F479522

General Info

Members Datasets Scaffolds Average Seq Length
760 365 702 201

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10002201|Ga0105240_1000220127
Length 203
Sequence MTTRPPNFHGLHIRKWFEFREETLALETGKLADGEPVVKLVLAAAVENPHAGGGFVDSFESVISKSKSLGIEFGRRLLATLGGTPVQSYGKAALVGVNGEYEHGNAFLTTEFADPIREALGGAKAWIPSTGKRAGPGATIDIPLAHKDALYVRSHYDTISVSFTDAPAPDEVVIAVAVATRGRLHARLGGIKVSEIVGKDGLR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
3 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
4 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
5 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
6 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
7 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
8 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
9 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
10 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
11 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
12 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
13 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
14 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
15 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
16 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
17 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
18 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
19 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
20 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
21 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
22 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
23 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
24 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
25 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
26 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
27 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
28 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
29 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
30 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
31 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
32 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
33 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
34 2818991446 Variovorax sp. 1180 Isolate Unclassified
35 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
36 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
37 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
38 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
39 2879163058 Sphingomonas pokkalii L3B27 Isolate Rhizosphere
40 2896253425 Aurantiacibacter rhizosphaerae GH3-10 Isolate Rhizosphere
41 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
42 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
43 2904456579 Variovorax sp. 2002 Isolate Unclassified
44 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
45 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
46 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
47 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
48 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
49 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
50 2919138771 Novosphingobium sp. 1748 Isolate Rhizosphere
51 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
52 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
53 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
54 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
55 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
56 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
57 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
58 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
59 3300001432 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
60 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
61 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
62 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
63 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
64 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
65 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
66 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
67 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
68 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
69 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
70 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
71 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
72 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
73 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
74 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
75 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
76 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
77 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
78 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
79 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
80 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
81 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
82 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
83 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
84 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
85 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
86 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
87 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
88 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
89 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
90 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
91 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
92 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
93 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
94 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
95 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
96 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
97 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
98 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
99 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
100 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
101 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
102 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
103 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
104 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
105 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
106 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
107 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
108 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
109 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
110 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
111 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
112 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
113 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
114 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
115 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
116 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
117 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
118 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
119 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
120 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
121 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
122 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
123 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
124 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
125 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
126 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
127 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
128 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
129 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
132 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
133 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
134 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
135 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
137 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
138 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
139 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
140 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
141 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
142 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
143 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
144 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
145 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
146 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
147 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
148 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
149 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
150 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
151 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
152 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
153 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
154 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
155 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
156 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
157 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
158 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
159 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
160 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
161 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
162 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
163 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
164 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
165 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
166 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
167 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
168 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
169 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
170 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
171 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
173 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
174 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
175 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
176 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
177 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
178 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
180 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
181 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
182 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
183 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
184 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
185 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
186 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
187 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
188 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
189 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
190 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
191 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
192 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
193 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
194 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
228 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
230 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
231 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
232 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
233 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
235 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
238 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
240 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
242 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
243 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
244 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
245 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
246 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
247 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
250 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
251 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
252 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
253 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
254 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
255 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
256 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
257 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
258 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
259 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
260 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
261 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
262 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
263 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
266 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
267 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
268 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
269 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
270 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
271 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
272 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
273 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
274 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
275 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
276 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
277 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
278 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
279 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
280 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
281 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
282 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
283 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
284 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
285 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
290 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
291 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
292 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
293 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
294 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
295 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
296 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
297 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
298 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
299 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
300 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
301 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
302 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
303 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
304 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
309 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
310 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
311 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
312 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
313 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
314 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
315 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
316 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
317 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
318 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
319 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
320 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
328 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
329 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
330 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
331 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
332 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
333 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
334 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
335 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
336 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
337 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
338 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
339 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
340 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
341 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
342 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
343 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
344 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
345 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
346 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
347 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
348 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
349 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
350 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
351 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
352 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
353 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
354 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
365 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.26
Metatranscriptomes 2.11
Isolates 7.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.05
Nodule 0.53
Rhizoplane 4.34
Rhizosphere 75.13
Stem 0
Stem Tuber 0
Unclassified 8.95

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3335162 2162886007 Bacteria 8575
2 JGI24034J14986_100776 3300001432 Bacteria 1898
3 JGI24736J21556_1000789 3300001904 Bacteria 5819
4 JGI24752J21851_1000020 3300001976 Bacteria 18109
5 JGI24740J21852_10000064 3300001979 Bacteria 34423
6 JGI24740J21852_10004332 3300001979 Bacteria 6116
7 JGI24739J22299_10000233 3300001989 Bacteria 18716
8 JGI24739J22299_10008392 3300001989 Bacteria 3858
9 JGI24737J22298_10001316 3300001990 Bacteria 8802
10 JGI24735J21928_10005060 3300002067 Bacteria 4388
11 JGI24735J21928_10143218 3300002067 Bacteria 690
12 JGI24750J21931_1000383 3300002070 Bacteria 7517
13 JGI24748J21848_1000013 3300002074 Bacteria 149648
14 JGI24738J21930_10003587 3300002075 Bacteria 3890
15 JGI24034J26672_10000011 3300002239 Bacteria 148169
16 JGI24742J22300_10000488 3300002244 Bacteria 5899
17 JGI25154J39366_1000416 3300002738 Bacteria 22947
18 JGI25157J39369_1000112 3300002741 Bacteria 69379
19 JGI25151J46595_10002504 3300003187 Bacteria 10957
20 rootH2_10026970 3300003320 Bacteria 6942
21 rootL2_10296995 3300003322 Bacteria 2565
22 rootH1_10099923 3300003323 Bacteria 4776
23 rootH1_10163039 3300003323 Bacteria 1331
24 JGI25161J50226_1005403 3300003374 Bacteria 2485
25 Ga0006562J51391_1111416 3300003578 Bacteria 1870
26 Ga0055539_1000633 3300003752 Bacteria 9408
27 Ga0055535_1000047 3300003761 Bacteria 139836
28 Ga0055535_1000226 3300003761 Bacteria 59752
29 Ga0055542_1000029 3300003762 Bacteria 248836
30 Ga0055529_1000148 3300003763 Bacteria 100809
31 Ga0055529_1000193 3300003763 Bacteria 83459
32 Ga0055526_1000155 3300003771 Bacteria 60928
33 Ga0055537_1000006 3300003773 Bacteria 147020
34 Ga0055537_1004166 3300003773 Bacteria 4212
35 Ga0055524_1000032 3300003775 Bacteria 182182
36 Ga0055524_1022006 3300003775 Bacteria 2095
37 Ga0055534_1000048 3300003784 Bacteria 94388
38 Ga0055534_1003042 3300003784 Bacteria 5501
39 Ga0055534_1004512 3300003784 Bacteria 4012
40 Ga0055528_1002482 3300003790 Bacteria 9861
41 Ga0055528_1009873 3300003790 Bacteria 3942
42 Ga0055540_1000017 3300003792 Bacteria 231465
43 Ga0055540_1004431 3300003792 Bacteria 6327
44 Ga0055531_10014250 3300003794 Bacteria 3596
45 Ga0065704_10070262 3300005289 Bacteria 45316
46 Ga0065704_10079067 3300005289 Bacteria 4264
47 Ga0065704_10080236 3300005289 Bacteria 3986
48 Ga0065704_10088568 3300005289 Bacteria 2928
49 Ga0070658_10000077 3300005327 Bacteria 94332
50 Ga0070690_100000054 3300005330 Bacteria 55235
51 Ga0070670_100000031 3300005331 Bacteria 159070
52 Ga0070670_100000154 3300005331 Bacteria 63034
53 Ga0070670_100018634 3300005331 Bacteria 5948
54 Ga0070670_100181094 3300005331 Bacteria 1830
55 Ga0068869_100132954 3300005334 Bacteria 1914
56 Ga0068869_100622083 3300005334 Bacteria 914
57 Ga0070666_10000114 3300005335 Bacteria 55625
58 Ga0070666_10013146 3300005335 Bacteria 5245
59 Ga0068868_100039651 3300005338 Bacteria 3661
60 Ga0070660_100037108 3300005339 Bacteria 3694
61 Ga0070660_100106669 3300005339 Bacteria 2225
62 Ga0070660_100122082 3300005339 Bacteria 2079
63 Ga0070661_100003307 3300005344 Bacteria 11126
64 Ga0070661_100015010 3300005344 Bacteria 5466
65 Ga0070661_100028762 3300005344 Bacteria 4010
66 Ga0070668_100022656 3300005347 Bacteria 4749
67 Ga0070668_100041542 3300005347 Bacteria 3524
68 Ga0070668_100228247 3300005347 Bacteria 1538
69 Ga0070668_100690797 3300005347 Bacteria 899
70 Ga0070669_100000737 3300005353 Bacteria 23845
71 Ga0070671_100002346 3300005355 Bacteria 14609
72 Ga0070671_100074779 3300005355 Unclassified 2830
73 Ga0070671_100214239 3300005355 Bacteria 1634
74 Ga0070671_100338864 3300005355 Bacteria 1282
75 Ga0070674_100000060 3300005356 Bacteria 48372
76 Ga0070674_100639338 3300005356 Bacteria 903
77 Ga0070659_100008609 3300005366 Bacteria 7462
78 Ga0070659_100018246 3300005366 Bacteria 5295
79 Ga0070667_100000189 3300005367 Bacteria 73916
80 Ga0070667_100002453 3300005367 Bacteria 16199
81 Ga0070667_100002691 3300005367 Bacteria 15386
82 Ga0070667_100043541 3300005367 Bacteria 3768
83 Ga0070667_100606549 3300005367 Bacteria 1009
84 Ga0070663_100064683 3300005455 Bacteria 2644
85 Ga0070663_100075341 3300005455 Bacteria 2466
86 Ga0070663_100194237 3300005455 Bacteria 1581
87 Ga0070678_100000003 3300005456 Bacteria 78009
88 Ga0070662_100001084 3300005457 Bacteria 16607
89 Ga0070662_100076358 3300005457 Bacteria 2483
90 Ga0068867_100003492 3300005459 Bacteria 11055
91 Ga0068867_100101879 3300005459 Bacteria 2194
92 Ga0070684_100102139 3300005535 Bacteria 2563
93 Ga0068853_100000190 3300005539 Bacteria 43364
94 Ga0068853_100001662 3300005539 Bacteria 16283
95 Ga0068853_100288311 3300005539 Bacteria 1515
96 Ga0068853_100301373 3300005539 Bacteria 1481
97 Ga0070686_100000119 3300005544 Bacteria 55595
98 Ga0070686_100219417 3300005544 Bacteria 1373
99 Ga0070665_100001340 3300005548 Bacteria 29284
100 Ga0070665_100006931 3300005548 Bacteria 11518
101 Ga0070665_100008059 3300005548 Bacteria 10667
102 Ga0070665_100028521 3300005548 Bacteria 5622
103 Ga0070665_100386044 3300005548 Bacteria 1408
104 Ga0070665_100441601 3300005548 Bacteria 1310
105 Ga0070665_101190170 3300005548 Bacteria 773
106 Ga0068855_100000165 3300005563 Bacteria 85018
107 Ga0068855_100001098 3300005563 Bacteria 33621
108 Ga0068855_100019234 3300005563 Bacteria 8209
109 Ga0068855_100217025 3300005563 Bacteria 2147
110 Ga0068855_100326043 3300005563 Bacteria 1696
111 Ga0070664_100138098 3300005564 Bacteria 2145
112 Ga0068857_100003317 3300005577 Bacteria 13382
113 Ga0068857_100022481 3300005577 Bacteria 5549
114 Ga0068857_100112850 3300005577 Unclassified 2444
115 Ga0068857_100388177 3300005577 Bacteria 1297
116 Ga0068854_100000778 3300005578 Bacteria 18941
117 Ga0068854_100000825 3300005578 Bacteria 18481
118 Ga0068854_100001946 3300005578 Bacteria 12609
119 Ga0068854_100017205 3300005578 Bacteria 4834
120 Ga0068854_100039256 3300005578 Bacteria 3334
121 Ga0068854_100230355 3300005578 Bacteria 1470
122 Ga0068856_100059133 3300005614 Bacteria 3786
123 Ga0068856_100125907 3300005614 Unclassified 2565
124 Ga0068856_100203917 3300005614 Bacteria 1992
125 Ga0068852_100025666 3300005616 Bacteria 4777
126 Ga0068852_100035998 3300005616 Bacteria 4136
127 Ga0068852_100099713 3300005616 Bacteria 2619
128 Ga0068852_100120800 3300005616 Bacteria 2398
129 Ga0068859_100000532 3300005617 Bacteria 37821
130 Ga0068859_100016932 3300005617 Bacteria 7315
131 Ga0068859_100026823 3300005617 Bacteria 5779
132 Ga0068859_100247150 3300005617 Bacteria 1874
133 Ga0068864_100000019 3300005618 Bacteria 271650
134 Ga0068864_100000075 3300005618 Bacteria 108554
135 Ga0068864_100000195 3300005618 Bacteria 55625
136 Ga0068866_10042310 3300005718 Bacteria 2266
137 Ga0068861_100018469 3300005719 Bacteria 4967
138 Ga0068861_100262832 3300005719 Bacteria 1478
139 Ga0068851_10032270 3300005834 Bacteria 2606
140 Ga0068851_10041416 3300005834 Bacteria 2315
141 Ga0068851_10103937 3300005834 Bacteria 1510
142 Ga0068863_100000015 3300005841 Bacteria 214824
143 Ga0068863_100000044 3300005841 Bacteria 149959
144 Ga0068863_100003919 3300005841 Bacteria 14702
145 Ga0068863_100007913 3300005841 Bacteria 10392
146 Ga0068863_100043333 3300005841 Bacteria 4273
147 Ga0068863_100069346 3300005841 Bacteria 3334
148 Ga0068863_100092404 3300005841 Bacteria 2871
149 Ga0068863_100140087 3300005841 Bacteria 2312
150 Ga0068858_100000499 3300005842 Bacteria 41087
151 Ga0068858_100002285 3300005842 Bacteria 19405
152 Ga0068858_100005811 3300005842 Bacteria 12051
153 Ga0068858_100100553 3300005842 Unclassified 2696
154 Ga0068860_100000413 3300005843 Bacteria 55625
155 Ga0068860_100001842 3300005843 Bacteria 22583
156 Ga0068860_100003487 3300005843 Bacteria 16193
157 Ga0068860_100355748 3300005843 Bacteria 1442
158 Ga0068860_100561281 3300005843 Bacteria 1144
159 Ga0068862_100000090 3300005844 Bacteria 108954
160 Ga0068862_100000097 3300005844 Bacteria 104686
161 Ga0068862_100006674 3300005844 Bacteria 9574
162 Ga0068862_100040873 3300005844 Bacteria 3944
163 Ga0068862_100044842 3300005844 Bacteria 3772
164 Ga0068862_100644826 3300005844 Bacteria 1021
165 Ga0075367_10011661 3300006178 Bacteria 4662
166 Ga0075367_10270254 3300006178 Bacteria 1068
167 Ga0075366_10013720 3300006195 Bacteria 4618
168 Ga0075366_10029661 3300006195 Bacteria 3215
169 Ga0075366_10051545 3300006195 Bacteria 2445
170 Ga0075366_10072974 3300006195 Bacteria 2045
171 Ga0097621_100082758 3300006237 Bacteria 2673
172 Ga0097621_100920695 3300006237 Bacteria 815
173 Ga0075370_10001309 3300006353 Bacteria 10651
174 Ga0075370_10018754 3300006353 Bacteria 3757
175 Ga0075370_10036810 3300006353 Bacteria 2750
176 Ga0075370_10038221 3300006353 Bacteria 2701
177 Ga0068871_100163544 3300006358 Bacteria 1904
178 Ga0075431_101184622 3300006847 Bacteria 727
179 Ga0068865_100031360 3300006881 Bacteria 3544
180 Ga0068865_100433383 3300006881 Bacteria 1083
181 Ga0097620_100000532 3300006931 Bacteria 37821
182 Ga0097620_100016932 3300006931 Bacteria 7315
183 Ga0097620_100026823 3300006931 Bacteria 5779
184 Ga0097620_100247163 3300006931 Bacteria 1874
185 Ga0079104_1000041 3300006946 Bacteria 186297
186 Ga0099826_10053259 3300006948 Bacteria 2695
187 Ga0105251_10000436 3300009011 Bacteria 40435
188 Ga0105251_10000718 3300009011 Bacteria 30525
189 Ga0105244_10000415 3300009036 Bacteria 39705
190 Ga0105250_10048372 3300009092 Bacteria 1706
191 Ga0105240_10001791 3300009093 Bacteria 36157
192 Ga0105240_10002201 3300009093 Bacteria 31819
193 Ga0105240_10005543 3300009093 Bacteria 18793
194 Ga0105240_10009588 3300009093 Bacteria 13707
195 Ga0105240_10011024 3300009093 Bacteria 12644
196 Ga0105240_10024317 3300009093 Bacteria 7989
197 Ga0105240_10041137 3300009093 Bacteria 5902
198 Ga0105240_10115734 3300009093 Bacteria 3236
199 Ga0105240_10181560 3300009093 Bacteria 2483
200 Ga0105240_10190626 3300009093 Unclassified 2411
201 Ga0105240_10199460 3300009093 Bacteria 2346
202 Ga0105240_10244520 3300009093 Bacteria 2078
203 Ga0105240_10446258 3300009093 Bacteria 1449
204 Ga0105240_10527073 3300009093 Bacteria 1310
205 Ga0105245_10001114 3300009098 Bacteria 24292
206 Ga0105245_10135154 3300009098 Bacteria 2317
207 Ga0105247_10000330 3300009101 Bacteria 41710
208 Ga0105247_10011822 3300009101 Bacteria 5250
209 Ga0105247_10030729 3300009101 Bacteria 3257
210 Ga0105247_10299608 3300009101 Bacteria 1115
211 Ga0114129_10367429 3300009147 Bacteria 1902
212 Ga0105243_10000108 3300009148 Bacteria 94868
213 Ga0105243_10005675 3300009148 Bacteria 9710
214 Ga0105243_10028515 3300009148 Bacteria 4286
215 Ga0105243_10075072 3300009148 Bacteria 2743
216 Ga0105243_10121620 3300009148 Bacteria 2202
217 Ga0105241_10137379 3300009174 Unclassified 1986
218 Ga0105242_10012190 3300009176 Bacteria 6614
219 Ga0105242_10026800 3300009176 Bacteria 4570
220 Ga0105242_10049693 3300009176 Bacteria 3413
221 Ga0105242_10922725 3300009176 Bacteria 875
222 Ga0105248_10000014 3300009177 Bacteria 324729
223 Ga0105248_10002946 3300009177 Bacteria 18877
224 Ga0105248_10006876 3300009177 Bacteria 12466
225 Ga0105248_10007589 3300009177 Bacteria 11915
226 Ga0105237_10003349 3300009545 Bacteria 19079
227 Ga0105237_10003698 3300009545 Bacteria 18033
228 Ga0105237_10006276 3300009545 Bacteria 13223
229 Ga0105237_10013677 3300009545 Bacteria 8498
230 Ga0105237_10013720 3300009545 Bacteria 8486
231 Ga0105237_10038601 3300009545 Bacteria 4822
232 Ga0105237_10111476 3300009545 Bacteria 2728
233 Ga0105237_10134823 3300009545 Bacteria 2464
234 Ga0105237_10135294 3300009545 Unclassified 2459
235 Ga0105237_10260842 3300009545 Bacteria 1735
236 Ga0105238_10001684 3300009551 Bacteria 22226
237 Ga0105238_10001771 3300009551 Bacteria 21656
238 Ga0105238_10041446 3300009551 Bacteria 4663
239 Ga0105238_10074294 3300009551 Bacteria 3393
240 Ga0105238_10161374 3300009551 Unclassified 2217
241 Ga0105238_10169595 3300009551 Bacteria 2158
242 Ga0105238_11743331 3300009551 Bacteria 654
243 Ga0105249_10000048 3300009553 Bacteria 172137
244 Ga0105249_10000266 3300009553 Bacteria 55631
245 Ga0105249_10021316 3300009553 Bacteria 5801
246 Ga0105249_10491430 3300009553 Bacteria 1271
247 Ga0105249_10902229 3300009553 Bacteria 951
248 Ga0105239_10000196 3300010375 Bacteria 88069
249 Ga0105239_10000889 3300010375 Bacteria 42397
250 Ga0105239_10007229 3300010375 Bacteria 12756
251 Ga0105239_10011115 3300010375 Bacteria 10047
252 Ga0105239_10033806 3300010375 Bacteria 5614
253 Ga0105239_10105233 3300010375 Bacteria 3125
254 Ga0105239_11583354 3300010375 Bacteria 758
255 Ga0105246_10001891 3300011119 Bacteria 12607
256 Ga0105246_10300421 3300011119 Bacteria 1296
257 Ga0157373_10000372 3300013100 Bacteria 35853
258 Ga0157373_10001218 3300013100 Bacteria 19692
259 Ga0157373_10004249 3300013100 Bacteria 10807
260 Ga0157370_10001791 3300013104 Bacteria 26480
261 Ga0157370_10007379 3300013104 Bacteria 11983
262 Ga0157370_10009890 3300013104 Bacteria 10106
263 Ga0157370_10180732 3300013104 Bacteria 1960
264 Ga0157369_10000249 3300013105 Bacteria 74245
265 Ga0157369_10006228 3300013105 Bacteria 13845
266 Ga0157369_10044116 3300013105 Bacteria 4855
267 Ga0157369_10186290 3300013105 Bacteria 2182
268 Ga0157369_10436457 3300013105 Bacteria 1357
269 Ga0157374_10610711 3300013296 Bacteria 1101
270 Ga0157378_10066370 3300013297 Bacteria 3232
271 Ga0163162_10012075 3300013306 Bacteria 8426
272 Ga0163162_10053953 3300013306 Bacteria 4041
273 Ga0163162_10149571 3300013306 Bacteria 2452
274 Ga0163162_10203148 3300013306 Unclassified 2111
275 Ga0157372_10099580 3300013307 Bacteria 3316
276 Ga0157372_10115251 3300013307 Bacteria 3081
277 Ga0157375_10905941 3300013308 Bacteria 1026
278 Ga0163163_10208612 3300014325 Bacteria 2002
279 Ga0163163_10565264 3300014325 Bacteria 1200
280 Ga0163163_10667807 3300014325 Bacteria 1103
281 Ga0157380_10002736 3300014326 Bacteria 11973
282 Ga0182008_10000038 3300014497 Bacteria 129386
283 Ga0182008_10002221 3300014497 Bacteria 12301
284 Ga0157377_10161762 3300014745 Bacteria 1393
285 Ga0157379_10099676 3300014968 Unclassified 2608
286 Ga0157379_10419182 3300014968 Bacteria 1233
287 Ga0157376_10453738 3300014969 Bacteria 1251
288 Ga0182006_1006063 3300015261 Bacteria 5655
289 Ga0182006_1028073 3300015261 Bacteria 2291
290 Ga0182007_10027916 3300015262 Bacteria 1942
291 Ga0163161_10000255 3300017792 Bacteria 47099
292 Ga0207672_1000436 3300025223 Bacteria 5287
293 Ga0209672_101158 3300025228 Bacteria 10824
294 Ga0209147_100338 3300025229 Bacteria 34841
295 Ga0209258_100018 3300025242 Bacteria 567561
296 Ga0209258_100072 3300025242 Bacteria 274355
297 Ga0209646_1000127 3300025246 Bacteria 131920
298 Ga0209026_1000004 3300025250 Bacteria 949012
299 Ga0209677_100085 3300025253 Bacteria 116046
300 Ga0209148_1000030 3300025254 Bacteria 567582
301 Ga0209148_1002344 3300025254 Bacteria 6709
302 Ga0209759_1000129 3300025256 Bacteria 131961
303 Ga0209129_1000187 3300025258 Bacteria 85001
304 Ga0209129_1004805 3300025258 Bacteria 5095
305 Ga0209565_1000016 3300025263 Bacteria 477707
306 Ga0209565_1001570 3300025263 Bacteria 9771
307 Ga0209455_1000053 3300025272 Bacteria 365949
308 Ga0209673_1000073 3300025273 Bacteria 233645
309 Ga0209673_1006176 3300025273 Bacteria 5861
310 Ga0209130_1001957 3300025284 Bacteria 11372
311 Ga0209675_1000080 3300025291 Bacteria 154613
312 Ga0209675_1000248 3300025291 Bacteria 53556
313 Ga0209675_1014231 3300025291 Bacteria 2432
314 Ga0209676_1001486 3300025292 Bacteria 21618
315 Ga0209676_1020343 3300025292 Bacteria 2257
316 Ga0209676_1020766 3300025292 Bacteria 2221
317 Ga0209025_1000334 3300025294 Bacteria 103696
318 Ga0209025_1001126 3300025294 Bacteria 38269
319 Ga0209025_1019337 3300025294 Bacteria 3791
320 Ga0209564_1000040 3300025295 Bacteria 411388
321 Ga0209564_1000165 3300025295 Bacteria 160244
322 Ga0209564_1000322 3300025295 Bacteria 93323
323 Ga0209564_1000621 3300025295 Bacteria 54266
324 Ga0209050_1000037 3300025298 Bacteria 415612
325 Ga0209050_1047351 3300025298 Bacteria 1121
326 Ga0209256_1000023 3300025299 Bacteria 461150
327 Ga0209256_1000110 3300025299 Bacteria 182312
328 Ga0209256_1005577 3300025299 Bacteria 7164
329 Ga0207426_1000029 3300025302 Bacteria 473835
330 Ga0207426_1000068 3300025302 Bacteria 335134
331 Ga0209051_1000040 3300025303 Bacteria 315055
332 Ga0209051_1008387 3300025303 Bacteria 5476
333 Ga0209257_1000566 3300025304 Bacteria 62726
334 Ga0209257_1010347 3300025304 Bacteria 4742
335 Ga0209257_1011936 3300025304 Bacteria 4096
336 Ga0207656_10020229 3300025321 Bacteria 2643
337 Ga0207656_10033943 3300025321 Bacteria 2128
338 Ga0207656_10036310 3300025321 Bacteria 2068
339 Ga0207696_1118927 3300025711 Bacteria 713
340 Ga0207655_1002845 3300025728 Bacteria 13383
341 Ga0207713_1001530 3300025735 Bacteria 18202
342 Ga0207713_1003540 3300025735 Bacteria 10575
343 Ga0207710_10006689 3300025900 Unclassified 4912
344 Ga0207710_10007344 3300025900 Bacteria 4669
345 Ga0207710_10175122 3300025900 Bacteria 1050
346 Ga0207680_10000052 3300025903 Bacteria 55639
347 Ga0207680_10025077 3300025903 Bacteria 3284
348 Ga0207680_10068477 3300025903 Bacteria 2190
349 Ga0207647_10042711 3300025904 Bacteria 2842
350 Ga0207647_10043900 3300025904 Bacteria 2795
351 Ga0207643_10045871 3300025908 Bacteria 2469
352 Ga0207705_10000182 3300025909 Bacteria 66143
353 Ga0207654_10000950 3300025911 Bacteria 15913
354 Ga0207695_10000383 3300025913 Bacteria 100354
355 Ga0207695_10000435 3300025913 Bacteria 91834
356 Ga0207695_10001255 3300025913 Bacteria 43272
357 Ga0207695_10002264 3300025913 Bacteria 28816
358 Ga0207695_10016391 3300025913 Bacteria 8669
359 Ga0207695_10089140 3300025913 Bacteria 3103
360 Ga0207695_10100048 3300025913 Bacteria 2896
361 Ga0207695_10212371 3300025913 Bacteria 1845
362 Ga0207695_10445259 3300025913 Bacteria 1178
363 Ga0207671_10002126 3300025914 Bacteria 21618
364 Ga0207671_10008765 3300025914 Bacteria 8520
365 Ga0207671_10015423 3300025914 Bacteria 5981
366 Ga0207671_10017160 3300025914 Bacteria 5593
367 Ga0207671_10035953 3300025914 Bacteria 3673
368 Ga0207671_10036194 3300025914 Bacteria 3660
369 Ga0207671_10044076 3300025914 Bacteria 3299
370 Ga0207671_10224908 3300025914 Bacteria 1471
371 Ga0207657_10040495 3300025919 Bacteria 4128
372 Ga0207657_10127400 3300025919 Bacteria 2090
373 Ga0207657_10159380 3300025919 Bacteria 1833
374 Ga0207649_10020941 3300025920 Bacteria 3755
375 Ga0207649_10042283 3300025920 Bacteria 2779
376 Ga0207681_10000001 3300025923 Bacteria 1105841
377 Ga0207681_10001393 3300025923 Bacteria 15616
378 Ga0207694_10000111 3300025924 Bacteria 85677
379 Ga0207694_10003218 3300025924 Bacteria 13006
380 Ga0207694_10004423 3300025924 Bacteria 10988
381 Ga0207694_10069950 3300025924 Bacteria 2742
382 Ga0207694_10083884 3300025924 Bacteria 2506
383 Ga0207694_10230511 3300025924 Bacteria 1512
384 Ga0207694_10338753 3300025924 Unclassified 1243
385 Ga0207650_10000055 3300025925 Bacteria 158325
386 Ga0207650_10001052 3300025925 Bacteria 20525
387 Ga0207650_10014989 3300025925 Bacteria 5391
388 Ga0207650_10054138 3300025925 Bacteria 2975
389 Ga0207687_10001973 3300025927 Bacteria 14107
390 Ga0207687_10074418 3300025927 Bacteria 2434
391 Ga0207644_10043573 3300025931 Bacteria 3185
392 Ga0207644_10075796 3300025931 Bacteria 2472
393 Ga0207644_10097406 3300025931 Bacteria 2203
394 Ga0207706_10001006 3300025933 Bacteria 28712
395 Ga0207706_10021636 3300025933 Bacteria 5774
396 Ga0207706_10138538 3300025933 Bacteria 2140
397 Ga0207686_10026138 3300025934 Bacteria 3404
398 Ga0207709_10000148 3300025935 Bacteria 96435
399 Ga0207709_10031723 3300025935 Bacteria 3089
400 Ga0207709_10129194 3300025935 Bacteria 1719
401 Ga0207670_10761133 3300025936 Bacteria 805
402 Ga0207669_10000015 3300025937 Bacteria 125492
403 Ga0207704_10020193 3300025938 Bacteria 3518
404 Ga0207711_10000021 3300025941 Bacteria 355952
405 Ga0207711_10003159 3300025941 Bacteria 14356
406 Ga0207711_10077874 3300025941 Bacteria 2891
407 Ga0207711_10290753 3300025941 Bacteria 1506
408 Ga0207667_10000102 3300025949 Bacteria 137469
409 Ga0207667_10000220 3300025949 Bacteria 80179
410 Ga0207667_10019128 3300025949 Bacteria 7658
411 Ga0207667_10106107 3300025949 Bacteria 2898
412 Ga0207667_10140023 3300025949 Bacteria 2491
413 Ga0207667_10853721 3300025949 Bacteria 904
414 Ga0207712_10000221 3300025961 Bacteria 56450
415 Ga0207712_10000598 3300025961 Bacteria 28786
416 Ga0207712_10141483 3300025961 Bacteria 1847
417 Ga0207712_10839787 3300025961 Bacteria 809
418 Ga0207668_10095262 3300025972 Bacteria 2197
419 Ga0207668_10156311 3300025972 Bacteria 1772
420 Ga0207668_10678046 3300025972 Bacteria 904
421 Ga0207640_10005437 3300025981 Bacteria 6943
422 Ga0207640_10008788 3300025981 Bacteria 5621
423 Ga0207640_10047382 3300025981 Bacteria 2772
424 Ga0207640_10056396 3300025981 Bacteria 2578
425 Ga0207640_10789609 3300025981 Bacteria 822
426 Ga0207658_10000567 3300025986 Bacteria 33560
427 Ga0207658_10005623 3300025986 Bacteria 8575
428 Ga0207658_10017918 3300025986 Bacteria 4881
429 Ga0207658_10342094 3300025986 Bacteria 1300
430 Ga0207658_10429756 3300025986 Bacteria 1166
431 Ga0207677_10026051 3300026023 Bacteria 3661
432 Ga0207677_11056513 3300026023 Bacteria 738
433 Ga0207703_10000439 3300026035 Bacteria 43808
434 Ga0207703_10000544 3300026035 Bacteria 38674
435 Ga0207703_10061105 3300026035 Unclassified 3083
436 Ga0207639_10000359 3300026041 Bacteria 31527
437 Ga0207639_10000764 3300026041 Bacteria 21926
438 Ga0207639_10003787 3300026041 Bacteria 10183
439 Ga0207639_10015954 3300026041 Bacteria 5305
440 Ga0207678_10003441 3300026067 Bacteria 14260
441 Ga0207678_10019573 3300026067 Bacteria 5949
442 Ga0207678_10086681 3300026067 Bacteria 2676
443 Ga0207678_10171019 3300026067 Bacteria 1855
444 Ga0207678_10329108 3300026067 Bacteria 1315
445 Ga0207702_10063314 3300026078 Bacteria 3162
446 Ga0207702_10072627 3300026078 Bacteria 2966
447 Ga0207702_10073157 3300026078 Bacteria 2955
448 Ga0207702_10734758 3300026078 Bacteria 974
449 Ga0207702_10907373 3300026078 Bacteria 873
450 Ga0207641_10000008 3300026088 Bacteria 424415
451 Ga0207641_10000073 3300026088 Bacteria 149989
452 Ga0207641_10003935 3300026088 Bacteria 12989
453 Ga0207641_10017638 3300026088 Bacteria 5846
454 Ga0207641_10060086 3300026088 Bacteria 3239
455 Ga0207641_10303699 3300026088 Bacteria 1508
456 Ga0207648_10006895 3300026089 Bacteria 11254
457 Ga0207648_10021743 3300026089 Bacteria 5764
458 Ga0207676_10000004 3300026095 Bacteria 725417
459 Ga0207676_10000019 3300026095 Bacteria 305653
460 Ga0207676_10000112 3300026095 Bacteria 73166
461 Ga0207674_10000167 3300026116 Bacteria 78909
462 Ga0207674_10002320 3300026116 Bacteria 24101
463 Ga0207674_10006048 3300026116 Bacteria 14317
464 Ga0207674_10143092 3300026116 Bacteria 2350
465 Ga0207675_100003904 3300026118 Bacteria 14497
466 Ga0207675_100142534 3300026118 Bacteria 2277
467 Ga0207683_10000046 3300026121 Bacteria 89256
468 Ga0207698_10006657 3300026142 Bacteria 7222
469 Ga0207698_10027208 3300026142 Bacteria 4057
470 Ga0207698_10062466 3300026142 Bacteria 2909
471 Ga0207698_10160117 3300026142 Bacteria 1967
472 Ga0209281_1000073 3300027111 Bacteria 269036
473 Ga0268266_10002649 3300028379 Bacteria 18854
474 Ga0268266_10005031 3300028379 Bacteria 12479
475 Ga0268266_10009507 3300028379 Bacteria 8555
476 Ga0268266_10042076 3300028379 Bacteria 3900
477 Ga0268266_10080439 3300028379 Bacteria 2839
478 Ga0268266_10565341 3300028379 Unclassified 1090
479 Ga0268265_10000011 3300028380 Bacteria 343832
480 Ga0268265_10000107 3300028380 Bacteria 104685
481 Ga0268265_10029655 3300028380 Bacteria 3930
482 Ga0268265_10136981 3300028380 Bacteria 2044
483 Ga0268265_10502098 3300028380 Bacteria 1143
484 Ga0268265_11321637 3300028380 Bacteria 721
485 Ga0268264_10000025 3300028381 Bacteria 468619
486 Ga0268264_10000081 3300028381 Bacteria 248362
487 Ga0268264_10000457 3300028381 Bacteria 55639
488 Ga0268264_10000869 3300028381 Bacteria 31997
489 Ga0268264_10771942 3300028381 Unclassified 959
490 Ga0307515_10015055 3300028794 Bacteria 14287
491 Ga0307408_100000852 3300031548 Bacteria 24073
492 Ga0307408_100059403 3300031548 Bacteria 2782
493 Ga0307408_100099438 3300031548 Bacteria 2213
494 Ga0307516_10003223 3300031730 Bacteria 21166
495 Ga0307405_10044034 3300031731 Bacteria 2727
496 Ga0307405_10270226 3300031731 Bacteria 1274
497 Ga0307405_10474787 3300031731 Bacteria 997
498 Ga0307412_10017311 3300031911 Bacteria 4312
499 Ga0307412_10019933 3300031911 Bacteria 4071
500 Ga0307412_10038964 3300031911 Bacteria 3064
501 Ga0307414_10015372 3300032004 Bacteria 4619
502 Ga0307414_10201425 3300032004 Bacteria 1619
503 Ga0307411_10499793 3300032005 Bacteria 1028
504 Ga0373931_0025728 3300035691 Bacteria 2989
505 Ga0395898_0023422 3300037466 Bacteria 6241
506 Ga0395898_0236465 3300037466 Bacteria 1742
507 Ga0395905_0002432 3300037471 Bacteria 20642
508 Ga0395905_0058757 3300037471 Bacteria 3596
509 Ga0395905_0060373 3300037471 Bacteria 3545
510 Ga0395905_0575613 3300037471 Bacteria 1027
511 Ga0395901_0042013 3300038443 Bacteria 4739
512 Ga0436360_1284070 3300039438 Bacteria 1388
513 Ga0436361_0657781 3300039447 Bacteria 2103
514 Ga0439438_002748 3300041405 Bacteria 7383
515 Ga0439438_007343 3300041405 Bacteria 3775
516 Ga0439438_008788 3300041405 Bacteria 3317
517 Ga0439447_039371 3300041407 Bacteria 1157
518 Ga0439466_0015205 3300041411 Bacteria 2796
519 Ga0451791_0216335 3300041451 Bacteria 872
520 Ga0451793_0721922 3300041452 Bacteria 1653
521 Ga0451795_1284843 3300041456 Bacteria 1651
522 Ga0451802_0724550 3300041460 Bacteria 1904
523 Ga0451807_0443440 3300041486 Bacteria 1518
524 Ga0451837_1123269 3300041494 Bacteria 671
525 Ga0451841_1270401 3300041498 Bacteria 1536
526 Ga0451853_1610789 3300041512 Bacteria 2684
527 Ga0439431_0004866 3300041997 Bacteria 2960
528 Ga0439431_0047542 3300041997 Bacteria 1106
529 Ga0439432_018237 3300042006 Bacteria 2346
530 Ga0439452_006058 3300042010 Bacteria 3823
531 Ga0450920_008871 3300042122 Bacteria 1844
532 Ga0450888_000189 3300042126 Bacteria 5443
533 Ga0450888_006728 3300042126 Bacteria 1256
534 Ga0450891_001637 3300042129 Bacteria 2311
535 Ga0450892_000294 3300042130 Bacteria 5887
536 Ga0450889_014814 3300042144 Bacteria 833
537 Ga0439458_0080775 3300042157 Bacteria 829
538 Ga0450908_001064 3300042184 Bacteria 5333
539 Ga0439434_0050623 3300042435 Bacteria 1287
540 Ga0450893_0002657 3300042532 Bacteria 2794
541 Ga0450893_0022976 3300042532 Bacteria 1082
542 Ga0466969_0004380 3300044656 Bacteria 7514
543 Ga0466969_0027935 3300044656 Bacteria 2887
544 Ga0466972_0000442 3300044658 Bacteria 21409
545 Ga0466972_0061133 3300044658 Bacteria 1807
546 Ga0466972_0149433 3300044658 Bacteria 1098
547 Ga0466965_0043710 3300044683 Bacteria 2212
548 Ga0466965_0108085 3300044683 Bacteria 1427
549 Ga0466965_0541543 3300044683 Bacteria 656
550 Ga0466966_0003863 3300044684 Bacteria 9890
551 Ga0466966_0017937 3300044684 Bacteria 4673
552 Ga0466966_0406075 3300044684 Bacteria 819
553 Ga0466961_0001590 3300044693 Bacteria 14079
554 Ga0466961_0026746 3300044693 Bacteria 3709
555 Ga0466961_0084249 3300044693 Bacteria 2010
556 Ga0466961_0130733 3300044693 Bacteria 1573
557 Ga0466964_0001270 3300044706 Bacteria 8589
558 Ga0466964_0047528 3300044706 Bacteria 1752
559 Ga0466964_0051326 3300044706 Bacteria 1693
560 Ga0466964_0138253 3300044706 Bacteria 1117
561 Ga0466971_0009149 3300044719 Bacteria 4331
562 Ga0466968_0008834 3300044735 Bacteria 3867
563 Ga0466968_0033469 3300044735 Bacteria 2141
564 Ga0466968_0227790 3300044735 Bacteria 879
565 Ga0466970_0006176 3300044765 Bacteria 5971
566 Ga0466970_0133972 3300044765 Bacteria 1362
567 Ga0466970_0552846 3300044765 Bacteria 665
568 Ga0466957_0033934 3300044842 Bacteria 3062
569 Ga0466957_0215409 3300044842 Bacteria 1266
570 Ga0466957_0739342 3300044842 Bacteria 696
571 Ga0466960_0232879 3300044901 Bacteria 1017
572 Ga0466960_0277395 3300044901 Bacteria 938
573 Ga0466959_0000455 3300045049 Bacteria 23797
574 Ga0466959_0010816 3300045049 Bacteria 6541
575 Ga0466959_0040224 3300045049 Unclassified 3454
576 Ga0466959_0062262 3300045049 Unclassified 2712
577 Ga0466959_0082661 3300045049 Bacteria 2313
578 Ga0466959_0137959 3300045049 Bacteria 1725
579 Ga0466959_0255324 3300045049 Bacteria 1208
580 Ga0466959_0301098 3300045049 Bacteria 1098
581 Ga0466959_0361457 3300045049 Unclassified 989
582 Ga0466959_0636399 3300045049 Bacteria 716
583 Ga0466967_0013873 3300045976 Bacteria 6249
584 Ga0495638_0000102 3300046460 Bacteria 137013
585 Ga0495639_0019750 3300046475 Bacteria 2941
586 Ga0495632_0075748 3300046519 Bacteria 1610
587 Ga0495648_0000001 3300046524 Bacteria 696872
588 Ga0495642_0000399 3300046528 Bacteria 23361
589 Ga0495609_0001495 3300046538 Bacteria 15463
590 Ga0495622_0000072 3300046557 Bacteria 88665
591 Ga0496101_0170505 3300048904 Bacteria 1673
592 Ga0496101_0439039 3300048904 Bacteria 1029
593 Ga0496102_0006012 3300048905 Bacteria 10335
594 Ga0496102_0151392 3300048905 Unclassified 2180
595 Ga0496102_0841111 3300048905 Bacteria 840
596 Ga0496103_0000966 3300048906 Bacteria 20376
597 Ga0496103_0068951 3300048906 Bacteria 2210
598 Ga0496105_0130695 3300048908 Bacteria 2070
599 Ga0496111_0364728 3300048914 Bacteria 1069
600 Ga0496112_0193871 3300048915 Unclassified 1993
601 Ga0496115_0201335 3300048918 Bacteria 1645
602 Ga0496116_0004783 3300048919 Bacteria 12782
603 Ga0496116_0025509 3300048919 Bacteria 4344
604 Ga0496116_0045027 3300048919 Bacteria 2991
605 Ga0496117_0012482 3300048920 Bacteria 7480
606 Ga0496117_0024734 3300048920 Bacteria 4737
607 Ga0496117_0045592 3300048920 Bacteria 3165
608 Ga0496118_0000152 3300048921 Bacteria 122913
609 Ga0496118_0005373 3300048921 Bacteria 14589
610 Ga0496118_0067454 3300048921 Bacteria 2604
611 Ga0496118_0108569 3300048921 Bacteria 1849
612 Ga0496119_0001236 3300048922 Bacteria 31768
613 Ga0496119_0001678 3300048922 Bacteria 25868
614 Ga0496119_0018793 3300048922 Bacteria 5124
615 Ga0496119_0063469 3300048922 Bacteria 2197
616 Ga0496120_0001156 3300048923 Bacteria 33809
617 Ga0496120_0003074 3300048923 Bacteria 15738
618 Ga0496121_0005197 3300048924 Bacteria 16868
619 Ga0496121_0009750 3300048924 Bacteria 10986
620 Ga0496121_0025617 3300048924 Bacteria 5590
621 Ga0496121_0034746 3300048924 Bacteria 4533
622 Ga0496121_0077399 3300048924 Bacteria 2649
623 Ga0496122_0048540 3300048925 Bacteria 3262
624 Ga0496122_0063347 3300048925 Bacteria 2699
625 Ga0496123_0011788 3300048926 Bacteria 7530
626 Ga0496123_0012006 3300048926 Bacteria 7430
627 Ga0496124_0001113 3300048927 Bacteria 42308
628 Ga0496124_0026821 3300048927 Bacteria 5186
629 Ga0496124_0179643 3300048927 Bacteria 1630
630 Ga0496124_0187621 3300048927 Bacteria 1585
631 Ga0496125_0003261 3300048928 Bacteria 19976
632 Ga0496125_0004247 3300048928 Bacteria 16695
633 Ga0496125_0004671 3300048928 Bacteria 15615
634 Ga0496125_0011179 3300048928 Bacteria 8999
635 Ga0496125_0040058 3300048928 Bacteria 4024
636 Ga0496125_0149169 3300048928 Bacteria 1610
637 Ga0496126_0002403 3300048929 Bacteria 25408
638 Ga0496126_0011528 3300048929 Bacteria 9135
639 Ga0496126_0016497 3300048929 Bacteria 7382
640 Ga0496126_0094961 3300048929 Bacteria 2616
641 Ga0501304_021897 3300049160 Bacteria 638
642 Ga0495678_000432 3300049459 Bacteria 41899
643 Ga0501290_000573 3300049513 Bacteria 5553
644 Ga0501292_000002 3300049515 Bacteria 188289
645 Ga0501294_000431 3300049517 Bacteria 4985
646 Ga0501314_000805 3300049530 Bacteria 2083
647 Ga0501315_004300 3300049531 Bacteria 1483
648 Ga0501317_000436 3300049533 Bacteria 2890
649 Ga0501318_006758 3300049534 Bacteria 1180
650 Ga0501032_0514059 3300049569 Bacteria 765
651 Ga0501039_0427859 3300049575 Bacteria 1040
652 Ga0501047_0439997 3300049581 Bacteria 1134
653 Ga0501073_0462092 3300049589 Bacteria 877
654 Ga0501202_039219 3300049652 Bacteria 1017
655 Ga0501206_003664 3300049653 Bacteria 1952
656 Ga0501222_000786 3300049662 Bacteria 4572
657 Ga0501223_000020 3300049663 Bacteria 67103
658 Ga0501223_000786 3300049663 Bacteria 7518
659 Ga0501224_000004 3300049664 Bacteria 169090
660 Ga0501224_000351 3300049664 Bacteria 5388
661 Ga0501227_003597 3300049665 Bacteria 3359
662 Ga0501233_003611 3300049668 Bacteria 2789
663 Ga0501235_000265 3300049669 Bacteria 9685
664 Ga0501235_015647 3300049669 Bacteria 1673
665 Ga0501246_002169 3300049676 Bacteria 1543
666 Ga0501257_001517 3300049686 Bacteria 4842
667 Ga0501259_000144 3300049688 Bacteria 10617
668 Ga0501261_000009 3300049690 Bacteria 56434
669 Ga0501225_0000060 3300049705 Bacteria 35405
670 Ga0501225_0000310 3300049705 Bacteria 15275
671 Ga0501225_0113840 3300049705 Bacteria 799
672 Ga0501229_005356 3300049706 Bacteria 1574
673 Ga0501234_001027 3300049707 Bacteria 4411
674 Ga0501245_001663 3300049708 Bacteria 2903
675 Ga0501279_000003 3300049775 Bacteria 188296
676 Ga0501280_000090 3300049776 Bacteria 24442
677 Ga0501281_00091 3300049777 Bacteria 10651
678 Ga0501226_000018 3300049853 Bacteria 147268
679 nmdc:mga0k408_107214_c1 3300050493 Bacteria 1650
680 nmdc:mga0k408_1744_c1 3300050493 Bacteria 6145
681 nmdc:mga0k408_4189_c1 3300050493 Bacteria 7653
682 nmdc:mga0k408_86216_c1 3300050493 Bacteria 1843
683 nmdc:mga06z11_313705_c1 3300050494 Bacteria 934
684 nmdc:mga07m45_136893_c1 3300050496 Bacteria 1418
685 nmdc:mga07m45_2113_c1 3300050496 Bacteria 9243
686 nmdc:mga07m45_461_c1 3300050496 Bacteria 17108
687 Ga0500590_060888 3300053148 Unclassified 1897
688 Ga0500616_0107569 3300053153 Bacteria 1352
689 Ga0500616_0117831 3300053153 Bacteria 1273
690 Ga0500637_0240765 3300053178 Bacteria 1014
691 Ga0500637_0424997 3300053178 Bacteria 682
692 Ga0587084_004573 3300059477 Bacteria 1591
693 Ga0587070_008565 3300059491 Bacteria 1453
694 Ga0587077_006126 3300059493 Bacteria 1686
695 Ga0587080_007804 3300059503 Bacteria 1514
696 Ga0587082_002042 3300059504 Bacteria 2217
697 Ga0587090_018926 3300059510 Bacteria 1057
698 Ga0587091_021604 3300059511 Bacteria 1129
699 Ga0587076_025304 3300059645 Bacteria 1014
700 Ga0587079_005665 3300059647 Bacteria 1780
701 Ga0587071_031649 3300060344 Bacteria 1021
702 Ga0466962_0012679 3300061719 Bacteria 4055

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10001791 Ga0105240_100017918 192
2 3300009545 Ga0105237_10013677 Ga0105237_100136778 192
3 3300013105 Ga0157369_10436457 Ga0157369_104364572 192
4 3300013296 Ga0157374_10610711 Ga0157374_106107112 192
5 3300006847 Ga0075431_101184622 Ga0075431_1011846221 193
6 3300049575 Ga0501039_0427859 Ga0501039_0427859_60_644 193
7 iso_pu_bacteria 2511231156 2511824478 196
8 iso_pu_bacteria 2521172590 2521559882 196
9 iso_pu_bacteria 2551306416 2553006983 196
10 iso_pu_bacteria 2599185212 2599614714 196
11 iso_pu_bacteria 2599185306 2599964023 196
12 iso_pu_bacteria 2599185307 2599972082 196
13 iso_pu_bacteria 2599185308 2599976746 196
14 iso_pu_bacteria 2599185311 2599996664 196
15 iso_pu_bacteria 2599185313 2600003778 196
16 iso_pu_bacteria 2599185314 2600010915 196
17 iso_pu_bacteria 2599185316 2600021870 196
18 iso_pu_bacteria 2599185317 2600031907 196
19 iso_pu_bacteria 2599185318 2600037335 196
20 iso_pu_bacteria 2599185319 2600041489 196
21 iso_pu_bacteria 2599185322 2600059474 196
22 iso_pu_bacteria 2599185323 2600063697 196
23 iso_pu_bacteria 2599185324 2600069172 196
24 iso_pu_bacteria 2599185325 2600075144 196
25 iso_pu_bacteria 2600254930 2600361677 196
26 iso_pu_bacteria 2643221650 2644281057 196
27 iso_pu_bacteria 2651869719 2652547119 196
28 iso_pu_bacteria 2667528176 2671126954 196
29 iso_pu_bacteria 2675903515 2678263494 196
30 iso_pu_bacteria 2744054620 2745009825 196
31 iso_pu_bacteria 2808606361 2808853498 196
32 iso_pu_bacteria 2808606376 2808922429 196
33 iso_pu_bacteria 2808606378 2808933879 196
34 iso_pu_bacteria 2808606380 2808944588 196
35 iso_pu_bacteria 2808606383 2808962353 196
36 iso_pu_bacteria 2808606389 2808996890 196
37 iso_pu_bacteria 2808606415 2809129788 196
38 iso_pu_bacteria 2808606419 2809149157 196
39 iso_pu_bacteria 2818991446 2819600969 196
40 iso_pu_bacteria 2825651385 2825652313 196
41 iso_pu_bacteria 2838054893 2838060684 196
42 iso_pu_bacteria 2842854478 2842857947 196
43 iso_pu_bacteria 2852618963 2852619297 196
44 iso_pu_bacteria 2904439833 2904444451 196
45 iso_pu_bacteria 2904530477 2904535604 196
46 iso_pu_bacteria 2904584206 2904588176 196
47 iso_pu_bacteria 2904589729 2904595212 196
48 iso_pu_bacteria 2904601388 2904606123 196
49 iso_pu_bacteria 2913036834 2913040338 196
50 iso_pu_bacteria 2919079590 2919084322 196
51 iso_pu_bacteria 2919704043 2919707941 196
52 iso_pu_bacteria 2923586266 2923588130 196
53 iso_pu_bacteria 2928115317 2928118682 196
54 iso_pu_bacteria 2928130867 2928135232 196
55 iso_pu_bacteria 2929144301 2929147757 196
56 iso_pu_bacteria 2931369376 2931374850 196
57 iso_pu_bacteria 2945928738 2945934108 196
58 iso_pu_bacteria 2988728565 2988728947 196
59 iso_pu_bacteria 8056143049 8056146493 196
60 iso_pu_bacteria 2896253425 2896254017 197
61 iso_pu_bacteria 2904449895 2904449923 197
62 iso_pu_bacteria 2904456579 2904457250 197
63 iso_pu_bacteria 2879163058 2879166525 198
64 iso_pu_bacteria 2919138771 2919140727 198
65 3300001432 JGI24034J14986_100776 JGI24034J14986_1007762 199
66 3300001904 JGI24736J21556_1000789 JGI24736J21556_10007893 199
67 3300001976 JGI24752J21851_1000020 JGI24752J21851_10000207 199
68 3300001989 JGI24739J22299_10008392 JGI24739J22299_100083922 199
69 3300001990 JGI24737J22298_10001316 JGI24737J22298_100013167 199
70 3300002067 JGI24735J21928_10005060 JGI24735J21928_100050603 199
71 3300002070 JGI24750J21931_1000383 JGI24750J21931_10003832 199
72 3300002074 JGI24748J21848_1000013 JGI24748J21848_100001341 199
73 3300002075 JGI24738J21930_10003587 JGI24738J21930_100035871 199
74 3300002239 JGI24034J26672_10000011 JGI24034J26672_1000001162 199
75 3300002244 JGI24742J22300_10000488 JGI24742J22300_100004884 199
76 3300003322 rootL2_10296995 rootL2_102969952 199
77 3300003784 Ga0055534_1003042 Ga0055534_10030422 199
78 3300005289 Ga0065704_10080236 Ga0065704_100802362 199
79 3300005289 Ga0065704_10088568 Ga0065704_100885684 199
80 3300005330 Ga0070690_100000054 Ga0070690_10000005427 199
81 3300005331 Ga0070670_100000031 Ga0070670_100000031154 199
82 3300005331 Ga0070670_100000154 Ga0070670_10000015450 199
83 3300005331 Ga0070670_100018634 Ga0070670_1000186345 199
84 3300005331 Ga0070670_100181094 Ga0070670_1001810942 199
85 3300005335 Ga0070666_10000114 Ga0070666_1000011426 199
86 3300005335 Ga0070666_10013146 Ga0070666_100131465 199
87 3300005339 Ga0070660_100122082 Ga0070660_1001220822 199
88 3300005344 Ga0070661_100028762 Ga0070661_1000287623 199
89 3300005347 Ga0070668_100022656 Ga0070668_1000226565 199
90 3300005347 Ga0070668_100041542 Ga0070668_1000415423 199
91 3300005347 Ga0070668_100228247 Ga0070668_1002282471 199
92 3300005353 Ga0070669_100000737 Ga0070669_10000073716 199
93 3300005355 Ga0070671_100002346 Ga0070671_10000234613 199
94 3300005355 Ga0070671_100074779 Ga0070671_1000747792 199
95 3300005355 Ga0070671_100214239 Ga0070671_1002142392 199
96 3300005355 Ga0070671_100338864 Ga0070671_1003388642 199
97 3300005366 Ga0070659_100018246 Ga0070659_1000182461 199
98 3300005367 Ga0070667_100000189 Ga0070667_10000018911 199
99 3300005367 Ga0070667_100002453 Ga0070667_1000024536 199
100 3300005367 Ga0070667_100002691 Ga0070667_1000026915 199
101 3300005455 Ga0070663_100064683 Ga0070663_1000646833 199
102 3300005457 Ga0070662_100076358 Ga0070662_1000763583 199
103 3300005539 Ga0068853_100288311 Ga0068853_1002883111 199
104 3300005539 Ga0068853_100301373 Ga0068853_1003013733 199
105 3300005544 Ga0070686_100000119 Ga0070686_10000011927 199
106 3300005544 Ga0070686_100219417 Ga0070686_1002194171 199
107 3300005548 Ga0070665_100001340 Ga0070665_10000134018 199
108 3300005548 Ga0070665_100006931 Ga0070665_1000069319 199
109 3300005548 Ga0070665_100008059 Ga0070665_1000080598 199
110 3300005548 Ga0070665_100386044 Ga0070665_1003860442 199
111 3300005548 Ga0070665_100441601 Ga0070665_1004416012 199
112 3300005564 Ga0070664_100138098 Ga0070664_1001380983 199
113 3300005577 Ga0068857_100112850 Ga0068857_1001128503 199
114 3300005577 Ga0068857_100388177 Ga0068857_1003881772 199
115 3300005578 Ga0068854_100000778 Ga0068854_1000007787 199
116 3300005578 Ga0068854_100039256 Ga0068854_1000392563 199
117 3300005614 Ga0068856_100125907 Ga0068856_1001259073 199
118 3300005616 Ga0068852_100120800 Ga0068852_1001208003 199
119 3300005617 Ga0068859_100000532 Ga0068859_10000053220 199
120 3300005617 Ga0068859_100016932 Ga0068859_1000169323 199
121 3300005617 Ga0068859_100026823 Ga0068859_1000268236 199
122 3300005617 Ga0068859_100247150 Ga0068859_1002471501 199
123 3300005618 Ga0068864_100000019 Ga0068864_100000019168 199
124 3300005618 Ga0068864_100000075 Ga0068864_10000007597 199
125 3300005618 Ga0068864_100000195 Ga0068864_10000019526 199
126 3300005719 Ga0068861_100018469 Ga0068861_1000184694 199
127 3300005719 Ga0068861_100262832 Ga0068861_1002628322 199
128 3300005834 Ga0068851_10041416 Ga0068851_100414162 199
129 3300005841 Ga0068863_100000015 Ga0068863_100000015167 199
130 3300005841 Ga0068863_100000044 Ga0068863_10000004492 199
131 3300005841 Ga0068863_100003919 Ga0068863_10000391911 199
132 3300005841 Ga0068863_100007913 Ga0068863_1000079135 199
133 3300005841 Ga0068863_100043333 Ga0068863_1000433332 199
134 3300005841 Ga0068863_100140087 Ga0068863_1001400873 199
135 3300005842 Ga0068858_100002285 Ga0068858_1000022851 199
136 3300005842 Ga0068858_100005811 Ga0068858_1000058112 199
137 3300005842 Ga0068858_100100553 Ga0068858_1001005532 199
138 3300005843 Ga0068860_100000413 Ga0068860_10000041326 199
139 3300005843 Ga0068860_100001842 Ga0068860_1000018424 199
140 3300005843 Ga0068860_100003487 Ga0068860_1000034874 199
141 3300005843 Ga0068860_100561281 Ga0068860_1005612812 199
142 3300005844 Ga0068862_100000090 Ga0068862_10000009047 199
143 3300005844 Ga0068862_100000097 Ga0068862_10000009712 199
144 3300005844 Ga0068862_100006674 Ga0068862_1000066744 199
145 3300005844 Ga0068862_100040873 Ga0068862_1000408732 199
146 3300006931 Ga0097620_100000532 Ga0097620_10000053220 199
147 3300006931 Ga0097620_100016932 Ga0097620_1000169323 199
148 3300006931 Ga0097620_100026823 Ga0097620_1000268236 199
149 3300006931 Ga0097620_100247163 Ga0097620_1002471631 199
150 3300009011 Ga0105251_10000436 Ga0105251_1000043635 199
151 3300009011 Ga0105251_10000718 Ga0105251_1000071818 199
152 3300009092 Ga0105250_10048372 Ga0105250_100483722 199
153 3300009093 Ga0105240_10002201 Ga0105240_1000220127 199
154 3300009093 Ga0105240_10041137 Ga0105240_100411373 199
155 3300009093 Ga0105240_10115734 Ga0105240_101157342 199
156 3300009093 Ga0105240_10181560 Ga0105240_101815602 199
157 3300009093 Ga0105240_10190626 Ga0105240_101906262 199
158 3300009093 Ga0105240_10199460 Ga0105240_101994602 199
159 3300009093 Ga0105240_10446258 Ga0105240_104462581 199
160 3300009093 Ga0105240_10527073 Ga0105240_105270732 199
161 3300009101 Ga0105247_10000330 Ga0105247_1000033024 199
162 3300009101 Ga0105247_10011822 Ga0105247_100118222 199
163 3300009101 Ga0105247_10030729 Ga0105247_100307293 199
164 3300009101 Ga0105247_10299608 Ga0105247_102996082 199
165 3300009174 Ga0105241_10137379 Ga0105241_101373792 199
166 3300009177 Ga0105248_10000014 Ga0105248_10000014111 199
167 3300009177 Ga0105248_10002946 Ga0105248_100029464 199
168 3300009177 Ga0105248_10006876 Ga0105248_100068762 199
169 3300009177 Ga0105248_10007589 Ga0105248_100075892 199
170 3300009545 Ga0105237_10111476 Ga0105237_101114762 199
171 3300009545 Ga0105237_10134823 Ga0105237_101348232 199
172 3300009545 Ga0105237_10135294 Ga0105237_101352942 199
173 3300009545 Ga0105237_10260842 Ga0105237_102608423 199
174 3300009551 Ga0105238_10041446 Ga0105238_100414462 199
175 3300009551 Ga0105238_10161374 Ga0105238_101613742 199
176 3300009551 Ga0105238_11743331 Ga0105238_117433311 199
177 3300009553 Ga0105249_10000048 Ga0105249_1000004869 199
178 3300009553 Ga0105249_10000266 Ga0105249_1000026625 199
179 3300009553 Ga0105249_10021316 Ga0105249_100213166 199
180 3300009553 Ga0105249_10491430 Ga0105249_104914301 199
181 3300009553 Ga0105249_10902229 Ga0105249_109022292 199
182 3300010375 Ga0105239_10033806 Ga0105239_100338063 199
183 3300010375 Ga0105239_10105233 Ga0105239_101052334 199
184 3300010375 Ga0105239_11583354 Ga0105239_115833541 199
185 3300013306 Ga0163162_10012075 Ga0163162_100120757 199
186 3300013306 Ga0163162_10053953 Ga0163162_100539532 199
187 3300013306 Ga0163162_10149571 Ga0163162_101495712 199
188 3300013306 Ga0163162_10203148 Ga0163162_102031482 199
189 3300013307 Ga0157372_10099580 Ga0157372_100995804 199
190 3300014325 Ga0163163_10208612 Ga0163163_102086122 199
191 3300014325 Ga0163163_10565264 Ga0163163_105652642 199
192 3300014325 Ga0163163_10667807 Ga0163163_106678072 199
193 3300014326 Ga0157380_10002736 Ga0157380_1000273610 199
194 3300014968 Ga0157379_10099676 Ga0157379_100996763 199
195 3300014968 Ga0157379_10419182 Ga0157379_104191822 199
196 3300014969 Ga0157376_10453738 Ga0157376_104537381 199
197 3300017792 Ga0163161_10000255 Ga0163161_1000025525 199
198 3300025223 Ga0207672_1000436 Ga0207672_10004364 199
199 3300025291 Ga0209675_1000248 Ga0209675_10002482 199
200 3300025321 Ga0207656_10020229 Ga0207656_100202292 199
201 3300025321 Ga0207656_10033943 Ga0207656_100339432 199
202 3300025711 Ga0207696_1118927 Ga0207696_11189271 199
203 3300025735 Ga0207713_1001530 Ga0207713_100153015 199
204 3300025735 Ga0207713_1003540 Ga0207713_10035403 199
205 3300025900 Ga0207710_10006689 Ga0207710_100066892 199
206 3300025900 Ga0207710_10007344 Ga0207710_100073444 199
207 3300025900 Ga0207710_10175122 Ga0207710_101751222 199
208 3300025903 Ga0207680_10000052 Ga0207680_1000005225 199
209 3300025903 Ga0207680_10025077 Ga0207680_100250773 199
210 3300025903 Ga0207680_10068477 Ga0207680_100684772 199
211 3300025904 Ga0207647_10042711 Ga0207647_100427113 199
212 3300025904 Ga0207647_10043900 Ga0207647_100439003 199
213 3300025911 Ga0207654_10000950 Ga0207654_100009504 199
214 3300025913 Ga0207695_10000435 Ga0207695_1000043547 199
215 3300025913 Ga0207695_10001255 Ga0207695_1000125531 199
216 3300025913 Ga0207695_10089140 Ga0207695_100891403 199
217 3300025913 Ga0207695_10212371 Ga0207695_102123712 199
218 3300025913 Ga0207695_10445259 Ga0207695_104452592 199
219 3300025914 Ga0207671_10002126 Ga0207671_1000212616 199
220 3300025914 Ga0207671_10036194 Ga0207671_100361942 199
221 3300025914 Ga0207671_10044076 Ga0207671_100440762 199
222 3300025914 Ga0207671_10224908 Ga0207671_102249082 199
223 3300025919 Ga0207657_10040495 Ga0207657_100404953 199
224 3300025923 Ga0207681_10000001 Ga0207681_100000011040 199
225 3300025923 Ga0207681_10001393 Ga0207681_100013938 199
226 3300025924 Ga0207694_10003218 Ga0207694_100032187 199
227 3300025924 Ga0207694_10069950 Ga0207694_100699503 199
228 3300025924 Ga0207694_10083884 Ga0207694_100838843 199
229 3300025924 Ga0207694_10338753 Ga0207694_103387532 199
230 3300025925 Ga0207650_10000055 Ga0207650_10000055154 199
231 3300025925 Ga0207650_10001052 Ga0207650_1000105210 199
232 3300025925 Ga0207650_10014989 Ga0207650_100149894 199
233 3300025925 Ga0207650_10054138 Ga0207650_100541384 199
234 3300025931 Ga0207644_10043573 Ga0207644_100435734 199
235 3300025931 Ga0207644_10075796 Ga0207644_100757963 199
236 3300025931 Ga0207644_10097406 Ga0207644_100974063 199
237 3300025933 Ga0207706_10021636 Ga0207706_100216366 199
238 3300025936 Ga0207670_10761133 Ga0207670_107611332 199
239 3300025941 Ga0207711_10000021 Ga0207711_10000021219 199
240 3300025941 Ga0207711_10003159 Ga0207711_100031594 199
241 3300025941 Ga0207711_10077874 Ga0207711_100778743 199
242 3300025941 Ga0207711_10290753 Ga0207711_102907532 199
243 3300025949 Ga0207667_10106107 Ga0207667_101061072 199
244 3300025949 Ga0207667_10140023 Ga0207667_101400233 199
245 3300025949 Ga0207667_10853721 Ga0207667_108537212 199
246 3300025961 Ga0207712_10000221 Ga0207712_1000022126 199
247 3300025961 Ga0207712_10000598 Ga0207712_1000059821 199
248 3300025961 Ga0207712_10141483 Ga0207712_101414832 199
249 3300025961 Ga0207712_10839787 Ga0207712_108397871 199
250 3300025972 Ga0207668_10095262 Ga0207668_100952623 199
251 3300025972 Ga0207668_10156311 Ga0207668_101563113 199
252 3300025972 Ga0207668_10678046 Ga0207668_106780462 199
253 3300025981 Ga0207640_10005437 Ga0207640_100054373 199
254 3300025981 Ga0207640_10789609 Ga0207640_107896091 199
255 3300025986 Ga0207658_10000567 Ga0207658_1000056711 199
256 3300025986 Ga0207658_10005623 Ga0207658_100056234 199
257 3300025986 Ga0207658_10342094 Ga0207658_103420941 199
258 3300026035 Ga0207703_10000544 Ga0207703_1000054424 199
259 3300026035 Ga0207703_10061105 Ga0207703_100611053 199
260 3300026041 Ga0207639_10015954 Ga0207639_100159544 199
261 3300026067 Ga0207678_10086681 Ga0207678_100866812 199
262 3300026067 Ga0207678_10171019 Ga0207678_101710192 199
263 3300026067 Ga0207678_10329108 Ga0207678_103291082 199
264 3300026078 Ga0207702_10072627 Ga0207702_100726273 199
265 3300026088 Ga0207641_10000008 Ga0207641_10000008271 199
266 3300026088 Ga0207641_10000073 Ga0207641_1000007340 199
267 3300026088 Ga0207641_10003935 Ga0207641_100039359 199
268 3300026088 Ga0207641_10017638 Ga0207641_100176381 199
269 3300026088 Ga0207641_10303699 Ga0207641_103036992 199
270 3300026095 Ga0207676_10000004 Ga0207676_1000000413 199
271 3300026095 Ga0207676_10000019 Ga0207676_10000019155 199
272 3300026095 Ga0207676_10000112 Ga0207676_1000011225 199
273 3300026116 Ga0207674_10143092 Ga0207674_101430923 199
274 3300026118 Ga0207675_100003904 Ga0207675_1000039047 199
275 3300026142 Ga0207698_10160117 Ga0207698_101601172 199
276 3300028379 Ga0268266_10002649 Ga0268266_1000264913 199
277 3300028379 Ga0268266_10005031 Ga0268266_1000503111 199
278 3300028379 Ga0268266_10042076 Ga0268266_100420762 199
279 3300028379 Ga0268266_10080439 Ga0268266_100804392 199
280 3300028379 Ga0268266_10565341 Ga0268266_105653412 199
281 3300028380 Ga0268265_10000011 Ga0268265_10000011271 199
282 3300028380 Ga0268265_10000107 Ga0268265_1000010711 199
283 3300028380 Ga0268265_10029655 Ga0268265_100296553 199
284 3300028380 Ga0268265_10136981 Ga0268265_101369812 199
285 3300028381 Ga0268264_10000025 Ga0268264_1000002527 199
286 3300028381 Ga0268264_10000081 Ga0268264_1000008173 199
287 3300028381 Ga0268264_10000457 Ga0268264_1000045725 199
288 3300028381 Ga0268264_10000869 Ga0268264_1000086921 199
289 3300028381 Ga0268264_10771942 Ga0268264_107719422 199
290 3300028794 Ga0307515_10015055 Ga0307515_100150557 199
291 3300037466 Ga0395898_0023422 Ga0395898_0023422_2651_3259 199
292 3300039438 Ga0436360_1284070 Ga0436360_1284070_362_1051 199
293 3300042126 Ga0450888_000189 Ga0450888_000189_3029_3685 199
294 3300042129 Ga0450891_001637 Ga0450891_001637_610_1266 199
295 3300042130 Ga0450892_000294 Ga0450892_000294_505_1161 199
296 3300042144 Ga0450889_014814 Ga0450889_014814_151_807 199
297 3300042532 Ga0450893_0002657 Ga0450893_0002657_853_1509 199
298 3300044656 Ga0466969_0027935 Ga0466969_0027935_1463_2071 199
299 3300044658 Ga0466972_0061133 Ga0466972_0061133_816_1424 199
300 3300044684 Ga0466966_0406075 Ga0466966_0406075_26_634 199
301 3300044693 Ga0466961_0026746 Ga0466961_0026746_2910_3518 199
302 3300044706 Ga0466964_0051326 Ga0466964_0051326_822_1430 199
303 3300044765 Ga0466970_0552846 Ga0466970_0552846_33_641 199
304 3300044842 Ga0466957_0215409 Ga0466957_0215409_483_1091 199
305 3300044842 Ga0466957_0739342 Ga0466957_0739342_14_622 199
306 3300044901 Ga0466960_0232879 Ga0466960_0232879_280_888 199
307 3300045049 Ga0466959_0000455 Ga0466959_0000455_1239_1847 199
308 3300045049 Ga0466959_0040224 Ga0466959_0040224_2503_3111 199
309 3300045049 Ga0466959_0062262 Ga0466959_0062262_631_1239 199
310 3300045049 Ga0466959_0082661 Ga0466959_0082661_488_1096 199
311 3300045049 Ga0466959_0361457 Ga0466959_0361457_47_655 199
312 3300046519 Ga0495632_0075748 Ga0495632_0075748_575_1183 199
313 3300048904 Ga0496101_0170505 Ga0496101_0170505_984_1589 199
314 3300048904 Ga0496101_0439039 Ga0496101_0439039_205_810 199
315 3300048905 Ga0496102_0006012 Ga0496102_0006012_8727_9332 199
316 3300048905 Ga0496102_0151392 Ga0496102_0151392_32_640 199
317 3300048905 Ga0496102_0841111 Ga0496102_0841111_171_776 199
318 3300048906 Ga0496103_0000966 Ga0496103_0000966_12403_13008 199
319 3300048906 Ga0496103_0068951 Ga0496103_0068951_1059_1664 199
320 3300048908 Ga0496105_0130695 Ga0496105_0130695_52_657 199
321 3300048914 Ga0496111_0364728 Ga0496111_0364728_101_706 199
322 3300048915 Ga0496112_0193871 Ga0496112_0193871_1175_1783 199
323 3300048918 Ga0496115_0201335 Ga0496115_0201335_17_625 199
324 3300048919 Ga0496116_0025509 Ga0496116_0025509_3004_3609 199
325 3300048919 Ga0496116_0045027 Ga0496116_0045027_623_1228 199
326 3300048920 Ga0496117_0012482 Ga0496117_0012482_6446_7051 199
327 3300048920 Ga0496117_0024734 Ga0496117_0024734_2496_3101 199
328 3300048920 Ga0496117_0045592 Ga0496117_0045592_2088_2693 199
329 3300048921 Ga0496118_0000152 Ga0496118_0000152_75073_75678 199
330 3300048921 Ga0496118_0005373 Ga0496118_0005373_912_1517 199
331 3300048921 Ga0496118_0108569 Ga0496118_0108569_439_1044 199
332 3300048922 Ga0496119_0001236 Ga0496119_0001236_9912_10523 199
333 3300048922 Ga0496119_0001678 Ga0496119_0001678_10891_11499 199
334 3300048922 Ga0496119_0018793 Ga0496119_0018793_1772_2377 199
335 3300048922 Ga0496119_0063469 Ga0496119_0063469_1228_1833 199
336 3300048923 Ga0496120_0001156 Ga0496120_0001156_21245_21856 199
337 3300048923 Ga0496120_0003074 Ga0496120_0003074_13198_13806 199
338 3300048924 Ga0496121_0005197 Ga0496121_0005197_8384_8989 199
339 3300048924 Ga0496121_0009750 Ga0496121_0009750_6767_7375 199
340 3300048924 Ga0496121_0025617 Ga0496121_0025617_1529_2137 199
341 3300048924 Ga0496121_0077399 Ga0496121_0077399_587_1192 199
342 3300048926 Ga0496123_0011788 Ga0496123_0011788_65_670 199
343 3300048927 Ga0496124_0026821 Ga0496124_0026821_3670_4275 199
344 3300048927 Ga0496124_0179643 Ga0496124_0179643_658_1263 199
345 3300048928 Ga0496125_0003261 Ga0496125_0003261_9676_10284 199
346 3300048928 Ga0496125_0011179 Ga0496125_0011179_3337_3945 199
347 3300048928 Ga0496125_0040058 Ga0496125_0040058_1735_2343 199
348 3300048928 Ga0496125_0149169 Ga0496125_0149169_830_1438 199
349 3300048929 Ga0496126_0002403 Ga0496126_0002403_4424_5032 199
350 3300048929 Ga0496126_0011528 Ga0496126_0011528_6147_6755 199
351 3300048929 Ga0496126_0016497 Ga0496126_0016497_3503_4108 199
352 3300048929 Ga0496126_0094961 Ga0496126_0094961_1229_1837 199
353 3300049513 Ga0501290_000573 Ga0501290_000573_2660_3265 199
354 3300049515 Ga0501292_000002 Ga0501292_000002_65879_66484 199
355 3300049517 Ga0501294_000431 Ga0501294_000431_3855_4460 199
356 3300049530 Ga0501314_000805 Ga0501314_000805_368_973 199
357 3300049531 Ga0501315_004300 Ga0501315_004300_126_731 199
358 3300049533 Ga0501317_000436 Ga0501317_000436_1316_1921 199
359 3300049534 Ga0501318_006758 Ga0501318_006758_564_1169 199
360 3300049569 Ga0501032_0514059 Ga0501032_0514059_68_673 199
361 3300049652 Ga0501202_039219 Ga0501202_039219_26_631 199
362 3300049653 Ga0501206_003664 Ga0501206_003664_907_1512 199
363 3300049662 Ga0501222_000786 Ga0501222_000786_53_658 199
364 3300049663 Ga0501223_000020 Ga0501223_000020_11360_11965 199
365 3300049663 Ga0501223_000786 Ga0501223_000786_1804_2409 199
366 3300049664 Ga0501224_000004 Ga0501224_000004_76992_77597 199
367 3300049664 Ga0501224_000351 Ga0501224_000351_3689_4294 199
368 3300049665 Ga0501227_003597 Ga0501227_003597_796_1401 199
369 3300049668 Ga0501233_003611 Ga0501233_003611_2156_2761 199
370 3300049669 Ga0501235_000265 Ga0501235_000265_3997_4602 199
371 3300049669 Ga0501235_015647 Ga0501235_015647_915_1520 199
372 3300049676 Ga0501246_002169 Ga0501246_002169_366_1016 199
373 3300049686 Ga0501257_001517 Ga0501257_001517_1776_2381 199
374 3300049688 Ga0501259_000144 Ga0501259_000144_4416_5021 199
375 3300049690 Ga0501261_000009 Ga0501261_000009_525_1130 199
376 3300049705 Ga0501225_0000060 Ga0501225_0000060_12802_13407 199
377 3300049705 Ga0501225_0000310 Ga0501225_0000310_11765_12415 199
378 3300049705 Ga0501225_0113840 Ga0501225_0113840_39_644 199
379 3300049706 Ga0501229_005356 Ga0501229_005356_80_685 199
380 3300049707 Ga0501234_001027 Ga0501234_001027_2037_2642 199
381 3300049708 Ga0501245_001663 Ga0501245_001663_1389_1994 199
382 3300049775 Ga0501279_000003 Ga0501279_000003_121813_122418 199
383 3300049776 Ga0501280_000090 Ga0501280_000090_22488_23093 199
384 3300049777 Ga0501281_00091 Ga0501281_00091_5670_6275 199
385 3300049853 Ga0501226_000018 Ga0501226_000018_91473_92078 199
386 3300053148 Ga0500590_060888 Ga0500590_060888_215_823 199
387 3300053153 Ga0500616_0107569 Ga0500616_0107569_166_774 199
388 3300053178 Ga0500637_0240765 Ga0500637_0240765_224_832 199
389 3300059504 Ga0587082_002042 Ga0587082_002042_1106_1711 199
390 3300059510 Ga0587090_018926 Ga0587090_018926_364_984 199
391 2162886007 SwRhRL2b_contig_3335162 SwRhRL2b_0204.00007670 200
392 3300001979 JGI24740J21852_10000064 JGI24740J21852_100000644 200
393 3300001979 JGI24740J21852_10004332 JGI24740J21852_100043325 200
394 3300001989 JGI24739J22299_10000233 JGI24739J22299_100002334 200
395 3300002067 JGI24735J21928_10143218 JGI24735J21928_101432181 200
396 3300002738 JGI25154J39366_1000416 JGI25154J39366_100041621 200
397 3300002741 JGI25157J39369_1000112 JGI25157J39369_100011241 200
398 3300003187 JGI25151J46595_10002504 JGI25151J46595_100025045 200
399 3300003320 rootH2_10026970 rootH2_100269703 200
400 3300003323 rootH1_10099923 rootH1_100999234 200
401 3300003323 rootH1_10163039 rootH1_101630391 200
402 3300003374 JGI25161J50226_1005403 JGI25161J50226_10054032 200
403 3300003578 Ga0006562J51391_1111416 Ga0006562J51391_11114162 200
404 3300003752 Ga0055539_1000633 Ga0055539_10006335 200
405 3300003761 Ga0055535_1000047 Ga0055535_1000047101 200
406 3300003761 Ga0055535_1000226 Ga0055535_100022614 200
407 3300003762 Ga0055542_1000029 Ga0055542_100002915 200
408 3300003763 Ga0055529_1000148 Ga0055529_1000148112 200
409 3300003763 Ga0055529_1000193 Ga0055529_100019356 200
410 3300003771 Ga0055526_1000155 Ga0055526_10001554 200
411 3300003773 Ga0055537_1000006 Ga0055537_100000675 200
412 3300003773 Ga0055537_1004166 Ga0055537_10041664 200
413 3300003775 Ga0055524_1000032 Ga0055524_100003269 200
414 3300003775 Ga0055524_1022006 Ga0055524_10220063 200
415 3300003784 Ga0055534_1000048 Ga0055534_100004833 200
416 3300003784 Ga0055534_1004512 Ga0055534_10045124 200
417 3300003790 Ga0055528_1002482 Ga0055528_10024829 200
418 3300003790 Ga0055528_1009873 Ga0055528_10098734 200
419 3300003792 Ga0055540_1000017 Ga0055540_1000017159 200
420 3300003792 Ga0055540_1004431 Ga0055540_10044314 200
421 3300003794 Ga0055531_10014250 Ga0055531_100142502 200
422 3300005289 Ga0065704_10070262 Ga0065704_1007026220 200
423 3300005289 Ga0065704_10079067 Ga0065704_100790672 200
424 3300005327 Ga0070658_10000077 Ga0070658_1000007759 200
425 3300005334 Ga0068869_100132954 Ga0068869_1001329543 200
426 3300005334 Ga0068869_100622083 Ga0068869_1006220831 200
427 3300005338 Ga0068868_100039651 Ga0068868_1000396514 200
428 3300005339 Ga0070660_100037108 Ga0070660_1000371083 200
429 3300005339 Ga0070660_100106669 Ga0070660_1001066693 200
430 3300005344 Ga0070661_100003307 Ga0070661_1000033076 200
431 3300005344 Ga0070661_100015010 Ga0070661_1000150103 200
432 3300005347 Ga0070668_100690797 Ga0070668_1006907972 200
433 3300005356 Ga0070674_100000060 Ga0070674_10000006017 200
434 3300005356 Ga0070674_100639338 Ga0070674_1006393381 200
435 3300005366 Ga0070659_100008609 Ga0070659_1000086097 200
436 3300005367 Ga0070667_100043541 Ga0070667_1000435411 200
437 3300005367 Ga0070667_100606549 Ga0070667_1006065491 200
438 3300005455 Ga0070663_100075341 Ga0070663_1000753411 200
439 3300005455 Ga0070663_100194237 Ga0070663_1001942372 200
440 3300005456 Ga0070678_100000003 Ga0070678_10000000336 200
441 3300005457 Ga0070662_100001084 Ga0070662_10000108410 200
442 3300005459 Ga0068867_100003492 Ga0068867_1000034924 200
443 3300005459 Ga0068867_100101879 Ga0068867_1001018792 200
444 3300005535 Ga0070684_100102139 Ga0070684_1001021393 200
445 3300005539 Ga0068853_100000190 Ga0068853_10000019034 200
446 3300005539 Ga0068853_100001662 Ga0068853_1000016624 200
447 3300005548 Ga0070665_100028521 Ga0070665_1000285214 200
448 3300005548 Ga0070665_101190170 Ga0070665_1011901701 200
449 3300005563 Ga0068855_100000165 Ga0068855_10000016526 200
450 3300005563 Ga0068855_100001098 Ga0068855_10000109811 200
451 3300005563 Ga0068855_100019234 Ga0068855_1000192342 200
452 3300005563 Ga0068855_100217025 Ga0068855_1002170251 200
453 3300005563 Ga0068855_100326043 Ga0068855_1003260432 200
454 3300005577 Ga0068857_100003317 Ga0068857_10000331712 200
455 3300005577 Ga0068857_100022481 Ga0068857_1000224814 200
456 3300005578 Ga0068854_100000825 Ga0068854_10000082510 200
457 3300005578 Ga0068854_100001946 Ga0068854_1000019463 200
458 3300005578 Ga0068854_100017205 Ga0068854_1000172055 200
459 3300005578 Ga0068854_100230355 Ga0068854_1002303552 200
460 3300005614 Ga0068856_100059133 Ga0068856_1000591333 200
461 3300005614 Ga0068856_100203917 Ga0068856_1002039172 200
462 3300005616 Ga0068852_100025666 Ga0068852_1000256664 200
463 3300005616 Ga0068852_100035998 Ga0068852_1000359982 200
464 3300005616 Ga0068852_100099713 Ga0068852_1000997133 200
465 3300005718 Ga0068866_10042310 Ga0068866_100423103 200
466 3300005834 Ga0068851_10032270 Ga0068851_100322701 200
467 3300005834 Ga0068851_10103937 Ga0068851_101039372 200
468 3300005841 Ga0068863_100069346 Ga0068863_1000693463 200
469 3300005841 Ga0068863_100092404 Ga0068863_1000924042 200
470 3300005842 Ga0068858_100000499 Ga0068858_10000049924 200
471 3300005843 Ga0068860_100355748 Ga0068860_1003557482 200
472 3300005844 Ga0068862_100044842 Ga0068862_1000448424 200
473 3300005844 Ga0068862_100644826 Ga0068862_1006448262 200
474 3300006178 Ga0075367_10011661 Ga0075367_100116613 200
475 3300006178 Ga0075367_10270254 Ga0075367_102702542 200
476 3300006195 Ga0075366_10013720 Ga0075366_100137205 200
477 3300006195 Ga0075366_10029661 Ga0075366_100296614 200
478 3300006195 Ga0075366_10051545 Ga0075366_100515453 200
479 3300006195 Ga0075366_10072974 Ga0075366_100729743 200
480 3300006237 Ga0097621_100082758 Ga0097621_1000827583 200
481 3300006237 Ga0097621_100920695 Ga0097621_1009206952 200
482 3300006353 Ga0075370_10001309 Ga0075370_100013093 200
483 3300006353 Ga0075370_10018754 Ga0075370_100187543 200
484 3300006353 Ga0075370_10036810 Ga0075370_100368103 200
485 3300006353 Ga0075370_10038221 Ga0075370_100382213 200
486 3300006358 Ga0068871_100163544 Ga0068871_1001635442 200
487 3300006881 Ga0068865_100031360 Ga0068865_1000313603 200
488 3300006881 Ga0068865_100433383 Ga0068865_1004333832 200
489 3300006946 Ga0079104_1000041 Ga0079104_10000417 200
490 3300006948 Ga0099826_10053259 Ga0099826_100532594 200
491 3300009036 Ga0105244_10000415 Ga0105244_1000041529 200
492 3300009093 Ga0105240_10005543 Ga0105240_1000554310 200
493 3300009093 Ga0105240_10009588 Ga0105240_100095888 200
494 3300009093 Ga0105240_10011024 Ga0105240_100110248 200
495 3300009093 Ga0105240_10024317 Ga0105240_100243178 200
496 3300009093 Ga0105240_10244520 Ga0105240_102445203 200
497 3300009098 Ga0105245_10001114 Ga0105245_100011149 200
498 3300009098 Ga0105245_10135154 Ga0105245_101351543 200
499 3300009147 Ga0114129_10367429 Ga0114129_103674293 200
500 3300009148 Ga0105243_10000108 Ga0105243_1000010834 200
501 3300009148 Ga0105243_10005675 Ga0105243_100056757 200
502 3300009148 Ga0105243_10028515 Ga0105243_100285154 200
503 3300009148 Ga0105243_10075072 Ga0105243_100750722 200
504 3300009148 Ga0105243_10121620 Ga0105243_101216202 200
505 3300009176 Ga0105242_10012190 Ga0105242_100121905 200
506 3300009176 Ga0105242_10026800 Ga0105242_100268002 200
507 3300009176 Ga0105242_10049693 Ga0105242_100496934 200
508 3300009176 Ga0105242_10922725 Ga0105242_109227252 200
509 3300009545 Ga0105237_10003349 Ga0105237_1000334916 200
510 3300009545 Ga0105237_10003698 Ga0105237_1000369815 200
511 3300009545 Ga0105237_10006276 Ga0105237_100062767 200
512 3300009545 Ga0105237_10013720 Ga0105237_100137206 200
513 3300009545 Ga0105237_10038601 Ga0105237_100386013 200
514 3300009551 Ga0105238_10001684 Ga0105238_1000168416 200
515 3300009551 Ga0105238_10001771 Ga0105238_1000177112 200
516 3300009551 Ga0105238_10074294 Ga0105238_100742944 200
517 3300009551 Ga0105238_10169595 Ga0105238_101695952 200
518 3300010375 Ga0105239_10000196 Ga0105239_1000019664 200
519 3300010375 Ga0105239_10000889 Ga0105239_1000088915 200
520 3300010375 Ga0105239_10007229 Ga0105239_100072292 200
521 3300010375 Ga0105239_10011115 Ga0105239_100111155 200
522 3300011119 Ga0105246_10001891 Ga0105246_100018913 200
523 3300011119 Ga0105246_10300421 Ga0105246_103004212 200
524 3300013100 Ga0157373_10000372 Ga0157373_1000037233 200
525 3300013100 Ga0157373_10001218 Ga0157373_100012185 200
526 3300013100 Ga0157373_10004249 Ga0157373_100042496 200
527 3300013104 Ga0157370_10001791 Ga0157370_1000179115 200
528 3300013104 Ga0157370_10007379 Ga0157370_1000737911 200
529 3300013104 Ga0157370_10009890 Ga0157370_100098905 200
530 3300013104 Ga0157370_10180732 Ga0157370_101807323 200
531 3300013105 Ga0157369_10000249 Ga0157369_1000024932 200
532 3300013105 Ga0157369_10006228 Ga0157369_100062286 200
533 3300013105 Ga0157369_10044116 Ga0157369_100441165 200
534 3300013105 Ga0157369_10186290 Ga0157369_101862903 200
535 3300013297 Ga0157378_10066370 Ga0157378_100663702 200
536 3300013307 Ga0157372_10115251 Ga0157372_101152513 200
537 3300013308 Ga0157375_10905941 Ga0157375_109059411 200
538 3300014497 Ga0182008_10000038 Ga0182008_1000003833 200
539 3300014497 Ga0182008_10002221 Ga0182008_100022216 200
540 3300014745 Ga0157377_10161762 Ga0157377_101617622 200
541 3300015261 Ga0182006_1006063 Ga0182006_10060636 200
542 3300015261 Ga0182006_1028073 Ga0182006_10280733 200
543 3300015262 Ga0182007_10027916 Ga0182007_100279162 200
544 3300025228 Ga0209672_101158 Ga0209672_1011589 200
545 3300025229 Ga0209147_100338 Ga0209147_10033820 200
546 3300025242 Ga0209258_100018 Ga0209258_100018189 200
547 3300025242 Ga0209258_100072 Ga0209258_100072170 200
548 3300025246 Ga0209646_1000127 Ga0209646_100012755 200
549 3300025250 Ga0209026_1000004 Ga0209026_1000004797 200
550 3300025253 Ga0209677_100085 Ga0209677_10008526 200
551 3300025254 Ga0209148_1000030 Ga0209148_1000030189 200
552 3300025254 Ga0209148_1002344 Ga0209148_10023442 200
553 3300025256 Ga0209759_1000129 Ga0209759_100012979 200
554 3300025258 Ga0209129_1000187 Ga0209129_10001876 200
555 3300025258 Ga0209129_1004805 Ga0209129_10048054 200
556 3300025263 Ga0209565_1000016 Ga0209565_1000016210 200
557 3300025263 Ga0209565_1001570 Ga0209565_10015705 200
558 3300025272 Ga0209455_1000053 Ga0209455_1000053250 200
559 3300025273 Ga0209673_1000073 Ga0209673_100007369 200
560 3300025273 Ga0209673_1006176 Ga0209673_10061764 200
561 3300025284 Ga0209130_1001957 Ga0209130_10019576 200
562 3300025291 Ga0209675_1000080 Ga0209675_1000080120 200
563 3300025291 Ga0209675_1014231 Ga0209675_10142312 200
564 3300025292 Ga0209676_1001486 Ga0209676_100148615 200
565 3300025292 Ga0209676_1020343 Ga0209676_10203433 200
566 3300025292 Ga0209676_1020766 Ga0209676_10207661 200
567 3300025294 Ga0209025_1000334 Ga0209025_100033466 200
568 3300025294 Ga0209025_1001126 Ga0209025_10011267 200
569 3300025294 Ga0209025_1019337 Ga0209025_10193373 200
570 3300025295 Ga0209564_1000040 Ga0209564_100004084 200
571 3300025295 Ga0209564_1000165 Ga0209564_100016598 200
572 3300025295 Ga0209564_1000322 Ga0209564_100032259 200
573 3300025295 Ga0209564_1000621 Ga0209564_100062132 200
574 3300025298 Ga0209050_1000037 Ga0209050_100003743 200
575 3300025298 Ga0209050_1047351 Ga0209050_10473512 200
576 3300025299 Ga0209256_1000023 Ga0209256_1000023354 200
577 3300025299 Ga0209256_1000110 Ga0209256_100011069 200
578 3300025299 Ga0209256_1005577 Ga0209256_10055772 200
579 3300025302 Ga0207426_1000029 Ga0207426_1000029412 200
580 3300025302 Ga0207426_1000068 Ga0207426_1000068194 200
581 3300025303 Ga0209051_1000040 Ga0209051_100004044 200
582 3300025303 Ga0209051_1008387 Ga0209051_10083873 200
583 3300025304 Ga0209257_1000566 Ga0209257_100056643 200
584 3300025304 Ga0209257_1010347 Ga0209257_10103475 200
585 3300025304 Ga0209257_1011936 Ga0209257_10119364 200
586 3300025321 Ga0207656_10036310 Ga0207656_100363103 200
587 3300025728 Ga0207655_1002845 Ga0207655_10028453 200
588 3300025908 Ga0207643_10045871 Ga0207643_100458713 200
589 3300025909 Ga0207705_10000182 Ga0207705_1000018229 200
590 3300025913 Ga0207695_10000383 Ga0207695_1000038320 200
591 3300025913 Ga0207695_10002264 Ga0207695_1000226419 200
592 3300025913 Ga0207695_10016391 Ga0207695_100163912 200
593 3300025913 Ga0207695_10100048 Ga0207695_101000483 200
594 3300025914 Ga0207671_10008765 Ga0207671_100087656 200
595 3300025914 Ga0207671_10015423 Ga0207671_100154234 200
596 3300025914 Ga0207671_10017160 Ga0207671_100171603 200
597 3300025914 Ga0207671_10035953 Ga0207671_100359532 200
598 3300025919 Ga0207657_10127400 Ga0207657_101274002 200
599 3300025919 Ga0207657_10159380 Ga0207657_101593802 200
600 3300025920 Ga0207649_10020941 Ga0207649_100209414 200
601 3300025920 Ga0207649_10042283 Ga0207649_100422833 200
602 3300025924 Ga0207694_10000111 Ga0207694_1000011152 200
603 3300025924 Ga0207694_10004423 Ga0207694_100044232 200
604 3300025924 Ga0207694_10230511 Ga0207694_102305112 200
605 3300025927 Ga0207687_10001973 Ga0207687_100019737 200
606 3300025927 Ga0207687_10074418 Ga0207687_100744182 200
607 3300025933 Ga0207706_10001006 Ga0207706_1000100612 200
608 3300025933 Ga0207706_10138538 Ga0207706_101385383 200
609 3300025934 Ga0207686_10026138 Ga0207686_100261384 200
610 3300025935 Ga0207709_10000148 Ga0207709_1000014857 200
611 3300025935 Ga0207709_10031723 Ga0207709_100317233 200
612 3300025935 Ga0207709_10129194 Ga0207709_101291943 200
613 3300025937 Ga0207669_10000015 Ga0207669_1000001583 200
614 3300025938 Ga0207704_10020193 Ga0207704_100201933 200
615 3300025949 Ga0207667_10000102 Ga0207667_1000010229 200
616 3300025949 Ga0207667_10000220 Ga0207667_1000022046 200
617 3300025949 Ga0207667_10019128 Ga0207667_100191282 200
618 3300025981 Ga0207640_10008788 Ga0207640_100087883 200
619 3300025981 Ga0207640_10047382 Ga0207640_100473824 200
620 3300025981 Ga0207640_10056396 Ga0207640_100563963 200
621 3300025986 Ga0207658_10017918 Ga0207658_100179185 200
622 3300025986 Ga0207658_10429756 Ga0207658_104297562 200
623 3300026023 Ga0207677_10026051 Ga0207677_100260514 200
624 3300026023 Ga0207677_11056513 Ga0207677_110565132 200
625 3300026035 Ga0207703_10000439 Ga0207703_100004396 200
626 3300026041 Ga0207639_10000359 Ga0207639_1000035920 200
627 3300026041 Ga0207639_10000764 Ga0207639_100007643 200
628 3300026041 Ga0207639_10003787 Ga0207639_100037875 200
629 3300026067 Ga0207678_10003441 Ga0207678_100034415 200
630 3300026067 Ga0207678_10019573 Ga0207678_100195732 200
631 3300026078 Ga0207702_10063314 Ga0207702_100633143 200
632 3300026078 Ga0207702_10073157 Ga0207702_100731573 200
633 3300026078 Ga0207702_10734758 Ga0207702_107347581 200
634 3300026078 Ga0207702_10907373 Ga0207702_109073731 200
635 3300026088 Ga0207641_10060086 Ga0207641_100600863 200
636 3300026089 Ga0207648_10006895 Ga0207648_100068959 200
637 3300026089 Ga0207648_10021743 Ga0207648_100217432 200
638 3300026116 Ga0207674_10000167 Ga0207674_1000016725 200
639 3300026116 Ga0207674_10002320 Ga0207674_1000232013 200
640 3300026116 Ga0207674_10006048 Ga0207674_1000604810 200
641 3300026118 Ga0207675_100142534 Ga0207675_1001425343 200
642 3300026121 Ga0207683_10000046 Ga0207683_1000004647 200
643 3300026142 Ga0207698_10006657 Ga0207698_100066574 200
644 3300026142 Ga0207698_10027208 Ga0207698_100272083 200
645 3300026142 Ga0207698_10062466 Ga0207698_100624662 200
646 3300027111 Ga0209281_1000073 Ga0209281_10000738 200
647 3300028379 Ga0268266_10009507 Ga0268266_100095078 200
648 3300028380 Ga0268265_10502098 Ga0268265_105020981 200
649 3300028380 Ga0268265_11321637 Ga0268265_113216371 200
650 3300031548 Ga0307408_100000852 Ga0307408_10000085219 200
651 3300031548 Ga0307408_100059403 Ga0307408_1000594032 200
652 3300031548 Ga0307408_100099438 Ga0307408_1000994382 200
653 3300031730 Ga0307516_10003223 Ga0307516_1000322314 200
654 3300031731 Ga0307405_10044034 Ga0307405_100440344 200
655 3300031731 Ga0307405_10270226 Ga0307405_102702262 200
656 3300031731 Ga0307405_10474787 Ga0307405_104747872 200
657 3300031911 Ga0307412_10017311 Ga0307412_100173113 200
658 3300031911 Ga0307412_10019933 Ga0307412_100199332 200
659 3300031911 Ga0307412_10038964 Ga0307412_100389644 200
660 3300032004 Ga0307414_10015372 Ga0307414_100153725 200
661 3300032004 Ga0307414_10201425 Ga0307414_102014252 200
662 3300032005 Ga0307411_10499793 Ga0307411_104997932 200
663 3300035691 Ga0373931_0025728 Ga0373931_0025728_469_1074 200
664 3300037466 Ga0395898_0236465 Ga0395898_0236465_411_1016 200
665 3300037471 Ga0395905_0002432 Ga0395905_0002432_2487_3092 200
666 3300037471 Ga0395905_0058757 Ga0395905_0058757_1953_2564 200
667 3300037471 Ga0395905_0060373 Ga0395905_0060373_1504_2109 200
668 3300037471 Ga0395905_0575613 Ga0395905_0575613_356_967 200
669 3300038443 Ga0395901_0042013 Ga0395901_0042013_1152_1763 200
670 3300039447 Ga0436361_0657781 Ga0436361_0657781_388_990 200
671 3300041405 Ga0439438_002748 Ga0439438_002748_6613_7215 200
672 3300041405 Ga0439438_007343 Ga0439438_007343_1119_1721 200
673 3300041405 Ga0439438_008788 Ga0439438_008788_886_1488 200
674 3300041407 Ga0439447_039371 Ga0439447_039371_355_957 200
675 3300041411 Ga0439466_0015205 Ga0439466_0015205_596_1198 200
676 3300041451 Ga0451791_0216335 Ga0451791_0216335_133_738 200
677 3300041452 Ga0451793_0721922 Ga0451793_0721922_264_869 200
678 3300041456 Ga0451795_1284843 Ga0451795_1284843_437_1042 200
679 3300041460 Ga0451802_0724550 Ga0451802_0724550_114_719 200
680 3300041486 Ga0451807_0443440 Ga0451807_0443440_246_851 200
681 3300041494 Ga0451837_1123269 Ga0451837_1123269_51_656 200
682 3300041498 Ga0451841_1270401 Ga0451841_1270401_269_874 200
683 3300041512 Ga0451853_1610789 Ga0451853_1610789_1102_1707 200
684 3300041997 Ga0439431_0004866 Ga0439431_0004866_1569_2171 200
685 3300041997 Ga0439431_0047542 Ga0439431_0047542_78_683 200
686 3300042006 Ga0439432_018237 Ga0439432_018237_845_1447 200
687 3300042010 Ga0439452_006058 Ga0439452_006058_271_873 200
688 3300042122 Ga0450920_008871 Ga0450920_008871_1027_1632 200
689 3300042126 Ga0450888_006728 Ga0450888_006728_251_856 200
690 3300042157 Ga0439458_0080775 Ga0439458_0080775_22_630 200
691 3300042184 Ga0450908_001064 Ga0450908_001064_4455_5060 200
692 3300042435 Ga0439434_0050623 Ga0439434_0050623_218_823 200
693 3300042532 Ga0450893_0022976 Ga0450893_0022976_284_889 200
694 3300044656 Ga0466969_0004380 Ga0466969_0004380_4640_5245 200
695 3300044658 Ga0466972_0000442 Ga0466972_0000442_19798_20412 200
696 3300044658 Ga0466972_0149433 Ga0466972_0149433_406_1008 200
697 3300044683 Ga0466965_0043710 Ga0466965_0043710_887_1492 200
698 3300044683 Ga0466965_0108085 Ga0466965_0108085_750_1352 200
699 3300044683 Ga0466965_0541543 Ga0466965_0541543_31_636 200
700 3300044684 Ga0466966_0003863 Ga0466966_0003863_4557_5171 200
701 3300044684 Ga0466966_0017937 Ga0466966_0017937_1649_2254 200
702 3300044693 Ga0466961_0001590 Ga0466961_0001590_4678_5292 200
703 3300044693 Ga0466961_0084249 Ga0466961_0084249_193_798 200
704 3300044693 Ga0466961_0130733 Ga0466961_0130733_475_1080 200
705 3300044706 Ga0466964_0001270 Ga0466964_0001270_7538_8143 200
706 3300044706 Ga0466964_0047528 Ga0466964_0047528_440_1042 200
707 3300044706 Ga0466964_0138253 Ga0466964_0138253_364_969 200
708 3300044719 Ga0466971_0009149 Ga0466971_0009149_1325_1930 200
709 3300044735 Ga0466968_0008834 Ga0466968_0008834_279_881 200
710 3300044735 Ga0466968_0033469 Ga0466968_0033469_106_720 200
711 3300044735 Ga0466968_0227790 Ga0466968_0227790_42_647 200
712 3300044765 Ga0466970_0006176 Ga0466970_0006176_4159_4764 200
713 3300044765 Ga0466970_0133972 Ga0466970_0133972_609_1211 200
714 3300044842 Ga0466957_0033934 Ga0466957_0033934_2035_2637 200
715 3300044901 Ga0466960_0277395 Ga0466960_0277395_294_896 200
716 3300045049 Ga0466959_0010816 Ga0466959_0010816_2356_2961 200
717 3300045049 Ga0466959_0137959 Ga0466959_0137959_489_1094 200
718 3300045049 Ga0466959_0255324 Ga0466959_0255324_525_1127 200
719 3300045049 Ga0466959_0301098 Ga0466959_0301098_178_792 200
720 3300045049 Ga0466959_0636399 Ga0466959_0636399_50_652 200
721 3300045976 Ga0466967_0013873 Ga0466967_0013873_3941_4546 200
722 3300046460 Ga0495638_0000102 Ga0495638_0000102_66684_67289 200
723 3300046475 Ga0495639_0019750 Ga0495639_0019750_1938_2543 200
724 3300046524 Ga0495648_0000001 Ga0495648_0000001_420112_420717 200
725 3300046528 Ga0495642_0000399 Ga0495642_0000399_16448_17053 200
726 3300046538 Ga0495609_0001495 Ga0495609_0001495_6077_6682 200
727 3300046557 Ga0495622_0000072 Ga0495622_0000072_6146_6751 200
728 3300048919 Ga0496116_0004783 Ga0496116_0004783_1389_1994 200
729 3300048921 Ga0496118_0067454 Ga0496118_0067454_371_976 200
730 3300048924 Ga0496121_0034746 Ga0496121_0034746_3808_4413 200
731 3300048925 Ga0496122_0048540 Ga0496122_0048540_1146_1748 200
732 3300048925 Ga0496122_0063347 Ga0496122_0063347_603_1208 200
733 3300048926 Ga0496123_0012006 Ga0496123_0012006_1526_2131 200
734 3300048927 Ga0496124_0001113 Ga0496124_0001113_10109_10714 200
735 3300048927 Ga0496124_0187621 Ga0496124_0187621_299_901 200
736 3300048928 Ga0496125_0004247 Ga0496125_0004247_5407_6024 200
737 3300048928 Ga0496125_0004671 Ga0496125_0004671_11492_12097 200
738 3300049160 Ga0501304_021897 Ga0501304_021897_20_625 200
739 3300049459 Ga0495678_000432 Ga0495678_000432_32919_33524 200
740 3300049581 Ga0501047_0439997 Ga0501047_0439997_327_929 200
741 3300049589 Ga0501073_0462092 Ga0501073_0462092_233_838 200
742 3300050493 nmdc:mga0k408_107214_c1 nmdc:mga0k408_107214_c1_1005_1610 200
743 3300050493 nmdc:mga0k408_1744_c1 nmdc:mga0k408_1744_c1_3090_3695 200
744 3300050493 nmdc:mga0k408_4189_c1 nmdc:mga0k408_4189_c1_886_1491 200
745 3300050493 nmdc:mga0k408_86216_c1 nmdc:mga0k408_86216_c1_996_1601 200
746 3300050494 nmdc:mga06z11_313705_c1 nmdc:mga06z11_313705_c1_294_899 200
747 3300050496 nmdc:mga07m45_136893_c1 nmdc:mga07m45_136893_c1_597_1202 200
748 3300050496 nmdc:mga07m45_2113_c1 nmdc:mga07m45_2113_c1_118_723 200
749 3300050496 nmdc:mga07m45_461_c1 nmdc:mga07m45_461_c1_6741_7346 200
750 3300053153 Ga0500616_0117831 Ga0500616_0117831_571_1176 200
751 3300053178 Ga0500637_0424997 Ga0500637_0424997_42_653 200
752 3300059477 Ga0587084_004573 Ga0587084_004573_10_618 200
753 3300059491 Ga0587070_008565 Ga0587070_008565_828_1436 200
754 3300059493 Ga0587077_006126 Ga0587077_006126_994_1602 200
755 3300059503 Ga0587080_007804 Ga0587080_007804_877_1485 200
756 3300059511 Ga0587091_021604 Ga0587091_021604_199_807 200
757 3300059645 Ga0587076_025304 Ga0587076_025304_10_618 200
758 3300059647 Ga0587079_005665 Ga0587079_005665_103_711 200
759 3300060344 Ga0587071_031649 Ga0587071_031649_393_1001 200
760 3300061719 Ga0466962_0012679 Ga0466962_0012679_921_1526 200

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06684

AA_synth

Amino acid synthesis

13

189

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3byq-assembly1.cif.gz_B crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution 0.903 9 200
2qtp-assembly1.cif.gz_A crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution 0.8927 10 176
3byq-assembly1.cif.gz_B crystal structure of a duf1185 family protein (bb2672) from bordetella bronchiseptica rb50 at 1.70 a resolution 0.8854 9 200
2qtp-assembly1.cif.gz_A crystal structure of a duf1185 family protein (spo0826) from silicibacter pomeroyi dss-3 at 2.10 a resolution 0.8755 10 176
5ixm-assembly1.cif.gz_B the lps transporter lptde from yersinia pestis, core complex 0.6818 9 45
ID Description Score Start End Superfamily
2qtpA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.8868 10 176 3.30.1330.110
3byqA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.8845 8 200 3.30.1330.110
3byqA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.8756 8 200 3.30.1330.110
2qtpA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;BB2672 0.8693 10 176 3.30.1330.110
2r76B00 Alpha Beta;2-Layer Sandwich;Double Stranded RNA Binding Domain;Lipoprotein like domain 0.6644 9 45 3.30.160.150
ID Description Score Start End GO Terms
AF-A0A529LYE5-F1-model_v4 Amino acid synthesis family protein 0.9611 8 112
AF-A0A7X1EA00-F1-model_v4 Amino acid synthesis family protein 0.9573 9 176
AF-A0A1T4TMX2-F1-model_v4 Amino acid synthesis 0.9564 1 189
AF-J3EFK7-F1-model_v4 Amino acid synthesis protein 0.9514 1 200
AF-A0A291AIN8-F1-model_v4 Amino acid synthesis family protein 0.9491 1 200

Feature Viewer

pLDDT pTM Quality
87.35 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map