F479466

General Info

Members Datasets Scaffolds Average Seq Length
758 432 650 293

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2721755702|2723643309
Length 328
Sequence HAHAQTPAGVSTETYATVAATGAASGGTTGRTVGTRRRRARRNWAGWWFVGPFMLIFTLVFIAPLVYAIYLSLFRETLMGGNSFVGLENYAIALVDPKFWEAMLRVSLFLLVQVPIMLGLALFAALALDSARLRWVPFYRLSIFLPYAVPGVVAVMIWGYMYGSQFGLVADLNRFFGMQLPSPLAENLILTSIGNIVTWEFVGYNMLIFFSALKAVPQELYEAAEIDGAGTFRTIFSIKLPSIRGAIVIATIFSVIGSFQLFNEPSILQTIAPNSITTYFTPNLYAFNLSFAGSQFNYAAAIAIISGVITMIVAYLVQLGGDRNGTKA

Samples

Sample ID Description Type Environment
1 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
2 2558860280 Kutzneria sp. 744 Isolate Unclassified
3 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
4 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
5 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
6 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
7 2643221548 Streptomyces sp. Root55 Isolate Unclassified
8 2643221549 Agromyces sp. Root1464 Isolate Unclassified
9 2643221553 Microbacterium sp. Root553 Isolate Unclassified
10 2643221572 Leifsonia sp. Root60 Isolate Unclassified
11 2643221575 Microbacterium sp. Root61 Isolate Unclassified
12 2643221597 Microbacterium sp. Root180 Isolate Unclassified
13 2643221619 Agromyces sp. Root81 Isolate Unclassified
14 2643221630 Microbacterium sp. Root322 Isolate Unclassified
15 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
16 2643221649 Leifsonia sp. Root4 Isolate Unclassified
17 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
18 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
19 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
20 2643221714 Streptomyces sp. Root264 Isolate Unclassified
21 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
22 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
23 2654587600 Glutamicibacter halophytocola KLBMP5180 Isolate Unclassified
24 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
25 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
26 2738541272 Promicromonospora sp. AC04 Isolate Unclassified
27 2738543027 Promicromonospora sp. CF082 Isolate Unclassified
28 2739367654 Promicromonospora sp. YR516 Isolate Unclassified
29 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
30 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
31 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
32 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
33 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
34 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
35 2799112218 Motilibacter rhizosphaerae DSM 45622 Isolate Rhizosphere
36 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
37 2808606372 Agromyces sp. 23-23 Isolate Unclassified
38 2808606394 Promicromonospora sp. C35 Isolate Unclassified
39 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
40 2808606448 Streptomyces sp. 193411 Isolate Unclassified
41 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
42 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
43 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
44 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
45 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
46 2832004796 Micromonospora endophytica JCM 18317 Isolate Unclassified
47 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
48 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
49 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
50 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
51 2862574272 Streptomyces sp. AcE210 Isolate Nodule
52 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
53 2866065130 Micromonospora endophytica DSM 45430 Isolate Unclassified
54 2867507094 Micromonospora zingiberis PLAI 1-1 Isolate Unclassified
55 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
56 2870622029 Conyzicola lurida DSM 105784 Isolate Unclassified
57 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
58 2887478801 Catellatospora paridis NEAU-CL2 Isolate Rhizosphere
59 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
60 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
61 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
62 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
63 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
64 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
65 2915768154 Amycolatopsis pittospori PIP199 Isolate Unclassified
66 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
67 2919069694 Microbacterium sp. 1154 Isolate Unclassified
68 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
69 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
70 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
71 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
72 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
73 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
74 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
75 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
76 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
77 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
78 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
79 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
80 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
81 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
82 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
83 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
84 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
85 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
86 2977251589 Microbacterium sp. SORGH_AS 505 Isolate Unclassified
87 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
88 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
89 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
90 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
91 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
92 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
93 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
94 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
95 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
96 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
97 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
98 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
99 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
100 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
101 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
102 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
103 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
104 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
105 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
106 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
107 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
108 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
109 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
110 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
111 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
112 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
113 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
114 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
115 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
116 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
117 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
118 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
119 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
120 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
121 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
122 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
123 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
124 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
125 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
126 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
127 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
128 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
129 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
130 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
131 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
132 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
133 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
134 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
135 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
136 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
137 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
138 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
139 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
140 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
141 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
142 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
143 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
144 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
145 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
146 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
147 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
148 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
149 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
150 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
151 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
152 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
153 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
154 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
155 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
156 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
157 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
158 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
159 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
160 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
161 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
162 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
163 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
164 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
165 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
166 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
167 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
168 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
169 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
170 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
171 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
172 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
173 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
174 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
175 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
176 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
177 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
178 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
179 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
180 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
181 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
182 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
183 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
221 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
223 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
224 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
225 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
226 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
227 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
228 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
229 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
230 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
231 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
232 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
233 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
234 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
235 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
236 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
237 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
238 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
239 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
246 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
247 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
248 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
253 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
254 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
255 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
256 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
257 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
258 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
259 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
260 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
261 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
262 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
263 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
264 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
265 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
266 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
267 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
268 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
271 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
272 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
273 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
274 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
275 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
276 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
277 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
278 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
281 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
286 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
287 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
290 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
293 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
294 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
295 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
296 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
297 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
298 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
299 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
300 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
301 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
304 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
305 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
306 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
307 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
308 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
309 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
310 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
311 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
312 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
313 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
314 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
315 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
316 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
317 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
318 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
319 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
320 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
321 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
322 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
323 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
324 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
325 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
326 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
327 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
328 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
329 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
330 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
331 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
332 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
333 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
334 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
335 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
336 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
337 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
338 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
339 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
340 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
341 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
342 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
343 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
344 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
345 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
346 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
347 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
348 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
349 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
350 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
351 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
352 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
353 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
354 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
357 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
358 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
359 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
360 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
361 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
362 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
363 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
364 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
365 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
366 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
367 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
368 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
369 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
370 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
371 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
376 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
377 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
378 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
380 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
381 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
382 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
383 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
385 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
386 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
390 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
391 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
392 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
393 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
394 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
395 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
396 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
397 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
400 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
401 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
402 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
403 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
404 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
405 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
406 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
407 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
408 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
409 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
410 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
411 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
412 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
413 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
414 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
415 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
416 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
417 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
418 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
419 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
420 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
421 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
422 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
426 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
427 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
428 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
429 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
430 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
431 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
432 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.43
Metatranscriptomes 1.32
Isolates 14.25

Biome Distribution

Category Percentage (%)
Aerial Root 0.26
Bulb 0
Endosphere 5.8
Nodule 0.13
Rhizoplane 1.98
Rhizosphere 72.82
Stem 0
Stem Tuber 0
Unclassified 19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10005331 3300001979 Bacteria 5450
2 JGI24740J21852_10006152 3300001979 Bacteria 5006
3 JGI24739J22299_10006370 3300001989 Bacteria 4457
4 JGI24737J22298_10004249 3300001990 Bacteria 5006
5 JGI24737J22298_10004684 3300001990 Bacteria 4758
6 JGI24737J22298_10006796 3300001990 Bacteria 3886
7 JGI24735J21928_10009817 3300002067 Bacteria 3065
8 JGI25406J46586_10036378 3300003203 Bacteria 1787
9 Ga0007423J48922_101173 3300003285 Bacteria 1210
10 rootH2_10054494 3300003320 Bacteria 10589
11 JGI25160J50197_1033347 3300003354 Bacteria 1296
12 Ga0055542_1000019 3300003762 Bacteria 341174
13 Ga0055529_1000008 3300003763 Bacteria 394786
14 Ga0065714_10019207 3300005288 Bacteria 1661
15 Ga0065714_10070907 3300005288 Bacteria 3731
16 Ga0065714_10124698 3300005288 Bacteria 1308
17 Ga0065714_10134026 3300005288 Bacteria 1225
18 Ga0070658_10032918 3300005327 Bacteria 4168
19 Ga0070658_10075763 3300005327 Bacteria 2760
20 Ga0070670_100028121 3300005331 Bacteria 4838
21 Ga0068869_100124994 3300005334 Bacteria 1971
22 Ga0070666_10081315 3300005335 Bacteria 2215
23 Ga0070682_100190302 3300005337 Bacteria 1440
24 Ga0068868_100121058 3300005338 Bacteria 2135
25 Ga0068868_100262897 3300005338 Bacteria 1456
26 Ga0070660_100054899 3300005339 Bacteria 3077
27 Ga0070692_10067378 3300005345 Bacteria 1900
28 Ga0070668_100028603 3300005347 Bacteria 4231
29 Ga0070668_100098861 3300005347 Bacteria 2310
30 Ga0070668_100120163 3300005347 Bacteria 2099
31 Ga0070669_100350890 3300005353 Bacteria 1198
32 Ga0070671_100063234 3300005355 Bacteria 3082
33 Ga0070673_100147998 3300005364 Bacteria 1987
34 Ga0070688_100029008 3300005365 Bacteria 3309
35 Ga0070659_100005438 3300005366 Bacteria 9147
36 Ga0070667_100058987 3300005367 Bacteria 3246
37 Ga0070667_100064126 3300005367 Bacteria 3116
38 Ga0070714_100016573 3300005435 Bacteria 5955
39 Ga0070713_100118526 3300005436 Bacteria 2318
40 Ga0070710_10035951 3300005437 Bacteria 2704
41 Ga0070663_100040694 3300005455 Bacteria 3256
42 Ga0070663_100041340 3300005455 Bacteria 3233
43 Ga0070663_100064990 3300005455 Bacteria 2639
44 Ga0070663_100087576 3300005455 Bacteria 2302
45 Ga0070663_100364064 3300005455 Bacteria 1174
46 Ga0070662_100054231 3300005457 Bacteria 2905
47 Ga0070681_10507867 3300005458 Bacteria 1119
48 Ga0068867_100361785 3300005459 Bacteria 1214
49 Ga0070684_100150625 3300005535 Bacteria 2107
50 Ga0068853_100033935 3300005539 Bacteria 4330
51 Ga0068853_100154855 3300005539 Bacteria 2065
52 Ga0068853_100216893 3300005539 Bacteria 1746
53 Ga0070672_100200057 3300005543 Bacteria 1670
54 Ga0070693_100105415 3300005547 Bacteria 1725
55 Ga0070665_100064997 3300005548 Bacteria 3660
56 Ga0070665_100392855 3300005548 Bacteria 1395
57 Ga0068855_100017723 3300005563 Bacteria 8562
58 Ga0068855_100052979 3300005563 Bacteria 4775
59 Ga0070664_100007052 3300005564 Bacteria 9070
60 Ga0070664_100133943 3300005564 Bacteria 2178
61 Ga0070664_100190005 3300005564 Bacteria 1830
62 Ga0068857_100082953 3300005577 Bacteria 2864
63 Ga0068857_100136752 3300005577 Bacteria 2213
64 Ga0068854_100027500 3300005578 Bacteria 3920
65 Ga0068856_100061526 3300005614 Bacteria 3709
66 Ga0068856_100167799 3300005614 Bacteria 2206
67 Ga0068856_100214592 3300005614 Bacteria 1940
68 Ga0068852_100019092 3300005616 Bacteria 5417
69 Ga0068852_100049796 3300005616 Bacteria 3586
70 Ga0068852_100093308 3300005616 Bacteria 2698
71 Ga0068859_100073431 3300005617 Bacteria 3459
72 Ga0068861_100036096 3300005719 Bacteria 3666
73 Ga0068863_100073776 3300005841 Bacteria 3228
74 Ga0068863_100242204 3300005841 Bacteria 1741
75 Ga0068858_100000023 3300005842 Bacteria 167824
76 Ga0068860_100000631 3300005843 Bacteria 41527
77 Ga0068860_100058287 3300005843 Bacteria 3671
78 Ga0068860_100282675 3300005843 Bacteria 1622
79 Ga0068860_100359322 3300005843 Bacteria 1434
80 Ga0068862_100016342 3300005844 Bacteria 6177
81 Ga0081455_10025631 3300005937 Bacteria 5438
82 Ga0081538_10009829 3300005981 Bacteria 7916
83 Ga0081539_10000195 3300005985 Bacteria 141188
84 Ga0081539_10000448 3300005985 Bacteria 87723
85 Ga0081539_10007488 3300005985 Bacteria 9925
86 Ga0081539_10023811 3300005985 Bacteria 3996
87 Ga0075365_10033648 3300006038 Bacteria 3305
88 Ga0075368_10016741 3300006042 Bacteria 2735
89 Ga0075363_100000519 3300006048 Bacteria 12390
90 Ga0075363_100003846 3300006048 Bacteria 6473
91 Ga0075363_100014117 3300006048 Bacteria 3893
92 Ga0075364_10045923 3300006051 Bacteria 2843
93 Ga0070716_100139241 3300006173 Bacteria 1545
94 Ga0075428_100121249 3300006844 Bacteria 2847
95 Ga0097620_100073434 3300006931 Bacteria 3459
96 Ga0105244_10014945 3300009036 Bacteria 4467
97 Ga0105240_10289365 3300009093 Bacteria 1879
98 Ga0105245_10065478 3300009098 Bacteria 3287
99 Ga0105245_10082940 3300009098 Bacteria 2933
100 Ga0105245_10128358 3300009098 Bacteria 2376
101 Ga0105245_10367355 3300009098 Bacteria 1430
102 Ga0105245_10449152 3300009098 Bacteria 1297
103 Ga0105243_10049273 3300009148 Bacteria 3322
104 Ga0105243_10056055 3300009148 Bacteria 3132
105 Ga0105243_10133487 3300009148 Bacteria 2109
106 Ga0105241_10007724 3300009174 Bacteria 7903
107 Ga0105248_10000365 3300009177 Bacteria 52722
108 Ga0105237_10059324 3300009545 Bacteria 3828
109 Ga0105238_10181378 3300009551 Bacteria 2082
110 Ga0105238_10435019 3300009551 Bacteria 1308
111 Ga0105238_10457777 3300009551 Bacteria 1273
112 Ga0105238_10469174 3300009551 Bacteria 1257
113 Ga0105249_10052646 3300009553 Bacteria 3718
114 Ga0105239_10240254 3300010375 Bacteria 2033
115 Ga0105239_10600906 3300010375 Bacteria 1255
116 Ga0105246_10021889 3300011119 Bacteria 4121
117 Ga0105246_10079086 3300011119 Bacteria 2337
118 Ga0105246_10101360 3300011119 Bacteria 2097
119 Ga0105246_10172798 3300011119 Bacteria 1656
120 Ga0105246_10335942 3300011119 Bacteria 1233
121 Ga0157373_10213522 3300013100 Bacteria 1361
122 Ga0157370_10077269 3300013104 Bacteria 3136
123 Ga0157369_10004513 3300013105 Bacteria 16385
124 Ga0157369_10251578 3300013105 Bacteria 1844
125 Ga0157369_10857486 3300013105 Bacteria 932
126 Ga0157374_10015647 3300013296 Bacteria 6659
127 Ga0157378_10022244 3300013297 Bacteria 5580
128 Ga0163162_10309527 3300013306 Bacteria 1712
129 Ga0157372_10022312 3300013307 Bacteria 6847
130 Ga0157372_10038922 3300013307 Bacteria 5248
131 Ga0157372_10084473 3300013307 Bacteria 3598
132 Ga0157372_10106942 3300013307 Bacteria 3201
133 Ga0157372_10387850 3300013307 Bacteria 1627
134 Ga0157372_10439392 3300013307 Bacteria 1521
135 Ga0157375_10110663 3300013308 Bacteria 2844
136 Ga0157375_10395411 3300013308 Bacteria 1549
137 Ga0157380_10056042 3300014326 Bacteria 3133
138 Ga0182008_10144203 3300014497 Bacteria 1192
139 Ga0157379_10028337 3300014968 Bacteria 4983
140 Ga0157376_10332691 3300014969 Bacteria 1448
141 Ga0183367_1004 3300015688 Bacteria 716880
142 Ga0183367_1012 3300015688 Bacteria 347438
143 Ga0206350_10637427 3300020080 Bacteria 2070
144 Ga0206354_10736904 3300020081 Bacteria 1497
145 Ga0209672_100011 3300025228 Bacteria 856297
146 Ga0209147_100319 3300025229 Bacteria 36693
147 Ga0209148_1000023 3300025254 Bacteria 680511
148 Ga0209455_1000023 3300025272 Bacteria 680449
149 Ga0207426_1013909 3300025302 Bacteria 2966
150 Ga0207655_1009093 3300025728 Bacteria 6216
151 Ga0207692_10011327 3300025898 Bacteria 3790
152 Ga0207647_10027659 3300025904 Bacteria 3694
153 Ga0207705_10008870 3300025909 Bacteria 7328
154 Ga0207705_10033743 3300025909 Bacteria 3657
155 Ga0207695_10009651 3300025913 Bacteria 11899
156 Ga0207671_10019262 3300025914 Bacteria 5221
157 Ga0207671_10186728 3300025914 Bacteria 1615
158 Ga0207649_10022261 3300025920 Bacteria 3661
159 Ga0207694_10115594 3300025924 Bacteria 2138
160 Ga0207694_10123285 3300025924 Bacteria 2071
161 Ga0207650_10066765 3300025925 Bacteria 2698
162 Ga0207687_10094070 3300025927 Bacteria 2192
163 Ga0207700_10061831 3300025928 Bacteria 2842
164 Ga0207664_10044114 3300025929 Bacteria 3490
165 Ga0207664_10108718 3300025929 Bacteria 2303
166 Ga0207690_10001158 3300025932 Bacteria 16695
167 Ga0207706_10024667 3300025933 Bacteria 5389
168 Ga0207709_10066605 3300025935 Bacteria 2269
169 Ga0207709_10090664 3300025935 Bacteria 1997
170 Ga0207670_10035180 3300025936 Bacteria 3245
171 Ga0207704_10097954 3300025938 Bacteria 1946
172 Ga0207691_10081974 3300025940 Bacteria 2899
173 Ga0207711_10000340 3300025941 Bacteria 49514
174 Ga0207711_10143217 3300025941 Bacteria 2152
175 Ga0207689_10028916 3300025942 Bacteria 4633
176 Ga0207661_10187649 3300025944 Bacteria 1811
177 Ga0207679_10016223 3300025945 Bacteria 4942
178 Ga0207667_10009261 3300025949 Bacteria 11626
179 Ga0207667_10031611 3300025949 Bacteria 5712
180 Ga0207712_10053210 3300025961 Bacteria 2839
181 Ga0207668_10016593 3300025972 Bacteria 4598
182 Ga0207668_10055671 3300025972 Bacteria 2751
183 Ga0207640_10080953 3300025981 Bacteria 2219
184 Ga0207658_10027115 3300025986 Bacteria 4023
185 Ga0207658_10222688 3300025986 Bacteria 1588
186 Ga0207658_10226131 3300025986 Bacteria 1577
187 Ga0207677_10101993 3300026023 Bacteria 2114
188 Ga0207677_10114977 3300026023 Bacteria 2012
189 Ga0207703_10000570 3300026035 Bacteria 37836
190 Ga0207703_10010084 3300026035 Bacteria 7405
191 Ga0207639_10112309 3300026041 Bacteria 2223
192 Ga0207639_10198348 3300026041 Bacteria 1719
193 Ga0207678_10000268 3300026067 Bacteria 47323
194 Ga0207678_10001777 3300026067 Bacteria 19740
195 Ga0207678_10014353 3300026067 Bacteria 6966
196 Ga0207678_10062320 3300026067 Bacteria 3206
197 Ga0207678_10335999 3300026067 Bacteria 1301
198 Ga0207702_10148764 3300026078 Bacteria 2128
199 Ga0207702_10155599 3300026078 Bacteria 2084
200 Ga0207702_10238310 3300026078 Bacteria 1703
201 Ga0207641_10241982 3300026088 Bacteria 1682
202 Ga0207674_10013828 3300026116 Bacteria 8930
203 Ga0207674_10019601 3300026116 Bacteria 7323
204 Ga0207674_10213929 3300026116 Bacteria 1876
205 Ga0207675_100012668 3300026118 Bacteria 7879
206 Ga0207683_10126218 3300026121 Bacteria 2300
207 Ga0207698_10012613 3300026142 Bacteria 5538
208 Ga0207698_10255720 3300026142 Bacteria 1606
209 Ga0209813_10007394 3300027866 Bacteria 2735
210 Ga0268264_10001893 3300028381 Bacteria 18990
211 Ga0265326_10000839 3300028558 Bacteria 11296
212 Ga0265319_1004853 3300028563 Bacteria 6581
213 Ga0265323_10038494 3300028653 Bacteria 1748
214 Ga0307517_10002208 3300028786 Bacteria 31459
215 Ga0307517_10017578 3300028786 Bacteria 9314
216 Ga0307517_10062302 3300028786 Bacteria 3510
217 Ga0307515_10000025 3300028794 Bacteria 390205
218 Ga0307515_10013809 3300028794 Bacteria 15051
219 Ga0307515_10083797 3300028794 Bacteria 4105
220 Ga0307515_10091252 3300028794 Bacteria 3809
221 Ga0307515_10109151 3300028794 Bacteria 3252
222 Ga0307515_10250106 3300028794 Bacteria 1527
223 Ga0307511_10038111 3300030521 Bacteria 4136
224 Ga0307512_10004340 3300030522 Bacteria 15637
225 Ga0307512_10004744 3300030522 Bacteria 14668
226 Ga0307512_10025790 3300030522 Bacteria 5200
227 Ga0307512_10033438 3300030522 Bacteria 4420
228 Ga0316177_1029591 3300030731 Bacteria 2697
229 Ga0314311_1194712 3300030733 Bacteria 2621
230 Ga0265332_10002167 3300031238 Bacteria 10112
231 Ga0307513_10000003 3300031456 Bacteria 590921
232 Ga0307513_10049850 3300031456 Bacteria 4532
233 Ga0307513_10069905 3300031456 Bacteria 3672
234 Ga0307513_10188878 3300031456 Bacteria 1914
235 Ga0307509_10045377 3300031507 Bacteria 4739
236 Ga0307508_10025662 3300031616 Bacteria 5340
237 Ga0307508_10051617 3300031616 Bacteria 3655
238 Ga0307508_10072113 3300031616 Bacteria 3028
239 Ga0307508_10231025 3300031616 Bacteria 1448
240 Ga0307508_10364419 3300031616 Bacteria 1036
241 Ga0307514_10064241 3300031649 Bacteria 2784
242 Ga0316579_10000381 3300031691 Bacteria 13953
243 Ga0265314_10004475 3300031711 Bacteria 12960
244 Ga0307405_10083030 3300031731 Bacteria 2099
245 Ga0307405_10116654 3300031731 Bacteria 1819
246 Ga0307406_10000260 3300031901 Bacteria 31960
247 Ga0307406_10073390 3300031901 Bacteria 2250
248 Ga0307406_10183215 3300031901 Bacteria 1526
249 Ga0307412_10005767 3300031911 Bacteria 6966
250 Ga0307412_10138111 3300031911 Bacteria 1781
251 Ga0307409_100472629 3300031995 Bacteria 1215
252 Ga0307409_100599658 3300031995 Bacteria 1088
253 Ga0307416_100061247 3300032002 Bacteria 3070
254 Ga0307414_10091639 3300032004 Bacteria 2260
255 Ga0307414_10102268 3300032004 Bacteria 2159
256 Ga0307415_100285683 3300032126 Bacteria 1359
257 Ga0307507_10015152 3300033179 Bacteria 9099
258 Ga0307507_10029493 3300033179 Bacteria 5815
259 Ga0307507_10045192 3300033179 Bacteria 4337
260 Ga0307510_10090821 3300033180 Bacteria 2899
261 Ga0307510_10106719 3300033180 Bacteria 2562
262 Ga0373951_0000049 3300035091 Bacteria 47611
263 Ga0373962_0002029 3300035242 Bacteria 4827
264 Ga0373935_0048201 3300035692 Bacteria 2697
265 Ga0373925_0480753 3300037068 Bacteria 1019
266 Ga0395899_0000858 3300037312 Bacteria 29037
267 Ga0395898_0022084 3300037466 Bacteria 6447
268 Ga0395898_0350728 3300037466 Bacteria 1407
269 Ga0439436_0017158 3300041404 Bacteria 2167
270 Ga0451789_0309907 3300041443 Bacteria 1538
271 Ga0451793_0665654 3300041452 Bacteria 1494
272 Ga0451807_0658772 3300041486 Bacteria 1895
273 Ga0451841_0651592 3300041498 Bacteria 2753
274 Ga0451845_0977945 3300041501 Bacteria 1804
275 Ga0451847_0489115 3300041503 Bacteria 1301
276 Ga0451843_0451920 3300041509 Bacteria 3334
277 Ga0451853_2189455 3300041512 Bacteria 2369
278 Ga0451853_2722946 3300041512 Bacteria 1448
279 Ga0439449_0001846 3300042007 Bacteria 8336
280 Ga0439449_0066101 3300042007 Bacteria 1333
281 Ga0439455_0073895 3300042012 Bacteria 919
282 Ga0450903_004374 3300042138 Bacteria 2414
283 Ga0439459_0039893 3300042438 Bacteria 994
284 Ga0466969_0020497 3300044656 Bacteria 3423
285 Ga0466969_0028115 3300044656 Bacteria 2874
286 Ga0466969_0057630 3300044656 Bacteria 1893
287 Ga0466969_0059461 3300044656 Bacteria 1858
288 Ga0466972_0006335 3300044658 Bacteria 5945
289 Ga0466972_0012642 3300044658 Bacteria 4240
290 Ga0466965_0022019 3300044683 Bacteria 3071
291 Ga0466965_0031318 3300044683 Bacteria 2593
292 Ga0466966_0005036 3300044684 Bacteria 8688
293 Ga0466966_0005223 3300044684 Bacteria 8535
294 Ga0466966_0036400 3300044684 Bacteria 3177
295 Ga0466966_0062617 3300044684 Bacteria 2345
296 Ga0466966_0212850 3300044684 Bacteria 1168
297 Ga0466961_0000884 3300044693 Bacteria 18652
298 Ga0466961_0004724 3300044693 Bacteria 8568
299 Ga0466961_0044020 3300044693 Bacteria 2857
300 Ga0466961_0216549 3300044693 Bacteria 1181
301 Ga0466963_0000867 3300044694 Bacteria 15312
302 Ga0466964_0002993 3300044706 Bacteria 6119
303 Ga0466971_0000558 3300044719 Bacteria 14746
304 Ga0466971_0012994 3300044719 Bacteria 3653
305 Ga0466971_0015473 3300044719 Bacteria 3358
306 Ga0466970_0000015 3300044765 Bacteria 68954
307 Ga0466970_0000414 3300044765 Bacteria 20867
308 Ga0466970_0140333 3300044765 Bacteria 1331
309 Ga0466957_0002513 3300044842 Bacteria 9870
310 Ga0466957_0031025 3300044842 Bacteria 3193
311 Ga0466960_0001602 3300044901 Bacteria 8282
312 Ga0466960_0008373 3300044901 Bacteria 4234
313 Ga0466960_0027645 3300044901 Bacteria 2590
314 Ga0466959_0008735 3300045049 Bacteria 7173
315 Ga0466959_0015694 3300045049 Bacteria 5523
316 Ga0466959_0172711 3300045049 Bacteria 1515
317 Ga0466958_0027958 3300045836 Bacteria 3340
318 Ga0466967_0004720 3300045976 Bacteria 9265
319 Ga0466967_0244944 3300045976 Bacteria 1711
320 Ga0495617_016044 3300046452 Bacteria 2534
321 Ga0495627_000262 3300046453 Bacteria 53953
322 Ga0495627_005954 3300046453 Bacteria 4845
323 Ga0495627_013966 3300046453 Bacteria 2816
324 Ga0495592_0001835 3300046454 Bacteria 14933
325 Ga0495592_0012547 3300046454 Bacteria 6439
326 Ga0495592_0025591 3300046454 Bacteria 4478
327 Ga0495592_0079471 3300046454 Bacteria 2374
328 Ga0495603_0002711 3300046455 Bacteria 10439
329 Ga0495603_0012538 3300046455 Bacteria 5131
330 Ga0495629_0000729 3300046459 Bacteria 26703
331 Ga0495629_0021514 3300046459 Bacteria 4602
332 Ga0495629_0044899 3300046459 Bacteria 3100
333 Ga0495629_0051579 3300046459 Bacteria 2879
334 Ga0495629_0053946 3300046459 Bacteria 2811
335 Ga0495629_0055563 3300046459 Bacteria 2768
336 Ga0495629_0087060 3300046459 Bacteria 2179
337 Ga0495638_0024173 3300046460 Bacteria 3965
338 Ga0495638_0032867 3300046460 Bacteria 3321
339 Ga0495638_0040207 3300046460 Bacteria 2964
340 Ga0495651_0003934 3300046462 Bacteria 11355
341 Ga0495651_0010033 3300046462 Bacteria 7280
342 Ga0495651_0035198 3300046462 Bacteria 3901
343 Ga0495651_0038322 3300046462 Bacteria 3733
344 Ga0495651_0191798 3300046462 Bacteria 1437
345 Ga0495653_0231846 3300046463 Bacteria 1235
346 Ga0495580_0028759 3300046472 Bacteria 4038
347 Ga0495580_0192351 3300046472 Bacteria 1407
348 Ga0495605_0001464 3300046474 Bacteria 15422
349 Ga0495605_0009059 3300046474 Bacteria 5603
350 Ga0495662_0002684 3300046476 Bacteria 8984
351 Ga0495662_0042302 3300046476 Bacteria 2199
352 Ga0495664_0001605 3300046477 Bacteria 12024
353 Ga0495664_0079574 3300046477 Bacteria 1964
354 Ga0495585_0063938 3300046492 Bacteria 2018
355 Ga0495594_0004036 3300046499 Bacteria 7552
356 Ga0495594_0010260 3300046499 Bacteria 4853
357 Ga0495594_0022491 3300046499 Bacteria 3372
358 Ga0495594_0037253 3300046499 Bacteria 2653
359 Ga0495607_0010980 3300046501 Bacteria 6055
360 Ga0495583_0005674 3300046506 Bacteria 8397
361 Ga0495583_0049245 3300046506 Bacteria 1930
362 Ga0495606_0024232 3300046507 Bacteria 4379
363 Ga0495608_0017280 3300046511 Bacteria 4992
364 Ga0495608_0023706 3300046511 Bacteria 4203
365 Ga0495610_0057477 3300046512 Bacteria 1865
366 Ga0495610_0086092 3300046512 Bacteria 1432
367 Ga0495610_0100765 3300046512 Bacteria 1294
368 Ga0495616_0003623 3300046513 Bacteria 9870
369 Ga0495618_0023361 3300046514 Bacteria 3822
370 Ga0495620_0011710 3300046515 Bacteria 4561
371 Ga0495620_0011920 3300046515 Bacteria 4516
372 Ga0495620_0032034 3300046515 Bacteria 2400
373 Ga0495628_0008151 3300046516 Bacteria 9014
374 Ga0495628_0079845 3300046516 Bacteria 2543
375 Ga0495630_0239422 3300046517 Bacteria 1387
376 Ga0495631_0002744 3300046518 Bacteria 9760
377 Ga0495631_0055508 3300046518 Bacteria 1726
378 Ga0495632_0030339 3300046519 Bacteria 2807
379 Ga0495643_0001461 3300046522 Bacteria 21642
380 Ga0495643_0002615 3300046522 Bacteria 14014
381 Ga0495648_0007727 3300046524 Bacteria 8564
382 Ga0495648_0150717 3300046524 Bacteria 1213
383 Ga0495642_0051214 3300046528 Bacteria 1698
384 Ga0495652_0003943 3300046529 Bacteria 14406
385 Ga0495652_0016428 3300046529 Bacteria 6622
386 Ga0495654_0041408 3300046530 Bacteria 2291
387 Ga0495654_0109047 3300046530 Bacteria 1265
388 Ga0495640_0005159 3300046533 Bacteria 10386
389 Ga0495640_0119162 3300046533 Bacteria 1717
390 Ga0495587_0136261 3300046536 Bacteria 1402
391 Ga0495609_0043885 3300046538 Bacteria 2006
392 Ga0495597_0013328 3300046542 Bacteria 3942
393 Ga0495597_0093314 3300046542 Bacteria 1275
394 Ga0495645_0017788 3300046543 Bacteria 5098
395 Ga0495645_0075474 3300046543 Bacteria 2426
396 Ga0495622_0039732 3300046557 Bacteria 2190
397 Ga0495633_0008115 3300046558 Bacteria 5954
398 Ga0495668_0004244 3300046616 Bacteria 10297
399 Ga0495668_0056109 3300046616 Bacteria 2174
400 Ga0495668_0061984 3300046616 Bacteria 2061
401 Ga0495634_0000745 3300046642 Bacteria 31538
402 Ga0495634_0040422 3300046642 Bacteria 3172
403 Ga0495634_0051933 3300046642 Bacteria 2750
404 Ga0495611_0070609 3300046648 Bacteria 1596
405 Ga0495611_0113928 3300046648 Bacteria 1259
406 Ga0495625_0000716 3300046660 Bacteria 46718
407 Ga0495625_0003926 3300046660 Bacteria 14294
408 Ga0495625_0038206 3300046660 Bacteria 3516
409 Ga0495625_0043973 3300046660 Bacteria 3236
410 Ga0495625_0046547 3300046660 Bacteria 3129
411 Ga0495625_0175179 3300046660 Bacteria 1429
412 Ga0495635_0003608 3300046663 Bacteria 10717
413 Ga0495635_0007408 3300046663 Bacteria 7657
414 Ga0495635_0052328 3300046663 Bacteria 2813
415 Ga0495661_0015815 3300046665 Bacteria 5025
416 Ga0495661_0027183 3300046665 Bacteria 3675
417 Ga0495588_0006810 3300046674 Bacteria 5173
418 Ga0495588_0014053 3300046674 Bacteria 3826
419 Ga0495657_0003773 3300046675 Bacteria 12271
420 Ga0495657_0032694 3300046675 Bacteria 3628
421 Ga0495623_0005945 3300046679 Bacteria 7954
422 Ga0495623_0011396 3300046679 Bacteria 5754
423 Ga0495623_0040473 3300046679 Bacteria 2976
424 Ga0495646_0000930 3300046680 Bacteria 16647
425 Ga0495646_0108576 3300046680 Bacteria 1582
426 Ga0495613_0007455 3300046689 Bacteria 8150
427 Ga0495613_0036920 3300046689 Bacteria 3622
428 Ga0495613_0085176 3300046689 Bacteria 2293
429 Ga0495613_0111525 3300046689 Bacteria 1970
430 Ga0495613_0149311 3300046689 Bacteria 1667
431 Ga0495624_0110289 3300046690 Bacteria 1692
432 Ga0495624_0129514 3300046690 Bacteria 1547
433 Ga0495624_0164919 3300046690 Bacteria 1352
434 Ga0495670_0075345 3300046691 Bacteria 1713
435 Ga0495671_0006199 3300046692 Bacteria 6938
436 Ga0495671_0068271 3300046692 Bacteria 1748
437 Ga0495649_0190780 3300046694 Bacteria 1067
438 Ga0495649_0214648 3300046694 Bacteria 996
439 Ga0495589_0017668 3300046794 Bacteria 3660
440 Ga0495589_0019866 3300046794 Bacteria 3437
441 Ga0495589_0102965 3300046794 Bacteria 1380
442 Ga0495589_0143118 3300046794 Bacteria 1144
443 Ga0495600_0014454 3300046809 Bacteria 4975
444 Ga0495600_0047004 3300046809 Bacteria 2815
445 Ga0495600_0071443 3300046809 Bacteria 2267
446 Ga0495581_0128366 3300047315 Bacteria 1477
447 Ga0495604_0000558 3300047317 Bacteria 32740
448 Ga0495604_0033881 3300047317 Bacteria 4041
449 Ga0495604_0127657 3300047317 Bacteria 1831
450 Ga0495636_0011685 3300047318 Bacteria 3478
451 Ga0495636_0054113 3300047318 Bacteria 1686
452 Ga0495674_0064437 3300047319 Bacteria 3186
453 Ga0495674_0074986 3300047319 Bacteria 2912
454 Ga0495676_0000768 3300047321 Bacteria 26771
455 Ga0495676_0001734 3300047321 Bacteria 19047
456 Ga0495676_0002784 3300047321 Bacteria 15725
457 Ga0495676_0007466 3300047321 Bacteria 10026
458 Ga0495676_0016330 3300047321 Bacteria 6593
459 Ga0495676_0034542 3300047321 Bacteria 4242
460 Ga0495680_0002951 3300047322 Bacteria 17021
461 Ga0495680_0027354 3300047322 Bacteria 4688
462 Ga0495680_0119389 3300047322 Bacteria 1948
463 Ga0495683_0005247 3300047323 Bacteria 7200
464 Ga0495683_0015981 3300047323 Bacteria 3898
465 Ga0495683_0035571 3300047323 Bacteria 2531
466 Ga0495683_0038615 3300047323 Bacteria 2417
467 Ga0495687_003729 3300047443 Bacteria 10805
468 Ga0495687_026079 3300047443 Bacteria 2755
469 Ga0495687_030465 3300047443 Bacteria 2483
470 Ga0495687_039268 3300047443 Bacteria 2095
471 Ga0495687_070979 3300047443 Bacteria 1396
472 Ga0495675_0011602 3300047444 Bacteria 5532
473 Ga0495675_0085730 3300047444 Bacteria 1980
474 Ga0495685_001450 3300047447 Bacteria 7268
475 Ga0495685_005944 3300047447 Bacteria 3983
476 Ga0495685_007130 3300047447 Bacteria 3683
477 Ga0495685_008265 3300047447 Bacteria 3450
478 Ga0495685_028691 3300047447 Bacteria 1914
479 Ga0495685_057995 3300047447 Bacteria 1307
480 Ga0495681_0009151 3300047470 Bacteria 6128
481 Ga0495681_0016568 3300047470 Bacteria 4123
482 Ga0495681_0046037 3300047470 Bacteria 2083
483 Ga0495686_0064577 3300047472 Bacteria 2265
484 Ga0495593_0027906 3300047673 Bacteria 3103
485 Ga0495593_0110296 3300047673 Bacteria 1405
486 Ga0495602_0034326 3300048088 Bacteria 4747
487 Ga0495602_0069826 3300048088 Bacteria 3010
488 Ga0495614_0000340 3300048089 Bacteria 18522
489 Ga0495614_0001852 3300048089 Bacteria 9262
490 Ga0495614_0007790 3300048089 Bacteria 4760
491 Ga0495614_0025542 3300048089 Bacteria 2547
492 Ga0495614_0095658 3300048089 Bacteria 1294
493 Ga0495626_0000069 3300048091 Bacteria 139104
494 Ga0495626_0008702 3300048091 Bacteria 5533
495 Ga0495626_0106559 3300048091 Bacteria 1217
496 Ga0496100_0014827 3300048903 Bacteria 4535
497 Ga0496101_0041456 3300048904 Bacteria 3282
498 Ga0496105_0038857 3300048908 Bacteria 3921
499 Ga0496105_0174257 3300048908 Bacteria 1763
500 Ga0496109_0026506 3300048912 Bacteria 5169
501 Ga0496109_0279976 3300048912 Bacteria 1572
502 Ga0496111_0222913 3300048914 Bacteria 1401
503 Ga0496113_0020066 3300048916 Bacteria 4691
504 Ga0496114_0028597 3300048917 Bacteria 4575
505 Ga0496114_0091095 3300048917 Bacteria 2589
506 Ga0496114_0179734 3300048917 Bacteria 1847
507 Ga0496115_0016015 3300048918 Bacteria 5701
508 Ga0496116_0015383 3300048919 Bacteria 6048
509 Ga0496117_0000091 3300048920 Bacteria 203826
510 Ga0496117_0007274 3300048920 Bacteria 10878
511 Ga0496117_0013877 3300048920 Bacteria 6986
512 Ga0496117_0050726 3300048920 Bacteria 2940
513 Ga0496117_0061202 3300048920 Bacteria 2589
514 Ga0496118_0009188 3300048921 Bacteria 10036
515 Ga0496118_0019417 3300048921 Bacteria 6075
516 Ga0496118_0033190 3300048921 Bacteria 4239
517 Ga0496118_0038621 3300048921 Bacteria 3823
518 Ga0496118_0113819 3300048921 Bacteria 1786
519 Ga0496119_0002470 3300048922 Bacteria 20282
520 Ga0496119_0003177 3300048922 Bacteria 17224
521 Ga0496119_0013259 3300048922 Bacteria 6588
522 Ga0496119_0019300 3300048922 Bacteria 5028
523 Ga0496119_0046464 3300048922 Bacteria 2711
524 Ga0496119_0157334 3300048922 Bacteria 1212
525 Ga0496120_0002278 3300048923 Bacteria 19927
526 Ga0496120_0009274 3300048923 Bacteria 7003
527 Ga0496120_0022202 3300048923 Bacteria 3995
528 Ga0496120_0094663 3300048923 Bacteria 1589
529 Ga0496121_0018146 3300048924 Bacteria 7117
530 Ga0496121_0046122 3300048924 Bacteria 3734
531 Ga0496122_0000208 3300048925 Bacteria 131175
532 Ga0496122_0002225 3300048925 Bacteria 28245
533 Ga0496122_0004690 3300048925 Bacteria 16786
534 Ga0496122_0025057 3300048925 Bacteria 5198
535 Ga0496122_0043875 3300048925 Bacteria 3498
536 Ga0496122_0075344 3300048925 Bacteria 2381
537 Ga0496123_0000003 3300048926 Bacteria 866556
538 Ga0496123_0086936 3300048926 Bacteria 1872
539 Ga0496124_0005331 3300048927 Bacteria 14521
540 Ga0496124_0029713 3300048927 Bacteria 4862
541 Ga0496124_0104611 3300048927 Bacteria 2289
542 Ga0496125_0000224 3300048928 Bacteria 115811
543 Ga0496125_0002214 3300048928 Bacteria 25925
544 Ga0496125_0003079 3300048928 Bacteria 20827
545 Ga0496125_0022669 3300048928 Bacteria 5824
546 Ga0496125_0036883 3300048928 Bacteria 4258
547 Ga0496126_0004390 3300048929 Bacteria 16907
548 Ga0496126_0014193 3300048929 Bacteria 8063
549 Ga0496126_0037356 3300048929 Bacteria 4533
550 Ga0496126_0041606 3300048929 Bacteria 4250
551 Ga0496126_0054157 3300048929 Bacteria 3635
552 Ga0496126_0123466 3300048929 Bacteria 2243
553 Ga0495678_039791 3300049459 Bacteria 1894
554 Ga0501316_000983 3300049532 Bacteria 2259
555 Ga0501317_004626 3300049533 Bacteria 1441
556 Ga0501325_003275 3300049541 Bacteria 1170
557 Ga0501031_0000972 3300049568 Bacteria 17408
558 Ga0501031_0007808 3300049568 Bacteria 6964
559 Ga0501031_0051818 3300049568 Bacteria 2673
560 Ga0501032_0012147 3300049569 Bacteria 6164
561 Ga0501032_0053596 3300049569 Bacteria 2716
562 Ga0501033_0020412 3300049570 Bacteria 5004
563 Ga0501033_0026109 3300049570 Bacteria 4396
564 Ga0501033_0167464 3300049570 Bacteria 1579
565 Ga0501034_0006353 3300049571 Bacteria 12725
566 Ga0501034_0027867 3300049571 Bacteria 5744
567 Ga0501034_0029066 3300049571 Bacteria 5620
568 Ga0501034_0074610 3300049571 Bacteria 3399
569 Ga0501034_0081820 3300049571 Bacteria 3231
570 Ga0501034_0081881 3300049571 Bacteria 3230
571 Ga0501036_0009130 3300049572 Bacteria 8154
572 Ga0501036_0011179 3300049572 Bacteria 7428
573 Ga0501037_0001882 3300049573 Bacteria 15254
574 Ga0501037_0010177 3300049573 Bacteria 6900
575 Ga0501037_0012569 3300049573 Bacteria 6238
576 Ga0501037_0186660 3300049573 Bacteria 1469
577 Ga0501038_0017119 3300049574 Bacteria 6556
578 Ga0501038_0023621 3300049574 Bacteria 5493
579 Ga0501038_0032115 3300049574 Bacteria 4634
580 Ga0501039_0027217 3300049575 Bacteria 4396
581 Ga0501040_0013161 3300049576 Bacteria 5440
582 Ga0501041_0010140 3300049577 Bacteria 5552
583 Ga0501042_0098644 3300049578 Bacteria 2100
584 Ga0501043_0002210 3300049579 Bacteria 16595
585 Ga0501043_0003543 3300049579 Bacteria 12828
586 Ga0501043_0060165 3300049579 Bacteria 2981
587 Ga0501046_0005693 3300049580 Bacteria 11123
588 Ga0501046_0025094 3300049580 Bacteria 4881
589 Ga0501047_0000121 3300049581 Bacteria 95409
590 Ga0501047_0003988 3300049581 Bacteria 13874
591 Ga0501047_0021044 3300049581 Bacteria 6264
592 Ga0501048_0002990 3300049582 Bacteria 12903
593 Ga0501048_0056201 3300049582 Bacteria 2792
594 Ga0501048_0297675 3300049582 Bacteria 1148
595 Ga0501069_0016086 3300049585 Bacteria 4013
596 Ga0501070_0003316 3300049586 Bacteria 13984
597 Ga0501072_0015578 3300049588 Bacteria 5827
598 Ga0501073_0021099 3300049589 Bacteria 4697
599 Ga0501077_0041060 3300049593 Bacteria 2946
600 Ga0501223_013986 3300049663 Bacteria 1594
601 Ga0501221_032295 3300049704 Bacteria 1099
602 Ga0501079_0001236 3300049741 Bacteria 17901
603 Ga0501035_0003738 3300049822 Bacteria 14513
604 Ga0501035_0005876 3300049822 Bacteria 11560
605 Ga0501035_0104416 3300049822 Bacteria 2485
606 Ga0501035_0185520 3300049822 Bacteria 1790
607 Ga0501044_0003883 3300049823 Bacteria 16749
608 Ga0501044_0041214 3300049823 Bacteria 4807
609 Ga0501044_0052776 3300049823 Bacteria 4186
610 Ga0501044_0111273 3300049823 Bacteria 2746
611 Ga0501045_0059045 3300049824 Bacteria 2809
612 nmdc:mga03n38_26092_c1 3300050490 Bacteria 2409
613 nmdc:mga03n38_2870_c1 3300050490 Bacteria 5426
614 nmdc:mga00v17_38795_c1 3300050491 Bacteria 2850
615 nmdc:mga00v17_5124_c1 3300050491 Bacteria 6890
616 nmdc:mga0yw44_28577_c1 3300050492 Bacteria 3210
617 nmdc:mga0yw44_9209_c1 3300050492 Bacteria 4972
618 nmdc:mga06z11_3762_c1 3300050494 Bacteria 5898
619 nmdc:mga04h51_8599_c1 3300050495 Bacteria 2734
620 nmdc:mga07m45_71397_c1 3300050496 Bacteria 1975
621 nmdc:mga07m45_91993_c1 3300050496 Bacteria 1738
622 nmdc:mga0sz30_23290_c1 3300050516 Bacteria 2518
623 Ga0495612_0001248 3300053078 Bacteria 10486
624 Ga0495619_0062154 3300053085 Bacteria 2486
625 Ga0495619_0092287 3300053085 Bacteria 2051
626 Ga0500644_0008624 3300053088 Bacteria 2696
627 Ga0500644_0055941 3300053088 Bacteria 1372
628 Ga0500646_0000126 3300053090 Bacteria 21536
629 Ga0500651_0023360 3300053093 Bacteria 3873
630 Ga0500641_0119771 3300053096 Bacteria 1134
631 Ga0500560_000339 3300053107 Bacteria 6099
632 Ga0500569_005054 3300053109 Bacteria 2813
633 Ga0500573_0003653 3300053140 Bacteria 7992
634 Ga0500573_0022965 3300053140 Bacteria 3581
635 Ga0500573_0029601 3300053140 Bacteria 3156
636 Ga0500577_0016442 3300053142 Bacteria 2332
637 Ga0500577_0107400 3300053142 Bacteria 1148
638 Ga0500579_030636 3300053143 Bacteria 3452
639 Ga0500600_0027133 3300053149 Bacteria 3395
640 Ga0500600_0215426 3300053149 Bacteria 891
641 Ga0500616_0001029 3300053153 Bacteria 29567
642 Ga0500616_0001796 3300053153 Bacteria 19540
643 Ga0500633_0096863 3300053160 Bacteria 1083
644 Ga0501084_0004162 3300054114 Bacteria 11796
645 Ga0587080_013214 3300059503 Bacteria 1261
646 Ga0587080_021017 3300059503 Bacteria 1071
647 Ga0587088_003435 3300059508 Bacteria 1918
648 Ga0587102_009367 3300059649 Bacteria 949
649 Ga0501082_0015621 3300060353 Bacteria 6534
650 Ga0466962_0002388 3300061719 Bacteria 8900

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046459 Ga0495629_0055563 Ga0495629_0055563_443_1258 225
2 3300005355 Ga0070671_100063234 Ga0070671_1000632341 228
3 3300009098 Ga0105245_10065478 Ga0105245_100654782 229
4 3300025927 Ga0207687_10094070 Ga0207687_100940702 229
5 3300005331 Ga0070670_100028121 Ga0070670_1000281214 232
6 3300005334 Ga0068869_100124994 Ga0068869_1001249941 232
7 3300005364 Ga0070673_100147998 Ga0070673_1001479982 232
8 3300005455 Ga0070663_100064990 Ga0070663_1000649902 232
9 3300005459 Ga0068867_100361785 Ga0068867_1003617851 232
10 3300005548 Ga0070665_100064997 Ga0070665_1000649973 232
11 3300005564 Ga0070664_100190005 Ga0070664_1001900051 232
12 3300014326 Ga0157380_10056042 Ga0157380_100560422 232
13 3300014497 Ga0182008_10144203 Ga0182008_101442032 232
14 3300025914 Ga0207671_10186728 Ga0207671_101867282 232
15 3300025936 Ga0207670_10035180 Ga0207670_100351802 232
16 3300025940 Ga0207691_10081974 Ga0207691_100819743 232
17 3300025942 Ga0207689_10028916 Ga0207689_100289162 232
18 3300026067 Ga0207678_10014353 Ga0207678_100143533 232
19 3300026116 Ga0207674_10019601 Ga0207674_100196013 232
20 3300026121 Ga0207683_10126218 Ga0207683_101262183 232
21 3300035091 Ga0373951_0000049 Ga0373951_0000049_43085_43972 232
22 3300005345 Ga0070692_10067378 Ga0070692_100673781 233
23 3300013307 Ga0157372_10387850 Ga0157372_103878502 233
24 3300049663 Ga0501223_013986 Ga0501223_013986_729_1547 233
25 3300014969 Ga0157376_10332691 Ga0157376_103326912 234
26 3300003203 JGI25406J46586_10036378 JGI25406J46586_100363782 235
27 3300005985 Ga0081539_10000195 Ga0081539_1000019540 235
28 3300048929 Ga0496126_0123466 Ga0496126_0123466_1033_1869 236
29 3300044765 Ga0466970_0140333 Ga0466970_0140333_150_1082 237
30 3300009551 Ga0105238_10435019 Ga0105238_104350191 240
31 3300025924 Ga0207694_10115594 Ga0207694_101155942 240
32 3300031995 Ga0307409_100472629 Ga0307409_1004726291 240
33 3300028794 Ga0307515_10091252 Ga0307515_100912523 242
34 3300048919 Ga0496116_0015383 Ga0496116_0015383_773_1693 242
35 3300048920 Ga0496117_0061202 Ga0496117_0061202_318_1238 242
36 3300048921 Ga0496118_0009188 Ga0496118_0009188_8114_9034 242
37 3300048922 Ga0496119_0003177 Ga0496119_0003177_4023_4943 242
38 3300048925 Ga0496122_0000208 Ga0496122_0000208_76479_77399 242
39 3300048925 Ga0496122_0004690 Ga0496122_0004690_2320_3255 242
40 3300048926 Ga0496123_0000003 Ga0496123_0000003_74113_75033 242
41 3300048927 Ga0496124_0005331 Ga0496124_0005331_6838_7758 242
42 3300048928 Ga0496125_0003079 Ga0496125_0003079_12549_13484 242
43 3300048928 Ga0496125_0036883 Ga0496125_0036883_641_1561 242
44 3300048929 Ga0496126_0054157 Ga0496126_0054157_446_1366 242
45 3300035692 Ga0373935_0048201 Ga0373935_0048201_1551_2456 243
46 3300049541 Ga0501325_003275 Ga0501325_003275_268_1116 243
47 3300005563 Ga0068855_100017723 Ga0068855_1000177237 244
48 3300005614 Ga0068856_100167799 Ga0068856_1001677992 244
49 3300009174 Ga0105241_10007724 Ga0105241_100077242 244
50 3300009545 Ga0105237_10059324 Ga0105237_100593242 244
51 3300025914 Ga0207671_10019262 Ga0207671_100192622 244
52 3300025949 Ga0207667_10031611 Ga0207667_100316113 244
53 3300026078 Ga0207702_10238310 Ga0207702_102383101 244
54 3300028786 Ga0307517_10062302 Ga0307517_100623023 244
55 3300047443 Ga0495687_003729 Ga0495687_003729_8309_9154 244
56 3300041503 Ga0451847_0489115 Ga0451847_0489115_81_1049 245
57 3300046477 Ga0495664_0079574 Ga0495664_0079574_1054_1872 245
58 3300046694 Ga0495649_0214648 Ga0495649_0214648_102_920 245
59 3300048089 Ga0495614_0095658 Ga0495614_0095658_411_1229 245
60 3300053096 Ga0500641_0119771 Ga0500641_0119771_261_1079 245
61 3300005367 Ga0070667_100064126 Ga0070667_1000641262 247
62 3300003285 Ga0007423J48922_101173 Ga0007423J48922_1011732 248
63 3300005616 Ga0068852_100093308 Ga0068852_1000933083 248
64 3300006048 Ga0075363_100003846 Ga0075363_1000038463 248
65 3300015688 Ga0183367_1004 Ga0183367_1004496 248
66 3300025924 Ga0207694_10123285 Ga0207694_101232852 248
67 3300033179 Ga0307507_10045192 Ga0307507_100451921 248
68 3300050490 nmdc:mga03n38_2870_c1 nmdc:mga03n38_2870_c1_3144_4022 248
69 3300046648 Ga0495611_0070609 Ga0495611_0070609_59_880 249
70 3300005327 Ga0070658_10032918 Ga0070658_100329183 250
71 3300005338 Ga0068868_100121058 Ga0068868_1001210582 250
72 3300005347 Ga0070668_100120163 Ga0070668_1001201632 250
73 3300005353 Ga0070669_100350890 Ga0070669_1003508901 250
74 3300005365 Ga0070688_100029008 Ga0070688_1000290082 250
75 3300005367 Ga0070667_100058987 Ga0070667_1000589873 250
76 3300005437 Ga0070710_10035951 Ga0070710_100359512 250
77 3300005535 Ga0070684_100150625 Ga0070684_1001506252 250
78 3300005539 Ga0068853_100033935 Ga0068853_1000339352 250
79 3300005543 Ga0070672_100200057 Ga0070672_1002000572 250
80 3300005547 Ga0070693_100105415 Ga0070693_1001054152 250
81 3300005577 Ga0068857_100082953 Ga0068857_1000829532 250
82 3300005719 Ga0068861_100036096 Ga0068861_1000360963 250
83 3300005841 Ga0068863_100073776 Ga0068863_1000737762 250
84 3300005843 Ga0068860_100000631 Ga0068860_1000006317 250
85 3300005843 Ga0068860_100359322 Ga0068860_1003593221 250
86 3300005844 Ga0068862_100016342 Ga0068862_1000163425 250
87 3300006173 Ga0070716_100139241 Ga0070716_1001392412 250
88 3300009098 Ga0105245_10367355 Ga0105245_103673551 250
89 3300011119 Ga0105246_10335942 Ga0105246_103359422 250
90 3300013105 Ga0157369_10857486 Ga0157369_108574861 250
91 3300013297 Ga0157378_10022244 Ga0157378_100222442 250
92 3300025898 Ga0207692_10011327 Ga0207692_100113272 250
93 3300025909 Ga0207705_10033743 Ga0207705_100337433 250
94 3300025938 Ga0207704_10097954 Ga0207704_100979542 250
95 3300025986 Ga0207658_10222688 Ga0207658_102226881 250
96 3300026023 Ga0207677_10101993 Ga0207677_101019932 250
97 3300026041 Ga0207639_10112309 Ga0207639_101123092 250
98 3300026116 Ga0207674_10213929 Ga0207674_102139292 250
99 3300026118 Ga0207675_100012668 Ga0207675_1000126683 250
100 3300028381 Ga0268264_10001893 Ga0268264_1000189317 250
101 3300028794 Ga0307515_10013809 Ga0307515_1001380912 250
102 3300031616 Ga0307508_10025662 Ga0307508_100256623 250
103 3300037068 Ga0373925_0480753 Ga0373925_0480753_114_1001 250
104 3300041452 Ga0451793_0665654 Ga0451793_0665654_417_1304 250
105 3300041486 Ga0451807_0658772 Ga0451807_0658772_76_963 250
106 3300041509 Ga0451843_0451920 Ga0451843_0451920_1806_2693 250
107 3300048917 Ga0496114_0091095 Ga0496114_0091095_535_1377 250
108 3300048923 Ga0496120_0094663 Ga0496120_0094663_158_1039 250
109 3300050492 nmdc:mga0yw44_9209_c1 nmdc:mga0yw44_9209_c1_3356_4216 250
110 3300053088 Ga0500644_0055941 Ga0500644_0055941_110_997 250
111 3300053093 Ga0500651_0023360 Ga0500651_0023360_650_1567 250
112 3300053109 Ga0500569_005054 Ga0500569_005054_1635_2552 250
113 3300001990 JGI24737J22298_10006796 JGI24737J22298_100067962 251
114 3300005843 Ga0068860_100058287 Ga0068860_1000582873 251
115 3300011119 Ga0105246_10079086 Ga0105246_100790862 251
116 3300013307 Ga0157372_10439392 Ga0157372_104393922 251
117 3300025904 Ga0207647_10027659 Ga0207647_100276593 251
118 3300025972 Ga0207668_10055671 Ga0207668_100556712 251
119 3300025986 Ga0207658_10226131 Ga0207658_102261312 251
120 3300026023 Ga0207677_10114977 Ga0207677_101149772 251
121 3300026035 Ga0207703_10010084 Ga0207703_100100844 251
122 3300005288 Ga0065714_10070907 Ga0065714_100709071 252
123 3300005564 Ga0070664_100133943 Ga0070664_1001339432 252
124 3300025929 Ga0207664_10108718 Ga0207664_101087182 252
125 3300028794 Ga0307515_10083797 Ga0307515_100837974 252
126 3300030522 Ga0307512_10004340 Ga0307512_100043409 252
127 3300031691 Ga0316579_10000381 Ga0316579_100003812 252
128 3300044901 Ga0466960_0008373 Ga0466960_0008373_3228_4136 252
129 3300046675 Ga0495657_0003773 Ga0495657_0003773_1803_2699 252
130 3300053142 Ga0500577_0016442 Ga0500577_0016442_854_1726 252
131 3300053160 Ga0500633_0096863 Ga0500633_0096863_98_970 252
132 3300059508 Ga0587088_003435 Ga0587088_003435_211_1119 252
133 3300059649 Ga0587102_009367 Ga0587102_009367_12_920 252
134 3300009551 Ga0105238_10181378 Ga0105238_101813782 253
135 3300010375 Ga0105239_10600906 Ga0105239_106009062 253
136 3300031901 Ga0307406_10073390 Ga0307406_100733902 253
137 3300044684 Ga0466966_0212850 Ga0466966_0212850_212_1081 253
138 3300048920 Ga0496117_0000091 Ga0496117_0000091_119841_120764 253
139 3300048920 Ga0496117_0013877 Ga0496117_0013877_322_1242 253
140 3300048921 Ga0496118_0038621 Ga0496118_0038621_327_1247 253
141 3300048922 Ga0496119_0002470 Ga0496119_0002470_7235_8158 253
142 3300048922 Ga0496119_0019300 Ga0496119_0019300_1401_2324 253
143 3300048923 Ga0496120_0002278 Ga0496120_0002278_12100_13023 253
144 3300048923 Ga0496120_0009274 Ga0496120_0009274_1346_2269 253
145 3300048925 Ga0496122_0025057 Ga0496122_0025057_3860_4780 253
146 3300048925 Ga0496122_0043875 Ga0496122_0043875_1363_2286 253
147 3300048926 Ga0496123_0086936 Ga0496123_0086936_731_1654 253
148 3300048927 Ga0496124_0029713 Ga0496124_0029713_2553_3476 253
149 3300048928 Ga0496125_0002214 Ga0496125_0002214_1322_2245 253
150 3300048929 Ga0496126_0014193 Ga0496126_0014193_1390_2313 253
151 3300049571 Ga0501034_0029066 Ga0501034_0029066_1209_2123 253
152 3300053149 Ga0500600_0215426 Ga0500600_0215426_16_840 253
153 3300005327 Ga0070658_10075763 Ga0070658_100757632 254
154 3300005455 Ga0070663_100041340 Ga0070663_1000413403 254
155 3300006048 Ga0075363_100000519 Ga0075363_10000051910 254
156 3300025944 Ga0207661_10187649 Ga0207661_101876491 254
157 3300049532 Ga0501316_000983 Ga0501316_000983_120_1046 254
158 3300049533 Ga0501317_004626 Ga0501317_004626_396_1322 254
159 3300006844 Ga0075428_100121249 Ga0075428_1001212493 255
160 3300015688 Ga0183367_1012 Ga0183367_1012225 255
161 3300042007 Ga0439449_0001846 Ga0439449_0001846_1951_2877 255
162 3300044656 Ga0466969_0028115 Ga0466969_0028115_1138_2070 255
163 3300044658 Ga0466972_0006335 Ga0466972_0006335_390_1289 255
164 3300044684 Ga0466966_0005036 Ga0466966_0005036_4728_5660 255
165 3300044693 Ga0466961_0044020 Ga0466961_0044020_142_1074 255
166 3300044719 Ga0466971_0015473 Ga0466971_0015473_965_1897 255
167 3300044765 Ga0466970_0000015 Ga0466970_0000015_40950_41849 255
168 3300045049 Ga0466959_0008735 Ga0466959_0008735_4073_5005 255
169 3300046454 Ga0495592_0012547 Ga0495592_0012547_3427_4350 255
170 3300046459 Ga0495629_0051579 Ga0495629_0051579_932_1855 255
171 3300046462 Ga0495651_0191798 Ga0495651_0191798_86_1009 255
172 3300046472 Ga0495580_0028759 Ga0495580_0028759_2131_3054 255
173 3300046476 Ga0495662_0042302 Ga0495662_0042302_1051_1974 255
174 3300046511 Ga0495608_0023706 Ga0495608_0023706_91_1014 255
175 3300046515 Ga0495620_0032034 Ga0495620_0032034_500_1423 255
176 3300046522 Ga0495643_0001461 Ga0495643_0001461_17389_18312 255
177 3300046528 Ga0495642_0051214 Ga0495642_0051214_489_1412 255
178 3300046533 Ga0495640_0005159 Ga0495640_0005159_693_1616 255
179 3300046542 Ga0495597_0093314 Ga0495597_0093314_116_1039 255
180 3300046616 Ga0495668_0061984 Ga0495668_0061984_337_1260 255
181 3300046642 Ga0495634_0040422 Ga0495634_0040422_726_1649 255
182 3300046663 Ga0495635_0052328 Ga0495635_0052328_1697_2620 255
183 3300046679 Ga0495623_0040473 Ga0495623_0040473_1489_2412 255
184 3300046680 Ga0495646_0108576 Ga0495646_0108576_558_1481 255
185 3300046689 Ga0495613_0149311 Ga0495613_0149311_243_1166 255
186 3300046794 Ga0495589_0019866 Ga0495589_0019866_1221_2144 255
187 3300047317 Ga0495604_0033881 Ga0495604_0033881_2086_3009 255
188 3300047319 Ga0495674_0064437 Ga0495674_0064437_1787_2710 255
189 3300047322 Ga0495680_0027354 Ga0495680_0027354_2521_3444 255
190 3300047443 Ga0495687_039268 Ga0495687_039268_978_1901 255
191 3300047673 Ga0495593_0110296 Ga0495593_0110296_472_1395 255
192 3300048927 Ga0496124_0104611 Ga0496124_0104611_1261_2184 255
193 3300049571 Ga0501034_0081881 Ga0501034_0081881_2124_3050 255
194 3300049573 Ga0501037_0186660 Ga0501037_0186660_155_1081 255
195 3300049581 Ga0501047_0021044 Ga0501047_0021044_1420_2346 255
196 3300049582 Ga0501048_0297675 Ga0501048_0297675_50_976 255
197 3300049822 Ga0501035_0104416 Ga0501035_0104416_1090_2016 255
198 3300049823 Ga0501044_0052776 Ga0501044_0052776_1966_2892 255
199 3300003320 rootH2_10054494 rootH2_100544943 256
200 3300030522 Ga0307512_10004744 Ga0307512_100047449 256
201 3300031456 Ga0307513_10049850 Ga0307513_100498502 256
202 3300031456 Ga0307513_10188878 Ga0307513_101888781 256
203 3300031616 Ga0307508_10364419 Ga0307508_103644191 256
204 3300041512 Ga0451853_2189455 Ga0451853_2189455_900_1826 256
205 3300044683 Ga0466965_0022019 Ga0466965_0022019_1184_2119 256
206 3300048920 Ga0496117_0007274 Ga0496117_0007274_6252_7190 256
207 3300048921 Ga0496118_0113819 Ga0496118_0113819_170_1108 256
208 3300048925 Ga0496122_0075344 Ga0496122_0075344_341_1276 256
209 3300048928 Ga0496125_0022669 Ga0496125_0022669_4758_5693 256
210 3300049570 Ga0501033_0020412 Ga0501033_0020412_1805_2800 256
211 3300049571 Ga0501034_0081820 Ga0501034_0081820_351_1310 256
212 3300049580 Ga0501046_0005693 Ga0501046_0005693_4909_5868 256
213 3300049823 Ga0501044_0041214 Ga0501044_0041214_697_1692 256
214 3300053090 Ga0500646_0000126 Ga0500646_0000126_18315_19235 256
215 3300053140 Ga0500573_0022965 Ga0500573_0022965_1456_2364 256
216 3300005841 Ga0068863_100242204 Ga0068863_1002422041 257
217 3300026088 Ga0207641_10241982 Ga0207641_102419822 257
218 3300028558 Ga0265326_10000839 Ga0265326_100008395 257
219 3300028563 Ga0265319_1004853 Ga0265319_10048532 257
220 3300028653 Ga0265323_10038494 Ga0265323_100384942 257
221 3300031238 Ga0265332_10002167 Ga0265332_100021677 257
222 3300031616 Ga0307508_10231025 Ga0307508_102310252 257
223 3300031711 Ga0265314_10004475 Ga0265314_100044753 257
224 3300033179 Ga0307507_10029493 Ga0307507_100294932 257
225 3300042007 Ga0439449_0066101 Ga0439449_0066101_294_1220 257
226 3300045976 Ga0466967_0244944 Ga0466967_0244944_127_1050 257
227 3300046454 Ga0495592_0025591 Ga0495592_0025591_1178_2074 257
228 3300046462 Ga0495651_0038322 Ga0495651_0038322_2509_3405 257
229 3300046476 Ga0495662_0002684 Ga0495662_0002684_4297_5193 257
230 3300046477 Ga0495664_0001605 Ga0495664_0001605_3806_4702 257
231 3300046536 Ga0495587_0136261 Ga0495587_0136261_50_946 257
232 3300046543 Ga0495645_0075474 Ga0495645_0075474_710_1606 257
233 3300046642 Ga0495634_0000745 Ga0495634_0000745_3828_4724 257
234 3300046660 Ga0495625_0043973 Ga0495625_0043973_1367_2293 257
235 3300046680 Ga0495646_0000930 Ga0495646_0000930_5047_5943 257
236 3300046689 Ga0495613_0007455 Ga0495613_0007455_486_1382 257
237 3300046809 Ga0495600_0014454 Ga0495600_0014454_2192_3088 257
238 3300047317 Ga0495604_0000558 Ga0495604_0000558_2378_3274 257
239 3300047444 Ga0495675_0085730 Ga0495675_0085730_639_1535 257
240 3300047447 Ga0495685_057995 Ga0495685_057995_353_1279 257
241 3300048088 Ga0495602_0034326 Ga0495602_0034326_1201_2097 257
242 3300048089 Ga0495614_0000340 Ga0495614_0000340_4471_5367 257
243 3300049568 Ga0501031_0007808 Ga0501031_0007808_1389_2315 257
244 3300049571 Ga0501034_0027867 Ga0501034_0027867_4668_5582 257
245 3300049571 Ga0501034_0074610 Ga0501034_0074610_681_1607 257
246 3300049572 Ga0501036_0011179 Ga0501036_0011179_467_1393 257
247 3300049573 Ga0501037_0010177 Ga0501037_0010177_5722_6648 257
248 3300049574 Ga0501038_0032115 Ga0501038_0032115_2354_3280 257
249 3300049579 Ga0501043_0002210 Ga0501043_0002210_4051_4977 257
250 3300049580 Ga0501046_0025094 Ga0501046_0025094_252_1178 257
251 3300049582 Ga0501048_0002990 Ga0501048_0002990_340_1266 257
252 3300049822 Ga0501035_0185520 Ga0501035_0185520_741_1667 257
253 3300049823 Ga0501044_0111273 Ga0501044_0111273_555_1481 257
254 3300053085 Ga0495619_0062154 Ga0495619_0062154_289_1185 257
255 3300053140 Ga0500573_0029601 Ga0500573_0029601_795_1691 257
256 3300005458 Ga0070681_10507867 Ga0070681_105078672 258
257 3300005614 Ga0068856_100061526 Ga0068856_1000615264 258
258 3300005981 Ga0081538_10009829 Ga0081538_100098293 258
259 3300026067 Ga0207678_10001777 Ga0207678_1000177711 258
260 3300026078 Ga0207702_10155599 Ga0207702_101555992 258
261 3300031616 Ga0307508_10072113 Ga0307508_100721132 258
262 3300046452 Ga0495617_016044 Ga0495617_016044_558_1484 258
263 3300046455 Ga0495603_0012538 Ga0495603_0012538_4194_5120 258
264 3300046459 Ga0495629_0087060 Ga0495629_0087060_1201_2127 258
265 3300046462 Ga0495651_0035198 Ga0495651_0035198_1294_2205 258
266 3300046463 Ga0495653_0231846 Ga0495653_0231846_286_1197 258
267 3300046474 Ga0495605_0009059 Ga0495605_0009059_3204_4130 258
268 3300046492 Ga0495585_0063938 Ga0495585_0063938_190_1116 258
269 3300046499 Ga0495594_0010260 Ga0495594_0010260_12_938 258
270 3300046507 Ga0495606_0024232 Ga0495606_0024232_997_1923 258
271 3300046512 Ga0495610_0086092 Ga0495610_0086092_37_963 258
272 3300046513 Ga0495616_0003623 Ga0495616_0003623_236_1162 258
273 3300046519 Ga0495632_0030339 Ga0495632_0030339_378_1304 258
274 3300046524 Ga0495648_0150717 Ga0495648_0150717_181_1107 258
275 3300046538 Ga0495609_0043885 Ga0495609_0043885_997_1923 258
276 3300046542 Ga0495597_0013328 Ga0495597_0013328_1715_2641 258
277 3300046557 Ga0495622_0039732 Ga0495622_0039732_194_1120 258
278 3300046660 Ga0495625_0175179 Ga0495625_0175179_210_1136 258
279 3300046665 Ga0495661_0027183 Ga0495661_0027183_364_1290 258
280 3300046690 Ga0495624_0129514 Ga0495624_0129514_148_1074 258
281 3300046692 Ga0495671_0068271 Ga0495671_0068271_680_1606 258
282 3300046794 Ga0495589_0102965 Ga0495589_0102965_443_1369 258
283 3300047321 Ga0495676_0016330 Ga0495676_0016330_34_960 258
284 3300047322 Ga0495680_0119389 Ga0495680_0119389_180_1091 258
285 3300047323 Ga0495683_0015981 Ga0495683_0015981_1628_2554 258
286 3300047447 Ga0495685_007130 Ga0495685_007130_159_1085 258
287 3300047470 Ga0495681_0016568 Ga0495681_0016568_2432_3358 258
288 3300047472 Ga0495686_0064577 Ga0495686_0064577_1047_1973 258
289 3300048091 Ga0495626_0106559 Ga0495626_0106559_113_1039 258
290 3300048920 Ga0496117_0050726 Ga0496117_0050726_748_1683 258
291 3300048921 Ga0496118_0019417 Ga0496118_0019417_5029_5964 258
292 3300048924 Ga0496121_0046122 Ga0496121_0046122_1814_2731 258
293 3300048929 Ga0496126_0041606 Ga0496126_0041606_3219_4154 258
294 3300049459 Ga0495678_039791 Ga0495678_039791_104_1030 258
295 3300050491 nmdc:mga00v17_5124_c1 nmdc:mga00v17_5124_c1_2666_3583 258
296 3300059503 Ga0587080_021017 Ga0587080_021017_41_949 258
297 3300030521 Ga0307511_10038111 Ga0307511_100381113 259
298 3300041443 Ga0451789_0309907 Ga0451789_0309907_143_1063 259
299 3300041498 Ga0451841_0651592 Ga0451841_0651592_260_1180 259
300 3300041512 Ga0451853_2722946 Ga0451853_2722946_124_1044 259
301 3300046455 Ga0495603_0002711 Ga0495603_0002711_6474_7400 259
302 3300047321 Ga0495676_0002784 Ga0495676_0002784_750_1676 259
303 3300047447 Ga0495685_001450 Ga0495685_001450_39_935 259
304 3300048908 Ga0496105_0174257 Ga0496105_0174257_626_1543 259
305 3300048921 Ga0496118_0033190 Ga0496118_0033190_1257_2180 259
306 3300048922 Ga0496119_0013259 Ga0496119_0013259_2112_3035 259
307 3300048925 Ga0496122_0002225 Ga0496122_0002225_6559_7482 259
308 3300048928 Ga0496125_0000224 Ga0496125_0000224_112485_113408 259
309 3300050496 nmdc:mga07m45_91993_c1 nmdc:mga07m45_91993_c1_80_997 259
310 3300009551 Ga0105238_10457777 Ga0105238_104577772 260
311 3300032004 Ga0307414_10091639 Ga0307414_100916392 260
312 3300032004 Ga0307414_10102268 Ga0307414_101022682 260
313 3300041501 Ga0451845_0977945 Ga0451845_0977945_188_1201 260
314 3300044656 Ga0466969_0059461 Ga0466969_0059461_41_985 260
315 3300044684 Ga0466966_0062617 Ga0466966_0062617_994_1938 260
316 3300044719 Ga0466971_0012994 Ga0466971_0012994_200_1144 260
317 3300044842 Ga0466957_0031025 Ga0466957_0031025_1754_2698 260
318 3300045049 Ga0466959_0172711 Ga0466959_0172711_427_1371 260
319 3300046453 Ga0495627_000262 Ga0495627_000262_37350_38297 260
320 3300046499 Ga0495594_0037253 Ga0495594_0037253_38_964 260
321 3300046518 Ga0495631_0055508 Ga0495631_0055508_380_1306 260
322 3300046694 Ga0495649_0190780 Ga0495649_0190780_22_918 260
323 3300047321 Ga0495676_0034542 Ga0495676_0034542_403_1329 260
324 3300047323 Ga0495683_0038615 Ga0495683_0038615_1414_2340 260
325 3300047447 Ga0495685_028691 Ga0495685_028691_405_1418 260
326 3300049581 Ga0501047_0003988 Ga0501047_0003988_6627_7475 260
327 3300061719 Ga0466962_0002388 Ga0466962_0002388_5039_5983 260
328 3300031731 Ga0307405_10083030 Ga0307405_100830302 261
329 3300049568 Ga0501031_0000972 Ga0501031_0000972_757_1692 261
330 3300005985 Ga0081539_10023811 Ga0081539_100238112 262
331 3300042438 Ga0439459_0039893 Ga0439459_0039893_22_924 262
332 3300044901 Ga0466960_0027645 Ga0466960_0027645_1377_2306 262
333 3300046460 Ga0495638_0040207 Ga0495638_0040207_538_1464 262
334 3300046501 Ga0495607_0010980 Ga0495607_0010980_3686_4612 262
335 3300046517 Ga0495630_0239422 Ga0495630_0239422_377_1234 262
336 3300046530 Ga0495654_0109047 Ga0495654_0109047_201_1127 262
337 3300046558 Ga0495633_0008115 Ga0495633_0008115_3179_4105 262
338 3300046648 Ga0495611_0113928 Ga0495611_0113928_12_938 262
339 3300050516 nmdc:mga0sz30_23290_c1 nmdc:mga0sz30_23290_c1_1006_1923 262
340 3300011119 Ga0105246_10101360 Ga0105246_101013602 263
341 3300031901 Ga0307406_10000260 Ga0307406_1000026017 263
342 3300048917 Ga0496114_0179734 Ga0496114_0179734_689_1606 263
343 3300053153 Ga0500616_0001796 Ga0500616_0001796_5389_6309 263
344 iso_pu_bacteria 2918501144 2918507936 263
345 3300009098 Ga0105245_10449152 Ga0105245_104491522 264
346 3300013307 Ga0157372_10022312 Ga0157372_100223123 264
347 3300030731 Ga0316177_1029591 Ga0316177_10295913 264
348 3300031911 Ga0307412_10005767 Ga0307412_100057676 264
349 3300049822 Ga0501035_0005876 Ga0501035_0005876_862_1713 264
350 3300053088 Ga0500644_0008624 Ga0500644_0008624_1722_2636 264
351 iso_pu_bacteria 2738541272 2738693978 264
352 iso_pu_bacteria 2738543027 2739327439 264
353 iso_pu_bacteria 2758568522 2760304874 264
354 iso_pu_bacteria 2862705112 2862709296 264
355 iso_pu_bacteria 2895660088 2895660408 264
356 iso_pu_bacteria 2912757875 2912764970 264
357 3300009177 Ga0105248_10000365 Ga0105248_1000036517 265
358 3300013296 Ga0157374_10015647 Ga0157374_100156472 265
359 3300033180 Ga0307510_10106719 Ga0307510_101067192 265
360 3300042012 Ga0439455_0073895 Ga0439455_0073895_85_909 265
361 3300046454 Ga0495592_0079471 Ga0495592_0079471_357_1193 265
362 3300046472 Ga0495580_0192351 Ga0495580_0192351_546_1370 265
363 3300046512 Ga0495610_0100765 Ga0495610_0100765_450_1274 265
364 3300046529 Ga0495652_0003943 Ga0495652_0003943_7556_8392 265
365 3300046543 Ga0495645_0017788 Ga0495645_0017788_2644_3480 265
366 3300046642 Ga0495634_0051933 Ga0495634_0051933_70_906 265
367 3300046663 Ga0495635_0003608 Ga0495635_0003608_8244_9080 265
368 3300046679 Ga0495623_0005945 Ga0495623_0005945_5180_6016 265
369 3300046689 Ga0495613_0085176 Ga0495613_0085176_578_1513 265
370 3300046690 Ga0495624_0164919 Ga0495624_0164919_212_1036 265
371 3300046809 Ga0495600_0071443 Ga0495600_0071443_1040_1876 265
372 3300047315 Ga0495581_0128366 Ga0495581_0128366_53_877 265
373 3300047447 Ga0495685_008265 Ga0495685_008265_1522_2448 265
374 3300048089 Ga0495614_0025542 Ga0495614_0025542_619_1554 265
375 3300049586 Ga0501070_0003316 Ga0501070_0003316_8619_9461 265
376 3300053078 Ga0495612_0001248 Ga0495612_0001248_2358_3194 265
377 3300053085 Ga0495619_0092287 Ga0495619_0092287_939_1775 265
378 3300053140 Ga0500573_0003653 Ga0500573_0003653_2674_3510 265
379 iso_pu_bacteria 2582581313 2585309623 265
380 iso_pu_bacteria 2643221575 2643886344 265
381 3300013306 Ga0163162_10309527 Ga0163162_103095272 266
382 3300046453 Ga0495627_005954 Ga0495627_005954_112_981 266
383 3300046459 Ga0495629_0000729 Ga0495629_0000729_18158_19084 266
384 3300046499 Ga0495594_0004036 Ga0495594_0004036_4153_5079 266
385 3300046674 Ga0495588_0014053 Ga0495588_0014053_402_1328 266
386 3300046794 Ga0495589_0143118 Ga0495589_0143118_148_1074 266
387 3300047321 Ga0495676_0000768 Ga0495676_0000768_18158_19084 266
388 3300059503 Ga0587080_013214 Ga0587080_013214_299_1240 266
389 iso_pu_bacteria 2739367654 2739607218 266
390 3300009093 Ga0105240_10289365 Ga0105240_102893652 267
391 3300009098 Ga0105245_10082940 Ga0105245_100829402 267
392 3300013104 Ga0157370_10077269 Ga0157370_100772692 267
393 3300013105 Ga0157369_10251578 Ga0157369_102515782 267
394 3300014968 Ga0157379_10028337 Ga0157379_100283374 267
395 3300035242 Ga0373962_0002029 Ga0373962_0002029_2330_3232 267
396 3300046506 Ga0495583_0005674 Ga0495583_0005674_6398_7333 267
397 3300046512 Ga0495610_0057477 Ga0495610_0057477_658_1593 267
398 3300046515 Ga0495620_0011710 Ga0495620_0011710_1068_2003 267
399 3300046522 Ga0495643_0002615 Ga0495643_0002615_3148_4083 267
400 3300047443 Ga0495687_030465 Ga0495687_030465_320_1255 267
401 3300048922 Ga0496119_0157334 Ga0496119_0157334_282_1178 267
402 iso_pu_bacteria 2811994878 2812349917 267
403 3300005937 Ga0081455_10025631 Ga0081455_100256315 268
404 3300009098 Ga0105245_10128358 Ga0105245_101283582 268
405 3300032126 Ga0307415_100285683 Ga0307415_1002856831 268
406 3300046460 Ga0495638_0032867 Ga0495638_0032867_2108_3049 268
407 3300046516 Ga0495628_0079845 Ga0495628_0079845_772_1704 268
408 3300046533 Ga0495640_0119162 Ga0495640_0119162_208_1140 268
409 3300046675 Ga0495657_0032694 Ga0495657_0032694_1376_2308 268
410 3300047673 Ga0495593_0027906 Ga0495593_0027906_1551_2483 268
411 3300049568 Ga0501031_0051818 Ga0501031_0051818_381_1316 268
412 3300049569 Ga0501032_0012147 Ga0501032_0012147_554_1489 268
413 3300049570 Ga0501033_0026109 Ga0501033_0026109_381_1316 268
414 3300049571 Ga0501034_0006353 Ga0501034_0006353_5086_6021 268
415 3300049572 Ga0501036_0009130 Ga0501036_0009130_5302_6237 268
416 3300049573 Ga0501037_0001882 Ga0501037_0001882_7876_8811 268
417 3300049574 Ga0501038_0017119 Ga0501038_0017119_5241_6176 268
418 3300049575 Ga0501039_0027217 Ga0501039_0027217_3081_4016 268
419 3300049576 Ga0501040_0013161 Ga0501040_0013161_1768_2703 268
420 3300049577 Ga0501041_0010140 Ga0501041_0010140_2260_3195 268
421 3300049578 Ga0501042_0098644 Ga0501042_0098644_554_1489 268
422 3300049579 Ga0501043_0003543 Ga0501043_0003543_4772_5707 268
423 3300049582 Ga0501048_0056201 Ga0501048_0056201_1804_2739 268
424 3300049585 Ga0501069_0016086 Ga0501069_0016086_727_1662 268
425 3300049588 Ga0501072_0015578 Ga0501072_0015578_4805_5740 268
426 3300049589 Ga0501073_0021099 Ga0501073_0021099_682_1617 268
427 3300049593 Ga0501077_0041060 Ga0501077_0041060_1935_2870 268
428 3300049741 Ga0501079_0001236 Ga0501079_0001236_8738_9673 268
429 3300049822 Ga0501035_0003738 Ga0501035_0003738_6457_7392 268
430 3300049823 Ga0501044_0003883 Ga0501044_0003883_8693_9628 268
431 3300049824 Ga0501045_0059045 Ga0501045_0059045_682_1617 268
432 3300054114 Ga0501084_0004162 Ga0501084_0004162_2102_3037 268
433 3300060353 Ga0501082_0015621 Ga0501082_0015621_181_1116 268
434 iso_pu_bacteria 2643221961 2645719913 268
435 iso_pu_bacteria 2832004796 2832009593 268
436 iso_pu_bacteria 2857720070 2857720809 268
437 iso_pu_bacteria 2866065130 2866071388 268
438 iso_pu_bacteria 2867507094 2867507563 268
439 iso_pu_bacteria 8008485437 8008486734 268
440 iso_pu_bacteria 8025524527 8025525976 268
441 iso_pu_bacteria 8056579771 8056579800 268
442 3300003354 JGI25160J50197_1033347 JGI25160J50197_10333471 269
443 3300005455 Ga0070663_100087576 Ga0070663_1000875762 269
444 3300005548 Ga0070665_100392855 Ga0070665_1003928552 269
445 3300025302 Ga0207426_1013909 Ga0207426_10139092 269
446 3300026067 Ga0207678_10000268 Ga0207678_100002682 269
447 3300044693 Ga0466961_0216549 Ga0466961_0216549_176_1102 269
448 3300044901 Ga0466960_0001602 Ga0466960_0001602_6854_7780 269
449 3300046453 Ga0495627_013966 Ga0495627_013966_1050_1943 269
450 3300046459 Ga0495629_0053946 Ga0495629_0053946_657_1583 269
451 3300046474 Ga0495605_0001464 Ga0495605_0001464_8746_9672 269
452 3300046499 Ga0495594_0022491 Ga0495594_0022491_1944_2870 269
453 3300046506 Ga0495583_0049245 Ga0495583_0049245_725_1651 269
454 3300046515 Ga0495620_0011920 Ga0495620_0011920_210_1136 269
455 3300046518 Ga0495631_0002744 Ga0495631_0002744_6854_7780 269
456 3300046524 Ga0495648_0007727 Ga0495648_0007727_6264_7190 269
457 3300046530 Ga0495654_0041408 Ga0495654_0041408_799_1725 269
458 3300046616 Ga0495668_0056109 Ga0495668_0056109_1204_2130 269
459 3300046660 Ga0495625_0046547 Ga0495625_0046547_2159_3085 269
460 3300046665 Ga0495661_0015815 Ga0495661_0015815_2018_2944 269
461 3300046691 Ga0495670_0075345 Ga0495670_0075345_450_1376 269
462 3300046794 Ga0495589_0017668 Ga0495589_0017668_1962_2888 269
463 3300047318 Ga0495636_0011685 Ga0495636_0011685_2022_2948 269
464 3300047318 Ga0495636_0054113 Ga0495636_0054113_728_1651 269
465 3300047321 Ga0495676_0001734 Ga0495676_0001734_16840_17766 269
466 3300047323 Ga0495683_0035571 Ga0495683_0035571_686_1612 269
467 3300047443 Ga0495687_070979 Ga0495687_070979_119_1045 269
468 3300047447 Ga0495685_005944 Ga0495685_005944_845_1771 269
469 3300047470 Ga0495681_0046037 Ga0495681_0046037_1044_1970 269
470 3300048091 Ga0495626_0008702 Ga0495626_0008702_864_1790 269
471 3300053143 Ga0500579_030636 Ga0500579_030636_808_1725 269
472 3300053149 Ga0500600_0027133 Ga0500600_0027133_1212_2129 269
473 iso_pu_bacteria 2643221549 2643768880 269
474 iso_pu_bacteria 2758568621 2760621293 269
475 3300005985 Ga0081539_10007488 Ga0081539_100074883 270
476 3300031911 Ga0307412_10138111 Ga0307412_101381112 270
477 3300049704 Ga0501221_032295 Ga0501221_032295_141_1040 270
478 iso_pu_bacteria 2643221548 2643760515 270
479 iso_pu_bacteria 2643221682 2644459598 270
480 iso_pu_bacteria 2818991472 2819744756 270
481 iso_pu_bacteria 2887478801 2887482793 270
482 3300005455 Ga0070663_100040694 Ga0070663_1000406942 271
483 3300005457 Ga0070662_100054231 Ga0070662_1000542312 271
484 3300005564 Ga0070664_100007052 Ga0070664_1000070523 271
485 3300011119 Ga0105246_10172798 Ga0105246_101727982 271
486 3300013308 Ga0157375_10110663 Ga0157375_101106632 271
487 3300025933 Ga0207706_10024667 Ga0207706_100246671 271
488 3300025945 Ga0207679_10016223 Ga0207679_100162234 271
489 3300026067 Ga0207678_10062320 Ga0207678_100623202 271
490 3300028786 Ga0307517_10017578 Ga0307517_100175783 271
491 3300031901 Ga0307406_10183215 Ga0307406_101832152 271
492 3300048924 Ga0496121_0018146 Ga0496121_0018146_5205_6140 271
493 3300049569 Ga0501032_0053596 Ga0501032_0053596_604_1533 271
494 3300049574 Ga0501038_0023621 Ga0501038_0023621_2812_3741 271
495 3300049579 Ga0501043_0060165 Ga0501043_0060165_1742_2671 271
496 3300050496 nmdc:mga07m45_71397_c1 nmdc:mga07m45_71397_c1_197_1120 271
497 iso_pu_bacteria 2547132111 2547405545 271
498 iso_pu_bacteria 2643221572 2643877727 271
499 iso_pu_bacteria 2643221669 2644384782 271
500 iso_pu_bacteria 2643221678 2644443507 271
501 iso_pu_bacteria 2643221714 2644627177 271
502 iso_pu_bacteria 2773857762 2774394121 271
503 iso_pu_bacteria 2784132148 2784585881 271
504 iso_pu_bacteria 2808606359 2808846020 271
505 iso_pu_bacteria 2808606448 2809229376 271
506 iso_pu_bacteria 2818991463 2819699974 271
507 iso_pu_bacteria 2839986021 2839986557 271
508 iso_pu_bacteria 2862281513 2862281732 271
509 iso_pu_bacteria 2862574272 2862581905 271
510 iso_pu_bacteria 2868088558 2868091359 271
511 iso_pu_bacteria 2891968417 2891972477 271
512 iso_pu_bacteria 2895660088 2895662580 271
513 iso_pu_bacteria 2919468124 2919474604 271
514 iso_pu_bacteria 2932431166 2932434387 271
515 iso_pu_bacteria 2946072368 2946079699 271
516 iso_pu_bacteria 2954002825 2954008696 271
517 iso_pu_bacteria 2966598605 2966604983 271
518 iso_pu_bacteria 3006493962 3006494000 271
519 iso_pu_bacteria 8023623736 8023627786 271
520 3300005985 Ga0081539_10000448 Ga0081539_1000044852 272
521 3300037466 Ga0395898_0022084 Ga0395898_0022084_239_1129 272
522 3300041404 Ga0439436_0017158 Ga0439436_0017158_1198_2118 272
523 3300042138 Ga0450903_004374 Ga0450903_004374_1278_2216 272
524 3300044656 Ga0466969_0020497 Ga0466969_0020497_1822_2760 272
525 3300044658 Ga0466972_0012642 Ga0466972_0012642_2953_3891 272
526 3300044683 Ga0466965_0031318 Ga0466965_0031318_1559_2497 272
527 3300044684 Ga0466966_0005223 Ga0466966_0005223_1555_2493 272
528 3300044693 Ga0466961_0004724 Ga0466961_0004724_1555_2493 272
529 3300044694 Ga0466963_0000867 Ga0466963_0000867_7862_8800 272
530 3300044706 Ga0466964_0002993 Ga0466964_0002993_5088_6026 272
531 3300044719 Ga0466971_0000558 Ga0466971_0000558_6074_7012 272
532 3300044765 Ga0466970_0000414 Ga0466970_0000414_13874_14812 272
533 3300044842 Ga0466957_0002513 Ga0466957_0002513_6443_7381 272
534 3300045049 Ga0466959_0015694 Ga0466959_0015694_4513_5451 272
535 3300045836 Ga0466958_0027958 Ga0466958_0027958_2330_3268 272
536 3300045976 Ga0466967_0004720 Ga0466967_0004720_4656_5594 272
537 3300046454 Ga0495592_0001835 Ga0495592_0001835_5970_6890 272
538 3300046459 Ga0495629_0021514 Ga0495629_0021514_1309_2235 272
539 3300046462 Ga0495651_0010033 Ga0495651_0010033_5586_6506 272
540 3300046511 Ga0495608_0017280 Ga0495608_0017280_2454_3374 272
541 3300046514 Ga0495618_0023361 Ga0495618_0023361_1954_2874 272
542 3300046516 Ga0495628_0008151 Ga0495628_0008151_6122_7042 272
543 3300046529 Ga0495652_0016428 Ga0495652_0016428_2160_3080 272
544 3300046663 Ga0495635_0007408 Ga0495635_0007408_2945_3865 272
545 3300046679 Ga0495623_0011396 Ga0495623_0011396_3635_4555 272
546 3300046689 Ga0495613_0036920 Ga0495613_0036920_2375_3301 272
547 3300046689 Ga0495613_0111525 Ga0495613_0111525_164_1084 272
548 3300046690 Ga0495624_0110289 Ga0495624_0110289_735_1655 272
549 3300046809 Ga0495600_0047004 Ga0495600_0047004_899_1819 272
550 3300047317 Ga0495604_0127657 Ga0495604_0127657_563_1483 272
551 3300047321 Ga0495676_0007466 Ga0495676_0007466_2422_3348 272
552 3300047322 Ga0495680_0002951 Ga0495680_0002951_13854_14774 272
553 3300047444 Ga0495675_0011602 Ga0495675_0011602_1674_2594 272
554 3300048088 Ga0495602_0069826 Ga0495602_0069826_486_1406 272
555 3300048089 Ga0495614_0007790 Ga0495614_0007790_2419_3345 272
556 iso_pu_bacteria 2558860280 2559432263 272
557 iso_pu_bacteria 2808606700 2810365146 272
558 iso_pu_bacteria 2945956166 2945956598 272
559 iso_pu_bacteria 2946003308 2946006657 272
560 iso_pu_bacteria 2946041624 2946043400 272
561 iso_pu_bacteria 2954691527 2954692519 272
562 iso_pu_bacteria 2954701450 2954707588 272
563 iso_pu_bacteria 8054107350 8054107394 272
564 3300001979 JGI24740J21852_10006152 JGI24740J21852_100061522 273
565 3300005337 Ga0070682_100190302 Ga0070682_1001903022 273
566 3300005339 Ga0070660_100054899 Ga0070660_1000548992 273
567 3300005366 Ga0070659_100005438 Ga0070659_1000054384 273
568 3300005435 Ga0070714_100016573 Ga0070714_1000165735 273
569 3300005436 Ga0070713_100118526 Ga0070713_1001185262 273
570 3300005539 Ga0068853_100154855 Ga0068853_1001548551 273
571 3300005563 Ga0068855_100052979 Ga0068855_1000529793 273
572 3300005578 Ga0068854_100027500 Ga0068854_1000275003 273
573 3300005616 Ga0068852_100019092 Ga0068852_1000190922 273
574 3300005617 Ga0068859_100073431 Ga0068859_1000734312 273
575 3300005842 Ga0068858_100000023 Ga0068858_10000002318 273
576 3300006931 Ga0097620_100073434 Ga0097620_1000734342 273
577 3300025909 Ga0207705_10008870 Ga0207705_100088705 273
578 3300025913 Ga0207695_10009651 Ga0207695_100096518 273
579 3300025920 Ga0207649_10022261 Ga0207649_100222613 273
580 3300025928 Ga0207700_10061831 Ga0207700_100618313 273
581 3300025929 Ga0207664_10044114 Ga0207664_100441142 273
582 3300025932 Ga0207690_10001158 Ga0207690_100011584 273
583 3300025935 Ga0207709_10066605 Ga0207709_100666052 273
584 3300025941 Ga0207711_10143217 Ga0207711_101432173 273
585 3300025949 Ga0207667_10009261 Ga0207667_100092614 273
586 3300025981 Ga0207640_10080953 Ga0207640_100809532 273
587 3300025986 Ga0207658_10027115 Ga0207658_100271154 273
588 3300026035 Ga0207703_10000570 Ga0207703_1000057032 273
589 3300026142 Ga0207698_10012613 Ga0207698_100126133 273
590 3300030733 Ga0314311_1194712 Ga0314311_11947123 273
591 3300047443 Ga0495687_026079 Ga0495687_026079_1328_2254 273
592 3300048929 Ga0496126_0004390 Ga0496126_0004390_13391_14338 273
593 3300049570 Ga0501033_0167464 Ga0501033_0167464_499_1407 273
594 3300049573 Ga0501037_0012569 Ga0501037_0012569_327_1262 273
595 3300049581 Ga0501047_0000121 Ga0501047_0000121_40653_41588 273
596 3300053142 Ga0500577_0107400 Ga0500577_0107400_165_1121 273
597 iso_pu_bacteria 2643221542 2643732176 273
598 iso_pu_bacteria 2643221553 2643785060 273
599 iso_pu_bacteria 2643221630 2644170994 273
600 iso_pu_bacteria 2643221724 2644679388 273
601 iso_pu_bacteria 2728369380 2730228906 273
602 iso_pu_bacteria 2739367654 2739606537 273
603 iso_pu_bacteria 2747842429 2747953031 273
604 iso_pu_bacteria 2758568522 2760306670 273
605 iso_pu_bacteria 2758568621 2760624851 273
606 iso_pu_bacteria 2857723135 2857727006 273
607 iso_pu_bacteria 2870622029 2870623235 273
608 iso_pu_bacteria 2945968032 2945971052 273
609 iso_pu_bacteria 2946080515 2946081672 273
610 iso_pu_bacteria 3006321560 3006324849 273
611 iso_pu_bacteria 8056579771 8056582932 273
612 3300005288 Ga0065714_10134026 Ga0065714_101340261 274
613 3300005347 Ga0070668_100028603 Ga0070668_1000286032 274
614 3300006038 Ga0075365_10033648 Ga0075365_100336482 274
615 3300006042 Ga0075368_10016741 Ga0075368_100167412 274
616 3300006048 Ga0075363_100014117 Ga0075363_1000141173 274
617 3300006051 Ga0075364_10045923 Ga0075364_100459233 274
618 3300009148 Ga0105243_10133487 Ga0105243_101334872 274
619 3300009553 Ga0105249_10052646 Ga0105249_100526462 274
620 3300011119 Ga0105246_10021889 Ga0105246_100218893 274
621 3300013308 Ga0157375_10395411 Ga0157375_103954112 274
622 3300025961 Ga0207712_10053210 Ga0207712_100532102 274
623 3300025972 Ga0207668_10016593 Ga0207668_100165933 274
624 3300027866 Ga0209813_10007394 Ga0209813_100073943 274
625 3300028786 Ga0307517_10002208 Ga0307517_100022083 274
626 3300028794 Ga0307515_10000025 Ga0307515_10000025258 274
627 3300030522 Ga0307512_10025790 Ga0307512_100257903 274
628 3300030522 Ga0307512_10033438 Ga0307512_100334383 274
629 3300031456 Ga0307513_10069905 Ga0307513_100699053 274
630 3300031507 Ga0307509_10045377 Ga0307509_100453774 274
631 3300031616 Ga0307508_10051617 Ga0307508_100516173 274
632 3300031649 Ga0307514_10064241 Ga0307514_100642412 274
633 3300031731 Ga0307405_10116654 Ga0307405_101166542 274
634 3300031995 Ga0307409_100599658 Ga0307409_1005996581 274
635 3300033179 Ga0307507_10015152 Ga0307507_100151527 274
636 3300033180 Ga0307510_10090821 Ga0307510_100908212 274
637 3300046459 Ga0495629_0044899 Ga0495629_0044899_411_1325 274
638 3300046460 Ga0495638_0024173 Ga0495638_0024173_477_1436 274
639 3300046616 Ga0495668_0004244 Ga0495668_0004244_4510_5436 274
640 3300046660 Ga0495625_0000716 Ga0495625_0000716_4535_5461 274
641 3300046660 Ga0495625_0003926 Ga0495625_0003926_5752_6666 274
642 3300046674 Ga0495588_0006810 Ga0495588_0006810_4166_5080 274
643 3300046692 Ga0495671_0006199 Ga0495671_0006199_1254_2168 274
644 3300047323 Ga0495683_0005247 Ga0495683_0005247_1727_2653 274
645 3300047470 Ga0495681_0009151 Ga0495681_0009151_3607_4521 274
646 3300048089 Ga0495614_0001852 Ga0495614_0001852_2791_3705 274
647 3300048091 Ga0495626_0000069 Ga0495626_0000069_4522_5448 274
648 3300048908 Ga0496105_0038857 Ga0496105_0038857_2482_3444 274
649 3300048912 Ga0496109_0026506 Ga0496109_0026506_450_1412 274
650 3300048912 Ga0496109_0279976 Ga0496109_0279976_28_987 274
651 3300048914 Ga0496111_0222913 Ga0496111_0222913_18_980 274
652 3300050490 nmdc:mga03n38_26092_c1 nmdc:mga03n38_26092_c1_641_1618 274
653 3300050491 nmdc:mga00v17_38795_c1 nmdc:mga00v17_38795_c1_436_1413 274
654 3300050492 nmdc:mga0yw44_28577_c1 nmdc:mga0yw44_28577_c1_1259_2236 274
655 3300050494 nmdc:mga06z11_3762_c1 nmdc:mga06z11_3762_c1_2635_3612 274
656 3300050495 nmdc:mga04h51_8599_c1 nmdc:mga04h51_8599_c1_147_1124 274
657 3300053107 Ga0500560_000339 Ga0500560_000339_2132_3046 274
658 iso_pu_bacteria 2616644814 2616698470 274
659 iso_pu_bacteria 2643221597 2643997761 274
660 iso_pu_bacteria 2654587600 2655034407 274
661 iso_pu_bacteria 2721755702 2723640801 274
662 iso_pu_bacteria 2773857758 2774379865 274
663 iso_pu_bacteria 2811994872 2812321934 274
664 iso_pu_bacteria 2904509784 2904513156 274
665 iso_pu_bacteria 2906799679 2906802215 274
666 iso_pu_bacteria 2908678064 2908679114 274
667 iso_pu_bacteria 2919069694 2919069745 274
668 iso_pu_bacteria 2919443155 2919443976 274
669 iso_pu_bacteria 2928090899 2928092949 274
670 iso_pu_bacteria 2974324384 2974327703 274
671 iso_pu_bacteria 2977228692 2977229320 274
672 iso_pu_bacteria 2977236895 2977238642 274
673 iso_pu_bacteria 2977251589 2977254523 274
674 iso_pu_bacteria 2977264416 2977264503 274
675 iso_pu_bacteria 2984542743 2984543576 274
676 iso_pu_bacteria 2984580707 2984583493 274
677 iso_pu_bacteria 8046352972 8046355299 274
678 3300020081 Ga0206354_10736904 Ga0206354_107369042 275
679 3300032002 Ga0307416_100061247 Ga0307416_1000612471 275
680 3300046462 Ga0495651_0003934 Ga0495651_0003934_3614_4540 275
681 3300047319 Ga0495674_0074986 Ga0495674_0074986_1353_2285 275
682 3300048929 Ga0496126_0037356 Ga0496126_0037356_2064_3020 275
683 iso_pu_bacteria 2643221631 2644179707 275
684 iso_pu_bacteria 2808606439 2809195030 275
685 iso_pu_bacteria 2919443155 2919443853 275
686 3300001990 JGI24737J22298_10004249 JGI24737J22298_100042494 276
687 3300002067 JGI24735J21928_10009817 JGI24735J21928_100098173 276
688 3300005335 Ga0070666_10081315 Ga0070666_100813152 276
689 3300005347 Ga0070668_100098861 Ga0070668_1000988612 276
690 3300005455 Ga0070663_100364064 Ga0070663_1003640641 276
691 3300005539 Ga0068853_100216893 Ga0068853_1002168932 276
692 3300005577 Ga0068857_100136752 Ga0068857_1001367522 276
693 3300005843 Ga0068860_100282675 Ga0068860_1002826752 276
694 3300009551 Ga0105238_10469174 Ga0105238_104691741 276
695 3300010375 Ga0105239_10240254 Ga0105239_102402542 276
696 3300013307 Ga0157372_10038922 Ga0157372_100389222 276
697 3300025925 Ga0207650_10066765 Ga0207650_100667652 276
698 3300025941 Ga0207711_10000340 Ga0207711_100003403 276
699 3300026041 Ga0207639_10198348 Ga0207639_101983481 276
700 3300026067 Ga0207678_10335999 Ga0207678_103359991 276
701 3300026116 Ga0207674_10013828 Ga0207674_1001382810 276
702 3300026142 Ga0207698_10255720 Ga0207698_102557202 276
703 iso_pu_bacteria 2808606372 2808903297 276
704 3300005288 Ga0065714_10019207 Ga0065714_100192072 277
705 3300005288 Ga0065714_10124698 Ga0065714_101246982 277
706 3300005338 Ga0068868_100262897 Ga0068868_1002628972 277
707 3300005614 Ga0068856_100214592 Ga0068856_1002145922 277
708 3300005616 Ga0068852_100049796 Ga0068852_1000497963 277
709 3300013100 Ga0157373_10213522 Ga0157373_102135222 277
710 3300013307 Ga0157372_10106942 Ga0157372_101069422 277
711 3300026078 Ga0207702_10148764 Ga0207702_101487642 277
712 3300031456 Ga0307513_10000003 Ga0307513_10000003264 277
713 3300037312 Ga0395899_0000858 Ga0395899_0000858_12854_13786 277
714 3300037466 Ga0395898_0350728 Ga0395898_0350728_190_1122 277
715 3300044656 Ga0466969_0057630 Ga0466969_0057630_629_1558 277
716 3300044684 Ga0466966_0036400 Ga0466966_0036400_455_1384 277
717 3300044693 Ga0466961_0000884 Ga0466961_0000884_15399_16328 277
718 3300046660 Ga0495625_0038206 Ga0495625_0038206_792_1733 277
719 3300048903 Ga0496100_0014827 Ga0496100_0014827_2394_3311 277
720 3300048904 Ga0496101_0041456 Ga0496101_0041456_2340_3257 277
721 3300048916 Ga0496113_0020066 Ga0496113_0020066_2546_3463 277
722 3300048917 Ga0496114_0028597 Ga0496114_0028597_1467_2384 277
723 3300048918 Ga0496115_0016015 Ga0496115_0016015_2412_3329 277
724 iso_pu_bacteria 2585427649 2586060846 277
725 iso_pu_bacteria 2643221649 2644278559 277
726 iso_pu_bacteria 2721755702 2723640881 277
727 iso_pu_bacteria 2799112218 2799183164 277
728 iso_pu_bacteria 2808606394 2809029763 277
729 iso_pu_bacteria 2870721527 2870724242 277
730 iso_pu_bacteria 2870721527 2870725031 277
731 iso_pu_bacteria 2915768154 2915769907 277
732 3300003762 Ga0055542_1000019 Ga0055542_1000019324 278
733 3300003763 Ga0055529_1000008 Ga0055529_100000842 278
734 3300009148 Ga0105243_10049273 Ga0105243_100492732 278
735 3300025228 Ga0209672_100011 Ga0209672_100011533 278
736 3300025229 Ga0209147_100319 Ga0209147_10031920 278
737 3300025254 Ga0209148_1000023 Ga0209148_1000023371 278
738 3300025272 Ga0209455_1000023 Ga0209455_1000023371 278
739 3300025935 Ga0207709_10090664 Ga0207709_100906642 278
740 3300028794 Ga0307515_10109151 Ga0307515_101091513 278
741 3300028794 Ga0307515_10250106 Ga0307515_102501061 278
742 3300053153 Ga0500616_0001029 Ga0500616_0001029_4240_5163 278
743 iso_pu_bacteria 2643221549 2643768744 278
744 iso_pu_bacteria 2643221619 2644112183 278
745 iso_pu_bacteria 2738543027 2739325470 278
746 3300001979 JGI24740J21852_10005331 JGI24740J21852_100053312 279
747 3300001989 JGI24739J22299_10006370 JGI24739J22299_100063704 279
748 3300001990 JGI24737J22298_10004684 JGI24737J22298_100046843 279
749 3300009036 Ga0105244_10014945 Ga0105244_100149454 279
750 3300009148 Ga0105243_10056055 Ga0105243_100560552 279
751 3300013105 Ga0157369_10004513 Ga0157369_100045138 279
752 3300013307 Ga0157372_10084473 Ga0157372_100844732 279
753 3300020080 Ga0206350_10637427 Ga0206350_106374272 279
754 3300025728 Ga0207655_1009093 Ga0207655_10090933 279
755 3300048922 Ga0496119_0046464 Ga0496119_0046464_332_1252 279
756 3300048923 Ga0496120_0022202 Ga0496120_0022202_1558_2478 279
757 iso_pu_bacteria 2721755702 2723643309 279
758 iso_pu_bacteria 2935409751 2935411946 279

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

26

320

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.8889 12 269
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.8884 14 269
4tqv-assembly4.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8755 12 275
4tqu-assembly1.cif.gz_M crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate 0.8691 8 275
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.8597 14 274
ID Description Score Start End Superfamily
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.917 35 279 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9099 35 279 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9063 35 275 1.10.3720.10
4tquM01 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8957 35 275 1.10.3720.10
af_P9WG03_18_293_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8922 14 269 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A428XM38-F1-model_v4 deleted 0.9709 14 276
AF-A0A3G8W6U8-F1-model_v4 deleted 0.9592 14 279
AF-A0A1W7D0Z3-F1-model_v4 ABC transmembrane type-1 domain-containing protein 0.9588 14 277 GO:0005886
GO:0055085
AF-A0A8A3TIC5-F1-model_v4 deleted 0.9509 14 279
AF-A0A850D038-F1-model_v4 deleted 0.9508 126 273

Feature Viewer

pLDDT pTM Quality
85.67 0.81 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map