F479528

General Info

Members Datasets Scaffolds Average Seq Length
760 400 1520 181

Family's Representative Sequence

Representative Sequence 3300025919|Ga0207657_10513386|Ga0207657_105133862
Length 195
Sequence MRRLMLLRHAKTEHDAPSGQDQDRRLDERGRLDAAAIGEWIGRHPPRPDAVLVSTAVRARQTWEISGQAMKDVLREPAASKWQVEFLDEIYGAEPAQLLQLVRTSEVTNPQNLLLVGHNPGMHELALMLTGSGDAAAKKALEDNLPTAGLAILDFAIDDWSEVAFRGGKLMRFTSPRLLKQASDEMPEKARNAGF

Samples

Sample ID Description Type Environment
1 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
56 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
57 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
58 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
59 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
82 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
83 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
118 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
119 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
125 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
126 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
177 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
178 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
182 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
183 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
184 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
185 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
186 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
187 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
190 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
191 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
192 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
193 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
194 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
195 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
196 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
197 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
198 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
199 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
200 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
214 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
215 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
216 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
217 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
220 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
221 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
222 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
223 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
224 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
225 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
226 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
227 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
228 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
229 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
230 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
231 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
232 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
233 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
234 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
235 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
236 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
237 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
238 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
239 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
240 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
241 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
242 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
243 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
244 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
245 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
246 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
247 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
248 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
249 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
250 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
251 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
252 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
253 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
254 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
255 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
256 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
257 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
258 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
261 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
262 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
263 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
264 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
265 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
266 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
267 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
268 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
269 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
270 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
271 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
272 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
273 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
274 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
275 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
276 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
277 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
278 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
279 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
280 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
281 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
282 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
285 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
286 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
287 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
288 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
289 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
290 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
291 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
292 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
293 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
294 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
295 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
296 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
297 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
298 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
299 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
300 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
301 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
302 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
303 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
304 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
305 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
306 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
307 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
308 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
309 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
310 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
311 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
312 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
313 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
314 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
315 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
316 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
317 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
319 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
320 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
323 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
325 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
327 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
328 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
333 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
334 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
337 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
338 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
339 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
340 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
341 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
342 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
343 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
344 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
345 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
346 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
347 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
348 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
349 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
350 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
351 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
352 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
353 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
354 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
355 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
356 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
357 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
358 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
359 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
360 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
361 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
362 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
363 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
364 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
365 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
366 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
367 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
368 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
369 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
370 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
371 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
372 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
373 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
374 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
375 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
376 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
377 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
378 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
379 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
380 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
381 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
382 2791355199
383 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
384 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
385 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
386 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
387 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
388 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
389 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
390 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
391 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
392 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
393 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
394 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
395 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
396 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
397 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
398 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
399 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
400 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 97.1
Metatranscriptomes 0.13
Isolates 2.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.39
Nodule 2.24
Rhizoplane 4.74
Rhizosphere 76.32
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207657_10513386 3300025919 Bacteria 938
2 JGI24750J21931_1027633 3300002070 Bacteria 821
3 JGI24744J21845_10041856 3300002077 Bacteria 856
4 JGI25406J46586_10008922 3300003203 Bacteria 4511
5 JGI25153J46596_10001823 3300003215 Bacteria 12628
6 JGI25153J46596_10009963 3300003215 Bacteria 4345
7 rootH2_10033957 3300003320 Bacteria 1670
8 rootH1_10230076 3300003323 Bacteria 1119
9 JGI25404J52841_10020828 3300003659 Bacteria 1419
10 Ga0065704_10236416 3300005289 Bacteria 1028
11 Ga0070658_10042987 3300005327 Bacteria 3651
12 Ga0070658_10105537 3300005327 Bacteria 2331
13 Ga0070658_10606777 3300005327 Bacteria 949
14 Ga0070683_100022389 3300005329 Bacteria 5647
15 Ga0070690_100227490 3300005330 Bacteria 1310
16 Ga0070670_100370450 3300005331 Bacteria 1261
17 Ga0070677_10506280 3300005333 Bacteria 655
18 Ga0068869_100139713 3300005334 Bacteria 1869
19 Ga0070666_10154518 3300005335 Bacteria 1602
20 Ga0070666_10291694 3300005335 Bacteria 1161
21 Ga0070666_10353589 3300005335 Bacteria 1052
22 Ga0070682_100094616 3300005337 Bacteria 1960
23 Ga0068868_100051990 3300005338 Bacteria 3225
24 Ga0068868_100299395 3300005338 Bacteria 1366
25 Ga0068868_100643251 3300005338 Bacteria 943
26 Ga0070660_100200681 3300005339 Bacteria 1618
27 Ga0070660_100527579 3300005339 Bacteria 984
28 Ga0070689_100186860 3300005340 Bacteria 1686
29 Ga0070689_100230423 3300005340 Bacteria 1523
30 Ga0070687_100249753 3300005343 Bacteria 1101
31 Ga0070687_100377505 3300005343 Bacteria 923
32 Ga0070661_100098600 3300005344 Bacteria 2170
33 Ga0070661_100687536 3300005344 Bacteria 833
34 Ga0070692_10068777 3300005345 Bacteria 1882
35 Ga0070668_100230939 3300005347 Bacteria 1529
36 Ga0070668_100246922 3300005347 Bacteria 1480
37 Ga0070668_100327792 3300005347 Bacteria 1290
38 Ga0070668_100352784 3300005347 Bacteria 1245
39 Ga0070668_100663014 3300005347 Bacteria 917
40 Ga0070669_100186698 3300005353 Bacteria 1624
41 Ga0070675_100374358 3300005354 Bacteria 1267
42 Ga0070671_100469856 3300005355 Bacteria 1080
43 Ga0070674_100130349 3300005356 Bacteria 1874
44 Ga0070674_100267047 3300005356 Bacteria 1351
45 Ga0070674_100580186 3300005356 Bacteria 945
46 Ga0070673_100312385 3300005364 Bacteria 1387
47 Ga0070673_100327987 3300005364 Bacteria 1353
48 Ga0070688_100081049 3300005365 Bacteria 2101
49 Ga0070688_100202118 3300005365 Bacteria 1391
50 Ga0070659_100208168 3300005366 Bacteria 1611
51 Ga0070667_100394054 3300005367 Bacteria 1259
52 Ga0070709_10081557 3300005434 Bacteria 2112
53 Ga0070701_10124902 3300005438 Bacteria 1455
54 Ga0070701_10236492 3300005438 Bacteria 1096
55 Ga0070711_100366011 3300005439 Bacteria 1162
56 Ga0070700_100056021 3300005441 Bacteria 2470
57 Ga0070700_100071185 3300005441 Bacteria 2219
58 Ga0070700_100353959 3300005441 Bacteria 1089
59 Ga0070700_100651568 3300005441 Bacteria 832
60 Ga0070694_101354369 3300005444 Bacteria 600
61 Ga0070708_100076759 3300005445 Bacteria 3018
62 Ga0070663_100007102 3300005455 Bacteria 6794
63 Ga0070663_100009408 3300005455 Bacteria 6049
64 Ga0070663_100045393 3300005455 Bacteria 3104
65 Ga0070663_100062950 3300005455 Bacteria 2676
66 Ga0070663_100138991 3300005455 Bacteria 1852
67 Ga0070663_100623522 3300005455 Bacteria 909
68 Ga0070663_100891661 3300005455 Bacteria 768
69 Ga0070678_100044893 3300005456 Bacteria 3158
70 Ga0070678_100082389 3300005456 Bacteria 2442
71 Ga0070678_100193068 3300005456 Bacteria 1675
72 Ga0070678_100371843 3300005456 Bacteria 1234
73 Ga0070678_100404495 3300005456 Bacteria 1187
74 Ga0070662_100027557 3300005457 Bacteria 3945
75 Ga0070662_100109605 3300005457 Bacteria 2101
76 Ga0070662_100389361 3300005457 Bacteria 1148
77 Ga0070681_10020582 3300005458 Bacteria 6611
78 Ga0068867_100111242 3300005459 Bacteria 2104
79 Ga0068867_101286327 3300005459 Bacteria 675
80 Ga0070706_100461518 3300005467 Bacteria 1182
81 Ga0070707_100722592 3300005468 Bacteria 959
82 Ga0070698_100051365 3300005471 Bacteria 4199
83 Ga0070699_100493012 3300005518 Bacteria 1112
84 Ga0070679_100109637 3300005530 Bacteria 2747
85 Ga0070679_100913310 3300005530 Bacteria 822
86 Ga0070697_100617111 3300005536 Bacteria 954
87 Ga0068853_100031053 3300005539 Bacteria 4517
88 Ga0068853_100374424 3300005539 Bacteria 1329
89 Ga0068853_100396883 3300005539 Bacteria 1290
90 Ga0070686_100082317 3300005544 Bacteria 2134
91 Ga0070686_100418921 3300005544 Bacteria 1022
92 Ga0070686_101238465 3300005544 Bacteria 621
93 Ga0070695_100371679 3300005545 Bacteria 1076
94 Ga0070696_100694743 3300005546 Bacteria 829
95 Ga0070665_100003902 3300005548 Bacteria 15759
96 Ga0070665_100012589 3300005548 Bacteria 8517
97 Ga0070665_100174661 3300005548 Bacteria 2149
98 Ga0070665_100240643 3300005548 Bacteria 1810
99 Ga0070665_100276363 3300005548 Bacteria 1681
100 Ga0070665_100481045 3300005548 Bacteria 1252
101 Ga0070665_100650074 3300005548 Bacteria 1067
102 Ga0070665_100777418 3300005548 Bacteria 970
103 Ga0068855_100040307 3300005563 Bacteria 5544
104 Ga0068855_100150901 3300005563 Bacteria 2643
105 Ga0070664_100694054 3300005564 Bacteria 948
106 Ga0068857_100118307 3300005577 Bacteria 2385
107 Ga0068857_100910438 3300005577 Bacteria 844
108 Ga0068857_101308052 3300005577 Bacteria 704
109 Ga0068854_100523853 3300005578 Bacteria 1001
110 Ga0068856_100349307 3300005614 Bacteria 1497
111 Ga0068856_100742381 3300005614 Bacteria 1002
112 Ga0070702_100037821 3300005615 Bacteria 2682
113 Ga0070702_100056054 3300005615 Bacteria 2274
114 Ga0070702_100843322 3300005615 Bacteria 712
115 Ga0068852_100059782 3300005616 Bacteria 3306
116 Ga0068852_100353313 3300005616 Bacteria 1436
117 Ga0068852_100625134 3300005616 Bacteria 1083
118 Ga0068852_100941525 3300005616 Bacteria 882
119 Ga0068859_100088964 3300005617 Bacteria 3137
120 Ga0068859_100180859 3300005617 Bacteria 2191
121 Ga0068864_100256800 3300005618 Bacteria 1624
122 Ga0068864_100371969 3300005618 Bacteria 1352
123 Ga0068866_10083224 3300005718 Bacteria 1724
124 Ga0068866_10096615 3300005718 Bacteria 1621
125 Ga0068861_100083104 3300005719 Bacteria 2511
126 Ga0068861_100111043 3300005719 Bacteria 2196
127 Ga0068861_100420633 3300005719 Bacteria 1190
128 Ga0068851_10257871 3300005834 Bacteria 991
129 Ga0068870_10179182 3300005840 Bacteria 1271
130 Ga0068870_10270320 3300005840 Bacteria 1061
131 Ga0068863_100506975 3300005841 Bacteria 1188
132 Ga0068863_101441572 3300005841 Bacteria 697
133 Ga0068858_100121260 3300005842 Bacteria 2445
134 Ga0068858_100741816 3300005842 Bacteria 956
135 Ga0068860_100524476 3300005843 Bacteria 1185
136 Ga0068860_100606362 3300005843 Bacteria 1100
137 Ga0068862_100171897 3300005844 Bacteria 1940
138 Ga0068862_100219573 3300005844 Bacteria 1720
139 Ga0068862_100596948 3300005844 Bacteria 1059
140 Ga0081455_10003404 3300005937 Bacteria 18299
141 Ga0081455_10033184 3300005937 Bacteria 4642
142 Ga0081455_10092446 3300005937 Bacteria 2447
143 Ga0081455_10121550 3300005937 Bacteria 2057
144 Ga0081455_10194702 3300005937 Bacteria 1523
145 Ga0081455_10450204 3300005937 Bacteria 880
146 Ga0081538_10021089 3300005981 Bacteria 4773
147 Ga0081540_1001946 3300005983 Bacteria 17280
148 Ga0081540_1003505 3300005983 Bacteria 12386
149 Ga0081540_1008381 3300005983 Bacteria 7224
150 Ga0081540_1028486 3300005983 Bacteria 3136
151 Ga0081540_1040217 3300005983 Bacteria 2440
152 Ga0081540_1056043 3300005983 Bacteria 1916
153 Ga0081539_10000864 3300005985 Bacteria 58047
154 Ga0081539_10034895 3300005985 Bacteria 3033
155 Ga0081539_10077476 3300005985 Bacteria 1758
156 Ga0075365_10013487 3300006038 Bacteria 4891
157 Ga0075365_10119591 3300006038 Bacteria 1816
158 Ga0075365_10158083 3300006038 Bacteria 1578
159 Ga0075365_10266549 3300006038 Bacteria 1204
160 Ga0075368_10012841 3300006042 Bacteria 3067
161 Ga0075368_10033659 3300006042 Bacteria 1994
162 Ga0075368_10043536 3300006042 Bacteria 1769
163 Ga0075368_10061616 3300006042 Bacteria 1503
164 Ga0075363_100045014 3300006048 Bacteria 2339
165 Ga0075363_100209079 3300006048 Bacteria 1116
166 Ga0075363_100241879 3300006048 Bacteria 1037
167 Ga0075364_10081020 3300006051 Bacteria 2146
168 Ga0070712_100759597 3300006175 Bacteria 830
169 Ga0075367_10045909 3300006178 Bacteria 2565
170 Ga0075367_10046141 3300006178 Bacteria 2559
171 Ga0075367_10103513 3300006178 Bacteria 1742
172 Ga0075367_10161231 3300006178 Bacteria 1395
173 Ga0075367_10464543 3300006178 Bacteria 802
174 Ga0075369_10069255 3300006186 Bacteria 1551
175 Ga0075369_10077494 3300006186 Bacteria 1470
176 Ga0075369_10107735 3300006186 Bacteria 1254
177 Ga0075366_10085190 3300006195 Bacteria 1890
178 Ga0075366_10107593 3300006195 Bacteria 1676
179 Ga0097621_100056345 3300006237 Bacteria 3211
180 Ga0097621_100147438 3300006237 Bacteria 2016
181 Ga0097621_100319989 3300006237 Bacteria 1374
182 Ga0075370_10008976 3300006353 Bacteria 5169
183 Ga0075370_10127736 3300006353 Bacteria 1482
184 Ga0068871_100059857 3300006358 Bacteria 3105
185 Ga0075431_100815430 3300006847 Bacteria 906
186 Ga0075434_100102223 3300006871 Bacteria 2874
187 Ga0075429_100176120 3300006880 Bacteria 1874
188 Ga0068865_100043803 3300006881 Bacteria 3060
189 Ga0075436_100233894 3300006914 Bacteria 1306
190 Ga0097620_100088965 3300006931 Bacteria 3137
191 Ga0097620_100180853 3300006931 Bacteria 2191
192 Ga0075435_100427810 3300007076 Bacteria 1141
193 Ga0099794_10030456 3300007265 Bacteria 2520
194 Ga0105250_10026150 3300009092 Bacteria 2351
195 Ga0105240_10017998 3300009093 Bacteria 9503
196 Ga0105240_10084254 3300009093 Bacteria 3898
197 Ga0105240_10331311 3300009093 Bacteria 1732
198 Ga0105240_10562103 3300009093 Bacteria 1261
199 Ga0105240_10766624 3300009093 Bacteria 1048
200 Ga0111539_10111250 3300009094 Bacteria 3214
201 Ga0105245_10034224 3300009098 Bacteria 4505
202 Ga0105245_10172985 3300009098 Bacteria 2057
203 Ga0105245_10803194 3300009098 Bacteria 979
204 Ga0105247_10072004 3300009101 Bacteria 2163
205 Ga0105247_10207723 3300009101 Bacteria 1319
206 Ga0105247_10327119 3300009101 Bacteria 1071
207 Ga0105247_10491448 3300009101 Bacteria 892
208 Ga0114129_10774924 3300009147 Bacteria 1226
209 Ga0105243_10363047 3300009148 Bacteria 1334
210 Ga0105243_10774678 3300009148 Bacteria 943
211 Ga0105241_10030850 3300009174 Bacteria 4009
212 Ga0105241_10228472 3300009174 Bacteria 1568
213 Ga0105241_10776807 3300009174 Bacteria 880
214 Ga0105242_10064517 3300009176 Bacteria 3019
215 Ga0105248_10255811 3300009177 Bacteria 1971
216 Ga0105248_10775296 3300009177 Bacteria 1082
217 Ga0105248_11419413 3300009177 Bacteria 786
218 Ga0105237_10044496 3300009545 Bacteria 4470
219 Ga0105237_10110656 3300009545 Bacteria 2738
220 Ga0105237_10359344 3300009545 Bacteria 1461
221 Ga0105237_10501319 3300009545 Bacteria 1220
222 Ga0105237_10897004 3300009545 Bacteria 893
223 Ga0105238_10259955 3300009551 Bacteria 1715
224 Ga0105249_10223665 3300009553 Bacteria 1853
225 Ga0105249_10961184 3300009553 Bacteria 922
226 Ga0099796_10028232 3300010159 Bacteria 1800
227 Ga0099796_10064065 3300010159 Bacteria 1311
228 Ga0105239_10037109 3300010375 Bacteria 5345
229 Ga0105239_10131593 3300010375 Bacteria 2783
230 Ga0105239_10443281 3300010375 Bacteria 1472
231 Ga0105239_11212691 3300010375 Bacteria 870
232 Ga0105239_12073030 3300010375 Bacteria 661
233 Ga0105246_10102850 3300011119 Bacteria 2084
234 Ga0157370_11197030 3300013104 Bacteria 685
235 Ga0157369_10017108 3300013105 Bacteria 8147
236 Ga0157374_10257036 3300013296 Bacteria 1720
237 Ga0157374_10356022 3300013296 Bacteria 1455
238 Ga0157378_10005382 3300013297 Bacteria 11224
239 Ga0157378_10689515 3300013297 Bacteria 1040
240 Ga0163162_10105069 3300013306 Bacteria 2919
241 Ga0157375_10235033 3300013308 Bacteria 1992
242 Ga0157375_10459338 3300013308 Bacteria 1439
243 Ga0157375_10671077 3300013308 Bacteria 1192
244 Ga0163163_10153356 3300014325 Bacteria 2347
245 Ga0163163_10162866 3300014325 Bacteria 2276
246 Ga0163163_10257861 3300014325 Bacteria 1794
247 Ga0163163_10527210 3300014325 Bacteria 1243
248 Ga0163163_10886838 3300014325 Bacteria 955
249 Ga0157380_10066822 3300014326 Bacteria 2893
250 Ga0157380_10078112 3300014326 Bacteria 2699
251 Ga0157380_10269341 3300014326 Bacteria 1552
252 Ga0157380_10540231 3300014326 Bacteria 1141
253 Ga0157380_11258439 3300014326 Bacteria 786
254 Ga0157377_10202450 3300014745 Bacteria 1261
255 Ga0157377_10301464 3300014745 Bacteria 1058
256 Ga0157379_10116085 3300014968 Bacteria 2407
257 Ga0157379_10480342 3300014968 Bacteria 1150
258 Ga0157376_10270818 3300014969 Bacteria 1595
259 Ga0157376_10774062 3300014969 Bacteria 971
260 Ga0157376_10832450 3300014969 Bacteria 937
261 Ga0163161_10124545 3300017792 Bacteria 1939
262 Ga0206353_10906612 3300020082 Bacteria 1879
263 Ga0213876_10142747 3300021384 Bacteria 1273
264 Ga0213875_10097720 3300021388 Bacteria 1370
265 Ga0209758_1000985 3300025297 Bacteria 38269
266 Ga0209758_1003626 3300025297 Bacteria 13803
267 Ga0209758_1013461 3300025297 Bacteria 4455
268 Ga0209758_1035328 3300025297 Bacteria 1972
269 Ga0207656_10115082 3300025321 Bacteria 1247
270 Ga0207692_10491071 3300025898 Bacteria 778
271 Ga0207642_10451796 3300025899 Bacteria 779
272 Ga0207688_10034599 3300025901 Bacteria 2798
273 Ga0207688_10385170 3300025901 Bacteria 868
274 Ga0207688_10524318 3300025901 Bacteria 743
275 Ga0207680_10466582 3300025903 Bacteria 897
276 Ga0207680_10676405 3300025903 Bacteria 739
277 Ga0207680_10689917 3300025903 Bacteria 732
278 Ga0207647_10074732 3300025904 Bacteria 2041
279 Ga0207645_10072019 3300025907 Bacteria 2212
280 Ga0207645_10145467 3300025907 Bacteria 1545
281 Ga0207645_10520758 3300025907 Bacteria 806
282 Ga0207643_10135578 3300025908 Bacteria 1467
283 Ga0207643_10176059 3300025908 Bacteria 1293
284 Ga0207705_10085125 3300025909 Bacteria 2309
285 Ga0207705_10086285 3300025909 Bacteria 2294
286 Ga0207654_10051886 3300025911 Bacteria 2362
287 Ga0207654_10159914 3300025911 Bacteria 1454
288 Ga0207707_10028075 3300025912 Bacteria 4919
289 Ga0207695_10000029 3300025913 Bacteria 548364
290 Ga0207695_10140999 3300025913 Bacteria 2359
291 Ga0207671_10004429 3300025914 Bacteria 13452
292 Ga0207671_10095228 3300025914 Bacteria 2248
293 Ga0207671_10579314 3300025914 Bacteria 895
294 Ga0207693_10587227 3300025915 Bacteria 868
295 Ga0207663_10080525 3300025916 Bacteria 2130
296 Ga0207662_10083223 3300025918 Bacteria 1956
297 Ga0207662_10114453 3300025918 Bacteria 1685
298 Ga0207657_10094474 3300025919 Bacteria 2490
299 Ga0207657_10199045 3300025919 Bacteria 1612
300 Ga0207649_10131004 3300025920 Bacteria 1703
301 Ga0207649_10270384 3300025920 Bacteria 1232
302 Ga0207681_10113174 3300025923 Bacteria 1978
303 Ga0207694_10082147 3300025924 Bacteria 2532
304 Ga0207694_10193906 3300025924 Bacteria 1651
305 Ga0207659_10477106 3300025926 Bacteria 1053
306 Ga0207659_10808419 3300025926 Bacteria 805
307 Ga0207687_10005254 3300025927 Bacteria 8587
308 Ga0207687_10015601 3300025927 Bacteria 4984
309 Ga0207687_10880713 3300025927 Bacteria 766
310 Ga0207644_10102427 3300025931 Bacteria 2153
311 Ga0207644_10117155 3300025931 Bacteria 2023
312 Ga0207644_10277800 3300025931 Bacteria 1344
313 Ga0207644_10347026 3300025931 Bacteria 1204
314 Ga0207690_10183610 3300025932 Bacteria 1577
315 Ga0207706_10066724 3300025933 Bacteria 3167
316 Ga0207706_10074068 3300025933 Bacteria 2994
317 Ga0207706_10080979 3300025933 Bacteria 2854
318 Ga0207706_10482909 3300025933 Bacteria 1070
319 Ga0207709_10111699 3300025935 Bacteria 1829
320 Ga0207709_10329587 3300025935 Bacteria 1145
321 Ga0207709_10337270 3300025935 Bacteria 1133
322 Ga0207709_10866675 3300025935 Bacteria 732
323 Ga0207669_10142682 3300025937 Bacteria 1665
324 Ga0207669_10213518 3300025937 Bacteria 1410
325 Ga0207669_10415801 3300025937 Bacteria 1057
326 Ga0207704_10116650 3300025938 Bacteria 1817
327 Ga0207704_10850792 3300025938 Bacteria 764
328 Ga0207691_10174605 3300025940 Bacteria 1880
329 Ga0207691_10542519 3300025940 Bacteria 986
330 Ga0207711_10052165 3300025941 Bacteria 3504
331 Ga0207711_10115295 3300025941 Bacteria 2394
332 Ga0207711_10964529 3300025941 Bacteria 792
333 Ga0207689_10005883 3300025942 Bacteria 10865
334 Ga0207689_10011601 3300025942 Bacteria 7550
335 Ga0207689_10312229 3300025942 Bacteria 1304
336 Ga0207679_10937553 3300025945 Bacteria 793
337 Ga0207667_10026723 3300025949 Bacteria 6300
338 Ga0207651_10251136 3300025960 Bacteria 1447
339 Ga0207651_10769483 3300025960 Bacteria 852
340 Ga0207712_10281379 3300025961 Bacteria 1358
341 Ga0207668_10084183 3300025972 Bacteria 2316
342 Ga0207668_10132430 3300025972 Bacteria 1905
343 Ga0207668_10174451 3300025972 Bacteria 1689
344 Ga0207668_10251503 3300025972 Bacteria 1435
345 Ga0207668_10620672 3300025972 Bacteria 943
346 Ga0207640_10114827 3300025981 Bacteria 1917
347 Ga0207640_10419749 3300025981 Bacteria 1094
348 Ga0207658_10621520 3300025986 Bacteria 972
349 Ga0207677_10053459 3300026023 Bacteria 2749
350 Ga0207677_10115699 3300026023 Bacteria 2006
351 Ga0207677_10743684 3300026023 Bacteria 873
352 Ga0207703_10082858 3300026035 Bacteria 2678
353 Ga0207703_10107705 3300026035 Bacteria 2373
354 Ga0207703_10694575 3300026035 Bacteria 967
355 Ga0207639_10139566 3300026041 Bacteria 2017
356 Ga0207639_10294426 3300026041 Bacteria 1432
357 Ga0207639_10648440 3300026041 Bacteria 977
358 Ga0207639_10764285 3300026041 Bacteria 899
359 Ga0207639_10774530 3300026041 Bacteria 893
360 Ga0207639_11255048 3300026041 Bacteria 695
361 Ga0207678_10025070 3300026067 Bacteria 5208
362 Ga0207678_10031460 3300026067 Bacteria 4629
363 Ga0207678_10059213 3300026067 Bacteria 3295
364 Ga0207678_10090020 3300026067 Bacteria 2623
365 Ga0207678_10112481 3300026067 Bacteria 2322
366 Ga0207678_10156024 3300026067 Bacteria 1949
367 Ga0207678_10346593 3300026067 Bacteria 1281
368 Ga0207678_10939353 3300026067 Bacteria 765
369 Ga0207708_10034110 3300026075 Bacteria 3870
370 Ga0207708_10125338 3300026075 Bacteria 2004
371 Ga0207708_10368762 3300026075 Bacteria 1182
372 Ga0207708_10390778 3300026075 Bacteria 1148
373 Ga0207702_10254207 3300026078 Bacteria 1651
374 Ga0207702_10272787 3300026078 Bacteria 1596
375 Ga0207641_11873250 3300026088 Bacteria 601
376 Ga0207648_10065813 3300026089 Bacteria 3160
377 Ga0207648_10215132 3300026089 Bacteria 1707
378 Ga0207648_10374739 3300026089 Bacteria 1286
379 Ga0207648_10487881 3300026089 Bacteria 1126
380 Ga0207675_100166500 3300026118 Bacteria 2105
381 Ga0207675_100294877 3300026118 Bacteria 1578
382 Ga0207683_10040885 3300026121 Bacteria 4048
383 Ga0207683_10054197 3300026121 Bacteria 3516
384 Ga0207683_10088266 3300026121 Bacteria 2759
385 Ga0207683_10227828 3300026121 Bacteria 1699
386 Ga0207683_10607605 3300026121 Bacteria 1012
387 Ga0207683_11337950 3300026121 Bacteria 663
388 Ga0207698_10192374 3300026142 Bacteria 1819
389 Ga0207698_10797429 3300026142 Bacteria 946
390 Ga0209588_1087317 3300027671 Bacteria 1006
391 Ga0209813_10017887 3300027866 Bacteria 1951
392 Ga0209813_10066776 3300027866 Bacteria 1161
393 Ga0207428_10335482 3300027907 Bacteria 1114
394 Ga0268266_10027291 3300028379 Bacteria 4855
395 Ga0268266_10043815 3300028379 Bacteria 3824
396 Ga0268266_10073299 3300028379 Bacteria 2971
397 Ga0268266_10107917 3300028379 Bacteria 2462
398 Ga0268266_10262363 3300028379 Bacteria 1601
399 Ga0268266_10364608 3300028379 Bacteria 1360
400 Ga0268265_10101422 3300028380 Bacteria 2325
401 Ga0268265_10108441 3300028380 Bacteria 2260
402 Ga0268265_10307242 3300028380 Bacteria 1430
403 Ga0268265_10377179 3300028380 Bacteria 1303
404 Ga0268265_10612343 3300028380 Bacteria 1042
405 Ga0268264_10091442 3300028381 Bacteria 2625
406 Ga0307515_10434567 3300028794 Bacteria 930
407 Ga0307513_10103505 3300031456 Bacteria 2863
408 Ga0307513_10562130 3300031456 Bacteria 852
409 Ga0307508_10341917 3300031616 Bacteria 1088
410 Ga0265314_10053944 3300031711 Bacteria 2785
411 Ga0307516_10115434 3300031730 Bacteria 2481
412 Ga0307516_10415916 3300031730 Bacteria 1003
413 Ga0307516_10519149 3300031730 Bacteria 845
414 Ga0307413_10055027 3300031824 Bacteria 2418
415 Ga0307413_10148543 3300031824 Bacteria 1630
416 Ga0307413_10692892 3300031824 Bacteria 845
417 Ga0307406_10037813 3300031901 Bacteria 2984
418 Ga0307407_10118370 3300031903 Bacteria 1675
419 Ga0307416_100227441 3300032002 Bacteria 1795
420 Ga0307416_100253315 3300032002 Bacteria 1715
421 Ga0307416_100492670 3300032002 Bacteria 1288
422 Ga0307416_100801199 3300032002 Bacteria 1038
423 Ga0307414_10446806 3300032004 Bacteria 1133
424 Ga0307411_10008427 3300032005 Bacteria 5341
425 Ga0307415_100140424 3300032126 Bacteria 1844
426 Ga0307415_100259400 3300032126 Bacteria 1417
427 Ga0307415_100397498 3300032126 Bacteria 1175
428 Ga0307510_10020511 3300033180 Bacteria 7722
429 Ga0307510_10048751 3300033180 Bacteria 4515
430 Ga0373938_0036414 3300034957 Bacteria 1077
431 Ga0373944_0030708 3300035089 Bacteria 1613
432 Ga0373932_0119589 3300035112 Bacteria 877
433 Ga0373936_0052181 3300035113 Bacteria 1656
434 Ga0373936_0128332 3300035113 Bacteria 1088
435 Ga0373939_0162366 3300035114 Bacteria 821
436 Ga0373941_0106023 3300035115 Bacteria 985
437 Ga0373953_0113223 3300035117 Bacteria 1149
438 Ga0373943_0429405 3300035170 Bacteria 765
439 Ga0373946_0272351 3300035171 Bacteria 831
440 Ga0373927_0002398 3300035695 Bacteria 13655
441 Ga0373927_0048122 3300035695 Bacteria 2758
442 Ga0373927_0178177 3300035695 Bacteria 1394
443 Ga0373947_0019775 3300035725 Bacteria 3885
444 Ga0373947_0351947 3300035725 Bacteria 988
445 Ga0373937_0840145 3300036401 Bacteria 867
446 Ga0395899_0036479 3300037312 Bacteria 3688
447 Ga0395900_0067388 3300037418 Bacteria 3677
448 Ga0395898_0079825 3300037466 Bacteria 3156
449 Ga0436364_0235668 3300037853 Bacteria 1439
450 Ga0395901_0037942 3300038443 Bacteria 4982
451 Ga0436365_0340129 3300039437 Bacteria 4948
452 Ga0436365_0494884 3300039437 Bacteria 1453
453 Ga0436365_1719200 3300039437 Bacteria 931
454 Ga0436360_0408208 3300039438 Bacteria 506
455 Ga0436360_0783668 3300039438 Bacteria 1697
456 Ga0436363_0805254 3300039450 Bacteria 1126
457 Ga0439461_0026640 3300041410 Bacteria 1181
458 Ga0439465_0155916 3300041413 Bacteria 817
459 Ga0451798_0786751 3300041458 Bacteria 721
460 Ga0451807_0046564 3300041486 Bacteria 735
461 Ga0451853_3272845 3300041512 Bacteria 730
462 Ga0439458_0021415 3300042157 Bacteria 1497
463 Ga0439459_0025338 3300042438 Bacteria 1170
464 Ga0466969_0259810 3300044656 Bacteria 787
465 Ga0466966_0172431 3300044684 Bacteria 1314
466 Ga0466961_0115384 3300044693 Bacteria 1688
467 Ga0466968_0343020 3300044735 Bacteria 725
468 Ga0466970_0074455 3300044765 Bacteria 1828
469 Ga0466970_0091427 3300044765 Bacteria 1652
470 Ga0466957_0028641 3300044842 Bacteria 3317
471 Ga0466957_0064965 3300044842 Bacteria 2246
472 Ga0466959_0010798 3300045049 Bacteria 6545
473 Ga0466959_0089526 3300045049 Bacteria 2211
474 Ga0466958_0403794 3300045836 Bacteria 882
475 Ga0466967_0144321 3300045976 Bacteria 2219
476 Ga0495617_109110 3300046452 Bacteria 896
477 Ga0495603_0006144 3300046455 Bacteria 7180
478 Ga0495603_0070194 3300046455 Bacteria 2059
479 Ga0495603_0166800 3300046455 Bacteria 1276
480 Ga0495629_0011197 3300046459 Bacteria 6513
481 Ga0495629_0086877 3300046459 Bacteria 2182
482 Ga0495629_0267915 3300046459 Bacteria 1174
483 Ga0495629_0637960 3300046459 Bacteria 710
484 Ga0495638_0149171 3300046460 Bacteria 1357
485 Ga0495638_0336822 3300046460 Bacteria 801
486 Ga0495651_0024139 3300046462 Bacteria 4730
487 Ga0495651_0110438 3300046462 Bacteria 2034
488 Ga0495651_0215512 3300046462 Bacteria 1333
489 Ga0495650_0121843 3300046471 Bacteria 959
490 Ga0495650_0153081 3300046471 Bacteria 827
491 Ga0495650_0164152 3300046471 Bacteria 790
492 Ga0495580_0042262 3300046472 Bacteria 3248
493 Ga0495580_0089320 3300046472 Bacteria 2145
494 Ga0495605_0052473 3300046474 Bacteria 1981
495 Ga0495605_0134320 3300046474 Bacteria 1114
496 Ga0495605_0350669 3300046474 Bacteria 619
497 Ga0495639_0133646 3300046475 Bacteria 1189
498 Ga0495584_0076516 3300046491 Bacteria 1683
499 Ga0495584_0106389 3300046491 Bacteria 1418
500 Ga0495584_0322495 3300046491 Bacteria 784
501 Ga0495584_0450604 3300046491 Bacteria 655
502 Ga0495594_0056838 3300046499 Bacteria 2160
503 Ga0495596_0156325 3300046500 Bacteria 886
504 Ga0495596_0196743 3300046500 Bacteria 783
505 Ga0495596_0213552 3300046500 Bacteria 749
506 Ga0495583_0047731 3300046506 Bacteria 1968
507 Ga0495583_0209883 3300046506 Bacteria 789
508 Ga0495606_0047902 3300046507 Bacteria 2815
509 Ga0495606_0199517 3300046507 Bacteria 1141
510 Ga0495608_0084386 3300046511 Bacteria 2060
511 Ga0495616_0105711 3300046513 Bacteria 1314
512 Ga0495620_0060287 3300046515 Bacteria 1582
513 Ga0495628_0140624 3300046516 Bacteria 1842
514 Ga0495631_0057808 3300046518 Bacteria 1687
515 Ga0495631_0189687 3300046518 Bacteria 880
516 Ga0495631_0209924 3300046518 Bacteria 832
517 Ga0495631_0281015 3300046518 Bacteria 709
518 Ga0495632_0064144 3300046519 Bacteria 1777
519 Ga0495632_0361576 3300046519 Bacteria 637
520 Ga0495637_0262250 3300046520 Bacteria 620
521 Ga0495643_0110724 3300046522 Bacteria 1396
522 Ga0495643_0252246 3300046522 Bacteria 823
523 Ga0495644_0137573 3300046523 Bacteria 932
524 Ga0495648_0127801 3300046524 Bacteria 1355
525 Ga0495648_0317510 3300046524 Bacteria 723
526 Ga0495663_0011224 3300046525 Bacteria 2493
527 Ga0495663_0083284 3300046525 Bacteria 1033
528 Ga0495652_0072469 3300046529 Bacteria 2871
529 Ga0495640_0060054 3300046533 Bacteria 2587
530 Ga0495587_0089314 3300046536 Bacteria 1781
531 Ga0495621_0071720 3300046539 Bacteria 1277
532 Ga0495645_0048550 3300046543 Bacteria 3091
533 Ga0495622_0116348 3300046557 Bacteria 1222
534 Ga0495622_0129839 3300046557 Bacteria 1148
535 Ga0495622_0242738 3300046557 Bacteria 794
536 Ga0495633_0187074 3300046558 Bacteria 952
537 Ga0495667_0036231 3300046559 Bacteria 3294
538 Ga0495656_0029757 3300046615 Bacteria 2201
539 Ga0495656_0345825 3300046615 Bacteria 770
540 Ga0495668_0286390 3300046616 Bacteria 903
541 Ga0495625_0123621 3300046660 Bacteria 1758
542 Ga0495625_0334822 3300046660 Bacteria 960
543 Ga0495635_0014780 3300046663 Bacteria 5460
544 Ga0495635_0046685 3300046663 Bacteria 2988
545 Ga0495635_0277228 3300046663 Bacteria 1127
546 Ga0495659_0022219 3300046664 Bacteria 2144
547 Ga0495661_0217479 3300046665 Bacteria 992
548 Ga0495661_0375449 3300046665 Bacteria 695
549 Ga0495588_0037026 3300046674 Bacteria 2477
550 Ga0495588_0271178 3300046674 Bacteria 894
551 Ga0495588_0285768 3300046674 Bacteria 869
552 Ga0495588_0310230 3300046674 Bacteria 830
553 Ga0495657_0033421 3300046675 Bacteria 3581
554 Ga0495657_0055723 3300046675 Bacteria 2636
555 Ga0495599_0007980 3300046678 Bacteria 6423
556 Ga0495623_0025778 3300046679 Bacteria 3786
557 Ga0495646_0055302 3300046680 Bacteria 2384
558 Ga0495669_0026812 3300046684 Bacteria 2518
559 Ga0495669_0173125 3300046684 Bacteria 1027
560 Ga0495624_0038576 3300046690 Bacteria 3069
561 Ga0495624_0513007 3300046690 Bacteria 717
562 Ga0495670_0065183 3300046691 Bacteria 1836
563 Ga0495670_0596180 3300046691 Bacteria 602
564 Ga0495589_0030869 3300046794 Bacteria 2699
565 Ga0495589_0196109 3300046794 Bacteria 954
566 Ga0495600_0068898 3300046809 Bacteria 2312
567 Ga0495581_0072556 3300047315 Bacteria 1992
568 Ga0495581_0101705 3300047315 Bacteria 1670
569 Ga0495581_0158965 3300047315 Bacteria 1321
570 Ga0495581_0204597 3300047315 Bacteria 1155
571 Ga0495604_0038876 3300047317 Bacteria 3743
572 Ga0495604_0109764 3300047317 Bacteria 2013
573 Ga0495604_0462111 3300047317 Bacteria 828
574 Ga0495636_0192362 3300047318 Bacteria 929
575 Ga0495672_0007046 3300047320 Bacteria 8534
576 Ga0495672_0120306 3300047320 Bacteria 1397
577 Ga0495672_0157257 3300047320 Bacteria 1172
578 Ga0495676_0016628 3300047321 Bacteria 6519
579 Ga0495683_0084797 3300047323 Bacteria 1541
580 Ga0495675_0167375 3300047444 Bacteria 1351
581 Ga0495677_0057264 3300047445 Bacteria 1440
582 Ga0495677_0103031 3300047445 Bacteria 1081
583 Ga0495677_0104107 3300047445 Bacteria 1076
584 Ga0495679_045976 3300047446 Bacteria 1331
585 Ga0495681_0285805 3300047470 Bacteria 642
586 Ga0495686_0062893 3300047472 Bacteria 2301
587 Ga0495686_0101898 3300047472 Bacteria 1731
588 Ga0495686_0335076 3300047472 Bacteria 826
589 Ga0495593_0070879 3300047673 Bacteria 1810
590 Ga0495602_0328357 3300048088 Bacteria 1110
591 Ga0496101_0162360 3300048904 Bacteria 1714
592 Ga0496101_0197250 3300048904 Bacteria 1555
593 Ga0496102_0269817 3300048905 Bacteria 1604
594 Ga0496102_0938838 3300048905 Bacteria 786
595 Ga0496102_1164509 3300048905 Bacteria 690
596 Ga0496103_0242193 3300048906 Bacteria 1160
597 Ga0496103_0266377 3300048906 Bacteria 1102
598 Ga0496104_0125195 3300048907 Bacteria 2467
599 Ga0496105_0000604 3300048908 Bacteria 23990
600 Ga0496105_0879704 3300048908 Bacteria 676
601 Ga0496106_0265819 3300048909 Bacteria 1373
602 Ga0496106_0359586 3300048909 Bacteria 1169
603 Ga0496107_0065695 3300048910 Bacteria 2630
604 Ga0496107_0356894 3300048910 Bacteria 1088
605 Ga0496107_0418916 3300048910 Bacteria 996
606 Ga0496108_0098905 3300048911 Bacteria 2486
607 Ga0496108_0131047 3300048911 Bacteria 2155
608 Ga0496108_0936159 3300048911 Bacteria 742
609 Ga0496109_0022595 3300048912 Bacteria 5572
610 Ga0496109_0401265 3300048912 Bacteria 1295
611 Ga0496110_0035235 3300048913 Bacteria 4341
612 Ga0496110_0378893 3300048913 Bacteria 1289
613 Ga0496110_0607317 3300048913 Bacteria 992
614 Ga0496111_0186627 3300048914 Bacteria 1541
615 Ga0496112_0046085 3300048915 Bacteria 4275
616 Ga0496112_0113128 3300048915 Bacteria 2685
617 Ga0496112_0249902 3300048915 Bacteria 1725
618 Ga0496112_1176154 3300048915 Bacteria 684
619 Ga0496113_0044645 3300048916 Bacteria 3284
620 Ga0496113_0233708 3300048916 Bacteria 1466
621 Ga0496114_0594517 3300048917 Bacteria 976
622 Ga0496115_0021495 3300048918 Bacteria 4987
623 Ga0496115_0630859 3300048918 Bacteria 849
624 Ga0496115_0856131 3300048918 Bacteria 704
625 Ga0496117_0181870 3300048920 Bacteria 1207
626 Ga0496117_0413266 3300048920 Bacteria 677
627 Ga0496118_0292197 3300048921 Bacteria 900
628 Ga0496119_0008122 3300048922 Bacteria 9294
629 Ga0496119_0032435 3300048922 Bacteria 3481
630 Ga0496119_0199157 3300048922 Bacteria 1038
631 Ga0496120_0013856 3300048923 Bacteria 5401
632 Ga0496121_0002948 3300048924 Bacteria 24844
633 Ga0496121_0042370 3300048924 Bacteria 3961
634 Ga0496121_0110094 3300048924 Bacteria 2102
635 Ga0496121_0252342 3300048924 Bacteria 1223
636 Ga0496121_0322912 3300048924 Bacteria 1039
637 Ga0496121_0504353 3300048924 Bacteria 767
638 Ga0496122_0178924 3300048925 Bacteria 1268
639 Ga0496124_0234700 3300048927 Bacteria 1368
640 Ga0496124_0538739 3300048927 Bacteria 773
641 Ga0496125_0137555 3300048928 Bacteria 1705
642 Ga0496126_0008100 3300048929 Bacteria 11382
643 Ga0496126_0037281 3300048929 Bacteria 4538
644 Ga0496126_0040677 3300048929 Bacteria 4308
645 Ga0496126_0089438 3300048929 Bacteria 2710
646 Ga0496126_0239483 3300048929 Bacteria 1516
647 Ga0496126_0281905 3300048929 Bacteria 1376
648 Ga0496126_0809822 3300048929 Bacteria 718
649 Ga0495682_0024602 3300049460 Bacteria 2244
650 Ga0501032_0208263 3300049569 Bacteria 1275
651 Ga0501034_0011046 3300049571 Bacteria 9377
652 Ga0501036_0435467 3300049572 Bacteria 1093
653 Ga0501037_0125002 3300049573 Bacteria 1847
654 Ga0501038_0164657 3300049574 Bacteria 1800
655 Ga0501038_0448295 3300049574 Bacteria 993
656 Ga0501041_0122508 3300049577 Bacteria 1617
657 Ga0501043_0077598 3300049579 Bacteria 2609
658 Ga0501043_0331023 3300049579 Bacteria 1160
659 Ga0501046_0071191 3300049580 Bacteria 2702
660 Ga0501046_0099332 3300049580 Bacteria 2234
661 Ga0501046_0225574 3300049580 Bacteria 1386
662 Ga0501047_0007633 3300049581 Bacteria 10184
663 Ga0501047_0171437 3300049581 Bacteria 2038
664 Ga0501047_0432185 3300049581 Bacteria 1147
665 Ga0501048_0259256 3300049582 Bacteria 1235
666 Ga0501067_0129902 3300049583 Bacteria 1402
667 Ga0501069_0163716 3300049585 Bacteria 1281
668 Ga0501073_0039107 3300049589 Bacteria 3362
669 Ga0501073_0220068 3300049589 Bacteria 1312
670 Ga0501074_0114840 3300049590 Bacteria 1926
671 Ga0501076_0196800 3300049592 Bacteria 1645
672 Ga0501079_0573205 3300049741 Bacteria 888
673 Ga0501080_0008285 3300049742 Bacteria 9418
674 Ga0501035_0004697 3300049822 Bacteria 12968
675 Ga0501044_0006221 3300049823 Bacteria 13197
676 Ga0501044_0092259 3300049823 Bacteria 3054
677 Ga0501045_0392909 3300049824 Bacteria 1032
678 nmdc:mga03683_20304_c1 3300050489 Bacteria 2548
679 nmdc:mga03683_329997_c1 3300050489 Bacteria 719
680 nmdc:mga03n38_564_c1 3300050490 Bacteria 9383
681 nmdc:mga03n38_91822_c1 3300050490 Bacteria 1447
682 nmdc:mga0yw44_373080_c1 3300050492 Bacteria 963
683 nmdc:mga0yw44_60304_c1 3300050492 Bacteria 2324
684 nmdc:mga0yw44_67268_c1 3300050492 Bacteria 2214
685 nmdc:mga0k408_191398_c1 3300050493 Bacteria 1221
686 nmdc:mga06z11_23603_c1 3300050494 Bacteria 2892
687 nmdc:mga06z11_240373_c1 3300050494 Bacteria 1063
688 nmdc:mga06z11_370253_c1 3300050494 Bacteria 860
689 nmdc:mga06z11_395157_c1 3300050494 Bacteria 832
690 nmdc:mga06z11_80931_c1 3300050494 Bacteria 1743
691 nmdc:mga04h51_166754_c1 3300050495 Bacteria 850
692 nmdc:mga04h51_52968_c1 3300050495 Bacteria 1368
693 nmdc:mga04h51_68718_c1 3300050495 Bacteria 1232
694 nmdc:mga05p37_1159280_c1 3300050507 Bacteria 803
695 nmdc:mga05p37_51457_c1 3300050507 Bacteria 5065
696 nmdc:mga0qj67_466479_c1 3300050509 Bacteria 1016
697 nmdc:mga06r32_755185_c1 3300050510 Bacteria 935
698 nmdc:mga08y16_39562_c1 3300050511 Bacteria 4947
699 nmdc:mga08y16_722752_c1 3300050511 Bacteria 994
700 nmdc:mga0n895_159874_c1 3300050512 Bacteria 2284
701 nmdc:mga0rr50_185980_c1 3300050513 Bacteria 1700
702 nmdc:mga08x19_57821_c1 3300050514 Bacteria 2507
703 nmdc:mga0a205_763381_c1 3300050515 Bacteria 815
704 nmdc:mga0sz30_61256_c1 3300050516 Bacteria 1608
705 Ga0495601_0260623 3300053077 Bacteria 1132
706 Ga0495655_0069296 3300053083 Bacteria 982
707 Ga0495619_0100389 3300053085 Bacteria 1969
708 Ga0500578_0161478 3300053086 Bacteria 1390
709 Ga0500581_197341 3300053089 Bacteria 897
710 Ga0500651_0158717 3300053093 Bacteria 1353
711 Ga0500566_0009632 3300053094 Bacteria 5709
712 Ga0500641_0020381 3300053096 Bacteria 2517
713 Ga0500641_0039355 3300053096 Bacteria 1904
714 Ga0500650_0393705 3300053098 Bacteria 600
715 Ga0500654_137600 3300053099 Bacteria 902
716 Ga0500554_005797 3300053102 Bacteria 2726
717 Ga0500555_017570 3300053103 Bacteria 2061
718 Ga0500557_036900 3300053105 Bacteria 1514
719 Ga0500595_000641 3300053119 Bacteria 20993
720 Ga0500595_013642 3300053119 Bacteria 3108
721 Ga0500614_107495 3300053123 Bacteria 810
722 Ga0500614_187440 3300053123 Bacteria 634
723 Ga0500655_010024 3300053133 Bacteria 1708
724 Ga0500658_0036911 3300053134 Bacteria 1941
725 Ga0500559_0025139 3300053136 Bacteria 2534
726 Ga0500559_0123218 3300053136 Bacteria 1206
727 Ga0500568_0050403 3300053139 Bacteria 1641
728 Ga0500577_0128709 3300053142 Bacteria 1059
729 Ga0500585_119596 3300053144 Bacteria 940
730 Ga0500589_051175 3300053147 Bacteria 1915
731 Ga0500589_240818 3300053147 Bacteria 669
732 Ga0500622_0141006 3300053156 Bacteria 1149
733 Ga0500638_001395 3300053162 Bacteria 7523
734 Ga0500638_075125 3300053162 Bacteria 1611
735 Ga0500637_0000223 3300053178 Bacteria 21034
736 Ga0500661_001922 3300055283 Bacteria 3920
737 Ga0500661_002169 3300055283 Bacteria 3704
738 Ga0530510_0278926 3300061734 Bacteria 1248
739 2513695412 2513237101 Bacteria 7952346
740 2513891892 2513237141 Bacteria 8496279
741 2723843802 2721755755 Bacteria 8322773
742 2793079364
743 2874612217 2874604998 Bacteria 7834745
744 2879114734 2879110137 Bacteria 8907982
745 2888388438 2888388044 Bacteria 7304136
746 2889041999 2889033259 Bacteria 9099371
747 2922366132 2922361189 Bacteria 7436256
748 2922386784 2922386360 Bacteria 7017218
749 2932801490 2932794094 Bacteria 7915132
750 2932804964 2932801729 Bacteria 7987968
751 2935884798 2935883170 Bacteria 7964738
752 2941537843 2941531003 Bacteria 7653939
753 3005512361 3005506211 Bacteria 6943378
754 3005597282 3005594810 Bacteria 8716512
755 3005720663 3005718088 Bacteria 8283608
756 8006964985 8006964411 Bacteria 8966052
757 8006988629 8006984368 Bacteria 9651211
758 8006994348 8006994254 Bacteria 8309700
759 8019656294 8019648815 Bacteria 10014479
760 8056679878 8056673599 Bacteria 7871253
761 Ga0207657_10513386
762 JGI24750J21931_1027633
763 JGI24744J21845_10041856
764 JGI25406J46586_10008922
765 JGI25153J46596_10001823
766 JGI25153J46596_10009963
767 rootH2_10033957
768 rootH1_10230076
769 JGI25404J52841_10020828
770 Ga0065704_10236416
771 Ga0070658_10042987
772 Ga0070658_10105537
773 Ga0070658_10606777
774 Ga0070683_100022389
775 Ga0070690_100227490
776 Ga0070670_100370450
777 Ga0070677_10506280
778 Ga0068869_100139713
779 Ga0070666_10154518
780 Ga0070666_10291694
781 Ga0070666_10353589
782 Ga0070682_100094616
783 Ga0068868_100051990
784 Ga0068868_100299395
785 Ga0068868_100643251
786 Ga0070660_100200681
787 Ga0070660_100527579
788 Ga0070689_100186860
789 Ga0070689_100230423
790 Ga0070687_100249753
791 Ga0070687_100377505
792 Ga0070661_100098600
793 Ga0070661_100687536
794 Ga0070692_10068777
795 Ga0070668_100230939
796 Ga0070668_100246922
797 Ga0070668_100327792
798 Ga0070668_100352784
799 Ga0070668_100663014
800 Ga0070669_100186698
801 Ga0070675_100374358
802 Ga0070671_100469856
803 Ga0070674_100130349
804 Ga0070674_100267047
805 Ga0070674_100580186
806 Ga0070673_100312385
807 Ga0070673_100327987
808 Ga0070688_100081049
809 Ga0070688_100202118
810 Ga0070659_100208168
811 Ga0070667_100394054
812 Ga0070709_10081557
813 Ga0070701_10124902
814 Ga0070701_10236492
815 Ga0070711_100366011
816 Ga0070700_100056021
817 Ga0070700_100071185
818 Ga0070700_100353959
819 Ga0070700_100651568
820 Ga0070694_101354369
821 Ga0070708_100076759
822 Ga0070663_100007102
823 Ga0070663_100009408
824 Ga0070663_100045393
825 Ga0070663_100062950
826 Ga0070663_100138991
827 Ga0070663_100623522
828 Ga0070663_100891661
829 Ga0070678_100044893
830 Ga0070678_100082389
831 Ga0070678_100193068
832 Ga0070678_100371843
833 Ga0070678_100404495
834 Ga0070662_100027557
835 Ga0070662_100109605
836 Ga0070662_100389361
837 Ga0070681_10020582
838 Ga0068867_100111242
839 Ga0068867_101286327
840 Ga0070706_100461518
841 Ga0070707_100722592
842 Ga0070698_100051365
843 Ga0070699_100493012
844 Ga0070679_100109637
845 Ga0070679_100913310
846 Ga0070697_100617111
847 Ga0068853_100031053
848 Ga0068853_100374424
849 Ga0068853_100396883
850 Ga0070686_100082317
851 Ga0070686_100418921
852 Ga0070686_101238465
853 Ga0070695_100371679
854 Ga0070696_100694743
855 Ga0070665_100003902
856 Ga0070665_100012589
857 Ga0070665_100174661
858 Ga0070665_100240643
859 Ga0070665_100276363
860 Ga0070665_100481045
861 Ga0070665_100650074
862 Ga0070665_100777418
863 Ga0068855_100040307
864 Ga0068855_100150901
865 Ga0070664_100694054
866 Ga0068857_100118307
867 Ga0068857_100910438
868 Ga0068857_101308052
869 Ga0068854_100523853
870 Ga0068856_100349307
871 Ga0068856_100742381
872 Ga0070702_100037821
873 Ga0070702_100056054
874 Ga0070702_100843322
875 Ga0068852_100059782
876 Ga0068852_100353313
877 Ga0068852_100625134
878 Ga0068852_100941525
879 Ga0068859_100088964
880 Ga0068859_100180859
881 Ga0068864_100256800
882 Ga0068864_100371969
883 Ga0068866_10083224
884 Ga0068866_10096615
885 Ga0068861_100083104
886 Ga0068861_100111043
887 Ga0068861_100420633
888 Ga0068851_10257871
889 Ga0068870_10179182
890 Ga0068870_10270320
891 Ga0068863_100506975
892 Ga0068863_101441572
893 Ga0068858_100121260
894 Ga0068858_100741816
895 Ga0068860_100524476
896 Ga0068860_100606362
897 Ga0068862_100171897
898 Ga0068862_100219573
899 Ga0068862_100596948
900 Ga0081455_10003404
901 Ga0081455_10033184
902 Ga0081455_10092446
903 Ga0081455_10121550
904 Ga0081455_10194702
905 Ga0081455_10450204
906 Ga0081538_10021089
907 Ga0081540_1001946
908 Ga0081540_1003505
909 Ga0081540_1008381
910 Ga0081540_1028486
911 Ga0081540_1040217
912 Ga0081540_1056043
913 Ga0081539_10000864
914 Ga0081539_10034895
915 Ga0081539_10077476
916 Ga0075365_10013487
917 Ga0075365_10119591
918 Ga0075365_10158083
919 Ga0075365_10266549
920 Ga0075368_10012841
921 Ga0075368_10033659
922 Ga0075368_10043536
923 Ga0075368_10061616
924 Ga0075363_100045014
925 Ga0075363_100209079
926 Ga0075363_100241879
927 Ga0075364_10081020
928 Ga0070712_100759597
929 Ga0075367_10045909
930 Ga0075367_10046141
931 Ga0075367_10103513
932 Ga0075367_10161231
933 Ga0075367_10464543
934 Ga0075369_10069255
935 Ga0075369_10077494
936 Ga0075369_10107735
937 Ga0075366_10085190
938 Ga0075366_10107593
939 Ga0097621_100056345
940 Ga0097621_100147438
941 Ga0097621_100319989
942 Ga0075370_10008976
943 Ga0075370_10127736
944 Ga0068871_100059857
945 Ga0075431_100815430
946 Ga0075434_100102223
947 Ga0075429_100176120
948 Ga0068865_100043803
949 Ga0075436_100233894
950 Ga0097620_100088965
951 Ga0097620_100180853
952 Ga0075435_100427810
953 Ga0099794_10030456
954 Ga0105250_10026150
955 Ga0105240_10017998
956 Ga0105240_10084254
957 Ga0105240_10331311
958 Ga0105240_10562103
959 Ga0105240_10766624
960 Ga0111539_10111250
961 Ga0105245_10034224
962 Ga0105245_10172985
963 Ga0105245_10803194
964 Ga0105247_10072004
965 Ga0105247_10207723
966 Ga0105247_10327119
967 Ga0105247_10491448
968 Ga0114129_10774924
969 Ga0105243_10363047
970 Ga0105243_10774678
971 Ga0105241_10030850
972 Ga0105241_10228472
973 Ga0105241_10776807
974 Ga0105242_10064517
975 Ga0105248_10255811
976 Ga0105248_10775296
977 Ga0105248_11419413
978 Ga0105237_10044496
979 Ga0105237_10110656
980 Ga0105237_10359344
981 Ga0105237_10501319
982 Ga0105237_10897004
983 Ga0105238_10259955
984 Ga0105249_10223665
985 Ga0105249_10961184
986 Ga0099796_10028232
987 Ga0099796_10064065
988 Ga0105239_10037109
989 Ga0105239_10131593
990 Ga0105239_10443281
991 Ga0105239_11212691
992 Ga0105239_12073030
993 Ga0105246_10102850
994 Ga0157370_11197030
995 Ga0157369_10017108
996 Ga0157374_10257036
997 Ga0157374_10356022
998 Ga0157378_10005382
999 Ga0157378_10689515
1000 Ga0163162_10105069
1001 Ga0157375_10235033
1002 Ga0157375_10459338
1003 Ga0157375_10671077
1004 Ga0163163_10153356
1005 Ga0163163_10162866
1006 Ga0163163_10257861
1007 Ga0163163_10527210
1008 Ga0163163_10886838
1009 Ga0157380_10066822
1010 Ga0157380_10078112
1011 Ga0157380_10269341
1012 Ga0157380_10540231
1013 Ga0157380_11258439
1014 Ga0157377_10202450
1015 Ga0157377_10301464
1016 Ga0157379_10116085
1017 Ga0157379_10480342
1018 Ga0157376_10270818
1019 Ga0157376_10774062
1020 Ga0157376_10832450
1021 Ga0163161_10124545
1022 Ga0206353_10906612
1023 Ga0213876_10142747
1024 Ga0213875_10097720
1025 Ga0209758_1000985
1026 Ga0209758_1003626
1027 Ga0209758_1013461
1028 Ga0209758_1035328
1029 Ga0207656_10115082
1030 Ga0207692_10491071
1031 Ga0207642_10451796
1032 Ga0207688_10034599
1033 Ga0207688_10385170
1034 Ga0207688_10524318
1035 Ga0207680_10466582
1036 Ga0207680_10676405
1037 Ga0207680_10689917
1038 Ga0207647_10074732
1039 Ga0207645_10072019
1040 Ga0207645_10145467
1041 Ga0207645_10520758
1042 Ga0207643_10135578
1043 Ga0207643_10176059
1044 Ga0207705_10085125
1045 Ga0207705_10086285
1046 Ga0207654_10051886
1047 Ga0207654_10159914
1048 Ga0207707_10028075
1049 Ga0207695_10000029
1050 Ga0207695_10140999
1051 Ga0207671_10004429
1052 Ga0207671_10095228
1053 Ga0207671_10579314
1054 Ga0207693_10587227
1055 Ga0207663_10080525
1056 Ga0207662_10083223
1057 Ga0207662_10114453
1058 Ga0207657_10094474
1059 Ga0207657_10199045
1060 Ga0207649_10131004
1061 Ga0207649_10270384
1062 Ga0207681_10113174
1063 Ga0207694_10082147
1064 Ga0207694_10193906
1065 Ga0207659_10477106
1066 Ga0207659_10808419
1067 Ga0207687_10005254
1068 Ga0207687_10015601
1069 Ga0207687_10880713
1070 Ga0207644_10102427
1071 Ga0207644_10117155
1072 Ga0207644_10277800
1073 Ga0207644_10347026
1074 Ga0207690_10183610
1075 Ga0207706_10066724
1076 Ga0207706_10074068
1077 Ga0207706_10080979
1078 Ga0207706_10482909
1079 Ga0207709_10111699
1080 Ga0207709_10329587
1081 Ga0207709_10337270
1082 Ga0207709_10866675
1083 Ga0207669_10142682
1084 Ga0207669_10213518
1085 Ga0207669_10415801
1086 Ga0207704_10116650
1087 Ga0207704_10850792
1088 Ga0207691_10174605
1089 Ga0207691_10542519
1090 Ga0207711_10052165
1091 Ga0207711_10115295
1092 Ga0207711_10964529
1093 Ga0207689_10005883
1094 Ga0207689_10011601
1095 Ga0207689_10312229
1096 Ga0207679_10937553
1097 Ga0207667_10026723
1098 Ga0207651_10251136
1099 Ga0207651_10769483
1100 Ga0207712_10281379
1101 Ga0207668_10084183
1102 Ga0207668_10132430
1103 Ga0207668_10174451
1104 Ga0207668_10251503
1105 Ga0207668_10620672
1106 Ga0207640_10114827
1107 Ga0207640_10419749
1108 Ga0207658_10621520
1109 Ga0207677_10053459
1110 Ga0207677_10115699
1111 Ga0207677_10743684
1112 Ga0207703_10082858
1113 Ga0207703_10107705
1114 Ga0207703_10694575
1115 Ga0207639_10139566
1116 Ga0207639_10294426
1117 Ga0207639_10648440
1118 Ga0207639_10764285
1119 Ga0207639_10774530
1120 Ga0207639_11255048
1121 Ga0207678_10025070
1122 Ga0207678_10031460
1123 Ga0207678_10059213
1124 Ga0207678_10090020
1125 Ga0207678_10112481
1126 Ga0207678_10156024
1127 Ga0207678_10346593
1128 Ga0207678_10939353
1129 Ga0207708_10034110
1130 Ga0207708_10125338
1131 Ga0207708_10368762
1132 Ga0207708_10390778
1133 Ga0207702_10254207
1134 Ga0207702_10272787
1135 Ga0207641_11873250
1136 Ga0207648_10065813
1137 Ga0207648_10215132
1138 Ga0207648_10374739
1139 Ga0207648_10487881
1140 Ga0207675_100166500
1141 Ga0207675_100294877
1142 Ga0207683_10040885
1143 Ga0207683_10054197
1144 Ga0207683_10088266
1145 Ga0207683_10227828
1146 Ga0207683_10607605
1147 Ga0207683_11337950
1148 Ga0207698_10192374
1149 Ga0207698_10797429
1150 Ga0209588_1087317
1151 Ga0209813_10017887
1152 Ga0209813_10066776
1153 Ga0207428_10335482
1154 Ga0268266_10027291
1155 Ga0268266_10043815
1156 Ga0268266_10073299
1157 Ga0268266_10107917
1158 Ga0268266_10262363
1159 Ga0268266_10364608
1160 Ga0268265_10101422
1161 Ga0268265_10108441
1162 Ga0268265_10307242
1163 Ga0268265_10377179
1164 Ga0268265_10612343
1165 Ga0268264_10091442
1166 Ga0307515_10434567
1167 Ga0307513_10103505
1168 Ga0307513_10562130
1169 Ga0307508_10341917
1170 Ga0265314_10053944
1171 Ga0307516_10115434
1172 Ga0307516_10415916
1173 Ga0307516_10519149
1174 Ga0307413_10055027
1175 Ga0307413_10148543
1176 Ga0307413_10692892
1177 Ga0307406_10037813
1178 Ga0307407_10118370
1179 Ga0307416_100227441
1180 Ga0307416_100253315
1181 Ga0307416_100492670
1182 Ga0307416_100801199
1183 Ga0307414_10446806
1184 Ga0307411_10008427
1185 Ga0307415_100140424
1186 Ga0307415_100259400
1187 Ga0307415_100397498
1188 Ga0307510_10020511
1189 Ga0307510_10048751
1190 Ga0373938_0036414
1191 Ga0373944_0030708
1192 Ga0373932_0119589
1193 Ga0373936_0052181
1194 Ga0373936_0128332
1195 Ga0373939_0162366
1196 Ga0373941_0106023
1197 Ga0373953_0113223
1198 Ga0373943_0429405
1199 Ga0373946_0272351
1200 Ga0373927_0002398
1201 Ga0373927_0048122
1202 Ga0373927_0178177
1203 Ga0373947_0019775
1204 Ga0373947_0351947
1205 Ga0373937_0840145
1206 Ga0395899_0036479
1207 Ga0395900_0067388
1208 Ga0395898_0079825
1209 Ga0436364_0235668
1210 Ga0395901_0037942
1211 Ga0436365_0340129
1212 Ga0436365_0494884
1213 Ga0436365_1719200
1214 Ga0436360_0408208
1215 Ga0436360_0783668
1216 Ga0436363_0805254
1217 Ga0439461_0026640
1218 Ga0439465_0155916
1219 Ga0451798_0786751
1220 Ga0451807_0046564
1221 Ga0451853_3272845
1222 Ga0439458_0021415
1223 Ga0439459_0025338
1224 Ga0466969_0259810
1225 Ga0466966_0172431
1226 Ga0466961_0115384
1227 Ga0466968_0343020
1228 Ga0466970_0074455
1229 Ga0466970_0091427
1230 Ga0466957_0028641
1231 Ga0466957_0064965
1232 Ga0466959_0010798
1233 Ga0466959_0089526
1234 Ga0466958_0403794
1235 Ga0466967_0144321
1236 Ga0495617_109110
1237 Ga0495603_0006144
1238 Ga0495603_0070194
1239 Ga0495603_0166800
1240 Ga0495629_0011197
1241 Ga0495629_0086877
1242 Ga0495629_0267915
1243 Ga0495629_0637960
1244 Ga0495638_0149171
1245 Ga0495638_0336822
1246 Ga0495651_0024139
1247 Ga0495651_0110438
1248 Ga0495651_0215512
1249 Ga0495650_0121843
1250 Ga0495650_0153081
1251 Ga0495650_0164152
1252 Ga0495580_0042262
1253 Ga0495580_0089320
1254 Ga0495605_0052473
1255 Ga0495605_0134320
1256 Ga0495605_0350669
1257 Ga0495639_0133646
1258 Ga0495584_0076516
1259 Ga0495584_0106389
1260 Ga0495584_0322495
1261 Ga0495584_0450604
1262 Ga0495594_0056838
1263 Ga0495596_0156325
1264 Ga0495596_0196743
1265 Ga0495596_0213552
1266 Ga0495583_0047731
1267 Ga0495583_0209883
1268 Ga0495606_0047902
1269 Ga0495606_0199517
1270 Ga0495608_0084386
1271 Ga0495616_0105711
1272 Ga0495620_0060287
1273 Ga0495628_0140624
1274 Ga0495631_0057808
1275 Ga0495631_0189687
1276 Ga0495631_0209924
1277 Ga0495631_0281015
1278 Ga0495632_0064144
1279 Ga0495632_0361576
1280 Ga0495637_0262250
1281 Ga0495643_0110724
1282 Ga0495643_0252246
1283 Ga0495644_0137573
1284 Ga0495648_0127801
1285 Ga0495648_0317510
1286 Ga0495663_0011224
1287 Ga0495663_0083284
1288 Ga0495652_0072469
1289 Ga0495640_0060054
1290 Ga0495587_0089314
1291 Ga0495621_0071720
1292 Ga0495645_0048550
1293 Ga0495622_0116348
1294 Ga0495622_0129839
1295 Ga0495622_0242738
1296 Ga0495633_0187074
1297 Ga0495667_0036231
1298 Ga0495656_0029757
1299 Ga0495656_0345825
1300 Ga0495668_0286390
1301 Ga0495625_0123621
1302 Ga0495625_0334822
1303 Ga0495635_0014780
1304 Ga0495635_0046685
1305 Ga0495635_0277228
1306 Ga0495659_0022219
1307 Ga0495661_0217479
1308 Ga0495661_0375449
1309 Ga0495588_0037026
1310 Ga0495588_0271178
1311 Ga0495588_0285768
1312 Ga0495588_0310230
1313 Ga0495657_0033421
1314 Ga0495657_0055723
1315 Ga0495599_0007980
1316 Ga0495623_0025778
1317 Ga0495646_0055302
1318 Ga0495669_0026812
1319 Ga0495669_0173125
1320 Ga0495624_0038576
1321 Ga0495624_0513007
1322 Ga0495670_0065183
1323 Ga0495670_0596180
1324 Ga0495589_0030869
1325 Ga0495589_0196109
1326 Ga0495600_0068898
1327 Ga0495581_0072556
1328 Ga0495581_0101705
1329 Ga0495581_0158965
1330 Ga0495581_0204597
1331 Ga0495604_0038876
1332 Ga0495604_0109764
1333 Ga0495604_0462111
1334 Ga0495636_0192362
1335 Ga0495672_0007046
1336 Ga0495672_0120306
1337 Ga0495672_0157257
1338 Ga0495676_0016628
1339 Ga0495683_0084797
1340 Ga0495675_0167375
1341 Ga0495677_0057264
1342 Ga0495677_0103031
1343 Ga0495677_0104107
1344 Ga0495679_045976
1345 Ga0495681_0285805
1346 Ga0495686_0062893
1347 Ga0495686_0101898
1348 Ga0495686_0335076
1349 Ga0495593_0070879
1350 Ga0495602_0328357
1351 Ga0496101_0162360
1352 Ga0496101_0197250
1353 Ga0496102_0269817
1354 Ga0496102_0938838
1355 Ga0496102_1164509
1356 Ga0496103_0242193
1357 Ga0496103_0266377
1358 Ga0496104_0125195
1359 Ga0496105_0000604
1360 Ga0496105_0879704
1361 Ga0496106_0265819
1362 Ga0496106_0359586
1363 Ga0496107_0065695
1364 Ga0496107_0356894
1365 Ga0496107_0418916
1366 Ga0496108_0098905
1367 Ga0496108_0131047
1368 Ga0496108_0936159
1369 Ga0496109_0022595
1370 Ga0496109_0401265
1371 Ga0496110_0035235
1372 Ga0496110_0378893
1373 Ga0496110_0607317
1374 Ga0496111_0186627
1375 Ga0496112_0046085
1376 Ga0496112_0113128
1377 Ga0496112_0249902
1378 Ga0496112_1176154
1379 Ga0496113_0044645
1380 Ga0496113_0233708
1381 Ga0496114_0594517
1382 Ga0496115_0021495
1383 Ga0496115_0630859
1384 Ga0496115_0856131
1385 Ga0496117_0181870
1386 Ga0496117_0413266
1387 Ga0496118_0292197
1388 Ga0496119_0008122
1389 Ga0496119_0032435
1390 Ga0496119_0199157
1391 Ga0496120_0013856
1392 Ga0496121_0002948
1393 Ga0496121_0042370
1394 Ga0496121_0110094
1395 Ga0496121_0252342
1396 Ga0496121_0322912
1397 Ga0496121_0504353
1398 Ga0496122_0178924
1399 Ga0496124_0234700
1400 Ga0496124_0538739
1401 Ga0496125_0137555
1402 Ga0496126_0008100
1403 Ga0496126_0037281
1404 Ga0496126_0040677
1405 Ga0496126_0089438
1406 Ga0496126_0239483
1407 Ga0496126_0281905
1408 Ga0496126_0809822
1409 Ga0495682_0024602
1410 Ga0501032_0208263
1411 Ga0501034_0011046
1412 Ga0501036_0435467
1413 Ga0501037_0125002
1414 Ga0501038_0164657
1415 Ga0501038_0448295
1416 Ga0501041_0122508
1417 Ga0501043_0077598
1418 Ga0501043_0331023
1419 Ga0501046_0071191
1420 Ga0501046_0099332
1421 Ga0501046_0225574
1422 Ga0501047_0007633
1423 Ga0501047_0171437
1424 Ga0501047_0432185
1425 Ga0501048_0259256
1426 Ga0501067_0129902
1427 Ga0501069_0163716
1428 Ga0501073_0039107
1429 Ga0501073_0220068
1430 Ga0501074_0114840
1431 Ga0501076_0196800
1432 Ga0501079_0573205
1433 Ga0501080_0008285
1434 Ga0501035_0004697
1435 Ga0501044_0006221
1436 Ga0501044_0092259
1437 Ga0501045_0392909
1438 nmdc:mga03683_20304_c1
1439 nmdc:mga03683_329997_c1
1440 nmdc:mga03n38_564_c1
1441 nmdc:mga03n38_91822_c1
1442 nmdc:mga0yw44_373080_c1
1443 nmdc:mga0yw44_60304_c1
1444 nmdc:mga0yw44_67268_c1
1445 nmdc:mga0k408_191398_c1
1446 nmdc:mga06z11_23603_c1
1447 nmdc:mga06z11_240373_c1
1448 nmdc:mga06z11_370253_c1
1449 nmdc:mga06z11_395157_c1
1450 nmdc:mga06z11_80931_c1
1451 nmdc:mga04h51_166754_c1
1452 nmdc:mga04h51_52968_c1
1453 nmdc:mga04h51_68718_c1
1454 nmdc:mga05p37_1159280_c1
1455 nmdc:mga05p37_51457_c1
1456 nmdc:mga0qj67_466479_c1
1457 nmdc:mga06r32_755185_c1
1458 nmdc:mga08y16_39562_c1
1459 nmdc:mga08y16_722752_c1
1460 nmdc:mga0n895_159874_c1
1461 nmdc:mga0rr50_185980_c1
1462 nmdc:mga08x19_57821_c1
1463 nmdc:mga0a205_763381_c1
1464 nmdc:mga0sz30_61256_c1
1465 Ga0495601_0260623
1466 Ga0495655_0069296
1467 Ga0495619_0100389
1468 Ga0500578_0161478
1469 Ga0500581_197341
1470 Ga0500651_0158717
1471 Ga0500566_0009632
1472 Ga0500641_0020381
1473 Ga0500641_0039355
1474 Ga0500650_0393705
1475 Ga0500654_137600
1476 Ga0500554_005797
1477 Ga0500555_017570
1478 Ga0500557_036900
1479 Ga0500595_000641
1480 Ga0500595_013642
1481 Ga0500614_107495
1482 Ga0500614_187440
1483 Ga0500655_010024
1484 Ga0500658_0036911
1485 Ga0500559_0025139
1486 Ga0500559_0123218
1487 Ga0500568_0050403
1488 Ga0500577_0128709
1489 Ga0500585_119596
1490 Ga0500589_051175
1491 Ga0500589_240818
1492 Ga0500622_0141006
1493 Ga0500638_001395
1494 Ga0500638_075125
1495 Ga0500637_0000223
1496 Ga0500661_001922
1497 Ga0500661_002169
1498 Ga0530510_0278926
1499 2513695412
1500 2513891892
1501 2723843802
1502 2793079364
1503 2874612217
1504 2879114734
1505 2888388438
1506 2889041999
1507 2922366132
1508 2922386784
1509 2932801490
1510 2932804964
1511 2935884798
1512 2941537843
1513 3005512361
1514 3005597282
1515 3005720663
1516 8006964985
1517 8006988629
1518 8006994348
1519 8019656294
1520 8056679878

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00300

His_Phos_1

Histidine phosphatase superfamily (branch 1)

4

112

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
2rfl-assembly7.cif.gz_G crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8816 2 175
2rfl-assembly2.cif.gz_B crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.875 3 175
2rfl-assembly1.cif.gz_A crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.872 2 175
2rfl-assembly3.cif.gz_C crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8682 2 175
2rfl-assembly5.cif.gz_E crystal structure of the putative phosphohistidine phosphatase sixa from agrobacterium tumefaciens 0.8648 2 175
ID Description Score Start End Superfamily
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.9008 8 175 3.40.50.1240
af_P9WGF9_1_158_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8846 8 175 3.40.50.1240
4hbzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8602 2 175 3.40.50.1240
af_I1L079_52_229_3.40.50.1240 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8359 2 175 3.40.50.1240
4hbzA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Phosphoglycerate mutase-like 0.8222 2 175 3.40.50.1240
ID Description Score Start End GO Terms
AF-A0A537PV11-F1-model_v4 Histidine phosphatase family protein 0.9795 1 180
AF-A0A0D7DXL2-F1-model_v4 Phosphohistidine phosphatase 0.9686 1 141
AF-A0A537PV11-F1-model_v4 Histidine phosphatase family protein 0.9686 1 180
AF-A0A1Q3VZV8-F1-model_v4 Phosphohistidine phosphatase 0.9674 1 183
AF-A0A431M2M5-F1-model_v4 Histidine phosphatase family protein 0.9626 1 183

Map