 Ga0439438_000441 Ga0439438_000441_4757_5434 225
378 3300041405 Ga0439438_000790 Ga0439438_000790_167_844 225
379 3300041405 Ga0439438_003039 Ga0439438_003039_1228_1908 225
380 3300041407 Ga0439447_009204 Ga0439447_009204_790_1470 225
381 3300041407 Ga0439447_052524 Ga0439447_052524_213_890 225
382 3300041411 Ga0439466_0018988 Ga0439466_0018988_977_1654 225
383 3300042004 Ga0439445_0056506 Ga0439445_0056506_272_949 225
384 3300042006 Ga0439432_000324 Ga0439432_000324_9229_9906 225
385 3300042006 Ga0439432_033735 Ga0439432_033735_749_1426 225
386 3300042007 Ga0439449_0030067 Ga0439449_0030067_827_1504 225
387 3300042010 Ga0439452_000024 Ga0439452_000024_104945_105622 225
388 3300042010 Ga0439452_000029 Ga0439452_000029_179061_179741 225
389 3300042010 Ga0439452_025785 Ga0439452_025785_253_930 225
390 3300042013 Ga0439456_002852 Ga0439456_002852_1342_2019 225
391 3300042016 Ga0439463_006748 Ga0439463_006748_1205_1882 225
392 3300042115 Ga0450911_000030 Ga0450911_000030_48894_49571 225
393 3300042131 Ga0450894_002755 Ga0450894_002755_349_1026 225
394 3300042134 Ga0450898_002908 Ga0450898_002908_857_1534 225
395 3300042139 Ga0450904_001668 Ga0450904_001668_1380_2057 225
396 3300042145 Ga0450906_000016 Ga0450906_000016_24767_25444 225
397 3300042439 Ga0439464_0002834 Ga0439464_0002834_2400_3077 225
398 3300045976 Ga0466967_0004162 Ga0466967_0004162_4834_5514 225
399 3300046452 Ga0495617_000026 Ga0495617_000026_15100_15780 225
400 3300046452 Ga0495617_003345 Ga0495617_003345_2575_3252 225
401 3300046452 Ga0495617_003358 Ga0495617_003358_17_694 225
402 3300046452 Ga0495617_005955 Ga0495617_005955_2804_3481 225
403 3300046452 Ga0495617_012833 Ga0495617_012833_560_1237 225
404 3300046452 Ga0495617_029468 Ga0495617_029468_176_853 225
405 3300046452 Ga0495617_086270 Ga0495617_086270_22_699 225
406 3300046453 Ga0495627_000083 Ga0495627_000083_14052_14729 225
407 3300046453 Ga0495627_000101 Ga0495627_000101_35453_36130 225
408 3300046453 Ga0495627_000133 Ga0495627_000133_76365_77132 225
409 3300046453 Ga0495627_000371 Ga0495627_000371_18473_19150 225
410 3300046453 Ga0495627_001842 Ga0495627_001842_868_1548 225
411 3300046453 Ga0495627_002851 Ga0495627_002851_65_742 225
412 3300046457 Ga0495590_0009296 Ga0495590_0009296_149_826 225
413 3300046457 Ga0495590_0029738 Ga0495590_0029738_1089_1766 225
414 3300046457 Ga0495590_0052974 Ga0495590_0052974_109_786 225
415 3300046458 Ga0495591_000037 Ga0495591_000037_102306_102983 225
416 3300046458 Ga0495591_000082 Ga0495591_000082_21844_22611 225
417 3300046458 Ga0495591_000120 Ga0495591_000120_74157_74834 225
418 3300046458 Ga0495591_000358 Ga0495591_000358_18463_19140 225
419 3300046458 Ga0495591_001584 Ga0495591_001584_4133_4810 225
420 3300046458 Ga0495591_001966 Ga0495591_001966_5302_5979 225
421 3300046458 Ga0495591_008363 Ga0495591_008363_3398_4075 225
422 3300046458 Ga0495591_023667 Ga0495591_023667_1136_1813 225
423 3300046458 Ga0495591_045496 Ga0495591_045496_113_790 225
424 3300046459 Ga0495629_0000928 Ga0495629_0000928_9826_10509 225
425 3300046460 Ga0495638_0001204 Ga0495638_0001204_16522_17199 225
426 3300046460 Ga0495638_0298373 Ga0495638_0298373_82_762 225
427 3300046462 Ga0495651_0004310 Ga0495651_0004310_5815_6492 225
428 3300046463 Ga0495653_0000875 Ga0495653_0000875_9789_10472 225
429 3300046463 Ga0495653_0019451 Ga0495653_0019451_2133_2810 225
430 3300046471 Ga0495650_0007800 Ga0495650_0007800_4505_5182 225
431 3300046471 Ga0495650_0009649 Ga0495650_0009649_393_1073 225
432 3300046472 Ga0495580_0095101 Ga0495580_0095101_403_1086 225
433 3300046473 Ga0495582_0166441 Ga0495582_0166441_268_951 225
434 3300046474 Ga0495605_0000147 Ga0495605_0000147_2908_3675 225
435 3300046474 Ga0495605_0003156 Ga0495605_0003156_504_1184 225
436 3300046474 Ga0495605_0003158 Ga0495605_0003158_1415_2092 225
437 3300046474 Ga0495605_0005186 Ga0495605_0005186_3772_4449 225
438 3300046474 Ga0495605_0051103 Ga0495605_0051103_940_1617 225
439 3300046491 Ga0495584_0001704 Ga0495584_0001704_1148_1825 225
440 3300046491 Ga0495584_0041941 Ga0495584_0041941_1156_1851 225
441 3300046491 Ga0495584_0072755 Ga0495584_0072755_839_1516 225
442 3300046492 Ga0495585_0000234 Ga0495585_0000234_5772_6449 225
443 3300046492 Ga0495585_0000272 Ga0495585_0000272_45906_46583 225
444 3300046492 Ga0495585_0000897 Ga0495585_0000897_15635_16312 225
445 3300046492 Ga0495585_0003956 Ga0495585_0003956_1945_2622 225
446 3300046492 Ga0495585_0008632 Ga0495585_0008632_4690_5457 225
447 3300046492 Ga0495585_0011868 Ga0495585_0011868_358_1038 225
448 3300046499 Ga0495594_0144283 Ga0495594_0144283_532_1209 225
449 3300046500 Ga0495596_0004877 Ga0495596_0004877_810_1487 225
450 3300046500 Ga0495596_0009074 Ga0495596_0009074_3327_4007 225
451 3300046500 Ga0495596_0014050 Ga0495596_0014050_64_741 225
452 3300046500 Ga0495596_0023356 Ga0495596_0023356_280_957 225
453 3300046501 Ga0495607_0000209 Ga0495607_0000209_15676_16353 225
454 3300046501 Ga0495607_0000596 Ga0495607_0000596_6183_6860 225
455 3300046501 Ga0495607_0004369 Ga0495607_0004369_504_1184 225
456 3300046501 Ga0495607_0019160 Ga0495607_0019160_2925_3692 225
457 3300046501 Ga0495607_0020451 Ga0495607_0020451_3422_4099 225
458 3300046501 Ga0495607_0023373 Ga0495607_0023373_2775_3452 225
459 3300046501 Ga0495607_0080689 Ga0495607_0080689_1026_1703 225
460 3300046501 Ga0495607_0147517 Ga0495607_0147517_390_1067 225
461 3300046501 Ga0495607_0183965 Ga0495607_0183965_302_997 225
462 3300046506 Ga0495583_0000477 Ga0495583_0000477_3920_4597 225
463 3300046506 Ga0495583_0006074 Ga0495583_0006074_265_942 225
464 3300046506 Ga0495583_0151118 Ga0495583_0151118_58_738 225
465 3300046507 Ga0495606_0000339 Ga0495606_0000339_44424_45101 225
466 3300046507 Ga0495606_0001660 Ga0495606_0001660_24323_25000 225
467 3300046507 Ga0495606_0003705 Ga0495606_0003705_4045_4722 225
468 3300046507 Ga0495606_0008227 Ga0495606_0008227_151_828 225
469 3300046507 Ga0495606_0009414 Ga0495606_0009414_1334_2011 225
470 3300046507 Ga0495606_0024052 Ga0495606_0024052_2840_3517 225
471 3300046507 Ga0495606_0078394 Ga0495606_0078394_738_1415 225
472 3300046511 Ga0495608_0013634 Ga0495608_0013634_1553_2230 225
473 3300046512 Ga0495610_0000133 Ga0495610_0000133_73014_73691 225
474 3300046512 Ga0495610_0000173 Ga0495610_0000173_59497_60174 225
475 3300046512 Ga0495610_0022878 Ga0495610_0022878_706_1383 225
476 3300046513 Ga0495616_0000041 Ga0495616_0000041_99076_99843 225
477 3300046513 Ga0495616_0000166 Ga0495616_0000166_7597_8274 225
478 3300046513 Ga0495616_0000352 Ga0495616_0000352_21437_22114 225
479 3300046513 Ga0495616_0002057 Ga0495616_0002057_12757_13434 225
480 3300046513 Ga0495616_0004061 Ga0495616_0004061_8400_9077 225
481 3300046514 Ga0495618_0015325 Ga0495618_0015325_1855_2532 225
482 3300046515 Ga0495620_0000257 Ga0495620_0000257_29794_30471 225
483 3300046515 Ga0495620_0000785 Ga0495620_0000785_11319_11996 225
484 3300046515 Ga0495620_0004067 Ga0495620_0004067_3138_3905 225
485 3300046515 Ga0495620_0004298 Ga0495620_0004298_86_763 225
486 3300046515 Ga0495620_0038289 Ga0495620_0038289_213_890 225
487 3300046515 Ga0495620_0127822 Ga0495620_0127822_158_835 225
488 3300046516 Ga0495628_0004445 Ga0495628_0004445_10814_11491 225
489 3300046516 Ga0495628_0005405 Ga0495628_0005405_10003_10686 225
490 3300046518 Ga0495631_0000013 Ga0495631_0000013_69561_70238 225
491 3300046518 Ga0495631_0015016 Ga0495631_0015016_1404_2099 225
492 3300046518 Ga0495631_0022628 Ga0495631_0022628_1849_2529 225
493 3300046518 Ga0495631_0183372 Ga0495631_0183372_20_697 225
494 3300046519 Ga0495632_0000097 Ga0495632_0000097_55721_56398 225
495 3300046519 Ga0495632_0000794 Ga0495632_0000794_9089_9766 225
496 3300046519 Ga0495632_0003006 Ga0495632_0003006_3612_4379 225
497 3300046519 Ga0495632_0021519 Ga0495632_0021519_1988_2665 225
498 3300046519 Ga0495632_0039706 Ga0495632_0039706_645_1322 225
499 3300046519 Ga0495632_0050398 Ga0495632_0050398_1033_1710 225
500 3300046519 Ga0495632_0167679 Ga0495632_0167679_117_794 225
501 3300046520 Ga0495637_0000831 Ga0495637_0000831_3019_3696 225
502 3300046520 Ga0495637_0001392 Ga0495637_0001392_21_698 225
503 3300046520 Ga0495637_0002731 Ga0495637_0002731_8910_9587 225
504 3300046520 Ga0495637_0005671 Ga0495637_0005671_5503_6180 225
505 3300046520 Ga0495637_0043843 Ga0495637_0043843_85_762 225
506 3300046522 Ga0495643_0000625 Ga0495643_0000625_30258_30935 225
507 3300046522 Ga0495643_0002569 Ga0495643_0002569_4629_5306 225
508 3300046522 Ga0495643_0008701 Ga0495643_0008701_2434_3111 225
509 3300046522 Ga0495643_0081026 Ga0495643_0081026_312_1007 225
510 3300046523 Ga0495644_0023559 Ga0495644_0023559_1490_2167 225
511 3300046523 Ga0495644_0157913 Ga0495644_0157913_180_857 225
512 3300046524 Ga0495648_0000062 Ga0495648_0000062_99559_100236 225
513 3300046524 Ga0495648_0000172 Ga0495648_0000172_53251_53928 225
514 3300046524 Ga0495648_0000259 Ga0495648_0000259_45867_46544 225
515 3300046524 Ga0495648_0000408 Ga0495648_0000408_10139_10816 225
516 3300046524 Ga0495648_0002220 Ga0495648_0002220_3891_4658 225
517 3300046524 Ga0495648_0005676 Ga0495648_0005676_504_1184 225
518 3300046524 Ga0495648_0146175 Ga0495648_0146175_549_1226 225
519 3300046525 Ga0495663_0010799 Ga0495663_0010799_23_700 225
520 3300046526 Ga0495666_0073382 Ga0495666_0073382_193_876 225
521 3300046528 Ga0495642_0001946 Ga0495642_0001946_7224_7904 225
522 3300046530 Ga0495654_0000050 Ga0495654_0000050_126769_127536 225
523 3300046530 Ga0495654_0000106 Ga0495654_0000106_68450_69127 225
524 3300046530 Ga0495654_0000864 Ga0495654_0000864_7777_8454 225
525 3300046530 Ga0495654_0019273 Ga0495654_0019273_2444_3121 225
526 3300046530 Ga0495654_0072858 Ga0495654_0072858_890_1567 225
527 3300046530 Ga0495654_0077249 Ga0495654_0077249_109_786 225
528 3300046530 Ga0495654_0093052 Ga0495654_0093052_49_726 225
529 3300046530 Ga0495654_0169530 Ga0495654_0169530_86_763 225
530 3300046530 Ga0495654_0216729 Ga0495654_0216729_51_728 225
531 3300046531 Ga0495665_0008463 Ga0495665_0008463_961_1644 225
532 3300046538 Ga0495609_0000286 Ga0495609_0000286_44998_45675 225
533 3300046538 Ga0495609_0001870 Ga0495609_0001870_11960_12637 225
534 3300046538 Ga0495609_0043450 Ga0495609_0043450_1020_1700 225
535 3300046538 Ga0495609_0057663 Ga0495609_0057663_821_1498 225
536 3300046542 Ga0495597_0000101 Ga0495597_0000101_71546_72223 225
537 3300046542 Ga0495597_0000117 Ga0495597_0000117_57239_57916 225
538 3300046542 Ga0495597_0001419 Ga0495597_0001419_16291_16971 225
539 3300046542 Ga0495597_0002964 Ga0495597_0002964_3155_3844 225
540 3300046543 Ga0495645_0274103 Ga0495645_0274103_234_911 225
541 3300046557 Ga0495622_0000047 Ga0495622_0000047_69392_70069 225
542 3300046557 Ga0495622_0038878 Ga0495622_0038878_639_1316 225
543 3300046558 Ga0495633_0000564 Ga0495633_0000564_14980_15657 225
544 3300046558 Ga0495633_0083429 Ga0495633_0083429_650_1330 225
545 3300046615 Ga0495656_0169602 Ga0495656_0169602_361_1038 225
546 3300046616 Ga0495668_0000461 Ga0495668_0000461_45961_46638 225
547 3300046616 Ga0495668_0004483 Ga0495668_0004483_504_1184 225
548 3300046616 Ga0495668_0014143 Ga0495668_0014143_1206_1883 225
549 3300046616 Ga0495668_0046629 Ga0495668_0046629_1000_1677 225
550 3300046616 Ga0495668_0127975 Ga0495668_0127975_668_1363 225
551 3300046648 Ga0495611_0000024 Ga0495611_0000024_45971_46648 225
552 3300046648 Ga0495611_0002828 Ga0495611_0002828_3101_3778 225
553 3300046648 Ga0495611_0013715 Ga0495611_0013715_339_1016 225
554 3300046648 Ga0495611_0014015 Ga0495611_0014015_2657_3337 225
555 3300046648 Ga0495611_0052701 Ga0495611_0052701_425_1102 225
556 3300046648 Ga0495611_0061678 Ga0495611_0061678_695_1390 225
557 3300046660 Ga0495625_0000103 Ga0495625_0000103_21884_22651 225
558 3300046660 Ga0495625_0000861 Ga0495625_0000861_38177_38854 225
559 3300046660 Ga0495625_0071000 Ga0495625_0071000_1324_2001 225
560 3300046660 Ga0495625_0119653 Ga0495625_0119653_638_1315 225
561 3300046665 Ga0495661_0000376 Ga0495661_0000376_18474_19151 225
562 3300046665 Ga0495661_0000586 Ga0495661_0000586_29450_30127 225
563 3300046665 Ga0495661_0006158 Ga0495661_0006158_556_1233 225
564 3300046665 Ga0495661_0010237 Ga0495661_0010237_3657_4334 225
565 3300046665 Ga0495661_0011594 Ga0495661_0011594_76_753 225
566 3300046665 Ga0495661_0140677 Ga0495661_0140677_475_1152 225
567 3300046674 Ga0495588_0102852 Ga0495588_0102852_153_830 225
568 3300046675 Ga0495657_0227822 Ga0495657_0227822_396_1073 225
569 3300046679 Ga0495623_0006021 Ga0495623_0006021_4878_5555 225
570 3300046680 Ga0495646_0000811 Ga0495646_0000811_13043_13726 225
571 3300046689 Ga0495613_0003376 Ga0495613_0003376_4294_4971 225
572 3300046689 Ga0495613_0043596 Ga0495613_0043596_2106_2789 225
573 3300046690 Ga0495624_0000913 Ga0495624_0000913_12860_13543 225
574 3300046690 Ga0495624_0028970 Ga0495624_0028970_2003_2680 225
575 3300046690 Ga0495624_0059728 Ga0495624_0059728_321_998 225
576 3300046691 Ga0495670_0000020 Ga0495670_0000020_69994_70671 225
577 3300046691 Ga0495670_0055731 Ga0495670_0055731_180_860 225
578 3300046692 Ga0495671_0000950 Ga0495671_0000950_13606_14373 225
579 3300046692 Ga0495671_0002769 Ga0495671_0002769_7038_7715 225
580 3300046692 Ga0495671_0003268 Ga0495671_0003268_8870_9550 225
581 3300046692 Ga0495671_0003818 Ga0495671_0003818_4732_5409 225
582 3300046692 Ga0495671_0022905 Ga0495671_0022905_2169_2846 225
583 3300046692 Ga0495671_0154388 Ga0495671_0154388_47_724 225
584 3300046692 Ga0495671_0258273 Ga0495671_0258273_88_765 225
585 3300046694 Ga0495649_0000108 Ga0495649_0000108_2993_3760 225
586 3300046694 Ga0495649_0000894 Ga0495649_0000894_8438_9115 225
587 3300046694 Ga0495649_0011685 Ga0495649_0011685_298_975 225
588 3300046694 Ga0495649_0011847 Ga0495649_0011847_4237_4914 225
589 3300046794 Ga0495589_0000167 Ga0495589_0000167_57062_57739 225
590 3300046794 Ga0495589_0000500 Ga0495589_0000500_18798_19475 225
591 3300046794 Ga0495589_0010260 Ga0495589_0010260_4068_4745 225
592 3300046794 Ga0495589_0069412 Ga0495589_0069412_673_1353 225
593 3300046794 Ga0495589_0102961 Ga0495589_0102961_639_1316 225
594 3300046810 Ga0495660_0000136 Ga0495660_0000136_5908_6585 225
595 3300046810 Ga0495660_0000703 Ga0495660_0000703_19899_20576 225
596 3300046810 Ga0495660_0000798 Ga0495660_0000798_7398_8075 225
597 3300046810 Ga0495660_0003014 Ga0495660_0003014_2859_3536 225
598 3300046810 Ga0495660_0003488 Ga0495660_0003488_7781_8458 225
599 3300046810 Ga0495660_0003565 Ga0495660_0003565_4116_4793 225
600 3300046810 Ga0495660_0013569 Ga0495660_0013569_1345_2112 225
601 3300046810 Ga0495660_0018570 Ga0495660_0018570_3056_3733 225
602 3300046810 Ga0495660_0123155 Ga0495660_0123155_446_1138 225
603 3300047319 Ga0495674_0051344 Ga0495674_0051344_442_1125 225
604 3300047320 Ga0495672_0000022 Ga0495672_0000022_233657_234442 225
605 3300047320 Ga0495672_0008202 Ga0495672_0008202_7023_7700 225
606 3300047320 Ga0495672_0017163 Ga0495672_0017163_1146_1823 225
607 3300047320 Ga0495672_0047689 Ga0495672_0047689_499_1176 225
608 3300047320 Ga0495672_0070761 Ga0495672_0070761_153_830 225
609 3300047321 Ga0495676_0000058 Ga0495676_0000058_19933_20610 225
610 3300047321 Ga0495676_0153344 Ga0495676_0153344_659_1342 225
611 3300047322 Ga0495680_0001006 Ga0495680_0001006_2534_3211 225
612 3300047323 Ga0495683_0002241 Ga0495683_0002241_7277_7954 225
613 3300047323 Ga0495683_0002655 Ga0495683_0002655_7211_7888 225
614 3300047323 Ga0495683_0073096 Ga0495683_0073096_701_1468 225
615 3300047445 Ga0495677_0001377 Ga0495677_0001377_8711_9391 225
616 3300047445 Ga0495677_0186823 Ga0495677_0186823_29_724 225
617 3300047446 Ga0495679_000191 Ga0495679_000191_11579_12256 225
618 3300047446 Ga0495679_000440 Ga0495679_000440_16292_17059 225
619 3300047446 Ga0495679_000507 Ga0495679_000507_18785_19462 225
620 3300047446 Ga0495679_000569 Ga0495679_000569_792_1469 225
621 3300047446 Ga0495679_000945 Ga0495679_000945_1108_1785 225
622 3300047469 Ga0495673_0002300 Ga0495673_0002300_3087_3854 225
623 3300047469 Ga0495673_0003865 Ga0495673_0003865_7719_8396 225
624 3300047469 Ga0495673_0007062 Ga0495673_0007062_957_1652 225
625 3300047469 Ga0495673_0008300 Ga0495673_0008300_1900_2577 225
626 3300047470 Ga0495681_0002512 Ga0495681_0002512_66_743 225
627 3300047470 Ga0495681_0003605 Ga0495681_0003605_9654_10334 225
628 3300047470 Ga0495681_0004978 Ga0495681_0004978_4408_5085 225
629 3300047470 Ga0495681_0007877 Ga0495681_0007877_5820_6497 225
630 3300047470 Ga0495681_0029087 Ga0495681_0029087_1440_2207 225
631 3300047470 Ga0495681_0099862 Ga0495681_0099862_195_875 225
632 3300047472 Ga0495686_0000266 Ga0495686_0000266_24887_25564 225
633 3300047472 Ga0495686_0002582 Ga0495686_0002582_12513_13190 225
634 3300048091 Ga0495626_0000074 Ga0495626_0000074_109901_110668 225
635 3300048091 Ga0495626_0000972 Ga0495626_0000972_3636_4313 225
636 3300048091 Ga0495626_0001407 Ga0495626_0001407_13487_14164 225
637 3300048091 Ga0495626_0002709 Ga0495626_0002709_10618_11295 225
638 3300048091 Ga0495626_0118182 Ga0495626_0118182_201_896 225
639 3300048903 Ga0496100_0023094 Ga0496100_0023094_102_779 225
640 3300048903 Ga0496100_0060536 Ga0496100_0060536_661_1341 225
641 3300048904 Ga0496101_0001241 Ga0496101_0001241_5784_6506 225
642 3300048904 Ga0496101_0031094 Ga0496101_0031094_1881_2561 225
643 3300048905 Ga0496102_0002156 Ga0496102_0002156_1936_2658 225
644 3300048905 Ga0496102_0011646 Ga0496102_0011646_6168_6848 225
645 3300048906 Ga0496103_0000021 Ga0496103_0000021_167093_167815 225
646 3300048907 Ga0496104_0000715 Ga0496104_0000715_9086_9808 225
647 3300048908 Ga0496105_0000151 Ga0496105_0000151_41362_42084 225
648 3300048909 Ga0496106_0088103 Ga0496106_0088103_210_887 225
649 3300048909 Ga0496106_0181488 Ga0496106_0181488_210_932 225
650 3300048910 Ga0496107_0040363 Ga0496107_0040363_722_1444 225
651 3300048915 Ga0496112_0005821 Ga0496112_0005821_9103_9825 225
652 3300048916 Ga0496113_0000102 Ga0496113_0000102_22145_22867 225
653 3300048918 Ga0496115_0728392 Ga0496115_0728392_38_760 225
654 3300048919 Ga0496116_0000255 Ga0496116_0000255_3730_4407 225
655 3300048919 Ga0496116_0002015 Ga0496116_0002015_3891_4568 225
656 3300048919 Ga0496116_0004044 Ga0496116_0004044_10714_11391 225
657 3300048919 Ga0496116_0019846 Ga0496116_0019846_4291_4968 225
658 3300048919 Ga0496116_0054651 Ga0496116_0054651_1427_2107 225
659 3300048919 Ga0496116_0063758 Ga0496116_0063758_851_1573 225
660 3300048919 Ga0496116_0117351 Ga0496116_0117351_423_1106 225
661 3300048919 Ga0496116_0179898 Ga0496116_0179898_305_982 225
662 3300048920 Ga0496117_0000284 Ga0496117_0000284_85052_85774 225
663 3300048920 Ga0496117_0000475 Ga0496117_0000475_3895_4572 225
664 3300048920 Ga0496117_0000790 Ga0496117_0000790_21001_21678 225
665 3300048920 Ga0496117_0001907 Ga0496117_0001907_16302_16982 225
666 3300048920 Ga0496117_0014070 Ga0496117_0014070_5464_6141 225
667 3300048920 Ga0496117_0024319 Ga0496117_0024319_966_1643 225
668 3300048920 Ga0496117_0164130 Ga0496117_0164130_102_782 225
669 3300048920 Ga0496117_0168377 Ga0496117_0168377_112_789 225
670 3300048920 Ga0496117_0262348 Ga0496117_0262348_102_782 225
671 3300048921 Ga0496118_0000482 Ga0496118_0000482_3959_4636 225
672 3300048921 Ga0496118_0002095 Ga0496118_0002095_9097_9777 225
673 3300048921 Ga0496118_0019428 Ga0496118_0019428_2731_3408 225
674 3300048921 Ga0496118_0043806 Ga0496118_0043806_698_1375 225
675 3300048921 Ga0496118_0052116 Ga0496118_0052116_2033_2710 225
676 3300048921 Ga0496118_0077991 Ga0496118_0077991_1408_2085 225
677 3300048921 Ga0496118_0172050 Ga0496118_0172050_552_1232 225
678 3300048922 Ga0496119_0000056 Ga0496119_0000056_149768_150448 225
679 3300048922 Ga0496119_0000077 Ga0496119_0000077_94259_94981 225
680 3300048922 Ga0496119_0001020 Ga0496119_0001020_29591_30271 225
681 3300048922 Ga0496119_0003742 Ga0496119_0003742_7645_8322 225
682 3300048922 Ga0496119_0010114 Ga0496119_0010114_1075_1752 225
683 3300048922 Ga0496119_0054734 Ga0496119_0054734_337_1014 225
684 3300048923 Ga0496120_0000063 Ga0496120_0000063_143567_144247 225
685 3300048923 Ga0496120_0001205 Ga0496120_0001205_3842_4564 225
686 3300048923 Ga0496120_0006488 Ga0496120_0006488_1114_1791 225
687 3300048923 Ga0496120_0009589 Ga0496120_0009589_1814_2491 225
688 3300048923 Ga0496120_0017015 Ga0496120_0017015_768_1448 225
689 3300048923 Ga0496120_0088856 Ga0496120_0088856_270_947 225
690 3300048924 Ga0496121_0004669 Ga0496121_0004669_2744_3466 225
691 3300048924 Ga0496121_0008008 Ga0496121_0008008_9125_9802 225
692 3300048924 Ga0496121_0141185 Ga0496121_0141185_255_932 225
693 3300048925 Ga0496122_0002034 Ga0496122_0002034_15196_15918 225
694 3300048925 Ga0496122_0002380 Ga0496122_0002380_4008_4685 225
695 3300048925 Ga0496122_0002939 Ga0496122_0002939_3240_3917 225
696 3300048925 Ga0496122_0005020 Ga0496122_0005020_4763_5446 225
697 3300048925 Ga0496122_0005255 Ga0496122_0005255_12101_12778 225
698 3300048925 Ga0496122_0014836 Ga0496122_0014836_2911_3588 225
699 3300048925 Ga0496122_0024893 Ga0496122_0024893_3286_3963 225
700 3300048925 Ga0496122_0055580 Ga0496122_0055580_956_1633 225
701 3300048925 Ga0496122_0056498 Ga0496122_0056498_1049_1726 225
702 3300048925 Ga0496122_0171583 Ga0496122_0171583_525_1205 225
703 3300048925 Ga0496122_0187620 Ga0496122_0187620_102_782 225
704 3300048926 Ga0496123_0000666 Ga0496123_0000666_36728_37405 225
705 3300048926 Ga0496123_0000927 Ga0496123_0000927_34159_34842 225
706 3300048926 Ga0496123_0001027 Ga0496123_0001027_39054_39731 225
707 3300048926 Ga0496123_0001803 Ga0496123_0001803_22857_23579 225
708 3300048926 Ga0496123_0001897 Ga0496123_0001897_26531_27208 225
709 3300048926 Ga0496123_0007003 Ga0496123_0007003_543_1223 225
710 3300048926 Ga0496123_0008081 Ga0496123_0008081_6357_7034 225
711 3300048926 Ga0496123_0011923 Ga0496123_0011923_266_943 225
712 3300048926 Ga0496123_0053328 Ga0496123_0053328_1092_1769 225
713 3300048926 Ga0496123_0055730 Ga0496123_0055730_1083_1760 225
714 3300048926 Ga0496123_0075157 Ga0496123_0075157_861_1538 225
715 3300048927 Ga0496124_0000944 Ga0496124_0000944_27094_27771 225
716 3300048927 Ga0496124_0001415 Ga0496124_0001415_20683_21363 225
717 3300048927 Ga0496124_0001563 Ga0496124_0001563_13856_14545 225
718 3300048927 Ga0496124_0023165 Ga0496124_0023165_2623_3300 225
719 3300048927 Ga0496124_0033436 Ga0496124_0033436_1210_1932 225
720 3300048927 Ga0496124_0099493 Ga0496124_0099493_469_1146 225
721 3300048927 Ga0496124_0112846 Ga0496124_0112846_212_889 225
722 3300048928 Ga0496125_0000038 Ga0496125_0000038_156875_157552 225
723 3300048928 Ga0496125_0000414 Ga0496125_0000414_42203_42880 225
724 3300048928 Ga0496125_0001808 Ga0496125_0001808_7857_8534 225
725 3300048928 Ga0496125_0001993 Ga0496125_0001993_21689_22411 225
726 3300048928 Ga0496125_0003412 Ga0496125_0003412_924_1601 225
727 3300048928 Ga0496125_0003434 Ga0496125_0003434_9496_10173 225
728 3300048928 Ga0496125_0011396 Ga0496125_0011396_1059_1736 225
729 3300048928 Ga0496125_0013069 Ga0496125_0013069_2456_3133 225
730 3300048928 Ga0496125_0027722 Ga0496125_0027722_3812_4489 225
731 3300048928 Ga0496125_0071751 Ga0496125_0071751_553_1230 225
732 3300048928 Ga0496125_0144589 Ga0496125_0144589_865_1545 225
733 3300048928 Ga0496125_0299637 Ga0496125_0299637_204_884 225
734 3300048928 Ga0496125_0340039 Ga0496125_0340039_20_697 225
735 3300048929 Ga0496126_0000175 Ga0496126_0000175_61194_61916 225
736 3300048929 Ga0496126_0000817 Ga0496126_0000817_5572_6249 225
737 3300048929 Ga0496126_0007003 Ga0496126_0007003_9591_10268 225
738 3300048929 Ga0496126_0011789 Ga0496126_0011789_2742_3419 225
739 3300048929 Ga0496126_0045365 Ga0496126_0045365_148_828 225
740 3300048929 Ga0496126_0047834 Ga0496126_0047834_1125_1802 225
741 3300049459 Ga0495678_000359 Ga0495678_000359_39544_40221 225
742 3300049459 Ga0495678_001048 Ga0495678_001048_13487_14254 225
743 3300049459 Ga0495678_001784 Ga0495678_001784_3188_3865 225
744 3300049459 Ga0495678_002659 Ga0495678_002659_1059_1736 225
745 3300049459 Ga0495678_041350 Ga0495678_041350_852_1529 225
746 3300049459 Ga0495678_045203 Ga0495678_045203_780_1547 225
747 3300049460 Ga0495682_0000085 Ga0495682_0000085_39259_39936 225
748 3300049460 Ga0495682_0062703 Ga0495682_0062703_275_952 225
749 3300049535 Ga0501319_004774 Ga0501319_004774_71_748 225
750 3300049673 Ga0501240_003553 Ga0501240_003553_870_1547 225
751 3300049758 Ga0501241_000395 Ga0501241_000395_7374_8051 225
752 3300049766 Ga0501269_002059 Ga0501269_002059_1838_2515 225
753 3300053098 Ga0500650_0147984 Ga0500650_0147984_383_1060 225
754 3300053111 Ga0500572_000082 Ga0500572_000082_18931_19608 225
755 3300053119 Ga0500595_010171 Ga0500595_010171_192_869 225
756 3300053126 Ga0500621_014165 Ga0500621_014165_1484_2161 225
757 3300053140 Ga0500573_0001991 Ga0500573_0001991_4971_5648 225
758 3300053145 Ga0500586_008184 Ga0500586_008184_155_832 225
759 3300053161 Ga0500634_0000413 Ga0500634_0000413_11105_11782 225
760 iso_pu_bacteria 3007614139 3007619260 225

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01965

DJ-1_PfpI

DJ-1/PfpI family

19

222

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4p5p-assembly1.cif.gz_A x-ray structure of francisella tularensis rapid encystment protein 24 kda (rep24), gene product of ftn_0841 0.9628 2 225
1u9c-assembly1.cif.gz_A crystallographic structure of apc35852 0.9419 2 224
4qyx-assembly1.cif.gz_A crystal structure of ydr533cp 0.9353 2 225
1qvv-assembly1.cif.gz_D-2 crystal structure of the s. cerevisiae ydr533c protein 0.9345 1 224
1qvz-assembly1.cif.gz_B crystal structure of the s. cerevisiae ydr533c protein 0.9325 2 224
ID Description Score Start End Superfamily
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9625 2 225 3.40.50.880
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9623 1 220 3.40.50.880
4p5pA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9458 2 225 3.40.50.880
af_Q54W12_1_221_3.40.50.880 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9454 1 220 3.40.50.880
1u9cA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Class I glutamine amidotransferase (GATase) domain 0.9401 2 224 3.40.50.880
ID Description Score Start End GO Terms
AF-A0A455U1L9-F1-model_v4 DJ-1/PfpI domain-containing protein 1.002 136 225 GO:0005737
GO:0019172
GO:0019243
AF-A0A377NFH9-F1-model_v4 Chaperone protein HchA 1.001 1 224 GO:0005737
GO:0019172
GO:0019243
AF-A0A5B9FLA3-F1-model_v4 Type 1 glutamine amidotransferase domain-containing protein 1.001 1 223 GO:0005737
GO:0016740
GO:0019172
GO:0019243
AF-Q5H3X0-F1-model_v4 NonF-related protein 1.001 1 223 GO:0005737
GO:0019172
GO:0019243
AF-A0A349P5K1-F1-model_v4 deleted 1.001 95 225

Feature Viewer

pLDDT pTM Quality
97.94 0.94 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map