F479504

General Info

Members Datasets Scaffolds Average Seq Length
759 419 1518 265

Family's Representative Sequence

Representative Sequence 3300053116|Ga0500592_000002|Ga0500592_000002_117140_118042
Length 300
Sequence MVKDFETLLVERPDSNIVRIRLNRPDTANSQDVKMIYELNDALMGAARNPEIKVIILGGVGKHFSAGHDLKSDYLDEVGRDYPLTSSWDGPGQPTIESWYAWEREVYLDMCKRWRSIAKPVIAEVQGACIAGGLMLAWVCDIIICSEDAFFQDPVVDLNIAGVEYFAHVWEIGSRKAKEILFTADRWTAADALDWGMVNRVVPRDTLPDEVLTLARKIASKPSFGLKLTKQLVNDSLDAQGFDQCLNHAFALHHLGHAHNRLIYGTLLDPAGVPKAVRNSLPGGKIPELETLRISQHELD

Samples

Sample ID Description Type Environment
1 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
10 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
103 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
104 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
105 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
106 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
111 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
112 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
115 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
165 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
166 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
167 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
168 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
169 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
172 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
173 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
174 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
175 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
176 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
177 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
178 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
179 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
180 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
181 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
182 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
183 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
184 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
185 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
186 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
187 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
188 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
189 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
190 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
191 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
192 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
193 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
194 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
195 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
196 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
199 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
200 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
201 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
202 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
203 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
204 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
205 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
206 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
207 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
208 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
210 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
214 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
215 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
216 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
217 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
218 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
221 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
222 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
223 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
224 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
225 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
226 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
227 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
228 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
229 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
230 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
231 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
237 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
238 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
239 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
240 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
241 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
242 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
256 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
257 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
260 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
261 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
262 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
263 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
264 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
265 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
266 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
267 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
268 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
273 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
274 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
275 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
276 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
277 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
278 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
279 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
280 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
281 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
282 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
283 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
284 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
285 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
286 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
287 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
290 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
291 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
292 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
293 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
302 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
303 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
309 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
310 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
311 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
312 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
313 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
314 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
315 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
316 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
319 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
320 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
321 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
322 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
323 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
324 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
325 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
326 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
339 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
340 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
341 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
342 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
343 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
344 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
345 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
346 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
347 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
348 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
349 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
350 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
352 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
353 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
354 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
355 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
356 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
357 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
358 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
359 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
360 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
361 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
362 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
363 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
364 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
365 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
366 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
367 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
368 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
369 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
370 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
371 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
372 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
373 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
374 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
375 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
376 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
377 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
378 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
379 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
380 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
381 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
382 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
383 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
384 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
385 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
386 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
387 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
388 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
389 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
390 2508501039 Frankia saprophytica CN3 Isolate Nodule
391 2517572101 Frankia sp. DC12 Isolate Nodule
392 2523231044 Gordonia rhizosphera NBRC 16068 Isolate Rhizosphere
393 2547132424 Nocardia nova SH22a Isolate Unclassified
394 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
395 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
396 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
397 2643221692 Nocardia sp. Root136 Isolate Unclassified
398 2671180195 Frankia sp. CcI49 Isolate Nodule
399 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
400 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
401 2687453737 Frankia sp. BMG5.36 Isolate Nodule
402 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
403 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
404 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
405 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
406 2773857922 Frankia sp. CcI49 Isolate Nodule
407 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
408 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
409 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
410 2895880812 Frankia sp. BMG5.11 Isolate Unclassified
411 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
412 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
413 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
414 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
415 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
416 3002998708 Actinomadura barringtoniae GKU 128 Isolate Unclassified
417 8002775197 Frankia nepalensis CN7 Isolate Nodule
418 8002784119 Frankia sp. AgB1.9 Isolate Nodule
419 8055157932 Frankia umida Ag45/Mut15 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.2
Metatranscriptomes 0.66
Isolates 5.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.35
Nodule 2.64
Rhizoplane 6.59
Rhizosphere 76.15
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500592_000002 3300053116 Bacteria 141670
2 JGI24746J21847_1010997 3300001977 Bacteria 1334
3 JGI24735J21928_10021367 3300002067 Bacteria 1977
4 JGI24738J21930_10005689 3300002075 Bacteria 2967
5 JGI24744J21845_10000071 3300002077 Bacteria 12597
6 JGI24744J21845_10006035 3300002077 Bacteria 2512
7 JGI24034J26672_10010902 3300002239 Bacteria 1356
8 JGI24742J22300_10003264 3300002244 Bacteria 2626
9 JGI24751J29686_10003252 3300002459 Bacteria 3270
10 JGI25407J50210_10000383 3300003373 Bacteria 8485
11 JGI25407J50210_10009099 3300003373 Bacteria 2510
12 Ga0058861_10074083 3300004800 Bacteria 1612
13 Ga0058862_10117455 3300004803 Bacteria 1692
14 Ga0070683_100047848 3300005329 Bacteria 3953
15 Ga0070683_100139557 3300005329 Bacteria 2296
16 Ga0070683_100680245 3300005329 Bacteria 985
17 Ga0070690_100013128 3300005330 Bacteria 4890
18 Ga0068869_100032177 3300005334 Bacteria 3694
19 Ga0068869_100125436 3300005334 Bacteria 1968
20 Ga0068869_100128334 3300005334 Bacteria 1947
21 Ga0070666_10158155 3300005335 Bacteria 1583
22 Ga0070680_100003872 3300005336 Bacteria 11189
23 Ga0070682_100010377 3300005337 Bacteria 5285
24 Ga0070682_100027139 3300005337 Bacteria 3434
25 Ga0070682_100051976 3300005337 Bacteria 2563
26 Ga0068868_100003577 3300005338 Bacteria 10826
27 Ga0070660_100061988 3300005339 Bacteria 2904
28 Ga0070689_100039648 3300005340 Bacteria 3608
29 Ga0070691_10001071 3300005341 Bacteria 11322
30 Ga0070661_100396642 3300005344 Bacteria 1090
31 Ga0070668_100007964 3300005347 Bacteria 7869
32 Ga0070669_100060326 3300005353 Bacteria 2786
33 Ga0070671_100196820 3300005355 Bacteria 1708
34 Ga0070674_100005277 3300005356 Bacteria 7441
35 Ga0070674_100038692 3300005356 Bacteria 3216
36 Ga0070673_100305093 3300005364 Bacteria 1403
37 Ga0070688_100007788 3300005365 Bacteria 5786
38 Ga0070667_100008515 3300005367 Bacteria 8501
39 Ga0070667_100011261 3300005367 Bacteria 7397
40 Ga0070667_100165465 3300005367 Bacteria 1950
41 Ga0070709_10174850 3300005434 Bacteria 1503
42 Ga0070714_100237017 3300005435 Bacteria 1683
43 Ga0070713_100149135 3300005436 Bacteria 2078
44 Ga0070713_100543092 3300005436 Bacteria 1100
45 Ga0070710_10002526 3300005437 Bacteria 8686
46 Ga0070701_10000967 3300005438 Bacteria 10385
47 Ga0070711_100000900 3300005439 Bacteria 15665
48 Ga0070705_100038817 3300005440 Bacteria 2698
49 Ga0070700_100004993 3300005441 Bacteria 6989
50 Ga0070700_100499323 3300005441 Bacteria 935
51 Ga0070708_100027627 3300005445 Bacteria 4871
52 Ga0070663_100003355 3300005455 Bacteria 9239
53 Ga0070663_100039518 3300005455 Bacteria 3297
54 Ga0070663_100115538 3300005455 Bacteria 2022
55 Ga0070678_100002109 3300005456 Bacteria 10783
56 Ga0070662_100001655 3300005457 Bacteria 13702
57 Ga0070662_100125760 3300005457 Bacteria 1970
58 Ga0070681_10000022 3300005458 Bacteria 116402
59 Ga0068867_100003589 3300005459 Bacteria 10913
60 Ga0070685_10023682 3300005466 Bacteria 3365
61 Ga0070706_100028335 3300005467 Bacteria 5157
62 Ga0070707_100044278 3300005468 Bacteria 4260
63 Ga0070698_100080307 3300005471 Bacteria 3256
64 Ga0070698_100223255 3300005471 Bacteria 1817
65 Ga0070698_100403880 3300005471 Bacteria 1300
66 Ga0070699_100074130 3300005518 Bacteria 2961
67 Ga0070679_100000004 3300005530 Bacteria 263662
68 Ga0070697_100084970 3300005536 Bacteria 2611
69 Ga0070697_100473039 3300005536 Bacteria 1094
70 Ga0068853_100012826 3300005539 Bacteria 6827
71 Ga0068853_100151723 3300005539 Bacteria 2086
72 Ga0070672_100063635 3300005543 Bacteria 2913
73 Ga0070695_100008636 3300005545 Bacteria 6052
74 Ga0070696_100001174 3300005546 Bacteria 16955
75 Ga0070696_100129663 3300005546 Bacteria 1834
76 Ga0070693_100015200 3300005547 Bacteria 3960
77 Ga0070665_100064170 3300005548 Bacteria 3682
78 Ga0070704_100007849 3300005549 Bacteria 6367
79 Ga0068855_100158431 3300005563 Bacteria 2571
80 Ga0068855_100347685 3300005563 Bacteria 1634
81 Ga0068854_100002576 3300005578 Bacteria 11232
82 Ga0068854_100185291 3300005578 Bacteria 1628
83 Ga0068854_100401081 3300005578 Bacteria 1135
84 Ga0070702_100013622 3300005615 Bacteria 4110
85 Ga0068852_100026336 3300005616 Bacteria 4725
86 Ga0068852_100119184 3300005616 Bacteria 2413
87 Ga0068852_100230284 3300005616 Bacteria 1766
88 Ga0068859_100019140 3300005617 Bacteria 6876
89 Ga0068864_100337291 3300005618 Bacteria 1420
90 Ga0068864_100373882 3300005618 Bacteria 1349
91 Ga0068866_10001342 3300005718 Bacteria 10634
92 Ga0068861_100009501 3300005719 Bacteria 6718
93 Ga0068861_100068502 3300005719 Bacteria 2742
94 Ga0068863_100006126 3300005841 Bacteria 11794
95 Ga0068863_100130991 3300005841 Bacteria 2395
96 Ga0068858_100000440 3300005842 Bacteria 43437
97 Ga0068858_100292310 3300005842 Bacteria 1553
98 Ga0068860_100007225 3300005843 Bacteria 11106
99 Ga0068862_100012046 3300005844 Bacteria 7146
100 Ga0068862_100090656 3300005844 Bacteria 2661
101 Ga0081455_10002376 3300005937 Bacteria 22485
102 Ga0081455_10006223 3300005937 Bacteria 12859
103 Ga0081455_10033215 3300005937 Bacteria 4639
104 Ga0081455_10062089 3300005937 Bacteria 3142
105 Ga0081455_10203252 3300005937 Bacteria 1482
106 Ga0081538_10000105 3300005981 Bacteria 83102
107 Ga0081538_10010738 3300005981 Bacteria 7490
108 Ga0081538_10018212 3300005981 Bacteria 5288
109 Ga0081538_10107356 3300005981 Bacteria 1383
110 Ga0070717_10034043 3300006028 Bacteria 4115
111 Ga0075365_10005497 3300006038 Bacteria 6840
112 Ga0075365_10030045 3300006038 Bacteria 3477
113 Ga0075365_10048915 3300006038 Bacteria 2784
114 Ga0075365_10069628 3300006038 Bacteria 2365
115 Ga0075365_10082713 3300006038 Bacteria 2177
116 Ga0075365_10156917 3300006038 Bacteria 1584
117 Ga0075365_10317557 3300006038 Bacteria 1097
118 Ga0075363_100001346 3300006048 Bacteria 9226
119 Ga0075363_100008510 3300006048 Bacteria 4780
120 Ga0075363_100010154 3300006048 Bacteria 4454
121 Ga0075363_100041932 3300006048 Bacteria 2415
122 Ga0075363_100042253 3300006048 Bacteria 2408
123 Ga0075363_100071811 3300006048 Bacteria 1882
124 Ga0075363_100131822 3300006048 Bacteria 1402
125 Ga0075364_10038544 3300006051 Bacteria 3096
126 Ga0075364_10041426 3300006051 Bacteria 2990
127 Ga0075364_10068960 3300006051 Bacteria 2326
128 Ga0075364_10216726 3300006051 Bacteria 1298
129 Ga0075364_10281170 3300006051 Bacteria 1132
130 Ga0075364_10348409 3300006051 Bacteria 1009
131 Ga0070715_10054191 3300006163 Bacteria 1736
132 Ga0070715_10107194 3300006163 Bacteria 1312
133 Ga0070716_100016854 3300006173 Bacteria 3778
134 Ga0070712_100050958 3300006175 Bacteria 2882
135 Ga0070712_100060626 3300006175 Bacteria 2669
136 Ga0070712_100061821 3300006175 Bacteria 2647
137 Ga0070712_100339701 3300006175 Bacteria 1226
138 Ga0075362_10007921 3300006177 Bacteria 4044
139 Ga0075362_10116404 3300006177 Bacteria 1262
140 Ga0075362_10130091 3300006177 Bacteria 1197
141 Ga0075367_10002296 3300006178 Bacteria 8677
142 Ga0075367_10012845 3300006178 Bacteria 4484
143 Ga0075367_10034751 3300006178 Bacteria 2913
144 Ga0075367_10233526 3300006178 Bacteria 1152
145 Ga0075369_10014541 3300006186 Bacteria 3146
146 Ga0075370_10059824 3300006353 Bacteria 2169
147 Ga0068871_100035296 3300006358 Bacteria 3972
148 Ga0075428_100006189 3300006844 Bacteria 13315
149 Ga0075428_100012634 3300006844 Bacteria 9389
150 Ga0075428_100014611 3300006844 Bacteria 8721
151 Ga0075428_100060337 3300006844 Bacteria 4153
152 Ga0075430_100015873 3300006846 Bacteria 6414
153 Ga0075430_100047582 3300006846 Bacteria 3622
154 Ga0075430_100317758 3300006846 Bacteria 1287
155 Ga0075431_100010280 3300006847 Bacteria 9404
156 Ga0075431_100073716 3300006847 Bacteria 3522
157 Ga0075429_100002654 3300006880 Bacteria 15048
158 Ga0075429_100170619 3300006880 Bacteria 1906
159 Ga0068865_100001386 3300006881 Bacteria 14100
160 Ga0075436_100002708 3300006914 Bacteria 12187
161 Ga0097620_100019140 3300006931 Bacteria 6876
162 Ga0075435_100005422 3300007076 Bacteria 8901
163 Ga0075435_100416379 3300007076 Bacteria 1157
164 Ga0105245_10005394 3300009098 Bacteria 11237
165 Ga0105245_10219912 3300009098 Bacteria 1832
166 Ga0105245_10427471 3300009098 Bacteria 1329
167 Ga0105247_10003226 3300009101 Bacteria 10738
168 Ga0105247_10190150 3300009101 Bacteria 1374
169 Ga0114129_10034130 3300009147 Bacteria 7186
170 Ga0114129_10037665 3300009147 Bacteria 6826
171 Ga0114129_10060958 3300009147 Bacteria 5274
172 Ga0114129_10142799 3300009147 Bacteria 3280
173 Ga0114129_10229442 3300009147 Bacteria 2501
174 Ga0114129_10536482 3300009147 Bacteria 1523
175 Ga0105242_10000923 3300009176 Bacteria 22835
176 Ga0105248_10014081 3300009177 Bacteria 8801
177 Ga0105248_10166222 3300009177 Bacteria 2487
178 Ga0105237_10044781 3300009545 Bacteria 4455
179 Ga0105249_10003832 3300009553 Bacteria 12977
180 Ga0105249_10133144 3300009553 Bacteria 2375
181 Ga0105249_10133271 3300009553 Bacteria 2374
182 Ga0105249_10198610 3300009553 Bacteria 1962
183 Ga0099796_10022111 3300010159 Bacteria 1969
184 Ga0105239_10006014 3300010375 Bacteria 14119
185 Ga0105239_10300610 3300010375 Bacteria 1807
186 Ga0105239_10306331 3300010375 Bacteria 1789
187 Ga0105246_10289754 3300011119 Bacteria 1317
188 Ga0157369_10629183 3300013105 Bacteria 1107
189 Ga0157378_10013546 3300013297 Bacteria 7133
190 Ga0163162_10005241 3300013306 Bacteria 12496
191 Ga0163162_10048240 3300013306 Bacteria 4266
192 Ga0157372_10000875 3300013307 Bacteria 32716
193 Ga0157372_10408583 3300013307 Bacteria 1582
194 Ga0157375_10006760 3300013308 Bacteria 9988
195 Ga0157375_10206496 3300013308 Bacteria 2121
196 Ga0157375_10502044 3300013308 Bacteria 1377
197 Ga0157380_10156708 3300014326 Bacteria 1974
198 Ga0157380_10192325 3300014326 Bacteria 1803
199 Ga0157377_10283887 3300014745 Bacteria 1086
200 Ga0157379_10005697 3300014968 Bacteria 10707
201 Ga0157379_10189922 3300014968 Bacteria 1856
202 Ga0163161_10049992 3300017792 Bacteria 3024
203 Ga0163161_10092192 3300017792 Bacteria 2243
204 Ga0163161_10094013 3300017792 Bacteria 2222
205 Ga0206351_10150286 3300020077 Bacteria 8100
206 Ga0154015_1016222 3300020610 Bacteria 1227
207 Ga0224712_10029263 3300022467 Bacteria 1976
208 Ga0224572_1001248 3300024225 Bacteria 3663
209 Ga0207692_10014913 3300025898 Bacteria 3407
210 Ga0207692_10031572 3300025898 Bacteria 2538
211 Ga0207642_10001690 3300025899 Bacteria 6823
212 Ga0207710_10001453 3300025900 Bacteria 11787
213 Ga0207688_10000208 3300025901 Bacteria 26121
214 Ga0207688_10005156 3300025901 Bacteria 7101
215 Ga0207647_10031879 3300025904 Bacteria 3390
216 Ga0207647_10045657 3300025904 Bacteria 2733
217 Ga0207685_10054099 3300025905 Bacteria 1562
218 Ga0207685_10257208 3300025905 Bacteria 847
219 Ga0207699_10024196 3300025906 Bacteria 3317
220 Ga0207684_10061317 3300025910 Bacteria 3194
221 Ga0207693_10004953 3300025915 Bacteria 11189
222 Ga0207693_10006753 3300025915 Bacteria 9475
223 Ga0207693_10023044 3300025915 Bacteria 4945
224 Ga0207693_10242056 3300025915 Bacteria 1416
225 Ga0207693_10365964 3300025915 Bacteria 1128
226 Ga0207663_10011590 3300025916 Bacteria 4739
227 Ga0207663_10039221 3300025916 Bacteria 2868
228 Ga0207663_10271771 3300025916 Bacteria 1256
229 Ga0207660_10001708 3300025917 Bacteria 14721
230 Ga0207657_10053372 3300025919 Bacteria 3502
231 Ga0207652_10000655 3300025921 Bacteria 34027
232 Ga0207646_10018486 3300025922 Bacteria 6498
233 Ga0207681_10028516 3300025923 Bacteria 3616
234 Ga0207659_10178956 3300025926 Bacteria 1678
235 Ga0207687_10011248 3300025927 Bacteria 5846
236 Ga0207687_10011739 3300025927 Bacteria 5731
237 Ga0207687_10022938 3300025927 Bacteria 4156
238 Ga0207700_10071151 3300025928 Bacteria 2677
239 Ga0207700_10189838 3300025928 Bacteria 1726
240 Ga0207664_10271899 3300025929 Bacteria 1485
241 Ga0207644_10033066 3300025931 Bacteria 3612
242 Ga0207644_10153206 3300025931 Bacteria 1785
243 Ga0207706_10006495 3300025933 Bacteria 10856
244 Ga0207706_10083495 3300025933 Bacteria 2809
245 Ga0207686_10003875 3300025934 Bacteria 8026
246 Ga0207709_10006493 3300025935 Bacteria 6567
247 Ga0207709_10083176 3300025935 Bacteria 2069
248 Ga0207669_10022290 3300025937 Bacteria 3361
249 Ga0207704_10006807 3300025938 Bacteria 5354
250 Ga0207665_10005046 3300025939 Bacteria 8809
251 Ga0207665_10009509 3300025939 Bacteria 6385
252 Ga0207665_10022975 3300025939 Bacteria 4105
253 Ga0207665_10315394 3300025939 Bacteria 1172
254 Ga0207691_10043881 3300025940 Bacteria 4118
255 Ga0207711_10032304 3300025941 Bacteria 4425
256 Ga0207711_10472122 3300025941 Bacteria 1168
257 Ga0207711_10500102 3300025941 Bacteria 1133
258 Ga0207689_10036253 3300025942 Bacteria 4095
259 Ga0207689_10053702 3300025942 Bacteria 3320
260 Ga0207689_10082146 3300025942 Bacteria 2649
261 Ga0207661_10071523 3300025944 Bacteria 2835
262 Ga0207661_10094623 3300025944 Bacteria 2496
263 Ga0207667_10300473 3300025949 Bacteria 1640
264 Ga0207712_10014205 3300025961 Bacteria 5115
265 Ga0207712_10381662 3300025961 Bacteria 1180
266 Ga0207668_10003736 3300025972 Bacteria 8956
267 Ga0207640_10000808 3300025981 Bacteria 17804
268 Ga0207640_10030647 3300025981 Bacteria 3314
269 Ga0207640_10406053 3300025981 Bacteria 1111
270 Ga0207658_10067011 3300025986 Bacteria 2703
271 Ga0207658_10236566 3300025986 Bacteria 1544
272 Ga0207658_10252730 3300025986 Bacteria 1498
273 Ga0207677_10090155 3300026023 Bacteria 2227
274 Ga0207703_10023031 3300026035 Bacteria 4890
275 Ga0207703_10174669 3300026035 Bacteria 1892
276 Ga0207703_10261104 3300026035 Bacteria 1565
277 Ga0207639_10026115 3300026041 Bacteria 4242
278 Ga0207639_10328994 3300026041 Bacteria 1359
279 Ga0207678_10008436 3300026067 Bacteria 9087
280 Ga0207678_10014426 3300026067 Bacteria 6948
281 Ga0207678_10055413 3300026067 Bacteria 3415
282 Ga0207708_10040064 3300026075 Bacteria 3571
283 Ga0207641_10002315 3300026088 Bacteria 17686
284 Ga0207648_10006892 3300026089 Bacteria 11256
285 Ga0207648_10107276 3300026089 Bacteria 2451
286 Ga0207676_10152159 3300026095 Bacteria 1994
287 Ga0207676_10396712 3300026095 Bacteria 1288
288 Ga0207676_10534837 3300026095 Bacteria 1118
289 Ga0207676_10584553 3300026095 Bacteria 1071
290 Ga0207675_100000917 3300026118 Bacteria 29411
291 Ga0207675_100074273 3300026118 Bacteria 3182
292 Ga0207675_100309962 3300026118 Bacteria 1539
293 Ga0207675_100757166 3300026118 Bacteria 983
294 Ga0207683_10000451 3300026121 Bacteria 38077
295 Ga0207683_10224112 3300026121 Bacteria 1713
296 Ga0207683_10287500 3300026121 Bacteria 1503
297 Ga0207698_10055085 3300026142 Bacteria 3062
298 Ga0207698_10597565 3300026142 Bacteria 1087
299 Ga0268266_10171342 3300028379 Bacteria 1970
300 Ga0268265_10028137 3300028380 Bacteria 4021
301 Ga0268265_10086778 3300028380 Bacteria 2488
302 Ga0268264_10003597 3300028381 Bacteria 13342
303 Ga0265334_10009784 3300028573 Bacteria 4054
304 Ga0307517_10079972 3300028786 Bacteria 2805
305 Ga0307515_10028158 3300028794 Bacteria 9562
306 Ga0307515_10146625 3300028794 Bacteria 2495
307 Ga0307515_10177937 3300028794 Bacteria 2090
308 Ga0265338_10000292 3300028800 Bacteria 90040
309 Ga0307511_10040555 3300030521 Bacteria 3951
310 Ga0307512_10004927 3300030522 Bacteria 14250
311 Ga0307512_10008362 3300030522 Bacteria 10097
312 Ga0307512_10074248 3300030522 Bacteria 2499
313 Ga0265325_10002665 3300031241 Bacteria 11953
314 Ga0265340_10117945 3300031247 Bacteria 1223
315 Ga0265339_10002943 3300031249 Bacteria 12037
316 Ga0265331_10019663 3300031250 Bacteria 3484
317 Ga0265327_10005757 3300031251 Bacteria 10209
318 Ga0265316_10065335 3300031344 Bacteria 2818
319 Ga0307513_10004357 3300031456 Bacteria 18910
320 Ga0307509_10013071 3300031507 Bacteria 9856
321 Ga0265313_10021235 3300031595 Bacteria 3555
322 Ga0307508_10020117 3300031616 Bacteria 6063
323 Ga0307508_10081519 3300031616 Bacteria 2816
324 Ga0307508_10114542 3300031616 Bacteria 2296
325 Ga0265314_10027067 3300031711 Bacteria 4299
326 Ga0265314_10178375 3300031711 Bacteria 1275
327 Ga0316576_10094787 3300031727 Bacteria 2226
328 Ga0307516_10011314 3300031730 Bacteria 9714
329 Ga0307516_10014621 3300031730 Bacteria 8294
330 Ga0307413_10038149 3300031824 Bacteria 2782
331 Ga0307518_10070171 3300031838 Bacteria 2538
332 Ga0307518_10174302 3300031838 Bacteria 1462
333 Ga0307407_10034470 3300031903 Bacteria 2772
334 Ga0307409_100029866 3300031995 Bacteria 3908
335 Ga0307409_100335200 3300031995 Bacteria 1421
336 Ga0307409_100524568 3300031995 Bacteria 1158
337 Ga0307416_100544823 3300032002 Bacteria 1233
338 Ga0307411_10050109 3300032005 Bacteria 2718
339 Ga0307415_100005470 3300032126 Bacteria 6749
340 Ga0307507_10000003 3300033179 Bacteria 371707
341 Ga0307507_10015504 3300033179 Bacteria 8958
342 Ga0307510_10010736 3300033180 Bacteria 10889
343 Ga0307510_10080300 3300033180 Bacteria 3172
344 Ga0316214_1008049 3300033545 Bacteria 1415
345 Ga0316212_1004398 3300033547 Bacteria 2048
346 Ga0373934_0131130 3300035086 Bacteria 1022
347 Ga0373940_0035409 3300035088 Bacteria 1351
348 Ga0373944_0003121 3300035089 Bacteria 4266
349 Ga0373923_0014576 3300035111 Bacteria 2956
350 Ga0373932_0030017 3300035112 Bacteria 1504
351 Ga0373939_0097068 3300035114 Bacteria 1005
352 Ga0373939_0105064 3300035114 Bacteria 975
353 Ga0373941_0045235 3300035115 Bacteria 1377
354 Ga0373943_0101728 3300035170 Bacteria 1504
355 Ga0373943_0140579 3300035170 Bacteria 1300
356 Ga0373943_0338359 3300035170 Bacteria 860
357 Ga0373946_0003379 3300035171 Bacteria 5661
358 Ga0373955_0004823 3300035172 Bacteria 6009
359 Ga0373955_0171667 3300035172 Bacteria 1284
360 Ga0373942_0001057 3300035207 Bacteria 7410
361 Ga0373962_0008246 3300035242 Bacteria 2561
362 Ga0316574_0014158 3300035398 Bacteria 4602
363 Ga0373931_0015036 3300035691 Bacteria 3793
364 Ga0373935_0002295 3300035692 Bacteria 10896
365 Ga0373935_0070599 3300035692 Bacteria 2252
366 Ga0373927_0001964 3300035695 Bacteria 15180
367 Ga0373927_0130321 3300035695 Bacteria 1643
368 Ga0373933_0059702 3300035724 Bacteria 2297
369 Ga0373947_0001459 3300035725 Bacteria 14536
370 Ga0373947_0009208 3300035725 Bacteria 5675
371 Ga0373937_0089831 3300036401 Bacteria 2845
372 Ga0373937_0099726 3300036401 Bacteria 2694
373 Ga0373925_0003652 3300037068 Bacteria 11858
374 Ga0395901_0412591 3300038443 Bacteria 1386
375 Ga0237819_00287 3300038705 Bacteria 18599
376 Ga0436365_0013961 3300039437 Bacteria 45475
377 Ga0436365_0303060 3300039437 Bacteria 3228
378 Ga0436360_1304279 3300039438 Bacteria 1429
379 Ga0436363_1415247 3300039450 Bacteria 1154
380 Ga0439461_0006411 3300041410 Bacteria 2048
381 Ga0439465_0005938 3300041413 Bacteria 3881
382 Ga0439465_0010360 3300041413 Bacteria 2930
383 Ga0451839_1130435 3300041496 Bacteria 828
384 Ga0451853_0686192 3300041512 Bacteria 5491
385 Ga0451853_0851822 3300041512 Bacteria 2697
386 Ga0451853_2157410 3300041512 Bacteria 2984
387 Ga0439445_0007561 3300042004 Bacteria 2524
388 Ga0439451_003594 3300042009 Bacteria 3139
389 Ga0439463_006004 3300042016 Bacteria 3017
390 Ga0450903_003117 3300042138 Bacteria 2889
391 Ga0439444_0005296 3300042437 Bacteria 1909
392 Ga0439464_0005381 3300042439 Bacteria 3309
393 Ga0439440_0008286 3300042993 Bacteria 2130
394 Ga0466972_0003050 3300044658 Bacteria 8307
395 Ga0466972_0018414 3300044658 Bacteria 3491
396 Ga0466972_0023475 3300044658 Bacteria 3067
397 Ga0466972_0194635 3300044658 Bacteria 950
398 Ga0466965_0001762 3300044683 Bacteria 8944
399 Ga0466966_0014629 3300044684 Bacteria 5194
400 Ga0466961_0024919 3300044693 Bacteria 3849
401 Ga0466964_0056826 3300044706 Bacteria 1619
402 Ga0466971_0013693 3300044719 Bacteria 3567
403 Ga0466970_0011570 3300044765 Bacteria 4500
404 Ga0466970_0021656 3300044765 Bacteria 3349
405 Ga0466957_0037767 3300044842 Bacteria 2908
406 Ga0466957_0040566 3300044842 Bacteria 2812
407 Ga0466957_0207246 3300044842 Bacteria 1290
408 Ga0466960_0001103 3300044901 Bacteria 9704
409 Ga0466960_0152083 3300044901 Bacteria 1237
410 Ga0466959_0018316 3300045049 Bacteria 5141
411 Ga0466959_0143953 3300045049 Bacteria 1683
412 Ga0466958_0006069 3300045836 Bacteria 6549
413 Ga0466958_0015236 3300045836 Bacteria 4402
414 Ga0466958_0084280 3300045836 Bacteria 1960
415 Ga0466967_0150731 3300045976 Bacteria 2173
416 Ga0466967_0352772 3300045976 Bacteria 1424
417 Ga0495617_053440 3300046452 Bacteria 1341
418 Ga0495592_0033572 3300046454 Bacteria 3870
419 Ga0495603_0060047 3300046455 Bacteria 2247
420 Ga0495629_0013871 3300046459 Bacteria 5814
421 Ga0495629_0017481 3300046459 Bacteria 5139
422 Ga0495629_0029077 3300046459 Bacteria 3922
423 Ga0495641_0019359 3300046461 Bacteria 3485
424 Ga0495641_0029814 3300046461 Bacteria 2625
425 Ga0495641_0078556 3300046461 Bacteria 1479
426 Ga0495641_0156453 3300046461 Bacteria 1019
427 Ga0495651_0017415 3300046462 Bacteria 5564
428 Ga0495653_0003621 3300046463 Bacteria 12467
429 Ga0495653_0043731 3300046463 Bacteria 3480
430 Ga0495653_0045475 3300046463 Bacteria 3403
431 Ga0495580_0418700 3300046472 Bacteria 901
432 Ga0495582_0017856 3300046473 Bacteria 3878
433 Ga0495605_0007783 3300046474 Bacteria 6070
434 Ga0495662_0000299 3300046476 Bacteria 21544
435 Ga0495662_0023400 3300046476 Bacteria 2983
436 Ga0495664_0001461 3300046477 Bacteria 12529
437 Ga0495664_0001486 3300046477 Bacteria 12409
438 Ga0495664_0001546 3300046477 Bacteria 12189
439 Ga0495664_0076732 3300046477 Bacteria 2000
440 Ga0495584_0126450 3300046491 Bacteria 1296
441 Ga0495584_0198475 3300046491 Bacteria 1020
442 Ga0495585_0106431 3300046492 Bacteria 1495
443 Ga0495607_0051493 3300046501 Bacteria 2391
444 Ga0495606_0006829 3300046507 Bacteria 10419
445 Ga0495608_0028308 3300046511 Bacteria 3808
446 Ga0495608_0029914 3300046511 Bacteria 3690
447 Ga0495608_0037144 3300046511 Bacteria 3276
448 Ga0495616_0004697 3300046513 Bacteria 8564
449 Ga0495618_0240767 3300046514 Bacteria 1137
450 Ga0495618_0300510 3300046514 Bacteria 997
451 Ga0495620_0002171 3300046515 Bacteria 11400
452 Ga0495628_0003185 3300046516 Bacteria 14705
453 Ga0495628_0035763 3300046516 Bacteria 3990
454 Ga0495630_0025561 3300046517 Bacteria 4368
455 Ga0495630_0048897 3300046517 Bacteria 3165
456 Ga0495630_0059636 3300046517 Bacteria 2863
457 Ga0495630_0369572 3300046517 Bacteria 1098
458 Ga0495631_0031129 3300046518 Bacteria 2416
459 Ga0495632_0053779 3300046519 Bacteria 1976
460 Ga0495643_0208290 3300046522 Bacteria 934
461 Ga0495648_0068301 3300046524 Bacteria 2074
462 Ga0495666_0000305 3300046526 Bacteria 21370
463 Ga0495666_0034115 3300046526 Bacteria 2483
464 Ga0495652_0020317 3300046529 Bacteria 5904
465 Ga0495652_0030477 3300046529 Bacteria 4731
466 Ga0495652_0109676 3300046529 Bacteria 2221
467 Ga0495665_0064889 3300046531 Bacteria 1927
468 Ga0495665_0135493 3300046531 Bacteria 1288
469 Ga0495640_0007132 3300046533 Bacteria 8797
470 Ga0495640_0038803 3300046533 Bacteria 3348
471 Ga0495586_0223874 3300046535 Bacteria 1069
472 Ga0495587_0002727 3300046536 Bacteria 11784
473 Ga0495609_0160406 3300046538 Bacteria 953
474 Ga0495645_0036943 3300046543 Bacteria 3559
475 Ga0495645_0094673 3300046543 Bacteria 2130
476 Ga0495622_0064729 3300046557 Bacteria 1690
477 Ga0495633_0013663 3300046558 Bacteria 4270
478 Ga0495667_0008071 3300046559 Bacteria 7146
479 Ga0495667_0289172 3300046559 Bacteria 1039
480 Ga0495668_0009277 3300046616 Bacteria 6049
481 Ga0495634_0002985 3300046642 Bacteria 13793
482 Ga0495634_0035622 3300046642 Bacteria 3406
483 Ga0495611_0001832 3300046648 Bacteria 10174
484 Ga0495611_0123241 3300046648 Bacteria 1208
485 Ga0495625_0270502 3300046660 Bacteria 1096
486 Ga0495635_0000692 3300046663 Bacteria 21712
487 Ga0495635_0003359 3300046663 Bacteria 11058
488 Ga0495635_0006449 3300046663 Bacteria 8182
489 Ga0495635_0220420 3300046663 Bacteria 1283
490 Ga0495635_0319402 3300046663 Bacteria 1039
491 Ga0495588_0074722 3300046674 Bacteria 1765
492 Ga0495657_0000085 3300046675 Bacteria 82569
493 Ga0495657_0004764 3300046675 Bacteria 10815
494 Ga0495657_0108051 3300046675 Bacteria 1765
495 Ga0495657_0116307 3300046675 Bacteria 1688
496 Ga0495599_0187664 3300046678 Bacteria 1272
497 Ga0495646_0010353 3300046680 Bacteria 5931
498 Ga0495646_0114678 3300046680 Bacteria 1531
499 Ga0495658_0033254 3300046683 Bacteria 2822
500 Ga0495613_0000645 3300046689 Bacteria 27674
501 Ga0495613_0005361 3300046689 Bacteria 9633
502 Ga0495613_0329962 3300046689 Bacteria 1052
503 Ga0495624_0005756 3300046690 Bacteria 8886
504 Ga0495624_0054142 3300046690 Bacteria 2530
505 Ga0495624_0122915 3300046690 Bacteria 1594
506 Ga0495624_0314287 3300046690 Bacteria 944
507 Ga0495671_0108033 3300046692 Bacteria 1359
508 Ga0495649_0167950 3300046694 Bacteria 1149
509 Ga0495649_0210856 3300046694 Bacteria 1006
510 Ga0495589_0047318 3300046794 Bacteria 2132
511 Ga0495660_0034549 3300046810 Bacteria 2829
512 Ga0495581_0000467 3300047315 Bacteria 20658
513 Ga0495581_0005908 3300047315 Bacteria 7098
514 Ga0495581_0021711 3300047315 Bacteria 3719
515 Ga0495604_0001862 3300047317 Bacteria 17180
516 Ga0495604_0007531 3300047317 Bacteria 8612
517 Ga0495604_0040246 3300047317 Bacteria 3671
518 Ga0495604_0170256 3300047317 Bacteria 1532
519 Ga0495604_0249066 3300047317 Bacteria 1212
520 Ga0495636_0114814 3300047318 Bacteria 1187
521 Ga0495674_0002479 3300047319 Bacteria 18014
522 Ga0495674_0031479 3300047319 Bacteria 4819
523 Ga0495674_0104007 3300047319 Bacteria 2414
524 Ga0495674_0282288 3300047319 Bacteria 1360
525 Ga0495676_0000632 3300047321 Bacteria 29176
526 Ga0495676_0007537 3300047321 Bacteria 9981
527 Ga0495676_0185883 3300047321 Bacteria 1453
528 Ga0495680_0011326 3300047322 Bacteria 7905
529 Ga0495680_0053304 3300047322 Bacteria 3149
530 Ga0495680_0055986 3300047322 Bacteria 3055
531 Ga0495680_0383069 3300047322 Bacteria 974
532 Ga0495687_001483 3300047443 Bacteria 21445
533 Ga0495687_011945 3300047443 Bacteria 4632
534 Ga0495675_0002048 3300047444 Bacteria 12057
535 Ga0495675_0104964 3300047444 Bacteria 1766
536 Ga0495675_0136538 3300047444 Bacteria 1522
537 Ga0495681_0004191 3300047470 Bacteria 9894
538 Ga0495681_0076105 3300047470 Bacteria 1509
539 Ga0495684_0006132 3300047471 Bacteria 9357
540 Ga0495684_0033003 3300047471 Bacteria 3975
541 Ga0495686_0013927 3300047472 Bacteria 5563
542 Ga0495593_0000589 3300047673 Bacteria 20695
543 Ga0495593_0002871 3300047673 Bacteria 10389
544 Ga0495593_0040078 3300047673 Bacteria 2523
545 Ga0495593_0138653 3300047673 Bacteria 1232
546 Ga0495602_0048751 3300048088 Bacteria 3802
547 Ga0495614_0001203 3300048089 Bacteria 11126
548 Ga0496100_0031443 3300048903 Bacteria 3300
549 Ga0496100_0322502 3300048903 Bacteria 1161
550 Ga0496101_0086059 3300048904 Bacteria 2330
551 Ga0496101_0482839 3300048904 Bacteria 979
552 Ga0496102_0018317 3300048905 Bacteria 6152
553 Ga0496102_0177414 3300048905 Bacteria 2007
554 Ga0496103_0008365 3300048906 Bacteria 6146
555 Ga0496103_0044243 3300048906 Bacteria 2743
556 Ga0496104_0429726 3300048907 Bacteria 1233
557 Ga0496104_0740892 3300048907 Bacteria 890
558 Ga0496105_0041486 3300048908 Bacteria 3793
559 Ga0496106_0003435 3300048909 Bacteria 11799
560 Ga0496106_0102005 3300048909 Bacteria 2226
561 Ga0496106_0523067 3300048909 Bacteria 953
562 Ga0496107_0001988 3300048910 Bacteria 13015
563 Ga0496107_0304102 3300048910 Bacteria 1187
564 Ga0496107_0370224 3300048910 Bacteria 1066
565 Ga0496108_0016609 3300048911 Bacteria 6010
566 Ga0496108_0037939 3300048911 Bacteria 4014
567 Ga0496108_0045664 3300048911 Bacteria 3659
568 Ga0496108_0123750 3300048911 Bacteria 2219
569 Ga0496108_0511142 3300048911 Bacteria 1049
570 Ga0496108_0600916 3300048911 Bacteria 959
571 Ga0496109_0005468 3300048912 Bacteria 10628
572 Ga0496109_0011084 3300048912 Bacteria 7729
573 Ga0496109_0052131 3300048912 Bacteria 3728
574 Ga0496109_0059044 3300048912 Bacteria 3504
575 Ga0496109_0095893 3300048912 Bacteria 2747
576 Ga0496109_0237807 3300048912 Bacteria 1714
577 Ga0496109_0336681 3300048912 Bacteria 1425
578 Ga0496110_0031628 3300048913 Bacteria 4567
579 Ga0496110_0063347 3300048913 Bacteria 3267
580 Ga0496110_0226827 3300048913 Bacteria 1699
581 Ga0496111_0087033 3300048914 Bacteria 2287
582 Ga0496111_0195788 3300048914 Bacteria 1502
583 Ga0496112_0001686 3300048915 Bacteria 17213
584 Ga0496112_0038388 3300048915 Bacteria 4675
585 Ga0496112_0061268 3300048915 Bacteria 3709
586 Ga0496112_0077617 3300048915 Bacteria 3285
587 Ga0496112_0083925 3300048915 Bacteria 3151
588 Ga0496112_0253011 3300048915 Bacteria 1712
589 Ga0496112_0332446 3300048915 Bacteria 1463
590 Ga0496113_0656170 3300048916 Bacteria 839
591 Ga0496114_0010972 3300048917 Bacteria 7223
592 Ga0496114_0178472 3300048917 Bacteria 1854
593 Ga0496114_0197277 3300048917 Bacteria 1762
594 Ga0496114_0323984 3300048917 Bacteria 1362
595 Ga0496114_0574757 3300048917 Bacteria 995
596 Ga0496115_0007795 3300048918 Bacteria 7893
597 Ga0496115_0590667 3300048918 Bacteria 884
598 Ga0495678_041840 3300049459 Bacteria 1830
599 Ga0501031_0035314 3300049568 Bacteria 3261
600 Ga0501032_0003267 3300049569 Bacteria 12478
601 Ga0501032_0011784 3300049569 Bacteria 6267
602 Ga0501033_0028480 3300049570 Bacteria 4196
603 Ga0501033_0372041 3300049570 Bacteria 999
604 Ga0501034_0017846 3300049571 Bacteria 7278
605 Ga0501034_0692415 3300049571 Bacteria 918
606 Ga0501036_0053507 3300049572 Bacteria 3418
607 Ga0501036_0081741 3300049572 Bacteria 2730
608 Ga0501037_0002541 3300049573 Bacteria 13186
609 Ga0501037_0114104 3300049573 Bacteria 1945
610 Ga0501038_0020301 3300049574 Bacteria 5975
611 Ga0501038_0372281 3300049574 Unclassified 1109
612 Ga0501039_0004623 3300049575 Bacteria 10405
613 Ga0501040_0189693 3300049576 Bacteria 1458
614 Ga0501041_0004539 3300049577 Bacteria 8053
615 Ga0501041_0063456 3300049577 Bacteria 2262
616 Ga0501043_0000633 3300049579 Bacteria 31114
617 Ga0501043_0014804 3300049579 Bacteria 6107
618 Ga0501043_0023991 3300049579 Bacteria 4786
619 Ga0501043_0407962 3300049579 Bacteria 1026
620 Ga0501048_0056007 3300049582 Bacteria 2798
621 Ga0501048_0158804 3300049582 Bacteria 1600
622 Ga0501067_0003230 3300049583 Bacteria 8977
623 Ga0501068_0018716 3300049584 Bacteria 4013
624 Ga0501069_0007950 3300049585 Bacteria 5568
625 Ga0501070_0000448 3300049586 Bacteria 37506
626 Ga0501070_0060660 3300049586 Bacteria 3134
627 Ga0501070_0070399 3300049586 Bacteria 2896
628 Ga0501070_0085936 3300049586 Bacteria 2604
629 Ga0501070_0087142 3300049586 Bacteria 2585
630 Ga0501070_0088509 3300049586 Bacteria 2563
631 Ga0501072_0459891 3300049588 Bacteria 1008
632 Ga0501073_0021427 3300049589 Bacteria 4660
633 Ga0501075_0001794 3300049591 Bacteria 14129
634 Ga0501076_0068113 3300049592 Bacteria 2843
635 Ga0501077_0046550 3300049593 Bacteria 2755
636 Ga0501079_0007851 3300049741 Bacteria 8081
637 Ga0501079_0372380 3300049741 Bacteria 1120
638 Ga0501080_0000094 3300049742 Bacteria 60247
639 Ga0501081_0200798 3300049743 Bacteria 1446
640 Ga0501035_0476911 3300049822 Bacteria 1029
641 Ga0501044_0000201 3300049823 Bacteria 75685
642 Ga0501044_0049783 3300049823 Bacteria 4325
643 Ga0501044_0440279 3300049823 Bacteria 1211
644 nmdc:mga03683_25090_c1 3300050489 Bacteria 2337
645 nmdc:mga03n38_107800_c1 3300050490 Bacteria 1352
646 nmdc:mga03n38_18775_c1 3300050490 Bacteria 2735
647 nmdc:mga03n38_30521_c1 3300050490 Bacteria 2267
648 nmdc:mga03n38_68552_c1 3300050490 Bacteria 1636
649 nmdc:mga00v17_11330_c1 3300050491 Bacteria 4902
650 nmdc:mga00v17_24795_c1 3300050491 Bacteria 3481
651 nmdc:mga00v17_4131_c1 3300050491 Bacteria 7512
652 nmdc:mga00v17_45641_c1 3300050491 Bacteria 2648
653 nmdc:mga0yw44_184581_c1 3300050492 Bacteria 1374
654 nmdc:mga0yw44_19263_c1 3300050492 Bacteria 3759
655 nmdc:mga0yw44_352632_c1 3300050492 Bacteria 991
656 nmdc:mga0yw44_375119_c1 3300050492 Bacteria 960
657 nmdc:mga0yw44_65674_c1 3300050492 Bacteria 2237
658 nmdc:mga0yw44_75250_c1 3300050492 Bacteria 2105
659 nmdc:mga06z11_13505_c1 3300050494 Bacteria 3589
660 nmdc:mga06z11_21301_c1 3300050494 Bacteria 3011
661 nmdc:mga06z11_56649_c1 3300050494 Bacteria 2028
662 nmdc:mga04h51_1692_c1 3300050495 Bacteria 5148
663 nmdc:mga07m45_380708_c1 3300050496 Bacteria 819
664 nmdc:mga07m45_81897_c1 3300050496 Bacteria 1843
665 nmdc:mga05p37_284304_c1 3300050507 Bacteria 1971
666 nmdc:mga05p37_435440_c1 3300050507 Bacteria 1522
667 nmdc:mga05p37_47279_c1 3300050507 Bacteria 5292
668 nmdc:mga05p37_55175_c1 3300050507 Bacteria 4889
669 nmdc:mga09592_2135_c1 3300050508 Bacteria 15981
670 nmdc:mga09592_24545_c1 3300050508 Bacteria 4986
671 nmdc:mga0qj67_110072_c1 3300050509 Bacteria 2223
672 nmdc:mga0qj67_4764_c1 3300050509 Bacteria 9859
673 nmdc:mga06r32_196273_c1 3300050510 Bacteria 2006
674 nmdc:mga06r32_44174_c1 3300050510 Bacteria 4242
675 nmdc:mga06r32_736628_c1 3300050510 Bacteria 949
676 nmdc:mga0n895_30795_c1 3300050512 Bacteria 5132
677 nmdc:mga0n895_320269_c1 3300050512 Bacteria 1571
678 nmdc:mga0rr50_45264_c1 3300050513 Bacteria 3233
679 nmdc:mga08x19_13508_c1 3300050514 Bacteria 4939
680 nmdc:mga08x19_78681_c1 3300050514 Bacteria 2161
681 nmdc:mga0a205_28206_c1 3300050515 Bacteria 5367
682 nmdc:mga0sz30_18255_c1 3300050516 Bacteria 2126
683 nmdc:mga0sz30_22392_c1 3300050516 Bacteria 2564
684 nmdc:mga0sz30_5977_c1 3300050516 Bacteria 4492
685 Ga0495601_0000136 3300053077 Bacteria 41775
686 Ga0495601_0046358 3300053077 Bacteria 2736
687 Ga0495601_0270413 3300053077 Bacteria 1109
688 Ga0495612_0060691 3300053078 Bacteria 1565
689 Ga0495612_0109294 3300053078 Bacteria 1182
690 Ga0495595_0147014 3300053084 Bacteria 1158
691 Ga0495619_0067259 3300053085 Bacteria 2392
692 Ga0495619_0099111 3300053085 Bacteria 1981
693 Ga0495619_0117504 3300053085 Bacteria 1821
694 Ga0495619_0193692 3300053085 Bacteria 1407
695 Ga0495619_0201231 3300053085 Bacteria 1379
696 Ga0495619_0374389 3300053085 Bacteria 984
697 Ga0500583_0206566 3300053092 Bacteria 975
698 Ga0500640_000534 3300053095 Bacteria 9621
699 Ga0500650_0135817 3300053098 Bacteria 1142
700 Ga0500569_000771 3300053109 Bacteria 5608
701 Ga0500569_036728 3300053109 Bacteria 1412
702 Ga0500593_054294 3300053117 Bacteria 1773
703 Ga0500628_011961 3300053129 Bacteria 1588
704 Ga0500568_0000013 3300053139 Bacteria 224760
705 Ga0500573_0027673 3300053140 Bacteria 3262
706 Ga0500573_0072184 3300053140 Bacteria 1968
707 Ga0500577_0008212 3300053142 Bacteria 2965
708 Ga0500600_0041461 3300053149 Bacteria 2654
709 Ga0500604_0010708 3300053151 Bacteria 2457
710 Ga0500616_0003173 3300053153 Bacteria 12802
711 Ga0500616_0006800 3300053153 Bacteria 7403
712 Ga0500627_0000026 3300053158 Bacteria 100362
713 Ga0500634_0061922 3300053161 Bacteria 1983
714 Ga0501084_0000230 3300054114 Bacteria 42013
715 Ga0501084_0137059 3300054114 Bacteria 2060
716 Ga0501084_0240596 3300054114 Bacteria 1528
717 Ga0501084_0690203 3300054114 Bacteria 861
718 Ga0501082_0056531 3300060353 Bacteria 3380
719 Ga0466962_0008351 3300061719 Bacteria 4963
720 Ga0530510_0042755 3300061734 Bacteria 3273
721 2508674792 2508501039 Bacteria 9978592
722 2508676532 2508501039 Bacteria 9978592
723 2517759508 2517572101 Bacteria 6884336
724 2523382873 2523231044 Bacteria 6434991
725 2523382978 2523231044 Bacteria 6434991
726 2548696588 2547132424 Bacteria 8348532
727 2585313774 2582581314 Bacteria 11452267
728 2616697749 2616644814 Bacteria 11555299
729 2644028387 2643221603 Bacteria 6147767
730 2644511681 2643221692 Bacteria 7282860
731 2671836152 2671180195 Bacteria 9757215
732 2676200567 2675902999 Bacteria 9438463
733 2676205803 2675902999 Bacteria 9438463
734 2686539979 2684623035 Bacteria 8032739
735 2689956943 2687453737 Bacteria 11203906
736 2689957900 2687453737 Bacteria 11203906
737 2689994295 2687453743 Bacteria 8361025
738 2738890818 2738541308 Bacteria 7020677
739 2744955439 2744054611 Bacteria 5611514
740 2774845145 2773857921 Bacteria 9435764
741 2774850378 2773857921 Bacteria 9435764
742 2774854308 2773857922 Bacteria 9757215
743 2774857869 2773857922 Bacteria 9757215
744 2785374564 2784746768 Bacteria 10036182
745 2812361035 2811994879 Bacteria 9313447
746 2842140235 2842134933 Bacteria 5847019
747 2895888796 2895880812 Bacteria 11255272
748 2919713519 2919713450 Bacteria 7431245
749 2929216799 2929212328 Bacteria 7708288
750 2946073340 2946072368 Bacteria 8999607
751 2954691604 2954691527 Bacteria 10720516
752 2954706700 2954701450 Bacteria 10834262
753 3003006633 3002998708 Bacteria 11715108
754 8002780223 8002775197 Bacteria 10728764
755 8002781817 8002775197 Bacteria 10728764
756 8002786230 8002784119 Bacteria 9788632
757 8002788477 8002784119 Bacteria 9788632
758 8002789488 8002784119 Bacteria 9788632
759 8055161833 8055157932 Bacteria 6429399
760 Ga0500592_000002
761 JGI24746J21847_1010997
762 JGI24735J21928_10021367
763 JGI24738J21930_10005689
764 JGI24744J21845_10000071
765 JGI24744J21845_10006035
766 JGI24034J26672_10010902
767 JGI24742J22300_10003264
768 JGI24751J29686_10003252
769 JGI25407J50210_10000383
770 JGI25407J50210_10009099
771 Ga0058861_10074083
772 Ga0058862_10117455
773 Ga0070683_100047848
774 Ga0070683_100139557
775 Ga0070683_100680245
776 Ga0070690_100013128
777 Ga0068869_100032177
778 Ga0068869_100125436
779 Ga0068869_100128334
780 Ga0070666_10158155
781 Ga0070680_100003872
782 Ga0070682_100010377
783 Ga0070682_100027139
784 Ga0070682_100051976
785 Ga0068868_100003577
786 Ga0070660_100061988
787 Ga0070689_100039648
788 Ga0070691_10001071
789 Ga0070661_100396642
790 Ga0070668_100007964
791 Ga0070669_100060326
792 Ga0070671_100196820
793 Ga0070674_100005277
794 Ga0070674_100038692
795 Ga0070673_100305093
796 Ga0070688_100007788
797 Ga0070667_100008515
798 Ga0070667_100011261
799 Ga0070667_100165465
800 Ga0070709_10174850
801 Ga0070714_100237017
802 Ga0070713_100149135
803 Ga0070713_100543092
804 Ga0070710_10002526
805 Ga0070701_10000967
806 Ga0070711_100000900
807 Ga0070705_100038817
808 Ga0070700_100004993
809 Ga0070700_100499323
810 Ga0070708_100027627
811 Ga0070663_100003355
812 Ga0070663_100039518
813 Ga0070663_100115538
814 Ga0070678_100002109
815 Ga0070662_100001655
816 Ga0070662_100125760
817 Ga0070681_10000022
818 Ga0068867_100003589
819 Ga0070685_10023682
820 Ga0070706_100028335
821 Ga0070707_100044278
822 Ga0070698_100080307
823 Ga0070698_100223255
824 Ga0070698_100403880
825 Ga0070699_100074130
826 Ga0070679_100000004
827 Ga0070697_100084970
828 Ga0070697_100473039
829 Ga0068853_100012826
830 Ga0068853_100151723
831 Ga0070672_100063635
832 Ga0070695_100008636
833 Ga0070696_100001174
834 Ga0070696_100129663
835 Ga0070693_100015200
836 Ga0070665_100064170
837 Ga0070704_100007849
838 Ga0068855_100158431
839 Ga0068855_100347685
840 Ga0068854_100002576
841 Ga0068854_100185291
842 Ga0068854_100401081
843 Ga0070702_100013622
844 Ga0068852_100026336
845 Ga0068852_100119184
846 Ga0068852_100230284
847 Ga0068859_100019140
848 Ga0068864_100337291
849 Ga0068864_100373882
850 Ga0068866_10001342
851 Ga0068861_100009501
852 Ga0068861_100068502
853 Ga0068863_100006126
854 Ga0068863_100130991
855 Ga0068858_100000440
856 Ga0068858_100292310
857 Ga0068860_100007225
858 Ga0068862_100012046
859 Ga0068862_100090656
860 Ga0081455_10002376
861 Ga0081455_10006223
862 Ga0081455_10033215
863 Ga0081455_10062089
864 Ga0081455_10203252
865 Ga0081538_10000105
866 Ga0081538_10010738
867 Ga0081538_10018212
868 Ga0081538_10107356
869 Ga0070717_10034043
870 Ga0075365_10005497
871 Ga0075365_10030045
872 Ga0075365_10048915
873 Ga0075365_10069628
874 Ga0075365_10082713
875 Ga0075365_10156917
876 Ga0075365_10317557
877 Ga0075363_100001346
878 Ga0075363_100008510
879 Ga0075363_100010154
880 Ga0075363_100041932
881 Ga0075363_100042253
882 Ga0075363_100071811
883 Ga0075363_100131822
884 Ga0075364_10038544
885 Ga0075364_10041426
886 Ga0075364_10068960
887 Ga0075364_10216726
888 Ga0075364_10281170
889 Ga0075364_10348409
890 Ga0070715_10054191
891 Ga0070715_10107194
892 Ga0070716_100016854
893 Ga0070712_100050958
894 Ga0070712_100060626
895 Ga0070712_100061821
896 Ga0070712_100339701
897 Ga0075362_10007921
898 Ga0075362_10116404
899 Ga0075362_10130091
900 Ga0075367_10002296
901 Ga0075367_10012845
902 Ga0075367_10034751
903 Ga0075367_10233526
904 Ga0075369_10014541
905 Ga0075370_10059824
906 Ga0068871_100035296
907 Ga0075428_100006189
908 Ga0075428_100012634
909 Ga0075428_100014611
910 Ga0075428_100060337
911 Ga0075430_100015873
912 Ga0075430_100047582
913 Ga0075430_100317758
914 Ga0075431_100010280
915 Ga0075431_100073716
916 Ga0075429_100002654
917 Ga0075429_100170619
918 Ga0068865_100001386
919 Ga0075436_100002708
920 Ga0097620_100019140
921 Ga0075435_100005422
922 Ga0075435_100416379
923 Ga0105245_10005394
924 Ga0105245_10219912
925 Ga0105245_10427471
926 Ga0105247_10003226
927 Ga0105247_10190150
928 Ga0114129_10034130
929 Ga0114129_10037665
930 Ga0114129_10060958
931 Ga0114129_10142799
932 Ga0114129_10229442
933 Ga0114129_10536482
934 Ga0105242_10000923
935 Ga0105248_10014081
936 Ga0105248_10166222
937 Ga0105237_10044781
938 Ga0105249_10003832
939 Ga0105249_10133144
940 Ga0105249_10133271
941 Ga0105249_10198610
942 Ga0099796_10022111
943 Ga0105239_10006014
944 Ga0105239_10300610
945 Ga0105239_10306331
946 Ga0105246_10289754
947 Ga0157369_10629183
948 Ga0157378_10013546
949 Ga0163162_10005241
950 Ga0163162_10048240
951 Ga0157372_10000875
952 Ga0157372_10408583
953 Ga0157375_10006760
954 Ga0157375_10206496
955 Ga0157375_10502044
956 Ga0157380_10156708
957 Ga0157380_10192325
958 Ga0157377_10283887
959 Ga0157379_10005697
960 Ga0157379_10189922
961 Ga0163161_10049992
962 Ga0163161_10092192
963 Ga0163161_10094013
964 Ga0206351_10150286
965 Ga0154015_1016222
966 Ga0224712_10029263
967 Ga0224572_1001248
968 Ga0207692_10014913
969 Ga0207692_10031572
970 Ga0207642_10001690
971 Ga0207710_10001453
972 Ga0207688_10000208
973 Ga0207688_10005156
974 Ga0207647_10031879
975 Ga0207647_10045657
976 Ga0207685_10054099
977 Ga0207685_10257208
978 Ga0207699_10024196
979 Ga0207684_10061317
980 Ga0207693_10004953
981 Ga0207693_10006753
982 Ga0207693_10023044
983 Ga0207693_10242056
984 Ga0207693_10365964
985 Ga0207663_10011590
986 Ga0207663_10039221
987 Ga0207663_10271771
988 Ga0207660_10001708
989 Ga0207657_10053372
990 Ga0207652_10000655
991 Ga0207646_10018486
992 Ga0207681_10028516
993 Ga0207659_10178956
994 Ga0207687_10011248
995 Ga0207687_10011739
996 Ga0207687_10022938
997 Ga0207700_10071151
998 Ga0207700_10189838
999 Ga0207664_10271899
1000 Ga0207644_10033066
1001 Ga0207644_10153206
1002 Ga0207706_10006495
1003 Ga0207706_10083495
1004 Ga0207686_10003875
1005 Ga0207709_10006493
1006 Ga0207709_10083176
1007 Ga0207669_10022290
1008 Ga0207704_10006807
1009 Ga0207665_10005046
1010 Ga0207665_10009509
1011 Ga0207665_10022975
1012 Ga0207665_10315394
1013 Ga0207691_10043881
1014 Ga0207711_10032304
1015 Ga0207711_10472122
1016 Ga0207711_10500102
1017 Ga0207689_10036253
1018 Ga0207689_10053702
1019 Ga0207689_10082146
1020 Ga0207661_10071523
1021 Ga0207661_10094623
1022 Ga0207667_10300473
1023 Ga0207712_10014205
1024 Ga0207712_10381662
1025 Ga0207668_10003736
1026 Ga0207640_10000808
1027 Ga0207640_10030647
1028 Ga0207640_10406053
1029 Ga0207658_10067011
1030 Ga0207658_10236566
1031 Ga0207658_10252730
1032 Ga0207677_10090155
1033 Ga0207703_10023031
1034 Ga0207703_10174669
1035 Ga0207703_10261104
1036 Ga0207639_10026115
1037 Ga0207639_10328994
1038 Ga0207678_10008436
1039 Ga0207678_10014426
1040 Ga0207678_10055413
1041 Ga0207708_10040064
1042 Ga0207641_10002315
1043 Ga0207648_10006892
1044 Ga0207648_10107276
1045 Ga0207676_10152159
1046 Ga0207676_10396712
1047 Ga0207676_10534837
1048 Ga0207676_10584553
1049 Ga0207675_100000917
1050 Ga0207675_100074273
1051 Ga0207675_100309962
1052 Ga0207675_100757166
1053 Ga0207683_10000451
1054 Ga0207683_10224112
1055 Ga0207683_10287500
1056 Ga0207698_10055085
1057 Ga0207698_10597565
1058 Ga0268266_10171342
1059 Ga0268265_10028137
1060 Ga0268265_10086778
1061 Ga0268264_10003597
1062 Ga0265334_10009784
1063 Ga0307517_10079972
1064 Ga0307515_10028158
1065 Ga0307515_10146625
1066 Ga0307515_10177937
1067 Ga0265338_10000292
1068 Ga0307511_10040555
1069 Ga0307512_10004927
1070 Ga0307512_10008362
1071 Ga0307512_10074248
1072 Ga0265325_10002665
1073 Ga0265340_10117945
1074 Ga0265339_10002943
1075 Ga0265331_10019663
1076 Ga0265327_10005757
1077 Ga0265316_10065335
1078 Ga0307513_10004357
1079 Ga0307509_10013071
1080 Ga0265313_10021235
1081 Ga0307508_10020117
1082 Ga0307508_10081519
1083 Ga0307508_10114542
1084 Ga0265314_10027067
1085 Ga0265314_10178375
1086 Ga0316576_10094787
1087 Ga0307516_10011314
1088 Ga0307516_10014621
1089 Ga0307413_10038149
1090 Ga0307518_10070171
1091 Ga0307518_10174302
1092 Ga0307407_10034470
1093 Ga0307409_100029866
1094 Ga0307409_100335200
1095 Ga0307409_100524568
1096 Ga0307416_100544823
1097 Ga0307411_10050109
1098 Ga0307415_100005470
1099 Ga0307507_10000003
1100 Ga0307507_10015504
1101 Ga0307510_10010736
1102 Ga0307510_10080300
1103 Ga0316214_1008049
1104 Ga0316212_1004398
1105 Ga0373934_0131130
1106 Ga0373940_0035409
1107 Ga0373944_0003121
1108 Ga0373923_0014576
1109 Ga0373932_0030017
1110 Ga0373939_0097068
1111 Ga0373939_0105064
1112 Ga0373941_0045235
1113 Ga0373943_0101728
1114 Ga0373943_0140579
1115 Ga0373943_0338359
1116 Ga0373946_0003379
1117 Ga0373955_0004823
1118 Ga0373955_0171667
1119 Ga0373942_0001057
1120 Ga0373962_0008246
1121 Ga0316574_0014158
1122 Ga0373931_0015036
1123 Ga0373935_0002295
1124 Ga0373935_0070599
1125 Ga0373927_0001964
1126 Ga0373927_0130321
1127 Ga0373933_0059702
1128 Ga0373947_0001459
1129 Ga0373947_0009208
1130 Ga0373937_0089831
1131 Ga0373937_0099726
1132 Ga0373925_0003652
1133 Ga0395901_0412591
1134 Ga0237819_00287
1135 Ga0436365_0013961
1136 Ga0436365_0303060
1137 Ga0436360_1304279
1138 Ga0436363_1415247
1139 Ga0439461_0006411
1140 Ga0439465_0005938
1141 Ga0439465_0010360
1142 Ga0451839_1130435
1143 Ga0451853_0686192
1144 Ga0451853_0851822
1145 Ga0451853_2157410
1146 Ga0439445_0007561
1147 Ga0439451_003594
1148 Ga0439463_006004
1149 Ga0450903_003117
1150 Ga0439444_0005296
1151 Ga0439464_0005381
1152 Ga0439440_0008286
1153 Ga0466972_0003050
1154 Ga0466972_0018414
1155 Ga0466972_0023475
1156 Ga0466972_0194635
1157 Ga0466965_0001762
1158 Ga0466966_0014629
1159 Ga0466961_0024919
1160 Ga0466964_0056826
1161 Ga0466971_0013693
1162 Ga0466970_0011570
1163 Ga0466970_0021656
1164 Ga0466957_0037767
1165 Ga0466957_0040566
1166 Ga0466957_0207246
1167 Ga0466960_0001103
1168 Ga0466960_0152083
1169 Ga0466959_0018316
1170 Ga0466959_0143953
1171 Ga0466958_0006069
1172 Ga0466958_0015236
1173 Ga0466958_0084280
1174 Ga0466967_0150731
1175 Ga0466967_0352772
1176 Ga0495617_053440
1177 Ga0495592_0033572
1178 Ga0495603_0060047
1179 Ga0495629_0013871
1180 Ga0495629_0017481
1181 Ga0495629_0029077
1182 Ga0495641_0019359
1183 Ga0495641_0029814
1184 Ga0495641_0078556
1185 Ga0495641_0156453
1186 Ga0495651_0017415
1187 Ga0495653_0003621
1188 Ga0495653_0043731
1189 Ga0495653_0045475
1190 Ga0495580_0418700
1191 Ga0495582_0017856
1192 Ga0495605_0007783
1193 Ga0495662_0000299
1194 Ga0495662_0023400
1195 Ga0495664_0001461
1196 Ga0495664_0001486
1197 Ga0495664_0001546
1198 Ga0495664_0076732
1199 Ga0495584_0126450
1200 Ga0495584_0198475
1201 Ga0495585_0106431
1202 Ga0495607_0051493
1203 Ga0495606_0006829
1204 Ga0495608_0028308
1205 Ga0495608_0029914
1206 Ga0495608_0037144
1207 Ga0495616_0004697
1208 Ga0495618_0240767
1209 Ga0495618_0300510
1210 Ga0495620_0002171
1211 Ga0495628_0003185
1212 Ga0495628_0035763
1213 Ga0495630_0025561
1214 Ga0495630_0048897
1215 Ga0495630_0059636
1216 Ga0495630_0369572
1217 Ga0495631_0031129
1218 Ga0495632_0053779
1219 Ga0495643_0208290
1220 Ga0495648_0068301
1221 Ga0495666_0000305
1222 Ga0495666_0034115
1223 Ga0495652_0020317
1224 Ga0495652_0030477
1225 Ga0495652_0109676
1226 Ga0495665_0064889
1227 Ga0495665_0135493
1228 Ga0495640_0007132
1229 Ga0495640_0038803
1230 Ga0495586_0223874
1231 Ga0495587_0002727
1232 Ga0495609_0160406
1233 Ga0495645_0036943
1234 Ga0495645_0094673
1235 Ga0495622_0064729
1236 Ga0495633_0013663
1237 Ga0495667_0008071
1238 Ga0495667_0289172
1239 Ga0495668_0009277
1240 Ga0495634_0002985
1241 Ga0495634_0035622
1242 Ga0495611_0001832
1243 Ga0495611_0123241
1244 Ga0495625_0270502
1245 Ga0495635_0000692
1246 Ga0495635_0003359
1247 Ga0495635_0006449
1248 Ga0495635_0220420
1249 Ga0495635_0319402
1250 Ga0495588_0074722
1251 Ga0495657_0000085
1252 Ga0495657_0004764
1253 Ga0495657_0108051
1254 Ga0495657_0116307
1255 Ga0495599_0187664
1256 Ga0495646_0010353
1257 Ga0495646_0114678
1258 Ga0495658_0033254
1259 Ga0495613_0000645
1260 Ga0495613_0005361
1261 Ga0495613_0329962
1262 Ga0495624_0005756
1263 Ga0495624_0054142
1264 Ga0495624_0122915
1265 Ga0495624_0314287
1266 Ga0495671_0108033
1267 Ga0495649_0167950
1268 Ga0495649_0210856
1269 Ga0495589_0047318
1270 Ga0495660_0034549
1271 Ga0495581_0000467
1272 Ga0495581_0005908
1273 Ga0495581_0021711
1274 Ga0495604_0001862
1275 Ga0495604_0007531
1276 Ga0495604_0040246
1277 Ga0495604_0170256
1278 Ga0495604_0249066
1279 Ga0495636_0114814
1280 Ga0495674_0002479
1281 Ga0495674_0031479
1282 Ga0495674_0104007
1283 Ga0495674_0282288
1284 Ga0495676_0000632
1285 Ga0495676_0007537
1286 Ga0495676_0185883
1287 Ga0495680_0011326
1288 Ga0495680_0053304
1289 Ga0495680_0055986
1290 Ga0495680_0383069
1291 Ga0495687_001483
1292 Ga0495687_011945
1293 Ga0495675_0002048
1294 Ga0495675_0104964
1295 Ga0495675_0136538
1296 Ga0495681_0004191
1297 Ga0495681_0076105
1298 Ga0495684_0006132
1299 Ga0495684_0033003
1300 Ga0495686_0013927
1301 Ga0495593_0000589
1302 Ga0495593_0002871
1303 Ga0495593_0040078
1304 Ga0495593_0138653
1305 Ga0495602_0048751
1306 Ga0495614_0001203
1307 Ga0496100_0031443
1308 Ga0496100_0322502
1309 Ga0496101_0086059
1310 Ga0496101_0482839
1311 Ga0496102_0018317
1312 Ga0496102_0177414
1313 Ga0496103_0008365
1314 Ga0496103_0044243
1315 Ga0496104_0429726
1316 Ga0496104_0740892
1317 Ga0496105_0041486
1318 Ga0496106_0003435
1319 Ga0496106_0102005
1320 Ga0496106_0523067
1321 Ga0496107_0001988
1322 Ga0496107_0304102
1323 Ga0496107_0370224
1324 Ga0496108_0016609
1325 Ga0496108_0037939
1326 Ga0496108_0045664
1327 Ga0496108_0123750
1328 Ga0496108_0511142
1329 Ga0496108_0600916
1330 Ga0496109_0005468
1331 Ga0496109_0011084
1332 Ga0496109_0052131
1333 Ga0496109_0059044
1334 Ga0496109_0095893
1335 Ga0496109_0237807
1336 Ga0496109_0336681
1337 Ga0496110_0031628
1338 Ga0496110_0063347
1339 Ga0496110_0226827
1340 Ga0496111_0087033
1341 Ga0496111_0195788
1342 Ga0496112_0001686
1343 Ga0496112_0038388
1344 Ga0496112_0061268
1345 Ga0496112_0077617
1346 Ga0496112_0083925
1347 Ga0496112_0253011
1348 Ga0496112_0332446
1349 Ga0496113_0656170
1350 Ga0496114_0010972
1351 Ga0496114_0178472
1352 Ga0496114_0197277
1353 Ga0496114_0323984
1354 Ga0496114_0574757
1355 Ga0496115_0007795
1356 Ga0496115_0590667
1357 Ga0495678_041840
1358 Ga0501031_0035314
1359 Ga0501032_0003267
1360 Ga0501032_0011784
1361 Ga0501033_0028480
1362 Ga0501033_0372041
1363 Ga0501034_0017846
1364 Ga0501034_0692415
1365 Ga0501036_0053507
1366 Ga0501036_0081741
1367 Ga0501037_0002541
1368 Ga0501037_0114104
1369 Ga0501038_0020301
1370 Ga0501038_0372281
1371 Ga0501039_0004623
1372 Ga0501040_0189693
1373 Ga0501041_0004539
1374 Ga0501041_0063456
1375 Ga0501043_0000633
1376 Ga0501043_0014804
1377 Ga0501043_0023991
1378 Ga0501043_0407962
1379 Ga0501048_0056007
1380 Ga0501048_0158804
1381 Ga0501067_0003230
1382 Ga0501068_0018716
1383 Ga0501069_0007950
1384 Ga0501070_0000448
1385 Ga0501070_0060660
1386 Ga0501070_0070399
1387 Ga0501070_0085936
1388 Ga0501070_0087142
1389 Ga0501070_0088509
1390 Ga0501072_0459891
1391 Ga0501073_0021427
1392 Ga0501075_0001794
1393 Ga0501076_0068113
1394 Ga0501077_0046550
1395 Ga0501079_0007851
1396 Ga0501079_0372380
1397 Ga0501080_0000094
1398 Ga0501081_0200798
1399 Ga0501035_0476911
1400 Ga0501044_0000201
1401 Ga0501044_0049783
1402 Ga0501044_0440279
1403 nmdc:mga03683_25090_c1
1404 nmdc:mga03n38_107800_c1
1405 nmdc:mga03n38_18775_c1
1406 nmdc:mga03n38_30521_c1
1407 nmdc:mga03n38_68552_c1
1408 nmdc:mga00v17_11330_c1
1409 nmdc:mga00v17_24795_c1
1410 nmdc:mga00v17_4131_c1
1411 nmdc:mga00v17_45641_c1
1412 nmdc:mga0yw44_184581_c1
1413 nmdc:mga0yw44_19263_c1
1414 nmdc:mga0yw44_352632_c1
1415 nmdc:mga0yw44_375119_c1
1416 nmdc:mga0yw44_65674_c1
1417 nmdc:mga0yw44_75250_c1
1418 nmdc:mga06z11_13505_c1
1419 nmdc:mga06z11_21301_c1
1420 nmdc:mga06z11_56649_c1
1421 nmdc:mga04h51_1692_c1
1422 nmdc:mga07m45_380708_c1
1423 nmdc:mga07m45_81897_c1
1424 nmdc:mga05p37_284304_c1
1425 nmdc:mga05p37_435440_c1
1426 nmdc:mga05p37_47279_c1
1427 nmdc:mga05p37_55175_c1
1428 nmdc:mga09592_2135_c1
1429 nmdc:mga09592_24545_c1
1430 nmdc:mga0qj67_110072_c1
1431 nmdc:mga0qj67_4764_c1
1432 nmdc:mga06r32_196273_c1
1433 nmdc:mga06r32_44174_c1
1434 nmdc:mga06r32_736628_c1
1435 nmdc:mga0n895_30795_c1
1436 nmdc:mga0n895_320269_c1
1437 nmdc:mga0rr50_45264_c1
1438 nmdc:mga08x19_13508_c1
1439 nmdc:mga08x19_78681_c1
1440 nmdc:mga0a205_28206_c1
1441 nmdc:mga0sz30_18255_c1
1442 nmdc:mga0sz30_22392_c1
1443 nmdc:mga0sz30_5977_c1
1444 Ga0495601_0000136
1445 Ga0495601_0046358
1446 Ga0495601_0270413
1447 Ga0495612_0060691
1448 Ga0495612_0109294
1449 Ga0495595_0147014
1450 Ga0495619_0067259
1451 Ga0495619_0099111
1452 Ga0495619_0117504
1453 Ga0495619_0193692
1454 Ga0495619_0201231
1455 Ga0495619_0374389
1456 Ga0500583_0206566
1457 Ga0500640_000534
1458 Ga0500650_0135817
1459 Ga0500569_000771
1460 Ga0500569_036728
1461 Ga0500593_054294
1462 Ga0500628_011961
1463 Ga0500568_0000013
1464 Ga0500573_0027673
1465 Ga0500573_0072184
1466 Ga0500577_0008212
1467 Ga0500600_0041461
1468 Ga0500604_0010708
1469 Ga0500616_0003173
1470 Ga0500616_0006800
1471 Ga0500627_0000026
1472 Ga0500634_0061922
1473 Ga0501084_0000230
1474 Ga0501084_0137059
1475 Ga0501084_0240596
1476 Ga0501084_0690203
1477 Ga0501082_0056531
1478 Ga0466962_0008351
1479 Ga0530510_0042755
1480 2508674792
1481 2508676532
1482 2517759508
1483 2523382873
1484 2523382978
1485 2548696588
1486 2585313774
1487 2616697749
1488 2644028387
1489 2644511681
1490 2671836152
1491 2676200567
1492 2676205803
1493 2686539979
1494 2689956943
1495 2689957900
1496 2689994295
1497 2738890818
1498 2744955439
1499 2774845145
1500 2774850378
1501 2774854308
1502 2774857869
1503 2785374564
1504 2812361035
1505 2842140235
1506 2895888796
1507 2919713519
1508 2929216799
1509 2946073340
1510 2954691604
1511 2954706700
1512 3003006633
1513 8002780223
1514 8002781817
1515 8002786230
1516 8002788477
1517 8002789488
1518 8055161833

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00378

ECH_1

Enoyl-CoA hydratase/isomerase

12

262

0.84

PF16113

ECH_2

Enoyl-CoA hydratase/isomerase

17

253

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
3t3w-assembly1.cif.gz_B crystal structure of probable enoyl-coa hydratase from mycobacterium thermoresistibile 0.9778 2 244
3ome-assembly1.cif.gz_A crystal structure of a probable enoyl-coa hydratase from mycobacterium smegmatis 0.9696 2 249
3t3w-assembly1.cif.gz_E crystal structure of probable enoyl-coa hydratase from mycobacterium thermoresistibile 0.969 2 249
3ome-assembly1.cif.gz_F crystal structure of a probable enoyl-coa hydratase from mycobacterium smegmatis 0.9668 2 251
3ome-assembly1.cif.gz_B crystal structure of a probable enoyl-coa hydratase from mycobacterium smegmatis 0.9664 2 249
ID Description Score Start End Superfamily
3omeC00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9693 1 249 3.90.226.10
3omeC00 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9539 1 249 3.90.226.10
af_P95279_25_296_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9536 1 239 3.90.226.10
3hrxF01 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.938 3 201 3.90.226.10
3rsiC01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3; 0.9324 2 53 3.30.300.220
ID Description Score Start End GO Terms
AF-A0A0U1DWS8-F1-model_v4 Enoyl-CoA hydratase 0.9849 1 221 GO:0006635
AF-A0A3B8R095-F1-model_v4 Enoyl-CoA hydratase (EC 4.2.1.17) 0.9772 91 215 GO:0004300
GO:0006635
AF-Q5ENI1-F1-model_v4 FadB 0.9685 72 242 GO:0006635
AF-A0A1H6DSJ8-F1-model_v4 Enoyl-CoA hydratase/isomerase 0.9681 1 116 GO:0008300
GO:0016853
AF-A0A1M3NU68-F1-model_v4 Enoyl-CoA hydratase 0.9659 2 231

Map