F479522
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 760 | 365 | 702 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300009093|Ga0105240_10002201|Ga0105240_1000220127 |
| Length | 203 |
| Sequence | MTTRPPNFHGLHIRKWFEFREETLALETGKLADGEPVVKLVLAAAVENPHAGGGFVDSFESVISKSKSLGIEFGRRLLATLGGTPVQSYGKAALVGVNGEYEHGNAFLTTEFADPIREALGGAKAWIPSTGKRAGPGATIDIPLAHKDALYVRSHYDTISVSFTDAPAPDEVVIAVAVATRGRLHARLGGIKVSEIVGKDGLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 3 | 2521172590 | Herbaspirillum sp. GW103 | Isolate | Rhizosphere |
| 4 | 2551306416 | Herbaspirillum seropedicae Os34 | Isolate | Unclassified |
| 5 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 6 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 7 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 8 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 9 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 10 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 11 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 12 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 13 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 14 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 15 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 16 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 17 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 18 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 19 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 20 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 21 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 22 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 23 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 24 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 25 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 26 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 27 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 28 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 29 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 30 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 31 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 32 | 2808606415 | Herbaspirillum sp. SJZ130 | Isolate | Rhizosphere |
| 33 | 2808606419 | Herbaspirillum sp. SJZ106 | Isolate | Rhizosphere |
| 34 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 35 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 36 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 37 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 38 | 2852618963 | Herbaspirillum sp. SJZ102 | Isolate | Rhizosphere |
| 39 | 2879163058 | Sphingomonas pokkalii L3B27 | Isolate | Rhizosphere |
| 40 | 2896253425 | Aurantiacibacter rhizosphaerae GH3-10 | Isolate | Rhizosphere |
| 41 | 2904439833 | Herbaspirillum sp. 1589 | Isolate | Rhizosphere |
| 42 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 43 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 44 | 2904530477 | Herbaspirillum huttiense 611 | Isolate | Unclassified |
| 45 | 2904584206 | Herbaspirillum sp. 1050 | Isolate | Unclassified |
| 46 | 2904589729 | Herbaspirillum sp. 1130 | Isolate | Unclassified |
| 47 | 2904601388 | Herbaspirillum sp. 1273 | Isolate | Rhizosphere |
| 48 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 49 | 2919079590 | Herbaspirillum sp. 1173 | Isolate | Unclassified |
| 50 | 2919138771 | Novosphingobium sp. 1748 | Isolate | Rhizosphere |
| 51 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 52 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 53 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 54 | 2928130867 | Herbaspirillum seropedicae 1977 | Isolate | Unclassified |
| 55 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 56 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 57 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 58 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 59 | 3300001432 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 60 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 61 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 62 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 63 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 64 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 65 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 66 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 67 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 68 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 69 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 70 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 71 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 72 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 73 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 74 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 75 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 76 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 77 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 78 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 79 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 80 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 81 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 82 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 83 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 84 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 85 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 86 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 87 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 88 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 89 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 90 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 91 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 93 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 95 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 97 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 109 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 111 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 112 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 114 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 116 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 117 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 118 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 119 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 120 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 121 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 122 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 123 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 124 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 125 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 126 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 127 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 128 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 129 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 130 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 132 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 133 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 134 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 135 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 137 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 138 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 139 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 141 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 144 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 160 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 163 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 165 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 169 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 170 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300025223 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 173 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 174 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 175 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 176 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 177 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 178 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 180 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 181 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 182 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 184 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 185 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 186 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 187 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 188 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 189 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 190 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 191 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 192 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 193 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 194 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 238 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 242 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 243 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 244 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 245 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 246 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 247 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 250 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 251 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 252 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 253 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 254 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 255 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 256 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 257 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 258 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 259 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 260 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 261 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 263 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 264 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 265 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 266 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 267 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 268 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 269 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 270 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 271 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 272 | 3300042144 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 | Metagenome | Rhizosphere |
| 273 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 274 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 275 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 276 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 277 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 278 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 279 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 280 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 281 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 282 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 283 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 284 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 285 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 290 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 298 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 299 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 300 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 301 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 302 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 303 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 304 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 305 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 306 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 307 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 308 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 309 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 310 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 311 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 312 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 313 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 314 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 315 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 316 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 318 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 319 | 3300049517 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control | Metagenome | Rhizosphere |
| 320 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 321 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 322 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 323 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 326 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 328 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 329 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 330 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 331 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 332 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 333 | 3300049665 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought | Metagenome | Rhizosphere |
| 334 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 335 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 336 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 337 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 338 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 339 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 340 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 341 | 3300049706 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control | Metagenome | Rhizosphere |
| 342 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 343 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 344 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 345 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 346 | 3300049777 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control | Metagenome | Rhizosphere |
| 347 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 348 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 349 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 350 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 351 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 352 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 353 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 354 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 355 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 357 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 358 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 359 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 361 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 362 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 365 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 90.26 |
| Metatranscriptomes | 2.11 |
| Isolates | 7.63 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.05 |
| Nodule | 0.53 |
| Rhizoplane | 4.34 |
| Rhizosphere | 75.13 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.95 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_3335162 | 2162886007 | Bacteria | 8575 |
| 2 | JGI24034J14986_100776 | 3300001432 | Bacteria | 1898 |
| 3 | JGI24736J21556_1000789 | 3300001904 | Bacteria | 5819 |
| 4 | JGI24752J21851_1000020 | 3300001976 | Bacteria | 18109 |
| 5 | JGI24740J21852_10000064 | 3300001979 | Bacteria | 34423 |
| 6 | JGI24740J21852_10004332 | 3300001979 | Bacteria | 6116 |
| 7 | JGI24739J22299_10000233 | 3300001989 | Bacteria | 18716 |
| 8 | JGI24739J22299_10008392 | 3300001989 | Bacteria | 3858 |
| 9 | JGI24737J22298_10001316 | 3300001990 | Bacteria | 8802 |
| 10 | JGI24735J21928_10005060 | 3300002067 | Bacteria | 4388 |
| 11 | JGI24735J21928_10143218 | 3300002067 | Bacteria | 690 |
| 12 | JGI24750J21931_1000383 | 3300002070 | Bacteria | 7517 |
| 13 | JGI24748J21848_1000013 | 3300002074 | Bacteria | 149648 |
| 14 | JGI24738J21930_10003587 | 3300002075 | Bacteria | 3890 |
| 15 | JGI24034J26672_10000011 | 3300002239 | Bacteria | 148169 |
| 16 | JGI24742J22300_10000488 | 3300002244 | Bacteria | 5899 |
| 17 | JGI25154J39366_1000416 | 3300002738 | Bacteria | 22947 |
| 18 | JGI25157J39369_1000112 | 3300002741 | Bacteria | 69379 |
| 19 | JGI25151J46595_10002504 | 3300003187 | Bacteria | 10957 |
| 20 | rootH2_10026970 | 3300003320 | Bacteria | 6942 |
| 21 | rootL2_10296995 | 3300003322 | Bacteria | 2565 |
| 22 | rootH1_10099923 | 3300003323 | Bacteria | 4776 |
| 23 | rootH1_10163039 | 3300003323 | Bacteria | 1331 |
| 24 | JGI25161J50226_1005403 | 3300003374 | Bacteria | 2485 |
| 25 | Ga0006562J51391_1111416 | 3300003578 | Bacteria | 1870 |
| 26 | Ga0055539_1000633 | 3300003752 | Bacteria | 9408 |
| 27 | Ga0055535_1000047 | 3300003761 | Bacteria | 139836 |
| 28 | Ga0055535_1000226 | 3300003761 | Bacteria | 59752 |
| 29 | Ga0055542_1000029 | 3300003762 | Bacteria | 248836 |
| 30 | Ga0055529_1000148 | 3300003763 | Bacteria | 100809 |
| 31 | Ga0055529_1000193 | 3300003763 | Bacteria | 83459 |
| 32 | Ga0055526_1000155 | 3300003771 | Bacteria | 60928 |
| 33 | Ga0055537_1000006 | 3300003773 | Bacteria | 147020 |
| 34 | Ga0055537_1004166 | 3300003773 | Bacteria | 4212 |
| 35 | Ga0055524_1000032 | 3300003775 | Bacteria | 182182 |
| 36 | Ga0055524_1022006 | 3300003775 | Bacteria | 2095 |
| 37 | Ga0055534_1000048 | 3300003784 | Bacteria | 94388 |
| 38 | Ga0055534_1003042 | 3300003784 | Bacteria | 5501 |
| 39 | Ga0055534_1004512 | 3300003784 | Bacteria | 4012 |
| 40 | Ga0055528_1002482 | 3300003790 | Bacteria | 9861 |
| 41 | Ga0055528_1009873 | 3300003790 | Bacteria | 3942 |
| 42 | Ga0055540_1000017 | 3300003792 | Bacteria | 231465 |
| 43 | Ga0055540_1004431 | 3300003792 | Bacteria | 6327 |
| 44 | Ga0055531_10014250 | 3300003794 | Bacteria | 3596 |
| 45 | Ga0065704_10070262 | 3300005289 | Bacteria | 45316 |
| 46 | Ga0065704_10079067 | 3300005289 | Bacteria | 4264 |
| 47 | Ga0065704_10080236 | 3300005289 | Bacteria | 3986 |
| 48 | Ga0065704_10088568 | 3300005289 | Bacteria | 2928 |
| 49 | Ga0070658_10000077 | 3300005327 | Bacteria | 94332 |
| 50 | Ga0070690_100000054 | 3300005330 | Bacteria | 55235 |
| 51 | Ga0070670_100000031 | 3300005331 | Bacteria | 159070 |
| 52 | Ga0070670_100000154 | 3300005331 | Bacteria | 63034 |
| 53 | Ga0070670_100018634 | 3300005331 | Bacteria | 5948 |
| 54 | Ga0070670_100181094 | 3300005331 | Bacteria | 1830 |
| 55 | Ga0068869_100132954 | 3300005334 | Bacteria | 1914 |
| 56 | Ga0068869_100622083 | 3300005334 | Bacteria | 914 |
| 57 | Ga0070666_10000114 | 3300005335 | Bacteria | 55625 |
| 58 | Ga0070666_10013146 | 3300005335 | Bacteria | 5245 |
| 59 | Ga0068868_100039651 | 3300005338 | Bacteria | 3661 |
| 60 | Ga0070660_100037108 | 3300005339 | Bacteria | 3694 |
| 61 | Ga0070660_100106669 | 3300005339 | Bacteria | 2225 |
| 62 | Ga0070660_100122082 | 3300005339 | Bacteria | 2079 |
| 63 | Ga0070661_100003307 | 3300005344 | Bacteria | 11126 |
| 64 | Ga0070661_100015010 | 3300005344 | Bacteria | 5466 |
| 65 | Ga0070661_100028762 | 3300005344 | Bacteria | 4010 |
| 66 | Ga0070668_100022656 | 3300005347 | Bacteria | 4749 |
| 67 | Ga0070668_100041542 | 3300005347 | Bacteria | 3524 |
| 68 | Ga0070668_100228247 | 3300005347 | Bacteria | 1538 |
| 69 | Ga0070668_100690797 | 3300005347 | Bacteria | 899 |
| 70 | Ga0070669_100000737 | 3300005353 | Bacteria | 23845 |
| 71 | Ga0070671_100002346 | 3300005355 | Bacteria | 14609 |
| 72 | Ga0070671_100074779 | 3300005355 | Unclassified | 2830 |
| 73 | Ga0070671_100214239 | 3300005355 | Bacteria | 1634 |
| 74 | Ga0070671_100338864 | 3300005355 | Bacteria | 1282 |
| 75 | Ga0070674_100000060 | 3300005356 | Bacteria | 48372 |
| 76 | Ga0070674_100639338 | 3300005356 | Bacteria | 903 |
| 77 | Ga0070659_100008609 | 3300005366 | Bacteria | 7462 |
| 78 | Ga0070659_100018246 | 3300005366 | Bacteria | 5295 |
| 79 | Ga0070667_100000189 | 3300005367 | Bacteria | 73916 |
| 80 | Ga0070667_100002453 | 3300005367 | Bacteria | 16199 |
| 81 | Ga0070667_100002691 | 3300005367 | Bacteria | 15386 |
| 82 | Ga0070667_100043541 | 3300005367 | Bacteria | 3768 |
| 83 | Ga0070667_100606549 | 3300005367 | Bacteria | 1009 |
| 84 | Ga0070663_100064683 | 3300005455 | Bacteria | 2644 |
| 85 | Ga0070663_100075341 | 3300005455 | Bacteria | 2466 |
| 86 | Ga0070663_100194237 | 3300005455 | Bacteria | 1581 |
| 87 | Ga0070678_100000003 | 3300005456 | Bacteria | 78009 |
| 88 | Ga0070662_100001084 | 3300005457 | Bacteria | 16607 |
| 89 | Ga0070662_100076358 | 3300005457 | Bacteria | 2483 |
| 90 | Ga0068867_100003492 | 3300005459 | Bacteria | 11055 |
| 91 | Ga0068867_100101879 | 3300005459 | Bacteria | 2194 |
| 92 | Ga0070684_100102139 | 3300005535 | Bacteria | 2563 |
| 93 | Ga0068853_100000190 | 3300005539 | Bacteria | 43364 |
| 94 | Ga0068853_100001662 | 3300005539 | Bacteria | 16283 |
| 95 | Ga0068853_100288311 | 3300005539 | Bacteria | 1515 |
| 96 | Ga0068853_100301373 | 3300005539 | Bacteria | 1481 |
| 97 | Ga0070686_100000119 | 3300005544 | Bacteria | 55595 |
| 98 | Ga0070686_100219417 | 3300005544 | Bacteria | 1373 |
| 99 | Ga0070665_100001340 | 3300005548 | Bacteria | 29284 |
| 100 | Ga0070665_100006931 | 3300005548 | Bacteria | 11518 |
| 101 | Ga0070665_100008059 | 3300005548 | Bacteria | 10667 |
| 102 | Ga0070665_100028521 | 3300005548 | Bacteria | 5622 |
| 103 | Ga0070665_100386044 | 3300005548 | Bacteria | 1408 |
| 104 | Ga0070665_100441601 | 3300005548 | Bacteria | 1310 |
| 105 | Ga0070665_101190170 | 3300005548 | Bacteria | 773 |
| 106 | Ga0068855_100000165 | 3300005563 | Bacteria | 85018 |
| 107 | Ga0068855_100001098 | 3300005563 | Bacteria | 33621 |
| 108 | Ga0068855_100019234 | 3300005563 | Bacteria | 8209 |
| 109 | Ga0068855_100217025 | 3300005563 | Bacteria | 2147 |
| 110 | Ga0068855_100326043 | 3300005563 | Bacteria | 1696 |
| 111 | Ga0070664_100138098 | 3300005564 | Bacteria | 2145 |
| 112 | Ga0068857_100003317 | 3300005577 | Bacteria | 13382 |
| 113 | Ga0068857_100022481 | 3300005577 | Bacteria | 5549 |
| 114 | Ga0068857_100112850 | 3300005577 | Unclassified | 2444 |
| 115 | Ga0068857_100388177 | 3300005577 | Bacteria | 1297 |
| 116 | Ga0068854_100000778 | 3300005578 | Bacteria | 18941 |
| 117 | Ga0068854_100000825 | 3300005578 | Bacteria | 18481 |
| 118 | Ga0068854_100001946 | 3300005578 | Bacteria | 12609 |
| 119 | Ga0068854_100017205 | 3300005578 | Bacteria | 4834 |
| 120 | Ga0068854_100039256 | 3300005578 | Bacteria | 3334 |
| 121 | Ga0068854_100230355 | 3300005578 | Bacteria | 1470 |
| 122 | Ga0068856_100059133 | 3300005614 | Bacteria | 3786 |
| 123 | Ga0068856_100125907 | 3300005614 | Unclassified | 2565 |
| 124 | Ga0068856_100203917 | 3300005614 | Bacteria | 1992 |
| 125 | Ga0068852_100025666 | 3300005616 | Bacteria | 4777 |
| 126 | Ga0068852_100035998 | 3300005616 | Bacteria | 4136 |
| 127 | Ga0068852_100099713 | 3300005616 | Bacteria | 2619 |
| 128 | Ga0068852_100120800 | 3300005616 | Bacteria | 2398 |
| 129 | Ga0068859_100000532 | 3300005617 | Bacteria | 37821 |
| 130 | Ga0068859_100016932 | 3300005617 | Bacteria | 7315 |
| 131 | Ga0068859_100026823 | 3300005617 | Bacteria | 5779 |
| 132 | Ga0068859_100247150 | 3300005617 | Bacteria | 1874 |
| 133 | Ga0068864_100000019 | 3300005618 | Bacteria | 271650 |
| 134 | Ga0068864_100000075 | 3300005618 | Bacteria | 108554 |
| 135 | Ga0068864_100000195 | 3300005618 | Bacteria | 55625 |
| 136 | Ga0068866_10042310 | 3300005718 | Bacteria | 2266 |
| 137 | Ga0068861_100018469 | 3300005719 | Bacteria | 4967 |
| 138 | Ga0068861_100262832 | 3300005719 | Bacteria | 1478 |
| 139 | Ga0068851_10032270 | 3300005834 | Bacteria | 2606 |
| 140 | Ga0068851_10041416 | 3300005834 | Bacteria | 2315 |
| 141 | Ga0068851_10103937 | 3300005834 | Bacteria | 1510 |
| 142 | Ga0068863_100000015 | 3300005841 | Bacteria | 214824 |
| 143 | Ga0068863_100000044 | 3300005841 | Bacteria | 149959 |
| 144 | Ga0068863_100003919 | 3300005841 | Bacteria | 14702 |
| 145 | Ga0068863_100007913 | 3300005841 | Bacteria | 10392 |
| 146 | Ga0068863_100043333 | 3300005841 | Bacteria | 4273 |
| 147 | Ga0068863_100069346 | 3300005841 | Bacteria | 3334 |
| 148 | Ga0068863_100092404 | 3300005841 | Bacteria | 2871 |
| 149 | Ga0068863_100140087 | 3300005841 | Bacteria | 2312 |
| 150 | Ga0068858_100000499 | 3300005842 | Bacteria | 41087 |
| 151 | Ga0068858_100002285 | 3300005842 | Bacteria | 19405 |
| 152 | Ga0068858_100005811 | 3300005842 | Bacteria | 12051 |
| 153 | Ga0068858_100100553 | 3300005842 | Unclassified | 2696 |
| 154 | Ga0068860_100000413 | 3300005843 | Bacteria | 55625 |
| 155 | Ga0068860_100001842 | 3300005843 | Bacteria | 22583 |
| 156 | Ga0068860_100003487 | 3300005843 | Bacteria | 16193 |
| 157 | Ga0068860_100355748 | 3300005843 | Bacteria | 1442 |
| 158 | Ga0068860_100561281 | 3300005843 | Bacteria | 1144 |
| 159 | Ga0068862_100000090 | 3300005844 | Bacteria | 108954 |
| 160 | Ga0068862_100000097 | 3300005844 | Bacteria | 104686 |
| 161 | Ga0068862_100006674 | 3300005844 | Bacteria | 9574 |
| 162 | Ga0068862_100040873 | 3300005844 | Bacteria | 3944 |
| 163 | Ga0068862_100044842 | 3300005844 | Bacteria | 3772 |
| 164 | Ga0068862_100644826 | 3300005844 | Bacteria | 1021 |
| 165 | Ga0075367_10011661 | 3300006178 | Bacteria | 4662 |
| 166 | Ga0075367_10270254 | 3300006178 | Bacteria | 1068 |
| 167 | Ga0075366_10013720 | 3300006195 | Bacteria | 4618 |
| 168 | Ga0075366_10029661 | 3300006195 | Bacteria | 3215 |
| 169 | Ga0075366_10051545 | 3300006195 | Bacteria | 2445 |
| 170 | Ga0075366_10072974 | 3300006195 | Bacteria | 2045 |
| 171 | Ga0097621_100082758 | 3300006237 | Bacteria | 2673 |
| 172 | Ga0097621_100920695 | 3300006237 | Bacteria | 815 |
| 173 | Ga0075370_10001309 | 3300006353 | Bacteria | 10651 |
| 174 | Ga0075370_10018754 | 3300006353 | Bacteria | 3757 |
| 175 | Ga0075370_10036810 | 3300006353 | Bacteria | 2750 |
| 176 | Ga0075370_10038221 | 3300006353 | Bacteria | 2701 |
| 177 | Ga0068871_100163544 | 3300006358 | Bacteria | 1904 |
| 178 | Ga0075431_101184622 | 3300006847 | Bacteria | 727 |
| 179 | Ga0068865_100031360 | 3300006881 | Bacteria | 3544 |
| 180 | Ga0068865_100433383 | 3300006881 | Bacteria | 1083 |
| 181 | Ga0097620_100000532 | 3300006931 | Bacteria | 37821 |
| 182 | Ga0097620_100016932 | 3300006931 | Bacteria | 7315 |
| 183 | Ga0097620_100026823 | 3300006931 | Bacteria | 5779 |
| 184 | Ga0097620_100247163 | 3300006931 | Bacteria | 1874 |
| 185 | Ga0079104_1000041 | 3300006946 | Bacteria | 186297 |
| 186 | Ga0099826_10053259 | 3300006948 | Bacteria | 2695 |
| 187 | Ga0105251_10000436 | 3300009011 | Bacteria | 40435 |
| 188 | Ga0105251_10000718 | 3300009011 | Bacteria | 30525 |
| 189 | Ga0105244_10000415 | 3300009036 | Bacteria | 39705 |
| 190 | Ga0105250_10048372 | 3300009092 | Bacteria | 1706 |
| 191 | Ga0105240_10001791 | 3300009093 | Bacteria | 36157 |
| 192 | Ga0105240_10002201 | 3300009093 | Bacteria | 31819 |
| 193 | Ga0105240_10005543 | 3300009093 | Bacteria | 18793 |
| 194 | Ga0105240_10009588 | 3300009093 | Bacteria | 13707 |
| 195 | Ga0105240_10011024 | 3300009093 | Bacteria | 12644 |
| 196 | Ga0105240_10024317 | 3300009093 | Bacteria | 7989 |
| 197 | Ga0105240_10041137 | 3300009093 | Bacteria | 5902 |
| 198 | Ga0105240_10115734 | 3300009093 | Bacteria | 3236 |
| 199 | Ga0105240_10181560 | 3300009093 | Bacteria | 2483 |
| 200 | Ga0105240_10190626 | 3300009093 | Unclassified | 2411 |
| 201 | Ga0105240_10199460 | 3300009093 | Bacteria | 2346 |
| 202 | Ga0105240_10244520 | 3300009093 | Bacteria | 2078 |
| 203 | Ga0105240_10446258 | 3300009093 | Bacteria | 1449 |
| 204 | Ga0105240_10527073 | 3300009093 | Bacteria | 1310 |
| 205 | Ga0105245_10001114 | 3300009098 | Bacteria | 24292 |
| 206 | Ga0105245_10135154 | 3300009098 | Bacteria | 2317 |
| 207 | Ga0105247_10000330 | 3300009101 | Bacteria | 41710 |
| 208 | Ga0105247_10011822 | 3300009101 | Bacteria | 5250 |
| 209 | Ga0105247_10030729 | 3300009101 | Bacteria | 3257 |
| 210 | Ga0105247_10299608 | 3300009101 | Bacteria | 1115 |
| 211 | Ga0114129_10367429 | 3300009147 | Bacteria | 1902 |
| 212 | Ga0105243_10000108 | 3300009148 | Bacteria | 94868 |
| 213 | Ga0105243_10005675 | 3300009148 | Bacteria | 9710 |
| 214 | Ga0105243_10028515 | 3300009148 | Bacteria | 4286 |
| 215 | Ga0105243_10075072 | 3300009148 | Bacteria | 2743 |
| 216 | Ga0105243_10121620 | 3300009148 | Bacteria | 2202 |
| 217 | Ga0105241_10137379 | 3300009174 | Unclassified | 1986 |
| 218 | Ga0105242_10012190 | 3300009176 | Bacteria | 6614 |
| 219 | Ga0105242_10026800 | 3300009176 | Bacteria | 4570 |
| 220 | Ga0105242_10049693 | 3300009176 | Bacteria | 3413 |
| 221 | Ga0105242_10922725 | 3300009176 | Bacteria | 875 |
| 222 | Ga0105248_10000014 | 3300009177 | Bacteria | 324729 |
| 223 | Ga0105248_10002946 | 3300009177 | Bacteria | 18877 |
| 224 | Ga0105248_10006876 | 3300009177 | Bacteria | 12466 |
| 225 | Ga0105248_10007589 | 3300009177 | Bacteria | 11915 |
| 226 | Ga0105237_10003349 | 3300009545 | Bacteria | 19079 |
| 227 | Ga0105237_10003698 | 3300009545 | Bacteria | 18033 |
| 228 | Ga0105237_10006276 | 3300009545 | Bacteria | 13223 |
| 229 | Ga0105237_10013677 | 3300009545 | Bacteria | 8498 |
| 230 | Ga0105237_10013720 | 3300009545 | Bacteria | 8486 |
| 231 | Ga0105237_10038601 | 3300009545 | Bacteria | 4822 |
| 232 | Ga0105237_10111476 | 3300009545 | Bacteria | 2728 |
| 233 | Ga0105237_10134823 | 3300009545 | Bacteria | 2464 |
| 234 | Ga0105237_10135294 | 3300009545 | Unclassified | 2459 |
| 235 | Ga0105237_10260842 | 3300009545 | Bacteria | 1735 |
| 236 | Ga0105238_10001684 | 3300009551 | Bacteria | 22226 |
| 237 | Ga0105238_10001771 | 3300009551 | Bacteria | 21656 |
| 238 | Ga0105238_10041446 | 3300009551 | Bacteria | 4663 |
| 239 | Ga0105238_10074294 | 3300009551 | Bacteria | 3393 |
| 240 | Ga0105238_10161374 | 3300009551 | Unclassified | 2217 |
| 241 | Ga0105238_10169595 | 3300009551 | Bacteria | 2158 |
| 242 | Ga0105238_11743331 | 3300009551 | Bacteria | 654 |
| 243 | Ga0105249_10000048 | 3300009553 | Bacteria | 172137 |
| 244 | Ga0105249_10000266 | 3300009553 | Bacteria | 55631 |
| 245 | Ga0105249_10021316 | 3300009553 | Bacteria | 5801 |
| 246 | Ga0105249_10491430 | 3300009553 | Bacteria | 1271 |
| 247 | Ga0105249_10902229 | 3300009553 | Bacteria | 951 |
| 248 | Ga0105239_10000196 | 3300010375 | Bacteria | 88069 |
| 249 | Ga0105239_10000889 | 3300010375 | Bacteria | 42397 |
| 250 | Ga0105239_10007229 | 3300010375 | Bacteria | 12756 |
| 251 | Ga0105239_10011115 | 3300010375 | Bacteria | 10047 |
| 252 | Ga0105239_10033806 | 3300010375 | Bacteria | 5614 |
| 253 | Ga0105239_10105233 | 3300010375 | Bacteria | 3125 |
| 254 | Ga0105239_11583354 | 3300010375 | Bacteria | 758 |
| 255 | Ga0105246_10001891 | 3300011119 | Bacteria | 12607 |
| 256 | Ga0105246_10300421 | 3300011119 | Bacteria | 1296 |
| 257 | Ga0157373_10000372 | 3300013100 | Bacteria | 35853 |
| 258 | Ga0157373_10001218 | 3300013100 | Bacteria | 19692 |
| 259 | Ga0157373_10004249 | 3300013100 | Bacteria | 10807 |
| 260 | Ga0157370_10001791 | 3300013104 | Bacteria | 26480 |
| 261 | Ga0157370_10007379 | 3300013104 | Bacteria | 11983 |
| 262 | Ga0157370_10009890 | 3300013104 | Bacteria | 10106 |
| 263 | Ga0157370_10180732 | 3300013104 | Bacteria | 1960 |
| 264 | Ga0157369_10000249 | 3300013105 | Bacteria | 74245 |
| 265 | Ga0157369_10006228 | 3300013105 | Bacteria | 13845 |
| 266 | Ga0157369_10044116 | 3300013105 | Bacteria | 4855 |
| 267 | Ga0157369_10186290 | 3300013105 | Bacteria | 2182 |
| 268 | Ga0157369_10436457 | 3300013105 | Bacteria | 1357 |
| 269 | Ga0157374_10610711 | 3300013296 | Bacteria | 1101 |
| 270 | Ga0157378_10066370 | 3300013297 | Bacteria | 3232 |
| 271 | Ga0163162_10012075 | 3300013306 | Bacteria | 8426 |
| 272 | Ga0163162_10053953 | 3300013306 | Bacteria | 4041 |
| 273 | Ga0163162_10149571 | 3300013306 | Bacteria | 2452 |
| 274 | Ga0163162_10203148 | 3300013306 | Unclassified | 2111 |
| 275 | Ga0157372_10099580 | 3300013307 | Bacteria | 3316 |
| 276 | Ga0157372_10115251 | 3300013307 | Bacteria | 3081 |
| 277 | Ga0157375_10905941 | 3300013308 | Bacteria | 1026 |
| 278 | Ga0163163_10208612 | 3300014325 | Bacteria | 2002 |
| 279 | Ga0163163_10565264 | 3300014325 | Bacteria | 1200 |
| 280 | Ga0163163_10667807 | 3300014325 | Bacteria | 1103 |
| 281 | Ga0157380_10002736 | 3300014326 | Bacteria | 11973 |
| 282 | Ga0182008_10000038 | 3300014497 | Bacteria | 129386 |
| 283 | Ga0182008_10002221 | 3300014497 | Bacteria | 12301 |
| 284 | Ga0157377_10161762 | 3300014745 | Bacteria | 1393 |
| 285 | Ga0157379_10099676 | 3300014968 | Unclassified | 2608 |
| 286 | Ga0157379_10419182 | 3300014968 | Bacteria | 1233 |
| 287 | Ga0157376_10453738 | 3300014969 | Bacteria | 1251 |
| 288 | Ga0182006_1006063 | 3300015261 | Bacteria | 5655 |
| 289 | Ga0182006_1028073 | 3300015261 | Bacteria | 2291 |
| 290 | Ga0182007_10027916 | 3300015262 | Bacteria | 1942 |
| 291 | Ga0163161_10000255 | 3300017792 | Bacteria | 47099 |
| 292 | Ga0207672_1000436 | 3300025223 | Bacteria | 5287 |
| 293 | Ga0209672_101158 | 3300025228 | Bacteria | 10824 |
| 294 | Ga0209147_100338 | 3300025229 | Bacteria | 34841 |
| 295 | Ga0209258_100018 | 3300025242 | Bacteria | 567561 |
| 296 | Ga0209258_100072 | 3300025242 | Bacteria | 274355 |
| 297 | Ga0209646_1000127 | 3300025246 | Bacteria | 131920 |
| 298 | Ga0209026_1000004 | 3300025250 | Bacteria | 949012 |
| 299 | Ga0209677_100085 | 3300025253 | Bacteria | 116046 |
| 300 | Ga0209148_1000030 | 3300025254 | Bacteria | 567582 |
| 301 | Ga0209148_1002344 | 3300025254 | Bacteria | 6709 |
| 302 | Ga0209759_1000129 | 3300025256 | Bacteria | 131961 |
| 303 | Ga0209129_1000187 | 3300025258 | Bacteria | 85001 |
| 304 | Ga0209129_1004805 | 3300025258 | Bacteria | 5095 |
| 305 | Ga0209565_1000016 | 3300025263 | Bacteria | 477707 |
| 306 | Ga0209565_1001570 | 3300025263 | Bacteria | 9771 |
| 307 | Ga0209455_1000053 | 3300025272 | Bacteria | 365949 |
| 308 | Ga0209673_1000073 | 3300025273 | Bacteria | 233645 |
| 309 | Ga0209673_1006176 | 3300025273 | Bacteria | 5861 |
| 310 | Ga0209130_1001957 | 3300025284 | Bacteria | 11372 |
| 311 | Ga0209675_1000080 | 3300025291 | Bacteria | 154613 |
| 312 | Ga0209675_1000248 | 3300025291 | Bacteria | 53556 |
| 313 | Ga0209675_1014231 | 3300025291 | Bacteria | 2432 |
| 314 | Ga0209676_1001486 | 3300025292 | Bacteria | 21618 |
| 315 | Ga0209676_1020343 | 3300025292 | Bacteria | 2257 |
| 316 | Ga0209676_1020766 | 3300025292 | Bacteria | 2221 |
| 317 | Ga0209025_1000334 | 3300025294 | Bacteria | 103696 |
| 318 | Ga0209025_1001126 | 3300025294 | Bacteria | 38269 |
| 319 | Ga0209025_1019337 | 3300025294 | Bacteria | 3791 |
| 320 | Ga0209564_1000040 | 3300025295 | Bacteria | 411388 |
| 321 | Ga0209564_1000165 | 3300025295 | Bacteria | 160244 |
| 322 | Ga0209564_1000322 | 3300025295 | Bacteria | 93323 |
| 323 | Ga0209564_1000621 | 3300025295 | Bacteria | 54266 |
| 324 | Ga0209050_1000037 | 3300025298 | Bacteria | 415612 |
| 325 | Ga0209050_1047351 | 3300025298 | Bacteria | 1121 |
| 326 | Ga0209256_1000023 | 3300025299 | Bacteria | 461150 |
| 327 | Ga0209256_1000110 | 3300025299 | Bacteria | 182312 |
| 328 | Ga0209256_1005577 | 3300025299 | Bacteria | 7164 |
| 329 | Ga0207426_1000029 | 3300025302 | Bacteria | 473835 |
| 330 | Ga0207426_1000068 | 3300025302 | Bacteria | 335134 |
| 331 | Ga0209051_1000040 | 3300025303 | Bacteria | 315055 |
| 332 | Ga0209051_1008387 | 3300025303 | Bacteria | 5476 |
| 333 | Ga0209257_1000566 | 3300025304 | Bacteria | 62726 |
| 334 | Ga0209257_1010347 | 3300025304 | Bacteria | 4742 |
| 335 | Ga0209257_1011936 | 3300025304 | Bacteria | 4096 |
| 336 | Ga0207656_10020229 | 3300025321 | Bacteria | 2643 |
| 337 | Ga0207656_10033943 | 3300025321 | Bacteria | 2128 |
| 338 | Ga0207656_10036310 | 3300025321 | Bacteria | 2068 |
| 339 | Ga0207696_1118927 | 3300025711 | Bacteria | 713 |
| 340 | Ga0207655_1002845 | 3300025728 | Bacteria | 13383 |
| 341 | Ga0207713_1001530 | 3300025735 | Bacteria | 18202 |
| 342 | Ga0207713_1003540 | 3300025735 | Bacteria | 10575 |
| 343 | Ga0207710_10006689 | 3300025900 | Unclassified | 4912 |
| 344 | Ga0207710_10007344 | 3300025900 | Bacteria | 4669 |
| 345 | Ga0207710_10175122 | 3300025900 | Bacteria | 1050 |
| 346 | Ga0207680_10000052 | 3300025903 | Bacteria | 55639 |
| 347 | Ga0207680_10025077 | 3300025903 | Bacteria | 3284 |
| 348 | Ga0207680_10068477 | 3300025903 | Bacteria | 2190 |
| 349 | Ga0207647_10042711 | 3300025904 | Bacteria | 2842 |
| 350 | Ga0207647_10043900 | 3300025904 | Bacteria | 2795 |
| 351 | Ga0207643_10045871 | 3300025908 | Bacteria | 2469 |
| 352 | Ga0207705_10000182 | 3300025909 | Bacteria | 66143 |
| 353 | Ga0207654_10000950 | 3300025911 | Bacteria | 15913 |
| 354 | Ga0207695_10000383 | 3300025913 | Bacteria | 100354 |
| 355 | Ga0207695_10000435 | 3300025913 | Bacteria | 91834 |
| 356 | Ga0207695_10001255 | 3300025913 | Bacteria | 43272 |
| 357 | Ga0207695_10002264 | 3300025913 | Bacteria | 28816 |
| 358 | Ga0207695_10016391 | 3300025913 | Bacteria | 8669 |
| 359 | Ga0207695_10089140 | 3300025913 | Bacteria | 3103 |
| 360 | Ga0207695_10100048 | 3300025913 | Bacteria | 2896 |
| 361 | Ga0207695_10212371 | 3300025913 | Bacteria | 1845 |
| 362 | Ga0207695_10445259 | 3300025913 | Bacteria | 1178 |
| 363 | Ga0207671_10002126 | 3300025914 | Bacteria | 21618 |
| 364 | Ga0207671_10008765 | 3300025914 | Bacteria | 8520 |
| 365 | Ga0207671_10015423 | 3300025914 | Bacteria | 5981 |
| 366 | Ga0207671_10017160 | 3300025914 | Bacteria | 5593 |
| 367 | Ga0207671_10035953 | 3300025914 | Bacteria | 3673 |
| 368 | Ga0207671_10036194 | 3300025914 | Bacteria | 3660 |
| 369 | Ga0207671_10044076 | 3300025914 | Bacteria | 3299 |
| 370 | Ga0207671_10224908 | 3300025914 | Bacteria | 1471 |
| 371 | Ga0207657_10040495 | 3300025919 | Bacteria | 4128 |
| 372 | Ga0207657_10127400 | 3300025919 | Bacteria | 2090 |
| 373 | Ga0207657_10159380 | 3300025919 | Bacteria | 1833 |
| 374 | Ga0207649_10020941 | 3300025920 | Bacteria | 3755 |
| 375 | Ga0207649_10042283 | 3300025920 | Bacteria | 2779 |
| 376 | Ga0207681_10000001 | 3300025923 | Bacteria | 1105841 |
| 377 | Ga0207681_10001393 | 3300025923 | Bacteria | 15616 |
| 378 | Ga0207694_10000111 | 3300025924 | Bacteria | 85677 |
| 379 | Ga0207694_10003218 | 3300025924 | Bacteria | 13006 |
| 380 | Ga0207694_10004423 | 3300025924 | Bacteria | 10988 |
| 381 | Ga0207694_10069950 | 3300025924 | Bacteria | 2742 |
| 382 | Ga0207694_10083884 | 3300025924 | Bacteria | 2506 |
| 383 | Ga0207694_10230511 | 3300025924 | Bacteria | 1512 |
| 384 | Ga0207694_10338753 | 3300025924 | Unclassified | 1243 |
| 385 | Ga0207650_10000055 | 3300025925 | Bacteria | 158325 |
| 386 | Ga0207650_10001052 | 3300025925 | Bacteria | 20525 |
| 387 | Ga0207650_10014989 | 3300025925 | Bacteria | 5391 |
| 388 | Ga0207650_10054138 | 3300025925 | Bacteria | 2975 |
| 389 | Ga0207687_10001973 | 3300025927 | Bacteria | 14107 |
| 390 | Ga0207687_10074418 | 3300025927 | Bacteria | 2434 |
| 391 | Ga0207644_10043573 | 3300025931 | Bacteria | 3185 |
| 392 | Ga0207644_10075796 | 3300025931 | Bacteria | 2472 |
| 393 | Ga0207644_10097406 | 3300025931 | Bacteria | 2203 |
| 394 | Ga0207706_10001006 | 3300025933 | Bacteria | 28712 |
| 395 | Ga0207706_10021636 | 3300025933 | Bacteria | 5774 |
| 396 | Ga0207706_10138538 | 3300025933 | Bacteria | 2140 |
| 397 | Ga0207686_10026138 | 3300025934 | Bacteria | 3404 |
| 398 | Ga0207709_10000148 | 3300025935 | Bacteria | 96435 |
| 399 | Ga0207709_10031723 | 3300025935 | Bacteria | 3089 |
| 400 | Ga0207709_10129194 | 3300025935 | Bacteria | 1719 |
| 401 | Ga0207670_10761133 | 3300025936 | Bacteria | 805 |
| 402 | Ga0207669_10000015 | 3300025937 | Bacteria | 125492 |
| 403 | Ga0207704_10020193 | 3300025938 | Bacteria | 3518 |
| 404 | Ga0207711_10000021 | 3300025941 | Bacteria | 355952 |
| 405 | Ga0207711_10003159 | 3300025941 | Bacteria | 14356 |
| 406 | Ga0207711_10077874 | 3300025941 | Bacteria | 2891 |
| 407 | Ga0207711_10290753 | 3300025941 | Bacteria | 1506 |
| 408 | Ga0207667_10000102 | 3300025949 | Bacteria | 137469 |
| 409 | Ga0207667_10000220 | 3300025949 | Bacteria | 80179 |
| 410 | Ga0207667_10019128 | 3300025949 | Bacteria | 7658 |
| 411 | Ga0207667_10106107 | 3300025949 | Bacteria | 2898 |
| 412 | Ga0207667_10140023 | 3300025949 | Bacteria | 2491 |
| 413 | Ga0207667_10853721 | 3300025949 | Bacteria | 904 |
| 414 | Ga0207712_10000221 | 3300025961 | Bacteria | 56450 |
| 415 | Ga0207712_10000598 | 3300025961 | Bacteria | 28786 |
| 416 | Ga0207712_10141483 | 3300025961 | Bacteria | 1847 |
| 417 | Ga0207712_10839787 | 3300025961 | Bacteria | 809 |
| 418 | Ga0207668_10095262 | 3300025972 | Bacteria | 2197 |
| 419 | Ga0207668_10156311 | 3300025972 | Bacteria | 1772 |
| 420 | Ga0207668_10678046 | 3300025972 | Bacteria | 904 |
| 421 | Ga0207640_10005437 | 3300025981 | Bacteria | 6943 |
| 422 | Ga0207640_10008788 | 3300025981 | Bacteria | 5621 |
| 423 | Ga0207640_10047382 | 3300025981 | Bacteria | 2772 |
| 424 | Ga0207640_10056396 | 3300025981 | Bacteria | 2578 |
| 425 | Ga0207640_10789609 | 3300025981 | Bacteria | 822 |
| 426 | Ga0207658_10000567 | 3300025986 | Bacteria | 33560 |
| 427 | Ga0207658_10005623 | 3300025986 | Bacteria | 8575 |
| 428 | Ga0207658_10017918 | 3300025986 | Bacteria | 4881 |
| 429 | Ga0207658_10342094 | 3300025986 | Bacteria | 1300 |
| 430 | Ga0207658_10429756 | 3300025986 | Bacteria | 1166 |
| 431 | Ga0207677_10026051 | 3300026023 | Bacteria | 3661 |
| 432 | Ga0207677_11056513 | 3300026023 | Bacteria | 738 |
| 433 | Ga0207703_10000439 | 3300026035 | Bacteria | 43808 |
| 434 | Ga0207703_10000544 | 3300026035 | Bacteria | 38674 |
| 435 | Ga0207703_10061105 | 3300026035 | Unclassified | 3083 |
| 436 | Ga0207639_10000359 | 3300026041 | Bacteria | 31527 |
| 437 | Ga0207639_10000764 | 3300026041 | Bacteria | 21926 |
| 438 | Ga0207639_10003787 | 3300026041 | Bacteria | 10183 |
| 439 | Ga0207639_10015954 | 3300026041 | Bacteria | 5305 |
| 440 | Ga0207678_10003441 | 3300026067 | Bacteria | 14260 |
| 441 | Ga0207678_10019573 | 3300026067 | Bacteria | 5949 |
| 442 | Ga0207678_10086681 | 3300026067 | Bacteria | 2676 |
| 443 | Ga0207678_10171019 | 3300026067 | Bacteria | 1855 |
| 444 | Ga0207678_10329108 | 3300026067 | Bacteria | 1315 |
| 445 | Ga0207702_10063314 | 3300026078 | Bacteria | 3162 |
| 446 | Ga0207702_10072627 | 3300026078 | Bacteria | 2966 |
| 447 | Ga0207702_10073157 | 3300026078 | Bacteria | 2955 |
| 448 | Ga0207702_10734758 | 3300026078 | Bacteria | 974 |
| 449 | Ga0207702_10907373 | 3300026078 | Bacteria | 873 |
| 450 | Ga0207641_10000008 | 3300026088 | Bacteria | 424415 |
| 451 | Ga0207641_10000073 | 3300026088 | Bacteria | 149989 |
| 452 | Ga0207641_10003935 | 3300026088 | Bacteria | 12989 |
| 453 | Ga0207641_10017638 | 3300026088 | Bacteria | 5846 |
| 454 | Ga0207641_10060086 | 3300026088 | Bacteria | 3239 |
| 455 | Ga0207641_10303699 | 3300026088 | Bacteria | 1508 |
| 456 | Ga0207648_10006895 | 3300026089 | Bacteria | 11254 |
| 457 | Ga0207648_10021743 | 3300026089 | Bacteria | 5764 |
| 458 | Ga0207676_10000004 | 3300026095 | Bacteria | 725417 |
| 459 | Ga0207676_10000019 | 3300026095 | Bacteria | 305653 |
| 460 | Ga0207676_10000112 | 3300026095 | Bacteria | 73166 |
| 461 | Ga0207674_10000167 | 3300026116 | Bacteria | 78909 |
| 462 | Ga0207674_10002320 | 3300026116 | Bacteria | 24101 |
| 463 | Ga0207674_10006048 | 3300026116 | Bacteria | 14317 |
| 464 | Ga0207674_10143092 | 3300026116 | Bacteria | 2350 |
| 465 | Ga0207675_100003904 | 3300026118 | Bacteria | 14497 |
| 466 | Ga0207675_100142534 | 3300026118 | Bacteria | 2277 |
| 467 | Ga0207683_10000046 | 3300026121 | Bacteria | 89256 |
| 468 | Ga0207698_10006657 | 3300026142 | Bacteria | 7222 |
| 469 | Ga0207698_10027208 | 3300026142 | Bacteria | 4057 |
| 470 | Ga0207698_10062466 | 3300026142 | Bacteria | 2909 |
| 471 | Ga0207698_10160117 | 3300026142 | Bacteria | 1967 |
| 472 | Ga0209281_1000073 | 3300027111 | Bacteria | 269036 |
| 473 | Ga0268266_10002649 | 3300028379 | Bacteria | 18854 |
| 474 | Ga0268266_10005031 | 3300028379 | Bacteria | 12479 |
| 475 | Ga0268266_10009507 | 3300028379 | Bacteria | 8555 |
| 476 | Ga0268266_10042076 | 3300028379 | Bacteria | 3900 |
| 477 | Ga0268266_10080439 | 3300028379 | Bacteria | 2839 |
| 478 | Ga0268266_10565341 | 3300028379 | Unclassified | 1090 |
| 479 | Ga0268265_10000011 | 3300028380 | Bacteria | 343832 |
| 480 | Ga0268265_10000107 | 3300028380 | Bacteria | 104685 |
| 481 | Ga0268265_10029655 | 3300028380 | Bacteria | 3930 |
| 482 | Ga0268265_10136981 | 3300028380 | Bacteria | 2044 |
| 483 | Ga0268265_10502098 | 3300028380 | Bacteria | 1143 |
| 484 | Ga0268265_11321637 | 3300028380 | Bacteria | 721 |
| 485 | Ga0268264_10000025 | 3300028381 | Bacteria | 468619 |
| 486 | Ga0268264_10000081 | 3300028381 | Bacteria | 248362 |
| 487 | Ga0268264_10000457 | 3300028381 | Bacteria | 55639 |
| 488 | Ga0268264_10000869 | 3300028381 | Bacteria | 31997 |
| 489 | Ga0268264_10771942 | 3300028381 | Unclassified | 959 |
| 490 | Ga0307515_10015055 | 3300028794 | Bacteria | 14287 |
| 491 | Ga0307408_100000852 | 3300031548 | Bacteria | 24073 |
| 492 | Ga0307408_100059403 | 3300031548 | Bacteria | 2782 |
| 493 | Ga0307408_100099438 | 3300031548 | Bacteria | 2213 |
| 494 | Ga0307516_10003223 | 3300031730 | Bacteria | 21166 |
| 495 | Ga0307405_10044034 | 3300031731 | Bacteria | 2727 |
| 496 | Ga0307405_10270226 | 3300031731 | Bacteria | 1274 |
| 497 | Ga0307405_10474787 | 3300031731 | Bacteria | 997 |
| 498 | Ga0307412_10017311 | 3300031911 | Bacteria | 4312 |
| 499 | Ga0307412_10019933 | 3300031911 | Bacteria | 4071 |
| 500 | Ga0307412_10038964 | 3300031911 | Bacteria | 3064 |
| 501 | Ga0307414_10015372 | 3300032004 | Bacteria | 4619 |
| 502 | Ga0307414_10201425 | 3300032004 | Bacteria | 1619 |
| 503 | Ga0307411_10499793 | 3300032005 | Bacteria | 1028 |
| 504 | Ga0373931_0025728 | 3300035691 | Bacteria | 2989 |
| 505 | Ga0395898_0023422 | 3300037466 | Bacteria | 6241 |
| 506 | Ga0395898_0236465 | 3300037466 | Bacteria | 1742 |
| 507 | Ga0395905_0002432 | 3300037471 | Bacteria | 20642 |
| 508 | Ga0395905_0058757 | 3300037471 | Bacteria | 3596 |
| 509 | Ga0395905_0060373 | 3300037471 | Bacteria | 3545 |
| 510 | Ga0395905_0575613 | 3300037471 | Bacteria | 1027 |
| 511 | Ga0395901_0042013 | 3300038443 | Bacteria | 4739 |
| 512 | Ga0436360_1284070 | 3300039438 | Bacteria | 1388 |
| 513 | Ga0436361_0657781 | 3300039447 | Bacteria | 2103 |
| 514 | Ga0439438_002748 | 3300041405 | Bacteria | 7383 |
| 515 | Ga0439438_007343 | 3300041405 | Bacteria | 3775 |
| 516 | Ga0439438_008788 | 3300041405 | Bacteria | 3317 |
| 517 | Ga0439447_039371 | 3300041407 | Bacteria | 1157 |
| 518 | Ga0439466_0015205 | 3300041411 | Bacteria | 2796 |
| 519 | Ga0451791_0216335 | 3300041451 | Bacteria | 872 |
| 520 | Ga0451793_0721922 | 3300041452 | Bacteria | 1653 |
| 521 | Ga0451795_1284843 | 3300041456 | Bacteria | 1651 |
| 522 | Ga0451802_0724550 | 3300041460 | Bacteria | 1904 |
| 523 | Ga0451807_0443440 | 3300041486 | Bacteria | 1518 |
| 524 | Ga0451837_1123269 | 3300041494 | Bacteria | 671 |
| 525 | Ga0451841_1270401 | 3300041498 | Bacteria | 1536 |
| 526 | Ga0451853_1610789 | 3300041512 | Bacteria | 2684 |
| 527 | Ga0439431_0004866 | 3300041997 | Bacteria | 2960 |
| 528 | Ga0439431_0047542 | 3300041997 | Bacteria | 1106 |
| 529 | Ga0439432_018237 | 3300042006 | Bacteria | 2346 |
| 530 | Ga0439452_006058 | 3300042010 | Bacteria | 3823 |
| 531 | Ga0450920_008871 | 3300042122 | Bacteria | 1844 |
| 532 | Ga0450888_000189 | 3300042126 | Bacteria | 5443 |
| 533 | Ga0450888_006728 | 3300042126 | Bacteria | 1256 |
| 534 | Ga0450891_001637 | 3300042129 | Bacteria | 2311 |
| 535 | Ga0450892_000294 | 3300042130 | Bacteria | 5887 |
| 536 | Ga0450889_014814 | 3300042144 | Bacteria | 833 |
| 537 | Ga0439458_0080775 | 3300042157 | Bacteria | 829 |
| 538 | Ga0450908_001064 | 3300042184 | Bacteria | 5333 |
| 539 | Ga0439434_0050623 | 3300042435 | Bacteria | 1287 |
| 540 | Ga0450893_0002657 | 3300042532 | Bacteria | 2794 |
| 541 | Ga0450893_0022976 | 3300042532 | Bacteria | 1082 |
| 542 | Ga0466969_0004380 | 3300044656 | Bacteria | 7514 |
| 543 | Ga0466969_0027935 | 3300044656 | Bacteria | 2887 |
| 544 | Ga0466972_0000442 | 3300044658 | Bacteria | 21409 |
| 545 | Ga0466972_0061133 | 3300044658 | Bacteria | 1807 |
| 546 | Ga0466972_0149433 | 3300044658 | Bacteria | 1098 |
| 547 | Ga0466965_0043710 | 3300044683 | Bacteria | 2212 |
| 548 | Ga0466965_0108085 | 3300044683 | Bacteria | 1427 |
| 549 | Ga0466965_0541543 | 3300044683 | Bacteria | 656 |
| 550 | Ga0466966_0003863 | 3300044684 | Bacteria | 9890 |
| 551 | Ga0466966_0017937 | 3300044684 | Bacteria | 4673 |
| 552 | Ga0466966_0406075 | 3300044684 | Bacteria | 819 |
| 553 | Ga0466961_0001590 | 3300044693 | Bacteria | 14079 |
| 554 | Ga0466961_0026746 | 3300044693 | Bacteria | 3709 |
| 555 | Ga0466961_0084249 | 3300044693 | Bacteria | 2010 |
| 556 | Ga0466961_0130733 | 3300044693 | Bacteria | 1573 |
| 557 | Ga0466964_0001270 | 3300044706 | Bacteria | 8589 |
| 558 | Ga0466964_0047528 | 3300044706 | Bacteria | 1752 |
| 559 | Ga0466964_0051326 | 3300044706 | Bacteria | 1693 |
| 560 | Ga0466964_0138253 | 3300044706 | Bacteria | 1117 |
| 561 | Ga0466971_0009149 | 3300044719 | Bacteria | 4331 |
| 562 | Ga0466968_0008834 | 3300044735 | Bacteria | 3867 |
| 563 | Ga0466968_0033469 | 3300044735 | Bacteria | 2141 |
| 564 | Ga0466968_0227790 | 3300044735 | Bacteria | 879 |
| 565 | Ga0466970_0006176 | 3300044765 | Bacteria | 5971 |
| 566 | Ga0466970_0133972 | 3300044765 | Bacteria | 1362 |
| 567 | Ga0466970_0552846 | 3300044765 | Bacteria | 665 |
| 568 | Ga0466957_0033934 | 3300044842 | Bacteria | 3062 |
| 569 | Ga0466957_0215409 | 3300044842 | Bacteria | 1266 |
| 570 | Ga0466957_0739342 | 3300044842 | Bacteria | 696 |
| 571 | Ga0466960_0232879 | 3300044901 | Bacteria | 1017 |
| 572 | Ga0466960_0277395 | 3300044901 | Bacteria | 938 |
| 573 | Ga0466959_0000455 | 3300045049 | Bacteria | 23797 |
| 574 | Ga0466959_0010816 | 3300045049 | Bacteria | 6541 |
| 575 | Ga0466959_0040224 | 3300045049 | Unclassified | 3454 |
| 576 | Ga0466959_0062262 | 3300045049 | Unclassified | 2712 |
| 577 | Ga0466959_0082661 | 3300045049 | Bacteria | 2313 |
| 578 | Ga0466959_0137959 | 3300045049 | Bacteria | 1725 |
| 579 | Ga0466959_0255324 | 3300045049 | Bacteria | 1208 |
| 580 | Ga0466959_0301098 | 3300045049 | Bacteria | 1098 |
| 581 | Ga0466959_0361457 | 3300045049 | Unclassified | 989 |
| 582 | Ga0466959_0636399 | 3300045049 | Bacteria | 716 |
| 583 | Ga0466967_0013873 | 3300045976 | Bacteria | 6249 |
| 584 | Ga0495638_0000102 | 3300046460 | Bacteria | 137013 |
| 585 | Ga0495639_0019750 | 3300046475 | Bacteria | 2941 |
| 586 | Ga0495632_0075748 | 3300046519 | Bacteria | 1610 |
| 587 | Ga0495648_0000001 | 3300046524 | Bacteria | 696872 |
| 588 | Ga0495642_0000399 | 3300046528 | Bacteria | 23361 |
| 589 | Ga0495609_0001495 | 3300046538 | Bacteria | 15463 |
| 590 | Ga0495622_0000072 | 3300046557 | Bacteria | 88665 |
| 591 | Ga0496101_0170505 | 3300048904 | Bacteria | 1673 |
| 592 | Ga0496101_0439039 | 3300048904 | Bacteria | 1029 |
| 593 | Ga0496102_0006012 | 3300048905 | Bacteria | 10335 |
| 594 | Ga0496102_0151392 | 3300048905 | Unclassified | 2180 |
| 595 | Ga0496102_0841111 | 3300048905 | Bacteria | 840 |
| 596 | Ga0496103_0000966 | 3300048906 | Bacteria | 20376 |
| 597 | Ga0496103_0068951 | 3300048906 | Bacteria | 2210 |
| 598 | Ga0496105_0130695 | 3300048908 | Bacteria | 2070 |
| 599 | Ga0496111_0364728 | 3300048914 | Bacteria | 1069 |
| 600 | Ga0496112_0193871 | 3300048915 | Unclassified | 1993 |
| 601 | Ga0496115_0201335 | 3300048918 | Bacteria | 1645 |
| 602 | Ga0496116_0004783 | 3300048919 | Bacteria | 12782 |
| 603 | Ga0496116_0025509 | 3300048919 | Bacteria | 4344 |
| 604 | Ga0496116_0045027 | 3300048919 | Bacteria | 2991 |
| 605 | Ga0496117_0012482 | 3300048920 | Bacteria | 7480 |
| 606 | Ga0496117_0024734 | 3300048920 | Bacteria | 4737 |
| 607 | Ga0496117_0045592 | 3300048920 | Bacteria | 3165 |
| 608 | Ga0496118_0000152 | 3300048921 | Bacteria | 122913 |
| 609 | Ga0496118_0005373 | 3300048921 | Bacteria | 14589 |
| 610 | Ga0496118_0067454 | 3300048921 | Bacteria | 2604 |
| 611 | Ga0496118_0108569 | 3300048921 | Bacteria | 1849 |
| 612 | Ga0496119_0001236 | 3300048922 | Bacteria | 31768 |
| 613 | Ga0496119_0001678 | 3300048922 | Bacteria | 25868 |
| 614 | Ga0496119_0018793 | 3300048922 | Bacteria | 5124 |
| 615 | Ga0496119_0063469 | 3300048922 | Bacteria | 2197 |
| 616 | Ga0496120_0001156 | 3300048923 | Bacteria | 33809 |
| 617 | Ga0496120_0003074 | 3300048923 | Bacteria | 15738 |
| 618 | Ga0496121_0005197 | 3300048924 | Bacteria | 16868 |
| 619 | Ga0496121_0009750 | 3300048924 | Bacteria | 10986 |
| 620 | Ga0496121_0025617 | 3300048924 | Bacteria | 5590 |
| 621 | Ga0496121_0034746 | 3300048924 | Bacteria | 4533 |
| 622 | Ga0496121_0077399 | 3300048924 | Bacteria | 2649 |
| 623 | Ga0496122_0048540 | 3300048925 | Bacteria | 3262 |
| 624 | Ga0496122_0063347 | 3300048925 | Bacteria | 2699 |
| 625 | Ga0496123_0011788 | 3300048926 | Bacteria | 7530 |
| 626 | Ga0496123_0012006 | 3300048926 | Bacteria | 7430 |
| 627 | Ga0496124_0001113 | 3300048927 | Bacteria | 42308 |
| 628 | Ga0496124_0026821 | 3300048927 | Bacteria | 5186 |
| 629 | Ga0496124_0179643 | 3300048927 | Bacteria | 1630 |
| 630 | Ga0496124_0187621 | 3300048927 | Bacteria | 1585 |
| 631 | Ga0496125_0003261 | 3300048928 | Bacteria | 19976 |
| 632 | Ga0496125_0004247 | 3300048928 | Bacteria | 16695 |
| 633 | Ga0496125_0004671 | 3300048928 | Bacteria | 15615 |
| 634 | Ga0496125_0011179 | 3300048928 | Bacteria | 8999 |
| 635 | Ga0496125_0040058 | 3300048928 | Bacteria | 4024 |
| 636 | Ga0496125_0149169 | 3300048928 | Bacteria | 1610 |
| 637 | Ga0496126_0002403 | 3300048929 | Bacteria | 25408 |
| 638 | Ga0496126_0011528 | 3300048929 | Bacteria | 9135 |
| 639 | Ga0496126_0016497 | 3300048929 | Bacteria | 7382 |
| 640 | Ga0496126_0094961 | 3300048929 | Bacteria | 2616 |
| 641 | Ga0501304_021897 | 3300049160 | Bacteria | 638 |
| 642 | Ga0495678_000432 | 3300049459 | Bacteria | 41899 |
| 643 | Ga0501290_000573 | 3300049513 | Bacteria | 5553 |
| 644 | Ga0501292_000002 | 3300049515 | Bacteria | 188289 |
| 645 | Ga0501294_000431 | 3300049517 | Bacteria | 4985 |
| 646 | Ga0501314_000805 | 3300049530 | Bacteria | 2083 |
| 647 | Ga0501315_004300 | 3300049531 | Bacteria | 1483 |
| 648 | Ga0501317_000436 | 3300049533 | Bacteria | 2890 |
| 649 | Ga0501318_006758 | 3300049534 | Bacteria | 1180 |
| 650 | Ga0501032_0514059 | 3300049569 | Bacteria | 765 |
| 651 | Ga0501039_0427859 | 3300049575 | Bacteria | 1040 |
| 652 | Ga0501047_0439997 | 3300049581 | Bacteria | 1134 |
| 653 | Ga0501073_0462092 | 3300049589 | Bacteria | 877 |
| 654 | Ga0501202_039219 | 3300049652 | Bacteria | 1017 |
| 655 | Ga0501206_003664 | 3300049653 | Bacteria | 1952 |
| 656 | Ga0501222_000786 | 3300049662 | Bacteria | 4572 |
| 657 | Ga0501223_000020 | 3300049663 | Bacteria | 67103 |
| 658 | Ga0501223_000786 | 3300049663 | Bacteria | 7518 |
| 659 | Ga0501224_000004 | 3300049664 | Bacteria | 169090 |
| 660 | Ga0501224_000351 | 3300049664 | Bacteria | 5388 |
| 661 | Ga0501227_003597 | 3300049665 | Bacteria | 3359 |
| 662 | Ga0501233_003611 | 3300049668 | Bacteria | 2789 |
| 663 | Ga0501235_000265 | 3300049669 | Bacteria | 9685 |
| 664 | Ga0501235_015647 | 3300049669 | Bacteria | 1673 |
| 665 | Ga0501246_002169 | 3300049676 | Bacteria | 1543 |
| 666 | Ga0501257_001517 | 3300049686 | Bacteria | 4842 |
| 667 | Ga0501259_000144 | 3300049688 | Bacteria | 10617 |
| 668 | Ga0501261_000009 | 3300049690 | Bacteria | 56434 |
| 669 | Ga0501225_0000060 | 3300049705 | Bacteria | 35405 |
| 670 | Ga0501225_0000310 | 3300049705 | Bacteria | 15275 |
| 671 | Ga0501225_0113840 | 3300049705 | Bacteria | 799 |
| 672 | Ga0501229_005356 | 3300049706 | Bacteria | 1574 |
| 673 | Ga0501234_001027 | 3300049707 | Bacteria | 4411 |
| 674 | Ga0501245_001663 | 3300049708 | Bacteria | 2903 |
| 675 | Ga0501279_000003 | 3300049775 | Bacteria | 188296 |
| 676 | Ga0501280_000090 | 3300049776 | Bacteria | 24442 |
| 677 | Ga0501281_00091 | 3300049777 | Bacteria | 10651 |
| 678 | Ga0501226_000018 | 3300049853 | Bacteria | 147268 |
| 679 | nmdc:mga0k408_107214_c1 | 3300050493 | Bacteria | 1650 |
| 680 | nmdc:mga0k408_1744_c1 | 3300050493 | Bacteria | 6145 |
| 681 | nmdc:mga0k408_4189_c1 | 3300050493 | Bacteria | 7653 |
| 682 | nmdc:mga0k408_86216_c1 | 3300050493 | Bacteria | 1843 |
| 683 | nmdc:mga06z11_313705_c1 | 3300050494 | Bacteria | 934 |
| 684 | nmdc:mga07m45_136893_c1 | 3300050496 | Bacteria | 1418 |
| 685 | nmdc:mga07m45_2113_c1 | 3300050496 | Bacteria | 9243 |
| 686 | nmdc:mga07m45_461_c1 | 3300050496 | Bacteria | 17108 |
| 687 | Ga0500590_060888 | 3300053148 | Unclassified | 1897 |
| 688 | Ga0500616_0107569 | 3300053153 | Bacteria | 1352 |
| 689 | Ga0500616_0117831 | 3300053153 | Bacteria | 1273 |
| 690 | Ga0500637_0240765 | 3300053178 | Bacteria | 1014 |
| 691 | Ga0500637_0424997 | 3300053178 | Bacteria | 682 |
| 692 | Ga0587084_004573 | 3300059477 | Bacteria | 1591 |
| 693 | Ga0587070_008565 | 3300059491 | Bacteria | 1453 |
| 694 | Ga0587077_006126 | 3300059493 | Bacteria | 1686 |
| 695 | Ga0587080_007804 | 3300059503 | Bacteria | 1514 |
| 696 | Ga0587082_002042 | 3300059504 | Bacteria | 2217 |
| 697 | Ga0587090_018926 | 3300059510 | Bacteria | 1057 |
| 698 | Ga0587091_021604 | 3300059511 | Bacteria | 1129 |
| 699 | Ga0587076_025304 | 3300059645 | Bacteria | 1014 |
| 700 | Ga0587079_005665 | 3300059647 | Bacteria | 1780 |
| 701 | Ga0587071_031649 | 3300060344 | Bacteria | 1021 |
| 702 | Ga0466962_0012679 | 3300061719 | Bacteria | 4055 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300009093 | Ga0105240_10001791 | Ga0105240_100017918 | 192 |
| 2 | 3300009545 | Ga0105237_10013677 | Ga0105237_100136778 | 192 |
| 3 | 3300013105 | Ga0157369_10436457 | Ga0157369_104364572 | 192 |
| 4 | 3300013296 | Ga0157374_10610711 | Ga0157374_106107112 | 192 |
| 5 | 3300006847 | Ga0075431_101184622 | Ga0075431_1011846221 | 193 |
| 6 | 3300049575 | Ga0501039_0427859 | Ga0501039_0427859_60_644 | 193 |
| 7 | iso_pu_bacteria | 2511231156 | 2511824478 | 196 |
| 8 | iso_pu_bacteria | 2521172590 | 2521559882 | 196 |
| 9 | iso_pu_bacteria | 2551306416 | 2553006983 | 196 |
| 10 | iso_pu_bacteria | 2599185212 | 2599614714 | 196 |
| 11 | iso_pu_bacteria | 2599185306 | 2599964023 | 196 |
| 12 | iso_pu_bacteria | 2599185307 | 2599972082 | 196 |
| 13 | iso_pu_bacteria | 2599185308 | 2599976746 | 196 |
| 14 | iso_pu_bacteria | 2599185311 | 2599996664 | 196 |
| 15 | iso_pu_bacteria | 2599185313 | 2600003778 | 196 |
| 16 | iso_pu_bacteria | 2599185314 | 2600010915 | 196 |
| 17 | iso_pu_bacteria | 2599185316 | 2600021870 | 196 |
| 18 | iso_pu_bacteria | 2599185317 | 2600031907 | 196 |
| 19 | iso_pu_bacteria | 2599185318 | 2600037335 | 196 |
| 20 | iso_pu_bacteria | 2599185319 | 2600041489 | 196 |
| 21 | iso_pu_bacteria | 2599185322 | 2600059474 | 196 |
| 22 | iso_pu_bacteria | 2599185323 | 2600063697 | 196 |
| 23 | iso_pu_bacteria | 2599185324 | 2600069172 | 196 |
| 24 | iso_pu_bacteria | 2599185325 | 2600075144 | 196 |
| 25 | iso_pu_bacteria | 2600254930 | 2600361677 | 196 |
| 26 | iso_pu_bacteria | 2643221650 | 2644281057 | 196 |
| 27 | iso_pu_bacteria | 2651869719 | 2652547119 | 196 |
| 28 | iso_pu_bacteria | 2667528176 | 2671126954 | 196 |
| 29 | iso_pu_bacteria | 2675903515 | 2678263494 | 196 |
| 30 | iso_pu_bacteria | 2744054620 | 2745009825 | 196 |
| 31 | iso_pu_bacteria | 2808606361 | 2808853498 | 196 |
| 32 | iso_pu_bacteria | 2808606376 | 2808922429 | 196 |
| 33 | iso_pu_bacteria | 2808606378 | 2808933879 | 196 |
| 34 | iso_pu_bacteria | 2808606380 | 2808944588 | 196 |
| 35 | iso_pu_bacteria | 2808606383 | 2808962353 | 196 |
| 36 | iso_pu_bacteria | 2808606389 | 2808996890 | 196 |
| 37 | iso_pu_bacteria | 2808606415 | 2809129788 | 196 |
| 38 | iso_pu_bacteria | 2808606419 | 2809149157 | 196 |
| 39 | iso_pu_bacteria | 2818991446 | 2819600969 | 196 |
| 40 | iso_pu_bacteria | 2825651385 | 2825652313 | 196 |
| 41 | iso_pu_bacteria | 2838054893 | 2838060684 | 196 |
| 42 | iso_pu_bacteria | 2842854478 | 2842857947 | 196 |
| 43 | iso_pu_bacteria | 2852618963 | 2852619297 | 196 |
| 44 | iso_pu_bacteria | 2904439833 | 2904444451 | 196 |
| 45 | iso_pu_bacteria | 2904530477 | 2904535604 | 196 |
| 46 | iso_pu_bacteria | 2904584206 | 2904588176 | 196 |
| 47 | iso_pu_bacteria | 2904589729 | 2904595212 | 196 |
| 48 | iso_pu_bacteria | 2904601388 | 2904606123 | 196 |
| 49 | iso_pu_bacteria | 2913036834 | 2913040338 | 196 |
| 50 | iso_pu_bacteria | 2919079590 | 2919084322 | 196 |
| 51 | iso_pu_bacteria | 2919704043 | 2919707941 | 196 |
| 52 | iso_pu_bacteria | 2923586266 | 2923588130 | 196 |
| 53 | iso_pu_bacteria | 2928115317 | 2928118682 | 196 |
| 54 | iso_pu_bacteria | 2928130867 | 2928135232 | 196 |
| 55 | iso_pu_bacteria | 2929144301 | 2929147757 | 196 |
| 56 | iso_pu_bacteria | 2931369376 | 2931374850 | 196 |
| 57 | iso_pu_bacteria | 2945928738 | 2945934108 | 196 |
| 58 | iso_pu_bacteria | 2988728565 | 2988728947 | 196 |
| 59 | iso_pu_bacteria | 8056143049 | 8056146493 | 196 |
| 60 | iso_pu_bacteria | 2896253425 | 2896254017 | 197 |
| 61 | iso_pu_bacteria | 2904449895 | 2904449923 | 197 |
| 62 | iso_pu_bacteria | 2904456579 | 2904457250 | 197 |
| 63 | iso_pu_bacteria | 2879163058 | 2879166525 | 198 |
| 64 | iso_pu_bacteria | 2919138771 | 2919140727 | 198 |
| 65 | 3300001432 | JGI24034J14986_100776 | JGI24034J14986_1007762 | 199 |
| 66 | 3300001904 | JGI24736J21556_1000789 | JGI24736J21556_10007893 | 199 |
| 67 | 3300001976 | JGI24752J21851_1000020 | JGI24752J21851_10000207 | 199 |
| 68 | 3300001989 | JGI24739J22299_10008392 | JGI24739J22299_100083922 | 199 |
| 69 | 3300001990 | JGI24737J22298_10001316 | JGI24737J22298_100013167 | 199 |
| 70 | 3300002067 | JGI24735J21928_10005060 | JGI24735J21928_100050603 | 199 |
| 71 | 3300002070 | JGI24750J21931_1000383 | JGI24750J21931_10003832 | 199 |
| 72 | 3300002074 | JGI24748J21848_1000013 | JGI24748J21848_100001341 | 199 |
| 73 | 3300002075 | JGI24738J21930_10003587 | JGI24738J21930_100035871 | 199 |
| 74 | 3300002239 | JGI24034J26672_10000011 | JGI24034J26672_1000001162 | 199 |
| 75 | 3300002244 | JGI24742J22300_10000488 | JGI24742J22300_100004884 | 199 |
| 76 | 3300003322 | rootL2_10296995 | rootL2_102969952 | 199 |
| 77 | 3300003784 | Ga0055534_1003042 | Ga0055534_10030422 | 199 |
| 78 | 3300005289 | Ga0065704_10080236 | Ga0065704_100802362 | 199 |
| 79 | 3300005289 | Ga0065704_10088568 | Ga0065704_100885684 | 199 |
| 80 | 3300005330 | Ga0070690_100000054 | Ga0070690_10000005427 | 199 |
| 81 | 3300005331 | Ga0070670_100000031 | Ga0070670_100000031154 | 199 |
| 82 | 3300005331 | Ga0070670_100000154 | Ga0070670_10000015450 | 199 |
| 83 | 3300005331 | Ga0070670_100018634 | Ga0070670_1000186345 | 199 |
| 84 | 3300005331 | Ga0070670_100181094 | Ga0070670_1001810942 | 199 |
| 85 | 3300005335 | Ga0070666_10000114 | Ga0070666_1000011426 | 199 |
| 86 | 3300005335 | Ga0070666_10013146 | Ga0070666_100131465 | 199 |
| 87 | 3300005339 | Ga0070660_100122082 | Ga0070660_1001220822 | 199 |
| 88 | 3300005344 | Ga0070661_100028762 | Ga0070661_1000287623 | 199 |
| 89 | 3300005347 | Ga0070668_100022656 | Ga0070668_1000226565 | 199 |
| 90 | 3300005347 | Ga0070668_100041542 | Ga0070668_1000415423 | 199 |
| 91 | 3300005347 | Ga0070668_100228247 | Ga0070668_1002282471 | 199 |
| 92 | 3300005353 | Ga0070669_100000737 | Ga0070669_10000073716 | 199 |
| 93 | 3300005355 | Ga0070671_100002346 | Ga0070671_10000234613 | 199 |
| 94 | 3300005355 | Ga0070671_100074779 | Ga0070671_1000747792 | 199 |
| 95 | 3300005355 | Ga0070671_100214239 | Ga0070671_1002142392 | 199 |
| 96 | 3300005355 | Ga0070671_100338864 | Ga0070671_1003388642 | 199 |
| 97 | 3300005366 | Ga0070659_100018246 | Ga0070659_1000182461 | 199 |
| 98 | 3300005367 | Ga0070667_100000189 | Ga0070667_10000018911 | 199 |
| 99 | 3300005367 | Ga0070667_100002453 | Ga0070667_1000024536 | 199 |
| 100 | 3300005367 | Ga0070667_100002691 | Ga0070667_1000026915 | 199 |
| 101 | 3300005455 | Ga0070663_100064683 | Ga0070663_1000646833 | 199 |
| 102 | 3300005457 | Ga0070662_100076358 | Ga0070662_1000763583 | 199 |
| 103 | 3300005539 | Ga0068853_100288311 | Ga0068853_1002883111 | 199 |
| 104 | 3300005539 | Ga0068853_100301373 | Ga0068853_1003013733 | 199 |
| 105 | 3300005544 | Ga0070686_100000119 | Ga0070686_10000011927 | 199 |
| 106 | 3300005544 | Ga0070686_100219417 | Ga0070686_1002194171 | 199 |
| 107 | 3300005548 | Ga0070665_100001340 | Ga0070665_10000134018 | 199 |
| 108 | 3300005548 | Ga0070665_100006931 | Ga0070665_1000069319 | 199 |
| 109 | 3300005548 | Ga0070665_100008059 | Ga0070665_1000080598 | 199 |
| 110 | 3300005548 | Ga0070665_100386044 | Ga0070665_1003860442 | 199 |
| 111 | 3300005548 | Ga0070665_100441601 | Ga0070665_1004416012 | 199 |
| 112 | 3300005564 | Ga0070664_100138098 | Ga0070664_1001380983 | 199 |
| 113 | 3300005577 | Ga0068857_100112850 | Ga0068857_1001128503 | 199 |
| 114 | 3300005577 | Ga0068857_100388177 | Ga0068857_1003881772 | 199 |
| 115 | 3300005578 | Ga0068854_100000778 | Ga0068854_1000007787 | 199 |
| 116 | 3300005578 | Ga0068854_100039256 | Ga0068854_1000392563 | 199 |
| 117 | 3300005614 | Ga0068856_100125907 | Ga0068856_1001259073 | 199 |
| 118 | 3300005616 | Ga0068852_100120800 | Ga0068852_1001208003 | 199 |
| 119 | 3300005617 | Ga0068859_100000532 | Ga0068859_10000053220 | 199 |
| 120 | 3300005617 | Ga0068859_100016932 | Ga0068859_1000169323 | 199 |
| 121 | 3300005617 | Ga0068859_100026823 | Ga0068859_1000268236 | 199 |
| 122 | 3300005617 | Ga0068859_100247150 | Ga0068859_1002471501 | 199 |
| 123 | 3300005618 | Ga0068864_100000019 | Ga0068864_100000019168 | 199 |
| 124 | 3300005618 | Ga0068864_100000075 | Ga0068864_10000007597 | 199 |
| 125 | 3300005618 | Ga0068864_100000195 | Ga0068864_10000019526 | 199 |
| 126 | 3300005719 | Ga0068861_100018469 | Ga0068861_1000184694 | 199 |
| 127 | 3300005719 | Ga0068861_100262832 | Ga0068861_1002628322 | 199 |
| 128 | 3300005834 | Ga0068851_10041416 | Ga0068851_100414162 | 199 |
| 129 | 3300005841 | Ga0068863_100000015 | Ga0068863_100000015167 | 199 |
| 130 | 3300005841 | Ga0068863_100000044 | Ga0068863_10000004492 | 199 |
| 131 | 3300005841 | Ga0068863_100003919 | Ga0068863_10000391911 | 199 |
| 132 | 3300005841 | Ga0068863_100007913 | Ga0068863_1000079135 | 199 |
| 133 | 3300005841 | Ga0068863_100043333 | Ga0068863_1000433332 | 199 |
| 134 | 3300005841 | Ga0068863_100140087 | Ga0068863_1001400873 | 199 |
| 135 | 3300005842 | Ga0068858_100002285 | Ga0068858_1000022851 | 199 |
| 136 | 3300005842 | Ga0068858_100005811 | Ga0068858_1000058112 | 199 |
| 137 | 3300005842 | Ga0068858_100100553 | Ga0068858_1001005532 | 199 |
| 138 | 3300005843 | Ga0068860_100000413 | Ga0068860_10000041326 | 199 |
| 139 | 3300005843 | Ga0068860_100001842 | Ga0068860_1000018424 | 199 |
| 140 | 3300005843 | Ga0068860_100003487 | Ga0068860_1000034874 | 199 |
| 141 | 3300005843 | Ga0068860_100561281 | Ga0068860_1005612812 | 199 |
| 142 | 3300005844 | Ga0068862_100000090 | Ga0068862_10000009047 | 199 |
| 143 | 3300005844 | Ga0068862_100000097 | Ga0068862_10000009712 | 199 |
| 144 | 3300005844 | Ga0068862_100006674 | Ga0068862_1000066744 | 199 |
| 145 | 3300005844 | Ga0068862_100040873 | Ga0068862_1000408732 | 199 |
| 146 | 3300006931 | Ga0097620_100000532 | Ga0097620_10000053220 | 199 |
| 147 | 3300006931 | Ga0097620_100016932 | Ga0097620_1000169323 | 199 |
| 148 | 3300006931 | Ga0097620_100026823 | Ga0097620_1000268236 | 199 |
| 149 | 3300006931 | Ga0097620_100247163 | Ga0097620_1002471631 | 199 |
| 150 | 3300009011 | Ga0105251_10000436 | Ga0105251_1000043635 | 199 |
| 151 | 3300009011 | Ga0105251_10000718 | Ga0105251_1000071818 | 199 |
| 152 | 3300009092 | Ga0105250_10048372 | Ga0105250_100483722 | 199 |
| 153 | 3300009093 | Ga0105240_10002201 | Ga0105240_1000220127 | 199 |
| 154 | 3300009093 | Ga0105240_10041137 | Ga0105240_100411373 | 199 |
| 155 | 3300009093 | Ga0105240_10115734 | Ga0105240_101157342 | 199 |
| 156 | 3300009093 | Ga0105240_10181560 | Ga0105240_101815602 | 199 |
| 157 | 3300009093 | Ga0105240_10190626 | Ga0105240_101906262 | 199 |
| 158 | 3300009093 | Ga0105240_10199460 | Ga0105240_101994602 | 199 |
| 159 | 3300009093 | Ga0105240_10446258 | Ga0105240_104462581 | 199 |
| 160 | 3300009093 | Ga0105240_10527073 | Ga0105240_105270732 | 199 |
| 161 | 3300009101 | Ga0105247_10000330 | Ga0105247_1000033024 | 199 |
| 162 | 3300009101 | Ga0105247_10011822 | Ga0105247_100118222 | 199 |
| 163 | 3300009101 | Ga0105247_10030729 | Ga0105247_100307293 | 199 |
| 164 | 3300009101 | Ga0105247_10299608 | Ga0105247_102996082 | 199 |
| 165 | 3300009174 | Ga0105241_10137379 | Ga0105241_101373792 | 199 |
| 166 | 3300009177 | Ga0105248_10000014 | Ga0105248_10000014111 | 199 |
| 167 | 3300009177 | Ga0105248_10002946 | Ga0105248_100029464 | 199 |
| 168 | 3300009177 | Ga0105248_10006876 | Ga0105248_100068762 | 199 |
| 169 | 3300009177 | Ga0105248_10007589 | Ga0105248_100075892 | 199 |
| 170 | 3300009545 | Ga0105237_10111476 | Ga0105237_101114762 | 199 |
| 171 | 3300009545 | Ga0105237_10134823 | Ga0105237_101348232 | 199 |
| 172 | 3300009545 | Ga0105237_10135294 | Ga0105237_101352942 | 199 |
| 173 | 3300009545 | Ga0105237_10260842 | Ga0105237_102608423 | 199 |
| 174 | 3300009551 | Ga0105238_10041446 | Ga0105238_100414462 | 199 |
| 175 | 3300009551 | Ga0105238_10161374 | Ga0105238_101613742 | 199 |
| 176 | 3300009551 | Ga0105238_11743331 | Ga0105238_117433311 | 199 |
| 177 | 3300009553 | Ga0105249_10000048 | Ga0105249_1000004869 | 199 |
| 178 | 3300009553 | Ga0105249_10000266 | Ga0105249_1000026625 | 199 |
| 179 | 3300009553 | Ga0105249_10021316 | Ga0105249_100213166 | 199 |
| 180 | 3300009553 | Ga0105249_10491430 | Ga0105249_104914301 | 199 |
| 181 | 3300009553 | Ga0105249_10902229 | Ga0105249_109022292 | 199 |
| 182 | 3300010375 | Ga0105239_10033806 | Ga0105239_100338063 | 199 |
| 183 | 3300010375 | Ga0105239_10105233 | Ga0105239_101052334 | 199 |
| 184 | 3300010375 | Ga0105239_11583354 | Ga0105239_115833541 | 199 |
| 185 | 3300013306 | Ga0163162_10012075 | Ga0163162_100120757 | 199 |
| 186 | 3300013306 | Ga0163162_10053953 | Ga0163162_100539532 | 199 |
| 187 | 3300013306 | Ga0163162_10149571 | Ga0163162_101495712 | 199 |
| 188 | 3300013306 | Ga0163162_10203148 | Ga0163162_102031482 | 199 |
| 189 | 3300013307 | Ga0157372_10099580 | Ga0157372_100995804 | 199 |
| 190 | 3300014325 | Ga0163163_10208612 | Ga0163163_102086122 | 199 |
| 191 | 3300014325 | Ga0163163_10565264 | Ga0163163_105652642 | 199 |
| 192 | 3300014325 | Ga0163163_10667807 | Ga0163163_106678072 | 199 |
| 193 | 3300014326 | Ga0157380_10002736 | Ga0157380_1000273610 | 199 |
| 194 | 3300014968 | Ga0157379_10099676 | Ga0157379_100996763 | 199 |
| 195 | 3300014968 | Ga0157379_10419182 | Ga0157379_104191822 | 199 |
| 196 | 3300014969 | Ga0157376_10453738 | Ga0157376_104537381 | 199 |
| 197 | 3300017792 | Ga0163161_10000255 | Ga0163161_1000025525 | 199 |
| 198 | 3300025223 | Ga0207672_1000436 | Ga0207672_10004364 | 199 |
| 199 | 3300025291 | Ga0209675_1000248 | Ga0209675_10002482 | 199 |
| 200 | 3300025321 | Ga0207656_10020229 | Ga0207656_100202292 | 199 |
| 201 | 3300025321 | Ga0207656_10033943 | Ga0207656_100339432 | 199 |
| 202 | 3300025711 | Ga0207696_1118927 | Ga0207696_11189271 | 199 |
| 203 | 3300025735 | Ga0207713_1001530 | Ga0207713_100153015 | 199 |
| 204 | 3300025735 | Ga0207713_1003540 | Ga0207713_10035403 | 199 |
| 205 | 3300025900 | Ga0207710_10006689 | Ga0207710_100066892 | 199 |
| 206 | 3300025900 | Ga0207710_10007344 | Ga0207710_100073444 | 199 |
| 207 | 3300025900 | Ga0207710_10175122 | Ga0207710_101751222 | 199 |
| 208 | 3300025903 | Ga0207680_10000052 | Ga0207680_1000005225 | 199 |
| 209 | 3300025903 | Ga0207680_10025077 | Ga0207680_100250773 | 199 |
| 210 | 3300025903 | Ga0207680_10068477 | Ga0207680_100684772 | 199 |
| 211 | 3300025904 | Ga0207647_10042711 | Ga0207647_100427113 | 199 |
| 212 | 3300025904 | Ga0207647_10043900 | Ga0207647_100439003 | 199 |
| 213 | 3300025911 | Ga0207654_10000950 | Ga0207654_100009504 | 199 |
| 214 | 3300025913 | Ga0207695_10000435 | Ga0207695_1000043547 | 199 |
| 215 | 3300025913 | Ga0207695_10001255 | Ga0207695_1000125531 | 199 |
| 216 | 3300025913 | Ga0207695_10089140 | Ga0207695_100891403 | 199 |
| 217 | 3300025913 | Ga0207695_10212371 | Ga0207695_102123712 | 199 |
| 218 | 3300025913 | Ga0207695_10445259 | Ga0207695_104452592 | 199 |
| 219 | 3300025914 | Ga0207671_10002126 | Ga0207671_1000212616 | 199 |
| 220 | 3300025914 | Ga0207671_10036194 | Ga0207671_100361942 | 199 |
| 221 | 3300025914 | Ga0207671_10044076 | Ga0207671_100440762 | 199 |
| 222 | 3300025914 | Ga0207671_10224908 | Ga0207671_102249082 | 199 |
| 223 | 3300025919 | Ga0207657_10040495 | Ga0207657_100404953 | 199 |
| 224 | 3300025923 | Ga0207681_10000001 | Ga0207681_100000011040 | 199 |
| 225 | 3300025923 | Ga0207681_10001393 | Ga0207681_100013938 | 199 |
| 226 | 3300025924 | Ga0207694_10003218 | Ga0207694_100032187 | 199 |
| 227 | 3300025924 | Ga0207694_10069950 | Ga0207694_100699503 | 199 |
| 228 | 3300025924 | Ga0207694_10083884 | Ga0207694_100838843 | 199 |
| 229 | 3300025924 | Ga0207694_10338753 | Ga0207694_103387532 | 199 |
| 230 | 3300025925 | Ga0207650_10000055 | Ga0207650_10000055154 | 199 |
| 231 | 3300025925 | Ga0207650_10001052 | Ga0207650_1000105210 | 199 |
| 232 | 3300025925 | Ga0207650_10014989 | Ga0207650_100149894 | 199 |
| 233 | 3300025925 | Ga0207650_10054138 | Ga0207650_100541384 | 199 |
| 234 | 3300025931 | Ga0207644_10043573 | Ga0207644_100435734 | 199 |
| 235 | 3300025931 | Ga0207644_10075796 | Ga0207644_100757963 | 199 |
| 236 | 3300025931 | Ga0207644_10097406 | Ga0207644_100974063 | 199 |
| 237 | 3300025933 | Ga0207706_10021636 | Ga0207706_100216366 | 199 |
| 238 | 3300025936 | Ga0207670_10761133 | Ga0207670_107611332 | 199 |
| 239 | 3300025941 | Ga0207711_10000021 | Ga0207711_10000021219 | 199 |
| 240 | 3300025941 | Ga0207711_10003159 | Ga0207711_100031594 | 199 |
| 241 | 3300025941 | Ga0207711_10077874 | Ga0207711_100778743 | 199 |
| 242 | 3300025941 | Ga0207711_10290753 | Ga0207711_102907532 | 199 |
| 243 | 3300025949 | Ga0207667_10106107 | Ga0207667_101061072 | 199 |
| 244 | 3300025949 | Ga0207667_10140023 | Ga0207667_101400233 | 199 |
| 245 | 3300025949 | Ga0207667_10853721 | Ga0207667_108537212 | 199 |
| 246 | 3300025961 | Ga0207712_10000221 | Ga0207712_1000022126 | 199 |
| 247 | 3300025961 | Ga0207712_10000598 | Ga0207712_1000059821 | 199 |
| 248 | 3300025961 | Ga0207712_10141483 | Ga0207712_101414832 | 199 |
| 249 | 3300025961 | Ga0207712_10839787 | Ga0207712_108397871 | 199 |
| 250 | 3300025972 | Ga0207668_10095262 | Ga0207668_100952623 | 199 |
| 251 | 3300025972 | Ga0207668_10156311 | Ga0207668_101563113 | 199 |
| 252 | 3300025972 | Ga0207668_10678046 | Ga0207668_106780462 | 199 |
| 253 | 3300025981 | Ga0207640_10005437 | Ga0207640_100054373 | 199 |
| 254 | 3300025981 | Ga0207640_10789609 | Ga0207640_107896091 | 199 |
| 255 | 3300025986 | Ga0207658_10000567 | Ga0207658_1000056711 | 199 |
| 256 | 3300025986 | Ga0207658_10005623 | Ga0207658_100056234 | 199 |
| 257 | 3300025986 | Ga0207658_10342094 | Ga0207658_103420941 | 199 |
| 258 | 3300026035 | Ga0207703_10000544 | Ga0207703_1000054424 | 199 |
| 259 | 3300026035 | Ga0207703_10061105 | Ga0207703_100611053 | 199 |
| 260 | 3300026041 | Ga0207639_10015954 | Ga0207639_100159544 | 199 |
| 261 | 3300026067 | Ga0207678_10086681 | Ga0207678_100866812 | 199 |
| 262 | 3300026067 | Ga0207678_10171019 | Ga0207678_101710192 | 199 |
| 263 | 3300026067 | Ga0207678_10329108 | Ga0207678_103291082 | 199 |
| 264 | 3300026078 | Ga0207702_10072627 | Ga0207702_100726273 | 199 |
| 265 | 3300026088 | Ga0207641_10000008 | Ga0207641_10000008271 | 199 |
| 266 | 3300026088 | Ga0207641_10000073 | Ga0207641_1000007340 | 199 |
| 267 | 3300026088 | Ga0207641_10003935 | Ga0207641_100039359 | 199 |
| 268 | 3300026088 | Ga0207641_10017638 | Ga0207641_100176381 | 199 |
| 269 | 3300026088 | Ga0207641_10303699 | Ga0207641_103036992 | 199 |
| 270 | 3300026095 | Ga0207676_10000004 | Ga0207676_1000000413 | 199 |
| 271 | 3300026095 | Ga0207676_10000019 | Ga0207676_10000019155 | 199 |
| 272 | 3300026095 | Ga0207676_10000112 | Ga0207676_1000011225 | 199 |
| 273 | 3300026116 | Ga0207674_10143092 | Ga0207674_101430923 | 199 |
| 274 | 3300026118 | Ga0207675_100003904 | Ga0207675_1000039047 | 199 |
| 275 | 3300026142 | Ga0207698_10160117 | Ga0207698_101601172 | 199 |
| 276 | 3300028379 | Ga0268266_10002649 | Ga0268266_1000264913 | 199 |
| 277 | 3300028379 | Ga0268266_10005031 | Ga0268266_1000503111 | 199 |
| 278 | 3300028379 | Ga0268266_10042076 | Ga0268266_100420762 | 199 |
| 279 | 3300028379 | Ga0268266_10080439 | Ga0268266_100804392 | 199 |
| 280 | 3300028379 | Ga0268266_10565341 | Ga0268266_105653412 | 199 |
| 281 | 3300028380 | Ga0268265_10000011 | Ga0268265_10000011271 | 199 |
| 282 | 3300028380 | Ga0268265_10000107 | Ga0268265_1000010711 | 199 |
| 283 | 3300028380 | Ga0268265_10029655 | Ga0268265_100296553 | 199 |
| 284 | 3300028380 | Ga0268265_10136981 | Ga0268265_101369812 | 199 |
| 285 | 3300028381 | Ga0268264_10000025 | Ga0268264_1000002527 | 199 |
| 286 | 3300028381 | Ga0268264_10000081 | Ga0268264_1000008173 | 199 |
| 287 | 3300028381 | Ga0268264_10000457 | Ga0268264_1000045725 | 199 |
| 288 | 3300028381 | Ga0268264_10000869 | Ga0268264_1000086921 | 199 |
| 289 | 3300028381 | Ga0268264_10771942 | Ga0268264_107719422 | 199 |
| 290 | 3300028794 | Ga0307515_10015055 | Ga0307515_100150557 | 199 |
| 291 | 3300037466 | Ga0395898_0023422 | Ga0395898_0023422_2651_3259 | 199 |
| 292 | 3300039438 | Ga0436360_1284070 | Ga0436360_1284070_362_1051 | 199 |
| 293 | 3300042126 | Ga0450888_000189 | Ga0450888_000189_3029_3685 | 199 |
| 294 | 3300042129 | Ga0450891_001637 | Ga0450891_001637_610_1266 | 199 |
| 295 | 3300042130 | Ga0450892_000294 | Ga0450892_000294_505_1161 | 199 |
| 296 | 3300042144 | Ga0450889_014814 | Ga0450889_014814_151_807 | 199 |
| 297 | 3300042532 | Ga0450893_0002657 | Ga0450893_0002657_853_1509 | 199 |
| 298 | 3300044656 | Ga0466969_0027935 | Ga0466969_0027935_1463_2071 | 199 |
| 299 | 3300044658 | Ga0466972_0061133 | Ga0466972_0061133_816_1424 | 199 |
| 300 | 3300044684 | Ga0466966_0406075 | Ga0466966_0406075_26_634 | 199 |
| 301 | 3300044693 | Ga0466961_0026746 | Ga0466961_0026746_2910_3518 | 199 |
| 302 | 3300044706 | Ga0466964_0051326 | Ga0466964_0051326_822_1430 | 199 |
| 303 | 3300044765 | Ga0466970_0552846 | Ga0466970_0552846_33_641 | 199 |
| 304 | 3300044842 | Ga0466957_0215409 | Ga0466957_0215409_483_1091 | 199 |
| 305 | 3300044842 | Ga0466957_0739342 | Ga0466957_0739342_14_622 | 199 |
| 306 | 3300044901 | Ga0466960_0232879 | Ga0466960_0232879_280_888 | 199 |
| 307 | 3300045049 | Ga0466959_0000455 | Ga0466959_0000455_1239_1847 | 199 |
| 308 | 3300045049 | Ga0466959_0040224 | Ga0466959_0040224_2503_3111 | 199 |
| 309 | 3300045049 | Ga0466959_0062262 | Ga0466959_0062262_631_1239 | 199 |
| 310 | 3300045049 | Ga0466959_0082661 | Ga0466959_0082661_488_1096 | 199 |
| 311 | 3300045049 | Ga0466959_0361457 | Ga0466959_0361457_47_655 | 199 |
| 312 | 3300046519 | Ga0495632_0075748 | Ga0495632_0075748_575_1183 | 199 |
| 313 | 3300048904 | Ga0496101_0170505 | Ga0496101_0170505_984_1589 | 199 |
| 314 | 3300048904 | Ga0496101_0439039 | Ga0496101_0439039_205_810 | 199 |
| 315 | 3300048905 | Ga0496102_0006012 | Ga0496102_0006012_8727_9332 | 199 |
| 316 | 3300048905 | Ga0496102_0151392 | Ga0496102_0151392_32_640 | 199 |
| 317 | 3300048905 | Ga0496102_0841111 | Ga0496102_0841111_171_776 | 199 |
| 318 | 3300048906 | Ga0496103_0000966 | Ga0496103_0000966_12403_13008 | 199 |
| 319 | 3300048906 | Ga0496103_0068951 | Ga0496103_0068951_1059_1664 | 199 |
| 320 | 3300048908 | Ga0496105_0130695 | Ga0496105_0130695_52_657 | 199 |
| 321 | 3300048914 | Ga0496111_0364728 | Ga0496111_0364728_101_706 | 199 |
| 322 | 3300048915 | Ga0496112_0193871 | Ga0496112_0193871_1175_1783 | 199 |
| 323 | 3300048918 | Ga0496115_0201335 | Ga0496115_0201335_17_625 | 199 |
| 324 | 3300048919 | Ga0496116_0025509 | Ga0496116_0025509_3004_3609 | 199 |
| 325 | 3300048919 | Ga0496116_0045027 | Ga0496116_0045027_623_1228 | 199 |
| 326 | 3300048920 | Ga0496117_0012482 | Ga0496117_0012482_6446_7051 | 199 |
| 327 | 3300048920 | Ga0496117_0024734 | Ga0496117_0024734_2496_3101 | 199 |
| 328 | 3300048920 | Ga0496117_0045592 | Ga0496117_0045592_2088_2693 | 199 |
| 329 | 3300048921 | Ga0496118_0000152 | Ga0496118_0000152_75073_75678 | 199 |
| 330 | 3300048921 | Ga0496118_0005373 | Ga0496118_0005373_912_1517 | 199 |
| 331 | 3300048921 | Ga0496118_0108569 | Ga0496118_0108569_439_1044 | 199 |
| 332 | 3300048922 | Ga0496119_0001236 | Ga0496119_0001236_9912_10523 | 199 |
| 333 | 3300048922 | Ga0496119_0001678 | Ga0496119_0001678_10891_11499 | 199 |
| 334 | 3300048922 | Ga0496119_0018793 | Ga0496119_0018793_1772_2377 | 199 |
| 335 | 3300048922 | Ga0496119_0063469 | Ga0496119_0063469_1228_1833 | 199 |
| 336 | 3300048923 | Ga0496120_0001156 | Ga0496120_0001156_21245_21856 | 199 |
| 337 | 3300048923 | Ga0496120_0003074 | Ga0496120_0003074_13198_13806 | 199 |
| 338 | 3300048924 | Ga0496121_0005197 | Ga0496121_0005197_8384_8989 | 199 |
| 339 | 3300048924 | Ga0496121_0009750 | Ga0496121_0009750_6767_7375 | 199 |
| 340 | 3300048924 | Ga0496121_0025617 | Ga0496121_0025617_1529_2137 | 199 |
| 341 | 3300048924 | Ga0496121_0077399 | Ga0496121_0077399_587_1192 | 199 |
| 342 | 3300048926 | Ga0496123_0011788 | Ga0496123_0011788_65_670 | 199 |
| 343 | 3300048927 | Ga0496124_0026821 | Ga0496124_0026821_3670_4275 | 199 |
| 344 | 3300048927 | Ga0496124_0179643 | Ga0496124_0179643_658_1263 | 199 |
| 345 | 3300048928 | Ga0496125_0003261 | Ga0496125_0003261_9676_10284 | 199 |
| 346 | 3300048928 | Ga0496125_0011179 | Ga0496125_0011179_3337_3945 | 199 |
| 347 | 3300048928 | Ga0496125_0040058 | Ga0496125_0040058_1735_2343 | 199 |
| 348 | 3300048928 | Ga0496125_0149169 | Ga0496125_0149169_830_1438 | 199 |
| 349 | 3300048929 | Ga0496126_0002403 | Ga0496126_0002403_4424_5032 | 199 |
| 350 | 3300048929 | Ga0496126_0011528 | Ga0496126_0011528_6147_6755 | 199 |
| 351 | 3300048929 | Ga0496126_0016497 | Ga0496126_0016497_3503_4108 | 199 |
| 352 | 3300048929 | Ga0496126_0094961 | Ga0496126_0094961_1229_1837 | 199 |
| 353 | 3300049513 | Ga0501290_000573 | Ga0501290_000573_2660_3265 | 199 |
| 354 | 3300049515 | Ga0501292_000002 | Ga0501292_000002_65879_66484 | 199 |
| 355 | 3300049517 | Ga0501294_000431 | Ga0501294_000431_3855_4460 | 199 |
| 356 | 3300049530 | Ga0501314_000805 | Ga0501314_000805_368_973 | 199 |
| 357 | 3300049531 | Ga0501315_004300 | Ga0501315_004300_126_731 | 199 |
| 358 | 3300049533 | Ga0501317_000436 | Ga0501317_000436_1316_1921 | 199 |
| 359 | 3300049534 | Ga0501318_006758 | Ga0501318_006758_564_1169 | 199 |
| 360 | 3300049569 | Ga0501032_0514059 | Ga0501032_0514059_68_673 | 199 |
| 361 | 3300049652 | Ga0501202_039219 | Ga0501202_039219_26_631 | 199 |
| 362 | 3300049653 | Ga0501206_003664 | Ga0501206_003664_907_1512 | 199 |
| 363 | 3300049662 | Ga0501222_000786 | Ga0501222_000786_53_658 | 199 |
| 364 | 3300049663 | Ga0501223_000020 | Ga0501223_000020_11360_11965 | 199 |
| 365 | 3300049663 | Ga0501223_000786 | Ga0501223_000786_1804_2409 | 199 |
| 366 | 3300049664 | Ga0501224_000004 | Ga0501224_000004_76992_77597 | 199 |
| 367 | 3300049664 | Ga0501224_000351 | Ga0501224_000351_3689_4294 | 199 |
| 368 | 3300049665 | Ga0501227_003597 | Ga0501227_003597_796_1401 | 199 |
| 369 | 3300049668 | Ga0501233_003611 | Ga0501233_003611_2156_2761 | 199 |
| 370 | 3300049669 | Ga0501235_000265 | Ga0501235_000265_3997_4602 | 199 |
| 371 | 3300049669 | Ga0501235_015647 | Ga0501235_015647_915_1520 | 199 |
| 372 | 3300049676 | Ga0501246_002169 | Ga0501246_002169_366_1016 | 199 |
| 373 | 3300049686 | Ga0501257_001517 | Ga0501257_001517_1776_2381 | 199 |
| 374 | 3300049688 | Ga0501259_000144 | Ga0501259_000144_4416_5021 | 199 |
| 375 | 3300049690 | Ga0501261_000009 | Ga0501261_000009_525_1130 | 199 |
| 376 | 3300049705 | Ga0501225_0000060 | Ga0501225_0000060_12802_13407 | 199 |
| 377 | 3300049705 | Ga0501225_0000310 | Ga0501225_0000310_11765_12415 | 199 |
| 378 | 3300049705 | Ga0501225_0113840 | Ga0501225_0113840_39_644 | 199 |
| 379 | 3300049706 | Ga0501229_005356 | Ga0501229_005356_80_685 | 199 |
| 380 | 3300049707 | Ga0501234_001027 | Ga0501234_001027_2037_2642 | 199 |
| 381 | 3300049708 | Ga0501245_001663 | Ga0501245_001663_1389_1994 | 199 |
| 382 | 3300049775 | Ga0501279_000003 | Ga0501279_000003_121813_122418 | 199 |
| 383 | 3300049776 | Ga0501280_000090 | Ga0501280_000090_22488_23093 | 199 |
| 384 | 3300049777 | Ga0501281_00091 | Ga0501281_00091_5670_6275 | 199 |
| 385 | 3300049853 | Ga0501226_000018 | Ga0501226_000018_91473_92078 | 199 |
| 386 | 3300053148 | Ga0500590_060888 | Ga0500590_060888_215_823 | 199 |
| 387 | 3300053153 | Ga0500616_0107569 | Ga0500616_0107569_166_774 | 199 |
| 388 | 3300053178 | Ga0500637_0240765 | Ga0500637_0240765_224_832 | 199 |
| 389 | 3300059504 | Ga0587082_002042 | Ga0587082_002042_1106_1711 | 199 |
| 390 | 3300059510 | Ga0587090_018926 | Ga0587090_018926_364_984 | 199 |
| 391 | 2162886007 | SwRhRL2b_contig_3335162 | SwRhRL2b_0204.00007670 | 200 |
| 392 | 3300001979 | JGI24740J21852_10000064 | JGI24740J21852_100000644 | 200 |
| 393 | 3300001979 | JGI24740J21852_10004332 | JGI24740J21852_100043325 | 200 |
| 394 | 3300001989 | JGI24739J22299_10000233 | JGI24739J22299_100002334 | 200 |
| 395 | 3300002067 | JGI24735J21928_10143218 | JGI24735J21928_101432181 | 200 |
| 396 | 3300002738 | JGI25154J39366_1000416 | JGI25154J39366_100041621 | 200 |
| 397 | 3300002741 | JGI25157J39369_1000112 | JGI25157J39369_100011241 | 200 |
| 398 | 3300003187 | JGI25151J46595_10002504 | JGI25151J46595_100025045 | 200 |
| 399 | 3300003320 | rootH2_10026970 | rootH2_100269703 | 200 |
| 400 | 3300003323 | rootH1_10099923 | rootH1_100999234 | 200 |
| 401 | 3300003323 | rootH1_10163039 | rootH1_101630391 | 200 |
| 402 | 3300003374 | JGI25161J50226_1005403 | JGI25161J50226_10054032 | 200 |
| 403 | 3300003578 | Ga0006562J51391_1111416 | Ga0006562J51391_11114162 | 200 |
| 404 | 3300003752 | Ga0055539_1000633 | Ga0055539_10006335 | 200 |
| 405 | 3300003761 | Ga0055535_1000047 | Ga0055535_1000047101 | 200 |
| 406 | 3300003761 | Ga0055535_1000226 | Ga0055535_100022614 | 200 |
| 407 | 3300003762 | Ga0055542_1000029 | Ga0055542_100002915 | 200 |
| 408 | 3300003763 | Ga0055529_1000148 | Ga0055529_1000148112 | 200 |
| 409 | 3300003763 | Ga0055529_1000193 | Ga0055529_100019356 | 200 |
| 410 | 3300003771 | Ga0055526_1000155 | Ga0055526_10001554 | 200 |
| 411 | 3300003773 | Ga0055537_1000006 | Ga0055537_100000675 | 200 |
| 412 | 3300003773 | Ga0055537_1004166 | Ga0055537_10041664 | 200 |
| 413 | 3300003775 | Ga0055524_1000032 | Ga0055524_100003269 | 200 |
| 414 | 3300003775 | Ga0055524_1022006 | Ga0055524_10220063 | 200 |
| 415 | 3300003784 | Ga0055534_1000048 | Ga0055534_100004833 | 200 |
| 416 | 3300003784 | Ga0055534_1004512 | Ga0055534_10045124 | 200 |
| 417 | 3300003790 | Ga0055528_1002482 | Ga0055528_10024829 | 200 |
| 418 | 3300003790 | Ga0055528_1009873 | Ga0055528_10098734 | 200 |
| 419 | 3300003792 | Ga0055540_1000017 | Ga0055540_1000017159 | 200 |
| 420 | 3300003792 | Ga0055540_1004431 | Ga0055540_10044314 | 200 |
| 421 | 3300003794 | Ga0055531_10014250 | Ga0055531_100142502 | 200 |
| 422 | 3300005289 | Ga0065704_10070262 | Ga0065704_1007026220 | 200 |
| 423 | 3300005289 | Ga0065704_10079067 | Ga0065704_100790672 | 200 |
| 424 | 3300005327 | Ga0070658_10000077 | Ga0070658_1000007759 | 200 |
| 425 | 3300005334 | Ga0068869_100132954 | Ga0068869_1001329543 | 200 |
| 426 | 3300005334 | Ga0068869_100622083 | Ga0068869_1006220831 | 200 |
| 427 | 3300005338 | Ga0068868_100039651 | Ga0068868_1000396514 | 200 |
| 428 | 3300005339 | Ga0070660_100037108 | Ga0070660_1000371083 | 200 |
| 429 | 3300005339 | Ga0070660_100106669 | Ga0070660_1001066693 | 200 |
| 430 | 3300005344 | Ga0070661_100003307 | Ga0070661_1000033076 | 200 |
| 431 | 3300005344 | Ga0070661_100015010 | Ga0070661_1000150103 | 200 |
| 432 | 3300005347 | Ga0070668_100690797 | Ga0070668_1006907972 | 200 |
| 433 | 3300005356 | Ga0070674_100000060 | Ga0070674_10000006017 | 200 |
| 434 | 3300005356 | Ga0070674_100639338 | Ga0070674_1006393381 | 200 |
| 435 | 3300005366 | Ga0070659_100008609 | Ga0070659_1000086097 | 200 |
| 436 | 3300005367 | Ga0070667_100043541 | Ga0070667_1000435411 | 200 |
| 437 | 3300005367 | Ga0070667_100606549 | Ga0070667_1006065491 | 200 |
| 438 | 3300005455 | Ga0070663_100075341 | Ga0070663_1000753411 | 200 |
| 439 | 3300005455 | Ga0070663_100194237 | Ga0070663_1001942372 | 200 |
| 440 | 3300005456 | Ga0070678_100000003 | Ga0070678_10000000336 | 200 |
| 441 | 3300005457 | Ga0070662_100001084 | Ga0070662_10000108410 | 200 |
| 442 | 3300005459 | Ga0068867_100003492 | Ga0068867_1000034924 | 200 |
| 443 | 3300005459 | Ga0068867_100101879 | Ga0068867_1001018792 | 200 |
| 444 | 3300005535 | Ga0070684_100102139 | Ga0070684_1001021393 | 200 |
| 445 | 3300005539 | Ga0068853_100000190 | Ga0068853_10000019034 | 200 |
| 446 | 3300005539 | Ga0068853_100001662 | Ga0068853_1000016624 | 200 |
| 447 | 3300005548 | Ga0070665_100028521 | Ga0070665_1000285214 | 200 |
| 448 | 3300005548 | Ga0070665_101190170 | Ga0070665_1011901701 | 200 |
| 449 | 3300005563 | Ga0068855_100000165 | Ga0068855_10000016526 | 200 |
| 450 | 3300005563 | Ga0068855_100001098 | Ga0068855_10000109811 | 200 |
| 451 | 3300005563 | Ga0068855_100019234 | Ga0068855_1000192342 | 200 |
| 452 | 3300005563 | Ga0068855_100217025 | Ga0068855_1002170251 | 200 |
| 453 | 3300005563 | Ga0068855_100326043 | Ga0068855_1003260432 | 200 |
| 454 | 3300005577 | Ga0068857_100003317 | Ga0068857_10000331712 | 200 |
| 455 | 3300005577 | Ga0068857_100022481 | Ga0068857_1000224814 | 200 |
| 456 | 3300005578 | Ga0068854_100000825 | Ga0068854_10000082510 | 200 |
| 457 | 3300005578 | Ga0068854_100001946 | Ga0068854_1000019463 | 200 |
| 458 | 3300005578 | Ga0068854_100017205 | Ga0068854_1000172055 | 200 |
| 459 | 3300005578 | Ga0068854_100230355 | Ga0068854_1002303552 | 200 |
| 460 | 3300005614 | Ga0068856_100059133 | Ga0068856_1000591333 | 200 |
| 461 | 3300005614 | Ga0068856_100203917 | Ga0068856_1002039172 | 200 |
| 462 | 3300005616 | Ga0068852_100025666 | Ga0068852_1000256664 | 200 |
| 463 | 3300005616 | Ga0068852_100035998 | Ga0068852_1000359982 | 200 |
| 464 | 3300005616 | Ga0068852_100099713 | Ga0068852_1000997133 | 200 |
| 465 | 3300005718 | Ga0068866_10042310 | Ga0068866_100423103 | 200 |
| 466 | 3300005834 | Ga0068851_10032270 | Ga0068851_100322701 | 200 |
| 467 | 3300005834 | Ga0068851_10103937 | Ga0068851_101039372 | 200 |
| 468 | 3300005841 | Ga0068863_100069346 | Ga0068863_1000693463 | 200 |
| 469 | 3300005841 | Ga0068863_100092404 | Ga0068863_1000924042 | 200 |
| 470 | 3300005842 | Ga0068858_100000499 | Ga0068858_10000049924 | 200 |
| 471 | 3300005843 | Ga0068860_100355748 | Ga0068860_1003557482 | 200 |
| 472 | 3300005844 | Ga0068862_100044842 | Ga0068862_1000448424 | 200 |
| 473 | 3300005844 | Ga0068862_100644826 | Ga0068862_1006448262 | 200 |
| 474 | 3300006178 | Ga0075367_10011661 | Ga0075367_100116613 | 200 |
| 475 | 3300006178 | Ga0075367_10270254 | Ga0075367_102702542 | 200 |
| 476 | 3300006195 | Ga0075366_10013720 | Ga0075366_100137205 | 200 |
| 477 | 3300006195 | Ga0075366_10029661 | Ga0075366_100296614 | 200 |
| 478 | 3300006195 | Ga0075366_10051545 | Ga0075366_100515453 | 200 |
| 479 | 3300006195 | Ga0075366_10072974 | Ga0075366_100729743 | 200 |
| 480 | 3300006237 | Ga0097621_100082758 | Ga0097621_1000827583 | 200 |
| 481 | 3300006237 | Ga0097621_100920695 | Ga0097621_1009206952 | 200 |
| 482 | 3300006353 | Ga0075370_10001309 | Ga0075370_100013093 | 200 |
| 483 | 3300006353 | Ga0075370_10018754 | Ga0075370_100187543 | 200 |
| 484 | 3300006353 | Ga0075370_10036810 | Ga0075370_100368103 | 200 |
| 485 | 3300006353 | Ga0075370_10038221 | Ga0075370_100382213 | 200 |
| 486 | 3300006358 | Ga0068871_100163544 | Ga0068871_1001635442 | 200 |
| 487 | 3300006881 | Ga0068865_100031360 | Ga0068865_1000313603 | 200 |
| 488 | 3300006881 | Ga0068865_100433383 | Ga0068865_1004333832 | 200 |
| 489 | 3300006946 | Ga0079104_1000041 | Ga0079104_10000417 | 200 |
| 490 | 3300006948 | Ga0099826_10053259 | Ga0099826_100532594 | 200 |
| 491 | 3300009036 | Ga0105244_10000415 | Ga0105244_1000041529 | 200 |
| 492 | 3300009093 | Ga0105240_10005543 | Ga0105240_1000554310 | 200 |
| 493 | 3300009093 | Ga0105240_10009588 | Ga0105240_100095888 | 200 |
| 494 | 3300009093 | Ga0105240_10011024 | Ga0105240_100110248 | 200 |
| 495 | 3300009093 | Ga0105240_10024317 | Ga0105240_100243178 | 200 |
| 496 | 3300009093 | Ga0105240_10244520 | Ga0105240_102445203 | 200 |
| 497 | 3300009098 | Ga0105245_10001114 | Ga0105245_100011149 | 200 |
| 498 | 3300009098 | Ga0105245_10135154 | Ga0105245_101351543 | 200 |
| 499 | 3300009147 | Ga0114129_10367429 | Ga0114129_103674293 | 200 |
| 500 | 3300009148 | Ga0105243_10000108 | Ga0105243_1000010834 | 200 |
| 501 | 3300009148 | Ga0105243_10005675 | Ga0105243_100056757 | 200 |
| 502 | 3300009148 | Ga0105243_10028515 | Ga0105243_100285154 | 200 |
| 503 | 3300009148 | Ga0105243_10075072 | Ga0105243_100750722 | 200 |
| 504 | 3300009148 | Ga0105243_10121620 | Ga0105243_101216202 | 200 |
| 505 | 3300009176 | Ga0105242_10012190 | Ga0105242_100121905 | 200 |
| 506 | 3300009176 | Ga0105242_10026800 | Ga0105242_100268002 | 200 |
| 507 | 3300009176 | Ga0105242_10049693 | Ga0105242_100496934 | 200 |
| 508 | 3300009176 | Ga0105242_10922725 | Ga0105242_109227252 | 200 |
| 509 | 3300009545 | Ga0105237_10003349 | Ga0105237_1000334916 | 200 |
| 510 | 3300009545 | Ga0105237_10003698 | Ga0105237_1000369815 | 200 |
| 511 | 3300009545 | Ga0105237_10006276 | Ga0105237_100062767 | 200 |
| 512 | 3300009545 | Ga0105237_10013720 | Ga0105237_100137206 | 200 |
| 513 | 3300009545 | Ga0105237_10038601 | Ga0105237_100386013 | 200 |
| 514 | 3300009551 | Ga0105238_10001684 | Ga0105238_1000168416 | 200 |
| 515 | 3300009551 | Ga0105238_10001771 | Ga0105238_1000177112 | 200 |
| 516 | 3300009551 | Ga0105238_10074294 | Ga0105238_100742944 | 200 |
| 517 | 3300009551 | Ga0105238_10169595 | Ga0105238_101695952 | 200 |
| 518 | 3300010375 | Ga0105239_10000196 | Ga0105239_1000019664 | 200 |
| 519 | 3300010375 | Ga0105239_10000889 | Ga0105239_1000088915 | 200 |
| 520 | 3300010375 | Ga0105239_10007229 | Ga0105239_100072292 | 200 |
| 521 | 3300010375 | Ga0105239_10011115 | Ga0105239_100111155 | 200 |
| 522 | 3300011119 | Ga0105246_10001891 | Ga0105246_100018913 | 200 |
| 523 | 3300011119 | Ga0105246_10300421 | Ga0105246_103004212 | 200 |
| 524 | 3300013100 | Ga0157373_10000372 | Ga0157373_1000037233 | 200 |
| 525 | 3300013100 | Ga0157373_10001218 | Ga0157373_100012185 | 200 |
| 526 | 3300013100 | Ga0157373_10004249 | Ga0157373_100042496 | 200 |
| 527 | 3300013104 | Ga0157370_10001791 | Ga0157370_1000179115 | 200 |
| 528 | 3300013104 | Ga0157370_10007379 | Ga0157370_1000737911 | 200 |
| 529 | 3300013104 | Ga0157370_10009890 | Ga0157370_100098905 | 200 |
| 530 | 3300013104 | Ga0157370_10180732 | Ga0157370_101807323 | 200 |
| 531 | 3300013105 | Ga0157369_10000249 | Ga0157369_1000024932 | 200 |
| 532 | 3300013105 | Ga0157369_10006228 | Ga0157369_100062286 | 200 |
| 533 | 3300013105 | Ga0157369_10044116 | Ga0157369_100441165 | 200 |
| 534 | 3300013105 | Ga0157369_10186290 | Ga0157369_101862903 | 200 |
| 535 | 3300013297 | Ga0157378_10066370 | Ga0157378_100663702 | 200 |
| 536 | 3300013307 | Ga0157372_10115251 | Ga0157372_101152513 | 200 |
| 537 | 3300013308 | Ga0157375_10905941 | Ga0157375_109059411 | 200 |
| 538 | 3300014497 | Ga0182008_10000038 | Ga0182008_1000003833 | 200 |
| 539 | 3300014497 | Ga0182008_10002221 | Ga0182008_100022216 | 200 |
| 540 | 3300014745 | Ga0157377_10161762 | Ga0157377_101617622 | 200 |
| 541 | 3300015261 | Ga0182006_1006063 | Ga0182006_10060636 | 200 |
| 542 | 3300015261 | Ga0182006_1028073 | Ga0182006_10280733 | 200 |
| 543 | 3300015262 | Ga0182007_10027916 | Ga0182007_100279162 | 200 |
| 544 | 3300025228 | Ga0209672_101158 | Ga0209672_1011589 | 200 |
| 545 | 3300025229 | Ga0209147_100338 | Ga0209147_10033820 | 200 |
| 546 | 3300025242 | Ga0209258_100018 | Ga0209258_100018189 | 200 |
| 547 | 3300025242 | Ga0209258_100072 | Ga0209258_100072170 | 200 |
| 548 | 3300025246 | Ga0209646_1000127 | Ga0209646_100012755 | 200 |
| 549 | 3300025250 | Ga0209026_1000004 | Ga0209026_1000004797 | 200 |
| 550 | 3300025253 | Ga0209677_100085 | Ga0209677_10008526 | 200 |
| 551 | 3300025254 | Ga0209148_1000030 | Ga0209148_1000030189 | 200 |
| 552 | 3300025254 | Ga0209148_1002344 | Ga0209148_10023442 | 200 |
| 553 | 3300025256 | Ga0209759_1000129 | Ga0209759_100012979 | 200 |
| 554 | 3300025258 | Ga0209129_1000187 | Ga0209129_10001876 | 200 |
| 555 | 3300025258 | Ga0209129_1004805 | Ga0209129_10048054 | 200 |
| 556 | 3300025263 | Ga0209565_1000016 | Ga0209565_1000016210 | 200 |
| 557 | 3300025263 | Ga0209565_1001570 | Ga0209565_10015705 | 200 |
| 558 | 3300025272 | Ga0209455_1000053 | Ga0209455_1000053250 | 200 |
| 559 | 3300025273 | Ga0209673_1000073 | Ga0209673_100007369 | 200 |
| 560 | 3300025273 | Ga0209673_1006176 | Ga0209673_10061764 | 200 |
| 561 | 3300025284 | Ga0209130_1001957 | Ga0209130_10019576 | 200 |
| 562 | 3300025291 | Ga0209675_1000080 | Ga0209675_1000080120 | 200 |
| 563 | 3300025291 | Ga0209675_1014231 | Ga0209675_10142312 | 200 |
| 564 | 3300025292 | Ga0209676_1001486 | Ga0209676_100148615 | 200 |
| 565 | 3300025292 | Ga0209676_1020343 | Ga0209676_10203433 | 200 |
| 566 | 3300025292 | Ga0209676_1020766 | Ga0209676_10207661 | 200 |
| 567 | 3300025294 | Ga0209025_1000334 | Ga0209025_100033466 | 200 |
| 568 | 3300025294 | Ga0209025_1001126 | Ga0209025_10011267 | 200 |
| 569 | 3300025294 | Ga0209025_1019337 | Ga0209025_10193373 | 200 |
| 570 | 3300025295 | Ga0209564_1000040 | Ga0209564_100004084 | 200 |
| 571 | 3300025295 | Ga0209564_1000165 | Ga0209564_100016598 | 200 |
| 572 | 3300025295 | Ga0209564_1000322 | Ga0209564_100032259 | 200 |
| 573 | 3300025295 | Ga0209564_1000621 | Ga0209564_100062132 | 200 |
| 574 | 3300025298 | Ga0209050_1000037 | Ga0209050_100003743 | 200 |
| 575 | 3300025298 | Ga0209050_1047351 | Ga0209050_10473512 | 200 |
| 576 | 3300025299 | Ga0209256_1000023 | Ga0209256_1000023354 | 200 |
| 577 | 3300025299 | Ga0209256_1000110 | Ga0209256_100011069 | 200 |
| 578 | 3300025299 | Ga0209256_1005577 | Ga0209256_10055772 | 200 |
| 579 | 3300025302 | Ga0207426_1000029 | Ga0207426_1000029412 | 200 |
| 580 | 3300025302 | Ga0207426_1000068 | Ga0207426_1000068194 | 200 |
| 581 | 3300025303 | Ga0209051_1000040 | Ga0209051_100004044 | 200 |
| 582 | 3300025303 | Ga0209051_1008387 | Ga0209051_10083873 | 200 |
| 583 | 3300025304 | Ga0209257_1000566 | Ga0209257_100056643 | 200 |
| 584 | 3300025304 | Ga0209257_1010347 | Ga0209257_10103475 | 200 |
| 585 | 3300025304 | Ga0209257_1011936 | Ga0209257_10119364 | 200 |
| 586 | 3300025321 | Ga0207656_10036310 | Ga0207656_100363103 | 200 |
| 587 | 3300025728 | Ga0207655_1002845 | Ga0207655_10028453 | 200 |
| 588 | 3300025908 | Ga0207643_10045871 | Ga0207643_100458713 | 200 |
| 589 | 3300025909 | Ga0207705_10000182 | Ga0207705_1000018229 | 200 |
| 590 | 3300025913 | Ga0207695_10000383 | Ga0207695_1000038320 | 200 |
| 591 | 3300025913 | Ga0207695_10002264 | Ga0207695_1000226419 | 200 |
| 592 | 3300025913 | Ga0207695_10016391 | Ga0207695_100163912 | 200 |
| 593 | 3300025913 | Ga0207695_10100048 | Ga0207695_101000483 | 200 |
| 594 | 3300025914 | Ga0207671_10008765 | Ga0207671_100087656 | 200 |
| 595 | 3300025914 | Ga0207671_10015423 | Ga0207671_100154234 | 200 |
| 596 | 3300025914 | Ga0207671_10017160 | Ga0207671_100171603 | 200 |
| 597 | 3300025914 | Ga0207671_10035953 | Ga0207671_100359532 | 200 |
| 598 | 3300025919 | Ga0207657_10127400 | Ga0207657_101274002 | 200 |
| 599 | 3300025919 | Ga0207657_10159380 | Ga0207657_101593802 | 200 |
| 600 | 3300025920 | Ga0207649_10020941 | Ga0207649_100209414 | 200 |
| 601 | 3300025920 | Ga0207649_10042283 | Ga0207649_100422833 | 200 |
| 602 | 3300025924 | Ga0207694_10000111 | Ga0207694_1000011152 | 200 |
| 603 | 3300025924 | Ga0207694_10004423 | Ga0207694_100044232 | 200 |
| 604 | 3300025924 | Ga0207694_10230511 | Ga0207694_102305112 | 200 |
| 605 | 3300025927 | Ga0207687_10001973 | Ga0207687_100019737 | 200 |
| 606 | 3300025927 | Ga0207687_10074418 | Ga0207687_100744182 | 200 |
| 607 | 3300025933 | Ga0207706_10001006 | Ga0207706_1000100612 | 200 |
| 608 | 3300025933 | Ga0207706_10138538 | Ga0207706_101385383 | 200 |
| 609 | 3300025934 | Ga0207686_10026138 | Ga0207686_100261384 | 200 |
| 610 | 3300025935 | Ga0207709_10000148 | Ga0207709_1000014857 | 200 |
| 611 | 3300025935 | Ga0207709_10031723 | Ga0207709_100317233 | 200 |
| 612 | 3300025935 | Ga0207709_10129194 | Ga0207709_101291943 | 200 |
| 613 | 3300025937 | Ga0207669_10000015 | Ga0207669_1000001583 | 200 |
| 614 | 3300025938 | Ga0207704_10020193 | Ga0207704_100201933 | 200 |
| 615 | 3300025949 | Ga0207667_10000102 | Ga0207667_1000010229 | 200 |
| 616 | 3300025949 | Ga0207667_10000220 | Ga0207667_1000022046 | 200 |
| 617 | 3300025949 | Ga0207667_10019128 | Ga0207667_100191282 | 200 |
| 618 | 3300025981 | Ga0207640_10008788 | Ga0207640_100087883 | 200 |
| 619 | 3300025981 | Ga0207640_10047382 | Ga0207640_100473824 | 200 |
| 620 | 3300025981 | Ga0207640_10056396 | Ga0207640_100563963 | 200 |
| 621 | 3300025986 | Ga0207658_10017918 | Ga0207658_100179185 | 200 |
| 622 | 3300025986 | Ga0207658_10429756 | Ga0207658_104297562 | 200 |
| 623 | 3300026023 | Ga0207677_10026051 | Ga0207677_100260514 | 200 |
| 624 | 3300026023 | Ga0207677_11056513 | Ga0207677_110565132 | 200 |
| 625 | 3300026035 | Ga0207703_10000439 | Ga0207703_100004396 | 200 |
| 626 | 3300026041 | Ga0207639_10000359 | Ga0207639_1000035920 | 200 |
| 627 | 3300026041 | Ga0207639_10000764 | Ga0207639_100007643 | 200 |
| 628 | 3300026041 | Ga0207639_10003787 | Ga0207639_100037875 | 200 |
| 629 | 3300026067 | Ga0207678_10003441 | Ga0207678_100034415 | 200 |
| 630 | 3300026067 | Ga0207678_10019573 | Ga0207678_100195732 | 200 |
| 631 | 3300026078 | Ga0207702_10063314 | Ga0207702_100633143 | 200 |
| 632 | 3300026078 | Ga0207702_10073157 | Ga0207702_100731573 | 200 |
| 633 | 3300026078 | Ga0207702_10734758 | Ga0207702_107347581 | 200 |
| 634 | 3300026078 | Ga0207702_10907373 | Ga0207702_109073731 | 200 |
| 635 | 3300026088 | Ga0207641_10060086 | Ga0207641_100600863 | 200 |
| 636 | 3300026089 | Ga0207648_10006895 | Ga0207648_100068959 | 200 |
| 637 | 3300026089 | Ga0207648_10021743 | Ga0207648_100217432 | 200 |
| 638 | 3300026116 | Ga0207674_10000167 | Ga0207674_1000016725 | 200 |
| 639 | 3300026116 | Ga0207674_10002320 | Ga0207674_1000232013 | 200 |
| 640 | 3300026116 | Ga0207674_10006048 | Ga0207674_1000604810 | 200 |
| 641 | 3300026118 | Ga0207675_100142534 | Ga0207675_1001425343 | 200 |
| 642 | 3300026121 | Ga0207683_10000046 | Ga0207683_1000004647 | 200 |
| 643 | 3300026142 | Ga0207698_10006657 | Ga0207698_100066574 | 200 |
| 644 | 3300026142 | Ga0207698_10027208 | Ga0207698_100272083 | 200 |
| 645 | 3300026142 | Ga0207698_10062466 | Ga0207698_100624662 | 200 |
| 646 | 3300027111 | Ga0209281_1000073 | Ga0209281_10000738 | 200 |
| 647 | 3300028379 | Ga0268266_10009507 | Ga0268266_100095078 | 200 |
| 648 | 3300028380 | Ga0268265_10502098 | Ga0268265_105020981 | 200 |
| 649 | 3300028380 | Ga0268265_11321637 | Ga0268265_113216371 | 200 |
| 650 | 3300031548 | Ga0307408_100000852 | Ga0307408_10000085219 | 200 |
| 651 | 3300031548 | Ga0307408_100059403 | Ga0307408_1000594032 | 200 |
| 652 | 3300031548 | Ga0307408_100099438 | Ga0307408_1000994382 | 200 |
| 653 | 3300031730 | Ga0307516_10003223 | Ga0307516_1000322314 | 200 |
| 654 | 3300031731 | Ga0307405_10044034 | Ga0307405_100440344 | 200 |
| 655 | 3300031731 | Ga0307405_10270226 | Ga0307405_102702262 | 200 |
| 656 | 3300031731 | Ga0307405_10474787 | Ga0307405_104747872 | 200 |
| 657 | 3300031911 | Ga0307412_10017311 | Ga0307412_100173113 | 200 |
| 658 | 3300031911 | Ga0307412_10019933 | Ga0307412_100199332 | 200 |
| 659 | 3300031911 | Ga0307412_10038964 | Ga0307412_100389644 | 200 |
| 660 | 3300032004 | Ga0307414_10015372 | Ga0307414_100153725 | 200 |
| 661 | 3300032004 | Ga0307414_10201425 | Ga0307414_102014252 | 200 |
| 662 | 3300032005 | Ga0307411_10499793 | Ga0307411_104997932 | 200 |
| 663 | 3300035691 | Ga0373931_0025728 | Ga0373931_0025728_469_1074 | 200 |
| 664 | 3300037466 | Ga0395898_0236465 | Ga0395898_0236465_411_1016 | 200 |
| 665 | 3300037471 | Ga0395905_0002432 | Ga0395905_0002432_2487_3092 | 200 |
| 666 | 3300037471 | Ga0395905_0058757 | Ga0395905_0058757_1953_2564 | 200 |
| 667 | 3300037471 | Ga0395905_0060373 | Ga0395905_0060373_1504_2109 | 200 |
| 668 | 3300037471 | Ga0395905_0575613 | Ga0395905_0575613_356_967 | 200 |
| 669 | 3300038443 | Ga0395901_0042013 | Ga0395901_0042013_1152_1763 | 200 |
| 670 | 3300039447 | Ga0436361_0657781 | Ga0436361_0657781_388_990 | 200 |
| 671 | 3300041405 | Ga0439438_002748 | Ga0439438_002748_6613_7215 | 200 |
| 672 | 3300041405 | Ga0439438_007343 | Ga0439438_007343_1119_1721 | 200 |
| 673 | 3300041405 | Ga0439438_008788 | Ga0439438_008788_886_1488 | 200 |
| 674 | 3300041407 | Ga0439447_039371 | Ga0439447_039371_355_957 | 200 |
| 675 | 3300041411 | Ga0439466_0015205 | Ga0439466_0015205_596_1198 | 200 |
| 676 | 3300041451 | Ga0451791_0216335 | Ga0451791_0216335_133_738 | 200 |
| 677 | 3300041452 | Ga0451793_0721922 | Ga0451793_0721922_264_869 | 200 |
| 678 | 3300041456 | Ga0451795_1284843 | Ga0451795_1284843_437_1042 | 200 |
| 679 | 3300041460 | Ga0451802_0724550 | Ga0451802_0724550_114_719 | 200 |
| 680 | 3300041486 | Ga0451807_0443440 | Ga0451807_0443440_246_851 | 200 |
| 681 | 3300041494 | Ga0451837_1123269 | Ga0451837_1123269_51_656 | 200 |
| 682 | 3300041498 | Ga0451841_1270401 | Ga0451841_1270401_269_874 | 200 |
| 683 | 3300041512 | Ga0451853_1610789 | Ga0451853_1610789_1102_1707 | 200 |
| 684 | 3300041997 | Ga0439431_0004866 | Ga0439431_0004866_1569_2171 | 200 |
| 685 | 3300041997 | Ga0439431_0047542 | Ga0439431_0047542_78_683 | 200 |
| 686 | 3300042006 | Ga0439432_018237 | Ga0439432_018237_845_1447 | 200 |
| 687 | 3300042010 | Ga0439452_006058 | Ga0439452_006058_271_873 | 200 |
| 688 | 3300042122 | Ga0450920_008871 | Ga0450920_008871_1027_1632 | 200 |
| 689 | 3300042126 | Ga0450888_006728 | Ga0450888_006728_251_856 | 200 |
| 690 | 3300042157 | Ga0439458_0080775 | Ga0439458_0080775_22_630 | 200 |
| 691 | 3300042184 | Ga0450908_001064 | Ga0450908_001064_4455_5060 | 200 |
| 692 | 3300042435 | Ga0439434_0050623 | Ga0439434_0050623_218_823 | 200 |
| 693 | 3300042532 | Ga0450893_0022976 | Ga0450893_0022976_284_889 | 200 |
| 694 | 3300044656 | Ga0466969_0004380 | Ga0466969_0004380_4640_5245 | 200 |
| 695 | 3300044658 | Ga0466972_0000442 | Ga0466972_0000442_19798_20412 | 200 |
| 696 | 3300044658 | Ga0466972_0149433 | Ga0466972_0149433_406_1008 | 200 |
| 697 | 3300044683 | Ga0466965_0043710 | Ga0466965_0043710_887_1492 | 200 |
| 698 | 3300044683 | Ga0466965_0108085 | Ga0466965_0108085_750_1352 | 200 |
| 699 | 3300044683 | Ga0466965_0541543 | Ga0466965_0541543_31_636 | 200 |
| 700 | 3300044684 | Ga0466966_0003863 | Ga0466966_0003863_4557_5171 | 200 |
| 701 | 3300044684 | Ga0466966_0017937 | Ga0466966_0017937_1649_2254 | 200 |
| 702 | 3300044693 | Ga0466961_0001590 | Ga0466961_0001590_4678_5292 | 200 |
| 703 | 3300044693 | Ga0466961_0084249 | Ga0466961_0084249_193_798 | 200 |
| 704 | 3300044693 | Ga0466961_0130733 | Ga0466961_0130733_475_1080 | 200 |
| 705 | 3300044706 | Ga0466964_0001270 | Ga0466964_0001270_7538_8143 | 200 |
| 706 | 3300044706 | Ga0466964_0047528 | Ga0466964_0047528_440_1042 | 200 |
| 707 | 3300044706 | Ga0466964_0138253 | Ga0466964_0138253_364_969 | 200 |
| 708 | 3300044719 | Ga0466971_0009149 | Ga0466971_0009149_1325_1930 | 200 |
| 709 | 3300044735 | Ga0466968_0008834 | Ga0466968_0008834_279_881 | 200 |
| 710 | 3300044735 | Ga0466968_0033469 | Ga0466968_0033469_106_720 | 200 |
| 711 | 3300044735 | Ga0466968_0227790 | Ga0466968_0227790_42_647 | 200 |
| 712 | 3300044765 | Ga0466970_0006176 | Ga0466970_0006176_4159_4764 | 200 |
| 713 | 3300044765 | Ga0466970_0133972 | Ga0466970_0133972_609_1211 | 200 |
| 714 | 3300044842 | Ga0466957_0033934 | Ga0466957_0033934_2035_2637 | 200 |
| 715 | 3300044901 | Ga0466960_0277395 | Ga0466960_0277395_294_896 | 200 |
| 716 | 3300045049 | Ga0466959_0010816 | Ga0466959_0010816_2356_2961 | 200 |
| 717 | 3300045049 | Ga0466959_0137959 | Ga0466959_0137959_489_1094 | 200 |
| 718 | 3300045049 | Ga0466959_0255324 | Ga0466959_0255324_525_1127 | 200 |
| 719 | 3300045049 | Ga0466959_0301098 | Ga0466959_0301098_178_792 | 200 |
| 720 | 3300045049 | Ga0466959_0636399 | Ga0466959_0636399_50_652 | 200 |
| 721 | 3300045976 | Ga0466967_0013873 | Ga0466967_0013873_3941_4546 | 200 |
| 722 | 3300046460 | Ga0495638_0000102 | Ga0495638_0000102_66684_67289 | 200 |
| 723 | 3300046475 | Ga0495639_0019750 | Ga0495639_0019750_1938_2543 | 200 |
| 724 | 3300046524 | Ga0495648_0000001 | Ga0495648_0000001_420112_420717 | 200 |
| 725 | 3300046528 | Ga0495642_0000399 | Ga0495642_0000399_16448_17053 | 200 |
| 726 | 3300046538 | Ga0495609_0001495 | Ga0495609_0001495_6077_6682 | 200 |
| 727 | 3300046557 | Ga0495622_0000072 | Ga0495622_0000072_6146_6751 | 200 |
| 728 | 3300048919 | Ga0496116_0004783 | Ga0496116_0004783_1389_1994 | 200 |
| 729 | 3300048921 | Ga0496118_0067454 | Ga0496118_0067454_371_976 | 200 |
| 730 | 3300048924 | Ga0496121_0034746 | Ga0496121_0034746_3808_4413 | 200 |
| 731 | 3300048925 | Ga0496122_0048540 | Ga0496122_0048540_1146_1748 | 200 |
| 732 | 3300048925 | Ga0496122_0063347 | Ga0496122_0063347_603_1208 | 200 |
| 733 | 3300048926 | Ga0496123_0012006 | Ga0496123_0012006_1526_2131 | 200 |
| 734 | 3300048927 | Ga0496124_0001113 | Ga0496124_0001113_10109_10714 | 200 |
| 735 | 3300048927 | Ga0496124_0187621 | Ga0496124_0187621_299_901 | 200 |
| 736 | 3300048928 | Ga0496125_0004247 | Ga0496125_0004247_5407_6024 | 200 |
| 737 | 3300048928 | Ga0496125_0004671 | Ga0496125_0004671_11492_12097 | 200 |
| 738 | 3300049160 | Ga0501304_021897 | Ga0501304_021897_20_625 | 200 |
| 739 | 3300049459 | Ga0495678_000432 | Ga0495678_000432_32919_33524 | 200 |
| 740 | 3300049581 | Ga0501047_0439997 | Ga0501047_0439997_327_929 | 200 |
| 741 | 3300049589 | Ga0501073_0462092 | Ga0501073_0462092_233_838 | 200 |
| 742 | 3300050493 | nmdc:mga0k408_107214_c1 | nmdc:mga0k408_107214_c1_1005_1610 | 200 |
| 743 | 3300050493 | nmdc:mga0k408_1744_c1 | nmdc:mga0k408_1744_c1_3090_3695 | 200 |
| 744 | 3300050493 | nmdc:mga0k408_4189_c1 | nmdc:mga0k408_4189_c1_886_1491 | 200 |
| 745 | 3300050493 | nmdc:mga0k408_86216_c1 | nmdc:mga0k408_86216_c1_996_1601 | 200 |
| 746 | 3300050494 | nmdc:mga06z11_313705_c1 | nmdc:mga06z11_313705_c1_294_899 | 200 |
| 747 | 3300050496 | nmdc:mga07m45_136893_c1 | nmdc:mga07m45_136893_c1_597_1202 | 200 |
| 748 | 3300050496 | nmdc:mga07m45_2113_c1 | nmdc:mga07m45_2113_c1_118_723 | 200 |
| 749 | 3300050496 | nmdc:mga07m45_461_c1 | nmdc:mga07m45_461_c1_6741_7346 | 200 |
| 750 | 3300053153 | Ga0500616_0117831 | Ga0500616_0117831_571_1176 | 200 |
| 751 | 3300053178 | Ga0500637_0424997 | Ga0500637_0424997_42_653 | 200 |
| 752 | 3300059477 | Ga0587084_004573 | Ga0587084_004573_10_618 | 200 |
| 753 | 3300059491 | Ga0587070_008565 | Ga0587070_008565_828_1436 | 200 |
| 754 | 3300059493 | Ga0587077_006126 | Ga0587077_006126_994_1602 | 200 |
| 755 | 3300059503 | Ga0587080_007804 | Ga0587080_007804_877_1485 | 200 |
| 756 | 3300059511 | Ga0587091_021604 | Ga0587091_021604_199_807 | 200 |
| 757 | 3300059645 | Ga0587076_025304 | Ga0587076_025304_10_618 | 200 |
| 758 | 3300059647 | Ga0587079_005665 | Ga0587079_005665_103_711 | 200 |
| 759 | 3300060344 | Ga0587071_031649 | Ga0587071_031649_393_1001 | 200 |
| 760 | 3300061719 | Ga0466962_0012679 | Ga0466962_0012679_921_1526 | 200 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3byq-assembly1.cif.gz_B | crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution | 0.903 | 9 | 200 |
| 2qtp-assembly1.cif.gz_A | crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution | 0.8927 | 10 | 176 |
| 3byq-assembly1.cif.gz_B | crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution | 0.8854 | 9 | 200 |
| 2qtp-assembly1.cif.gz_A | crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution | 0.8755 | 10 | 176 |
| 5ixm-assembly1.cif.gz_B | the lps transporter lptde from yersinia pestis, core complex | 0.6818 | 9 | 45 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2qtpA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 | 0.8868 | 10 | 176 | 3.30.1330.110 |
| 3byqA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 | 0.8845 | 8 | 200 | 3.30.1330.110 |
| 3byqA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 | 0.8756 | 8 | 200 | 3.30.1330.110 |
| 2qtpA00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 | 0.8693 | 10 | 176 | 3.30.1330.110 |
| 2r76B00 | Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain | 0.6644 | 9 | 45 | 3.30.160.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A529LYE5-F1-model_v4 | Amino acid synthesis family protein | 0.9611 | 8 | 112 |
|
| AF-A0A7X1EA00-F1-model_v4 | Amino acid synthesis family protein | 0.9573 | 9 | 176 |
|
| AF-A0A1T4TMX2-F1-model_v4 | Amino acid synthesis | 0.9564 | 1 | 189 |
|
| AF-J3EFK7-F1-model_v4 | Amino acid synthesis protein | 0.9514 | 1 | 200 |
|
| AF-A0A291AIN8-F1-model_v4 | Amino acid synthesis family protein | 0.9491 | 1 | 200 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar