F479466
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 758 | 432 | 650 | 293 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2721755702|2723643309 |
| Length | 328 |
| Sequence | HAHAQTPAGVSTETYATVAATGAASGGTTGRTVGTRRRRARRNWAGWWFVGPFMLIFTLVFIAPLVYAIYLSLFRETLMGGNSFVGLENYAIALVDPKFWEAMLRVSLFLLVQVPIMLGLALFAALALDSARLRWVPFYRLSIFLPYAVPGVVAVMIWGYMYGSQFGLVADLNRFFGMQLPSPLAENLILTSIGNIVTWEFVGYNMLIFFSALKAVPQELYEAAEIDGAGTFRTIFSIKLPSIRGAIVIATIFSVIGSFQLFNEPSILQTIAPNSITTYFTPNLYAFNLSFAGSQFNYAAAIAIISGVITMIVAYLVQLGGDRNGTKA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 2 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 3 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 4 | 2585427649 | Amycolatopsis japonica MG417-CF17, DSM 44213 | Isolate | Unclassified |
| 5 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 6 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 7 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 8 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 9 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 10 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 11 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 12 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 13 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 14 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 15 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 16 | 2643221649 | Leifsonia sp. Root4 | Isolate | Unclassified |
| 17 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 18 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 19 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 20 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 21 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 22 | 2643221961 | Aeromicrobium sp. Root236 | Isolate | Unclassified |
| 23 | 2654587600 | Glutamicibacter halophytocola KLBMP5180 | Isolate | Unclassified |
| 24 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 25 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 26 | 2738541272 | Promicromonospora sp. AC04 | Isolate | Unclassified |
| 27 | 2738543027 | Promicromonospora sp. CF082 | Isolate | Unclassified |
| 28 | 2739367654 | Promicromonospora sp. YR516 | Isolate | Unclassified |
| 29 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 30 | 2758568522 | Promicromonospora thailandica SAI-039 | Isolate | Unclassified |
| 31 | 2758568621 | Promicromonospora sukumoe SAI-064 | Isolate | Unclassified |
| 32 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 33 | 2773857762 | Nocardioides sp. SAI-095 | Isolate | Unclassified |
| 34 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 35 | 2799112218 | Motilibacter rhizosphaerae DSM 45622 | Isolate | Rhizosphere |
| 36 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 37 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 38 | 2808606394 | Promicromonospora sp. C35 | Isolate | Unclassified |
| 39 | 2808606439 | Nocardioides sp. SLBN-172 | Isolate | Unclassified |
| 40 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 41 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 42 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 43 | 2811994878 | Nocardioides sp. SLBN-169 | Isolate | Unclassified |
| 44 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 45 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 46 | 2832004796 | Micromonospora endophytica JCM 18317 | Isolate | Unclassified |
| 47 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 48 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 49 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 50 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 51 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 52 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 53 | 2866065130 | Micromonospora endophytica DSM 45430 | Isolate | Unclassified |
| 54 | 2867507094 | Micromonospora zingiberis PLAI 1-1 | Isolate | Unclassified |
| 55 | 2868088558 | Phytoactinopolyspora endophytica EGI 60009 | Isolate | Unclassified |
| 56 | 2870622029 | Conyzicola lurida DSM 105784 | Isolate | Unclassified |
| 57 | 2870721527 | Saccharothrix ecbatanensis DSM 45486 | Isolate | Rhizosphere |
| 58 | 2887478801 | Catellatospora paridis NEAU-CL2 | Isolate | Rhizosphere |
| 59 | 2891968417 | Nocardioides luteus SAI-037 | Isolate | Unclassified |
| 60 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 61 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 62 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 63 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 64 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 65 | 2915768154 | Amycolatopsis pittospori PIP199 | Isolate | Unclassified |
| 66 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 67 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 68 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 69 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 70 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 71 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 72 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 73 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 74 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 75 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 76 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 77 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 78 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 79 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 80 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 81 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 82 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 83 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 84 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 85 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 86 | 2977251589 | Microbacterium sp. SORGH_AS 505 | Isolate | Unclassified |
| 87 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 88 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 89 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 90 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 91 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 92 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 93 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 94 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 95 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 96 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 97 | 3300003285 | Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 98 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 99 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 100 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 101 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 102 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 103 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 105 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 106 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 108 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 109 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 111 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 115 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 116 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 119 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 120 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 121 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 122 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 124 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 125 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 126 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 127 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 128 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 129 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 130 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 131 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 132 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 133 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 134 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 135 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 136 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 137 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 138 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 139 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 140 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 141 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 142 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 143 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 144 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 145 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 146 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 147 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 148 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 149 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 150 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 151 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 153 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 154 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 155 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 156 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 157 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 158 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 159 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 160 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 161 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 162 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 163 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 164 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 166 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 167 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 168 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 169 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 170 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 171 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 172 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 173 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 174 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 175 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 176 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 177 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 178 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 179 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 180 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 181 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 182 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 183 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 221 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 224 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 225 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 226 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 227 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 228 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 229 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 230 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 231 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 232 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 233 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 234 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 235 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 236 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 237 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 238 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 239 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 242 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 243 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 244 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 245 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 246 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 247 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 253 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 254 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 255 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 256 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 257 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 258 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 259 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 260 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 261 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 262 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 263 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 264 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 265 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 266 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 267 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 268 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 269 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 270 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 271 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 272 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 273 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 274 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 275 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 276 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 277 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 278 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 279 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 280 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 352 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 354 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 357 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 358 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 359 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 360 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 361 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 362 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 363 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 364 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 365 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 366 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 367 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 368 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 369 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 370 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 372 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 373 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 374 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 377 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 378 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 392 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 393 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 395 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 396 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 399 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 400 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 401 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 402 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 403 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 404 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 405 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 406 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 407 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 410 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 411 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 412 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 413 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 414 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 415 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 416 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 417 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 418 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 419 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 420 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 421 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 423 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 424 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 425 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 427 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 428 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 429 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 430 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 431 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 432 | 8056579771 | Promicromonospora iranensis UTMC 00792 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.43 |
| Metatranscriptomes | 1.32 |
| Isolates | 14.25 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.26 |
| Bulb | 0 |
| Endosphere | 5.8 |
| Nodule | 0.13 |
| Rhizoplane | 1.98 |
| Rhizosphere | 72.82 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10005331 | 3300001979 | Bacteria | 5450 |
| 2 | JGI24740J21852_10006152 | 3300001979 | Bacteria | 5006 |
| 3 | JGI24739J22299_10006370 | 3300001989 | Bacteria | 4457 |
| 4 | JGI24737J22298_10004249 | 3300001990 | Bacteria | 5006 |
| 5 | JGI24737J22298_10004684 | 3300001990 | Bacteria | 4758 |
| 6 | JGI24737J22298_10006796 | 3300001990 | Bacteria | 3886 |
| 7 | JGI24735J21928_10009817 | 3300002067 | Bacteria | 3065 |
| 8 | JGI25406J46586_10036378 | 3300003203 | Bacteria | 1787 |
| 9 | Ga0007423J48922_101173 | 3300003285 | Bacteria | 1210 |
| 10 | rootH2_10054494 | 3300003320 | Bacteria | 10589 |
| 11 | JGI25160J50197_1033347 | 3300003354 | Bacteria | 1296 |
| 12 | Ga0055542_1000019 | 3300003762 | Bacteria | 341174 |
| 13 | Ga0055529_1000008 | 3300003763 | Bacteria | 394786 |
| 14 | Ga0065714_10019207 | 3300005288 | Bacteria | 1661 |
| 15 | Ga0065714_10070907 | 3300005288 | Bacteria | 3731 |
| 16 | Ga0065714_10124698 | 3300005288 | Bacteria | 1308 |
| 17 | Ga0065714_10134026 | 3300005288 | Bacteria | 1225 |
| 18 | Ga0070658_10032918 | 3300005327 | Bacteria | 4168 |
| 19 | Ga0070658_10075763 | 3300005327 | Bacteria | 2760 |
| 20 | Ga0070670_100028121 | 3300005331 | Bacteria | 4838 |
| 21 | Ga0068869_100124994 | 3300005334 | Bacteria | 1971 |
| 22 | Ga0070666_10081315 | 3300005335 | Bacteria | 2215 |
| 23 | Ga0070682_100190302 | 3300005337 | Bacteria | 1440 |
| 24 | Ga0068868_100121058 | 3300005338 | Bacteria | 2135 |
| 25 | Ga0068868_100262897 | 3300005338 | Bacteria | 1456 |
| 26 | Ga0070660_100054899 | 3300005339 | Bacteria | 3077 |
| 27 | Ga0070692_10067378 | 3300005345 | Bacteria | 1900 |
| 28 | Ga0070668_100028603 | 3300005347 | Bacteria | 4231 |
| 29 | Ga0070668_100098861 | 3300005347 | Bacteria | 2310 |
| 30 | Ga0070668_100120163 | 3300005347 | Bacteria | 2099 |
| 31 | Ga0070669_100350890 | 3300005353 | Bacteria | 1198 |
| 32 | Ga0070671_100063234 | 3300005355 | Bacteria | 3082 |
| 33 | Ga0070673_100147998 | 3300005364 | Bacteria | 1987 |
| 34 | Ga0070688_100029008 | 3300005365 | Bacteria | 3309 |
| 35 | Ga0070659_100005438 | 3300005366 | Bacteria | 9147 |
| 36 | Ga0070667_100058987 | 3300005367 | Bacteria | 3246 |
| 37 | Ga0070667_100064126 | 3300005367 | Bacteria | 3116 |
| 38 | Ga0070714_100016573 | 3300005435 | Bacteria | 5955 |
| 39 | Ga0070713_100118526 | 3300005436 | Bacteria | 2318 |
| 40 | Ga0070710_10035951 | 3300005437 | Bacteria | 2704 |
| 41 | Ga0070663_100040694 | 3300005455 | Bacteria | 3256 |
| 42 | Ga0070663_100041340 | 3300005455 | Bacteria | 3233 |
| 43 | Ga0070663_100064990 | 3300005455 | Bacteria | 2639 |
| 44 | Ga0070663_100087576 | 3300005455 | Bacteria | 2302 |
| 45 | Ga0070663_100364064 | 3300005455 | Bacteria | 1174 |
| 46 | Ga0070662_100054231 | 3300005457 | Bacteria | 2905 |
| 47 | Ga0070681_10507867 | 3300005458 | Bacteria | 1119 |
| 48 | Ga0068867_100361785 | 3300005459 | Bacteria | 1214 |
| 49 | Ga0070684_100150625 | 3300005535 | Bacteria | 2107 |
| 50 | Ga0068853_100033935 | 3300005539 | Bacteria | 4330 |
| 51 | Ga0068853_100154855 | 3300005539 | Bacteria | 2065 |
| 52 | Ga0068853_100216893 | 3300005539 | Bacteria | 1746 |
| 53 | Ga0070672_100200057 | 3300005543 | Bacteria | 1670 |
| 54 | Ga0070693_100105415 | 3300005547 | Bacteria | 1725 |
| 55 | Ga0070665_100064997 | 3300005548 | Bacteria | 3660 |
| 56 | Ga0070665_100392855 | 3300005548 | Bacteria | 1395 |
| 57 | Ga0068855_100017723 | 3300005563 | Bacteria | 8562 |
| 58 | Ga0068855_100052979 | 3300005563 | Bacteria | 4775 |
| 59 | Ga0070664_100007052 | 3300005564 | Bacteria | 9070 |
| 60 | Ga0070664_100133943 | 3300005564 | Bacteria | 2178 |
| 61 | Ga0070664_100190005 | 3300005564 | Bacteria | 1830 |
| 62 | Ga0068857_100082953 | 3300005577 | Bacteria | 2864 |
| 63 | Ga0068857_100136752 | 3300005577 | Bacteria | 2213 |
| 64 | Ga0068854_100027500 | 3300005578 | Bacteria | 3920 |
| 65 | Ga0068856_100061526 | 3300005614 | Bacteria | 3709 |
| 66 | Ga0068856_100167799 | 3300005614 | Bacteria | 2206 |
| 67 | Ga0068856_100214592 | 3300005614 | Bacteria | 1940 |
| 68 | Ga0068852_100019092 | 3300005616 | Bacteria | 5417 |
| 69 | Ga0068852_100049796 | 3300005616 | Bacteria | 3586 |
| 70 | Ga0068852_100093308 | 3300005616 | Bacteria | 2698 |
| 71 | Ga0068859_100073431 | 3300005617 | Bacteria | 3459 |
| 72 | Ga0068861_100036096 | 3300005719 | Bacteria | 3666 |
| 73 | Ga0068863_100073776 | 3300005841 | Bacteria | 3228 |
| 74 | Ga0068863_100242204 | 3300005841 | Bacteria | 1741 |
| 75 | Ga0068858_100000023 | 3300005842 | Bacteria | 167824 |
| 76 | Ga0068860_100000631 | 3300005843 | Bacteria | 41527 |
| 77 | Ga0068860_100058287 | 3300005843 | Bacteria | 3671 |
| 78 | Ga0068860_100282675 | 3300005843 | Bacteria | 1622 |
| 79 | Ga0068860_100359322 | 3300005843 | Bacteria | 1434 |
| 80 | Ga0068862_100016342 | 3300005844 | Bacteria | 6177 |
| 81 | Ga0081455_10025631 | 3300005937 | Bacteria | 5438 |
| 82 | Ga0081538_10009829 | 3300005981 | Bacteria | 7916 |
| 83 | Ga0081539_10000195 | 3300005985 | Bacteria | 141188 |
| 84 | Ga0081539_10000448 | 3300005985 | Bacteria | 87723 |
| 85 | Ga0081539_10007488 | 3300005985 | Bacteria | 9925 |
| 86 | Ga0081539_10023811 | 3300005985 | Bacteria | 3996 |
| 87 | Ga0075365_10033648 | 3300006038 | Bacteria | 3305 |
| 88 | Ga0075368_10016741 | 3300006042 | Bacteria | 2735 |
| 89 | Ga0075363_100000519 | 3300006048 | Bacteria | 12390 |
| 90 | Ga0075363_100003846 | 3300006048 | Bacteria | 6473 |
| 91 | Ga0075363_100014117 | 3300006048 | Bacteria | 3893 |
| 92 | Ga0075364_10045923 | 3300006051 | Bacteria | 2843 |
| 93 | Ga0070716_100139241 | 3300006173 | Bacteria | 1545 |
| 94 | Ga0075428_100121249 | 3300006844 | Bacteria | 2847 |
| 95 | Ga0097620_100073434 | 3300006931 | Bacteria | 3459 |
| 96 | Ga0105244_10014945 | 3300009036 | Bacteria | 4467 |
| 97 | Ga0105240_10289365 | 3300009093 | Bacteria | 1879 |
| 98 | Ga0105245_10065478 | 3300009098 | Bacteria | 3287 |
| 99 | Ga0105245_10082940 | 3300009098 | Bacteria | 2933 |
| 100 | Ga0105245_10128358 | 3300009098 | Bacteria | 2376 |
| 101 | Ga0105245_10367355 | 3300009098 | Bacteria | 1430 |
| 102 | Ga0105245_10449152 | 3300009098 | Bacteria | 1297 |
| 103 | Ga0105243_10049273 | 3300009148 | Bacteria | 3322 |
| 104 | Ga0105243_10056055 | 3300009148 | Bacteria | 3132 |
| 105 | Ga0105243_10133487 | 3300009148 | Bacteria | 2109 |
| 106 | Ga0105241_10007724 | 3300009174 | Bacteria | 7903 |
| 107 | Ga0105248_10000365 | 3300009177 | Bacteria | 52722 |
| 108 | Ga0105237_10059324 | 3300009545 | Bacteria | 3828 |
| 109 | Ga0105238_10181378 | 3300009551 | Bacteria | 2082 |
| 110 | Ga0105238_10435019 | 3300009551 | Bacteria | 1308 |
| 111 | Ga0105238_10457777 | 3300009551 | Bacteria | 1273 |
| 112 | Ga0105238_10469174 | 3300009551 | Bacteria | 1257 |
| 113 | Ga0105249_10052646 | 3300009553 | Bacteria | 3718 |
| 114 | Ga0105239_10240254 | 3300010375 | Bacteria | 2033 |
| 115 | Ga0105239_10600906 | 3300010375 | Bacteria | 1255 |
| 116 | Ga0105246_10021889 | 3300011119 | Bacteria | 4121 |
| 117 | Ga0105246_10079086 | 3300011119 | Bacteria | 2337 |
| 118 | Ga0105246_10101360 | 3300011119 | Bacteria | 2097 |
| 119 | Ga0105246_10172798 | 3300011119 | Bacteria | 1656 |
| 120 | Ga0105246_10335942 | 3300011119 | Bacteria | 1233 |
| 121 | Ga0157373_10213522 | 3300013100 | Bacteria | 1361 |
| 122 | Ga0157370_10077269 | 3300013104 | Bacteria | 3136 |
| 123 | Ga0157369_10004513 | 3300013105 | Bacteria | 16385 |
| 124 | Ga0157369_10251578 | 3300013105 | Bacteria | 1844 |
| 125 | Ga0157369_10857486 | 3300013105 | Bacteria | 932 |
| 126 | Ga0157374_10015647 | 3300013296 | Bacteria | 6659 |
| 127 | Ga0157378_10022244 | 3300013297 | Bacteria | 5580 |
| 128 | Ga0163162_10309527 | 3300013306 | Bacteria | 1712 |
| 129 | Ga0157372_10022312 | 3300013307 | Bacteria | 6847 |
| 130 | Ga0157372_10038922 | 3300013307 | Bacteria | 5248 |
| 131 | Ga0157372_10084473 | 3300013307 | Bacteria | 3598 |
| 132 | Ga0157372_10106942 | 3300013307 | Bacteria | 3201 |
| 133 | Ga0157372_10387850 | 3300013307 | Bacteria | 1627 |
| 134 | Ga0157372_10439392 | 3300013307 | Bacteria | 1521 |
| 135 | Ga0157375_10110663 | 3300013308 | Bacteria | 2844 |
| 136 | Ga0157375_10395411 | 3300013308 | Bacteria | 1549 |
| 137 | Ga0157380_10056042 | 3300014326 | Bacteria | 3133 |
| 138 | Ga0182008_10144203 | 3300014497 | Bacteria | 1192 |
| 139 | Ga0157379_10028337 | 3300014968 | Bacteria | 4983 |
| 140 | Ga0157376_10332691 | 3300014969 | Bacteria | 1448 |
| 141 | Ga0183367_1004 | 3300015688 | Bacteria | 716880 |
| 142 | Ga0183367_1012 | 3300015688 | Bacteria | 347438 |
| 143 | Ga0206350_10637427 | 3300020080 | Bacteria | 2070 |
| 144 | Ga0206354_10736904 | 3300020081 | Bacteria | 1497 |
| 145 | Ga0209672_100011 | 3300025228 | Bacteria | 856297 |
| 146 | Ga0209147_100319 | 3300025229 | Bacteria | 36693 |
| 147 | Ga0209148_1000023 | 3300025254 | Bacteria | 680511 |
| 148 | Ga0209455_1000023 | 3300025272 | Bacteria | 680449 |
| 149 | Ga0207426_1013909 | 3300025302 | Bacteria | 2966 |
| 150 | Ga0207655_1009093 | 3300025728 | Bacteria | 6216 |
| 151 | Ga0207692_10011327 | 3300025898 | Bacteria | 3790 |
| 152 | Ga0207647_10027659 | 3300025904 | Bacteria | 3694 |
| 153 | Ga0207705_10008870 | 3300025909 | Bacteria | 7328 |
| 154 | Ga0207705_10033743 | 3300025909 | Bacteria | 3657 |
| 155 | Ga0207695_10009651 | 3300025913 | Bacteria | 11899 |
| 156 | Ga0207671_10019262 | 3300025914 | Bacteria | 5221 |
| 157 | Ga0207671_10186728 | 3300025914 | Bacteria | 1615 |
| 158 | Ga0207649_10022261 | 3300025920 | Bacteria | 3661 |
| 159 | Ga0207694_10115594 | 3300025924 | Bacteria | 2138 |
| 160 | Ga0207694_10123285 | 3300025924 | Bacteria | 2071 |
| 161 | Ga0207650_10066765 | 3300025925 | Bacteria | 2698 |
| 162 | Ga0207687_10094070 | 3300025927 | Bacteria | 2192 |
| 163 | Ga0207700_10061831 | 3300025928 | Bacteria | 2842 |
| 164 | Ga0207664_10044114 | 3300025929 | Bacteria | 3490 |
| 165 | Ga0207664_10108718 | 3300025929 | Bacteria | 2303 |
| 166 | Ga0207690_10001158 | 3300025932 | Bacteria | 16695 |
| 167 | Ga0207706_10024667 | 3300025933 | Bacteria | 5389 |
| 168 | Ga0207709_10066605 | 3300025935 | Bacteria | 2269 |
| 169 | Ga0207709_10090664 | 3300025935 | Bacteria | 1997 |
| 170 | Ga0207670_10035180 | 3300025936 | Bacteria | 3245 |
| 171 | Ga0207704_10097954 | 3300025938 | Bacteria | 1946 |
| 172 | Ga0207691_10081974 | 3300025940 | Bacteria | 2899 |
| 173 | Ga0207711_10000340 | 3300025941 | Bacteria | 49514 |
| 174 | Ga0207711_10143217 | 3300025941 | Bacteria | 2152 |
| 175 | Ga0207689_10028916 | 3300025942 | Bacteria | 4633 |
| 176 | Ga0207661_10187649 | 3300025944 | Bacteria | 1811 |
| 177 | Ga0207679_10016223 | 3300025945 | Bacteria | 4942 |
| 178 | Ga0207667_10009261 | 3300025949 | Bacteria | 11626 |
| 179 | Ga0207667_10031611 | 3300025949 | Bacteria | 5712 |
| 180 | Ga0207712_10053210 | 3300025961 | Bacteria | 2839 |
| 181 | Ga0207668_10016593 | 3300025972 | Bacteria | 4598 |
| 182 | Ga0207668_10055671 | 3300025972 | Bacteria | 2751 |
| 183 | Ga0207640_10080953 | 3300025981 | Bacteria | 2219 |
| 184 | Ga0207658_10027115 | 3300025986 | Bacteria | 4023 |
| 185 | Ga0207658_10222688 | 3300025986 | Bacteria | 1588 |
| 186 | Ga0207658_10226131 | 3300025986 | Bacteria | 1577 |
| 187 | Ga0207677_10101993 | 3300026023 | Bacteria | 2114 |
| 188 | Ga0207677_10114977 | 3300026023 | Bacteria | 2012 |
| 189 | Ga0207703_10000570 | 3300026035 | Bacteria | 37836 |
| 190 | Ga0207703_10010084 | 3300026035 | Bacteria | 7405 |
| 191 | Ga0207639_10112309 | 3300026041 | Bacteria | 2223 |
| 192 | Ga0207639_10198348 | 3300026041 | Bacteria | 1719 |
| 193 | Ga0207678_10000268 | 3300026067 | Bacteria | 47323 |
| 194 | Ga0207678_10001777 | 3300026067 | Bacteria | 19740 |
| 195 | Ga0207678_10014353 | 3300026067 | Bacteria | 6966 |
| 196 | Ga0207678_10062320 | 3300026067 | Bacteria | 3206 |
| 197 | Ga0207678_10335999 | 3300026067 | Bacteria | 1301 |
| 198 | Ga0207702_10148764 | 3300026078 | Bacteria | 2128 |
| 199 | Ga0207702_10155599 | 3300026078 | Bacteria | 2084 |
| 200 | Ga0207702_10238310 | 3300026078 | Bacteria | 1703 |
| 201 | Ga0207641_10241982 | 3300026088 | Bacteria | 1682 |
| 202 | Ga0207674_10013828 | 3300026116 | Bacteria | 8930 |
| 203 | Ga0207674_10019601 | 3300026116 | Bacteria | 7323 |
| 204 | Ga0207674_10213929 | 3300026116 | Bacteria | 1876 |
| 205 | Ga0207675_100012668 | 3300026118 | Bacteria | 7879 |
| 206 | Ga0207683_10126218 | 3300026121 | Bacteria | 2300 |
| 207 | Ga0207698_10012613 | 3300026142 | Bacteria | 5538 |
| 208 | Ga0207698_10255720 | 3300026142 | Bacteria | 1606 |
| 209 | Ga0209813_10007394 | 3300027866 | Bacteria | 2735 |
| 210 | Ga0268264_10001893 | 3300028381 | Bacteria | 18990 |
| 211 | Ga0265326_10000839 | 3300028558 | Bacteria | 11296 |
| 212 | Ga0265319_1004853 | 3300028563 | Bacteria | 6581 |
| 213 | Ga0265323_10038494 | 3300028653 | Bacteria | 1748 |
| 214 | Ga0307517_10002208 | 3300028786 | Bacteria | 31459 |
| 215 | Ga0307517_10017578 | 3300028786 | Bacteria | 9314 |
| 216 | Ga0307517_10062302 | 3300028786 | Bacteria | 3510 |
| 217 | Ga0307515_10000025 | 3300028794 | Bacteria | 390205 |
| 218 | Ga0307515_10013809 | 3300028794 | Bacteria | 15051 |
| 219 | Ga0307515_10083797 | 3300028794 | Bacteria | 4105 |
| 220 | Ga0307515_10091252 | 3300028794 | Bacteria | 3809 |
| 221 | Ga0307515_10109151 | 3300028794 | Bacteria | 3252 |
| 222 | Ga0307515_10250106 | 3300028794 | Bacteria | 1527 |
| 223 | Ga0307511_10038111 | 3300030521 | Bacteria | 4136 |
| 224 | Ga0307512_10004340 | 3300030522 | Bacteria | 15637 |
| 225 | Ga0307512_10004744 | 3300030522 | Bacteria | 14668 |
| 226 | Ga0307512_10025790 | 3300030522 | Bacteria | 5200 |
| 227 | Ga0307512_10033438 | 3300030522 | Bacteria | 4420 |
| 228 | Ga0316177_1029591 | 3300030731 | Bacteria | 2697 |
| 229 | Ga0314311_1194712 | 3300030733 | Bacteria | 2621 |
| 230 | Ga0265332_10002167 | 3300031238 | Bacteria | 10112 |
| 231 | Ga0307513_10000003 | 3300031456 | Bacteria | 590921 |
| 232 | Ga0307513_10049850 | 3300031456 | Bacteria | 4532 |
| 233 | Ga0307513_10069905 | 3300031456 | Bacteria | 3672 |
| 234 | Ga0307513_10188878 | 3300031456 | Bacteria | 1914 |
| 235 | Ga0307509_10045377 | 3300031507 | Bacteria | 4739 |
| 236 | Ga0307508_10025662 | 3300031616 | Bacteria | 5340 |
| 237 | Ga0307508_10051617 | 3300031616 | Bacteria | 3655 |
| 238 | Ga0307508_10072113 | 3300031616 | Bacteria | 3028 |
| 239 | Ga0307508_10231025 | 3300031616 | Bacteria | 1448 |
| 240 | Ga0307508_10364419 | 3300031616 | Bacteria | 1036 |
| 241 | Ga0307514_10064241 | 3300031649 | Bacteria | 2784 |
| 242 | Ga0316579_10000381 | 3300031691 | Bacteria | 13953 |
| 243 | Ga0265314_10004475 | 3300031711 | Bacteria | 12960 |
| 244 | Ga0307405_10083030 | 3300031731 | Bacteria | 2099 |
| 245 | Ga0307405_10116654 | 3300031731 | Bacteria | 1819 |
| 246 | Ga0307406_10000260 | 3300031901 | Bacteria | 31960 |
| 247 | Ga0307406_10073390 | 3300031901 | Bacteria | 2250 |
| 248 | Ga0307406_10183215 | 3300031901 | Bacteria | 1526 |
| 249 | Ga0307412_10005767 | 3300031911 | Bacteria | 6966 |
| 250 | Ga0307412_10138111 | 3300031911 | Bacteria | 1781 |
| 251 | Ga0307409_100472629 | 3300031995 | Bacteria | 1215 |
| 252 | Ga0307409_100599658 | 3300031995 | Bacteria | 1088 |
| 253 | Ga0307416_100061247 | 3300032002 | Bacteria | 3070 |
| 254 | Ga0307414_10091639 | 3300032004 | Bacteria | 2260 |
| 255 | Ga0307414_10102268 | 3300032004 | Bacteria | 2159 |
| 256 | Ga0307415_100285683 | 3300032126 | Bacteria | 1359 |
| 257 | Ga0307507_10015152 | 3300033179 | Bacteria | 9099 |
| 258 | Ga0307507_10029493 | 3300033179 | Bacteria | 5815 |
| 259 | Ga0307507_10045192 | 3300033179 | Bacteria | 4337 |
| 260 | Ga0307510_10090821 | 3300033180 | Bacteria | 2899 |
| 261 | Ga0307510_10106719 | 3300033180 | Bacteria | 2562 |
| 262 | Ga0373951_0000049 | 3300035091 | Bacteria | 47611 |
| 263 | Ga0373962_0002029 | 3300035242 | Bacteria | 4827 |
| 264 | Ga0373935_0048201 | 3300035692 | Bacteria | 2697 |
| 265 | Ga0373925_0480753 | 3300037068 | Bacteria | 1019 |
| 266 | Ga0395899_0000858 | 3300037312 | Bacteria | 29037 |
| 267 | Ga0395898_0022084 | 3300037466 | Bacteria | 6447 |
| 268 | Ga0395898_0350728 | 3300037466 | Bacteria | 1407 |
| 269 | Ga0439436_0017158 | 3300041404 | Bacteria | 2167 |
| 270 | Ga0451789_0309907 | 3300041443 | Bacteria | 1538 |
| 271 | Ga0451793_0665654 | 3300041452 | Bacteria | 1494 |
| 272 | Ga0451807_0658772 | 3300041486 | Bacteria | 1895 |
| 273 | Ga0451841_0651592 | 3300041498 | Bacteria | 2753 |
| 274 | Ga0451845_0977945 | 3300041501 | Bacteria | 1804 |
| 275 | Ga0451847_0489115 | 3300041503 | Bacteria | 1301 |
| 276 | Ga0451843_0451920 | 3300041509 | Bacteria | 3334 |
| 277 | Ga0451853_2189455 | 3300041512 | Bacteria | 2369 |
| 278 | Ga0451853_2722946 | 3300041512 | Bacteria | 1448 |
| 279 | Ga0439449_0001846 | 3300042007 | Bacteria | 8336 |
| 280 | Ga0439449_0066101 | 3300042007 | Bacteria | 1333 |
| 281 | Ga0439455_0073895 | 3300042012 | Bacteria | 919 |
| 282 | Ga0450903_004374 | 3300042138 | Bacteria | 2414 |
| 283 | Ga0439459_0039893 | 3300042438 | Bacteria | 994 |
| 284 | Ga0466969_0020497 | 3300044656 | Bacteria | 3423 |
| 285 | Ga0466969_0028115 | 3300044656 | Bacteria | 2874 |
| 286 | Ga0466969_0057630 | 3300044656 | Bacteria | 1893 |
| 287 | Ga0466969_0059461 | 3300044656 | Bacteria | 1858 |
| 288 | Ga0466972_0006335 | 3300044658 | Bacteria | 5945 |
| 289 | Ga0466972_0012642 | 3300044658 | Bacteria | 4240 |
| 290 | Ga0466965_0022019 | 3300044683 | Bacteria | 3071 |
| 291 | Ga0466965_0031318 | 3300044683 | Bacteria | 2593 |
| 292 | Ga0466966_0005036 | 3300044684 | Bacteria | 8688 |
| 293 | Ga0466966_0005223 | 3300044684 | Bacteria | 8535 |
| 294 | Ga0466966_0036400 | 3300044684 | Bacteria | 3177 |
| 295 | Ga0466966_0062617 | 3300044684 | Bacteria | 2345 |
| 296 | Ga0466966_0212850 | 3300044684 | Bacteria | 1168 |
| 297 | Ga0466961_0000884 | 3300044693 | Bacteria | 18652 |
| 298 | Ga0466961_0004724 | 3300044693 | Bacteria | 8568 |
| 299 | Ga0466961_0044020 | 3300044693 | Bacteria | 2857 |
| 300 | Ga0466961_0216549 | 3300044693 | Bacteria | 1181 |
| 301 | Ga0466963_0000867 | 3300044694 | Bacteria | 15312 |
| 302 | Ga0466964_0002993 | 3300044706 | Bacteria | 6119 |
| 303 | Ga0466971_0000558 | 3300044719 | Bacteria | 14746 |
| 304 | Ga0466971_0012994 | 3300044719 | Bacteria | 3653 |
| 305 | Ga0466971_0015473 | 3300044719 | Bacteria | 3358 |
| 306 | Ga0466970_0000015 | 3300044765 | Bacteria | 68954 |
| 307 | Ga0466970_0000414 | 3300044765 | Bacteria | 20867 |
| 308 | Ga0466970_0140333 | 3300044765 | Bacteria | 1331 |
| 309 | Ga0466957_0002513 | 3300044842 | Bacteria | 9870 |
| 310 | Ga0466957_0031025 | 3300044842 | Bacteria | 3193 |
| 311 | Ga0466960_0001602 | 3300044901 | Bacteria | 8282 |
| 312 | Ga0466960_0008373 | 3300044901 | Bacteria | 4234 |
| 313 | Ga0466960_0027645 | 3300044901 | Bacteria | 2590 |
| 314 | Ga0466959_0008735 | 3300045049 | Bacteria | 7173 |
| 315 | Ga0466959_0015694 | 3300045049 | Bacteria | 5523 |
| 316 | Ga0466959_0172711 | 3300045049 | Bacteria | 1515 |
| 317 | Ga0466958_0027958 | 3300045836 | Bacteria | 3340 |
| 318 | Ga0466967_0004720 | 3300045976 | Bacteria | 9265 |
| 319 | Ga0466967_0244944 | 3300045976 | Bacteria | 1711 |
| 320 | Ga0495617_016044 | 3300046452 | Bacteria | 2534 |
| 321 | Ga0495627_000262 | 3300046453 | Bacteria | 53953 |
| 322 | Ga0495627_005954 | 3300046453 | Bacteria | 4845 |
| 323 | Ga0495627_013966 | 3300046453 | Bacteria | 2816 |
| 324 | Ga0495592_0001835 | 3300046454 | Bacteria | 14933 |
| 325 | Ga0495592_0012547 | 3300046454 | Bacteria | 6439 |
| 326 | Ga0495592_0025591 | 3300046454 | Bacteria | 4478 |
| 327 | Ga0495592_0079471 | 3300046454 | Bacteria | 2374 |
| 328 | Ga0495603_0002711 | 3300046455 | Bacteria | 10439 |
| 329 | Ga0495603_0012538 | 3300046455 | Bacteria | 5131 |
| 330 | Ga0495629_0000729 | 3300046459 | Bacteria | 26703 |
| 331 | Ga0495629_0021514 | 3300046459 | Bacteria | 4602 |
| 332 | Ga0495629_0044899 | 3300046459 | Bacteria | 3100 |
| 333 | Ga0495629_0051579 | 3300046459 | Bacteria | 2879 |
| 334 | Ga0495629_0053946 | 3300046459 | Bacteria | 2811 |
| 335 | Ga0495629_0055563 | 3300046459 | Bacteria | 2768 |
| 336 | Ga0495629_0087060 | 3300046459 | Bacteria | 2179 |
| 337 | Ga0495638_0024173 | 3300046460 | Bacteria | 3965 |
| 338 | Ga0495638_0032867 | 3300046460 | Bacteria | 3321 |
| 339 | Ga0495638_0040207 | 3300046460 | Bacteria | 2964 |
| 340 | Ga0495651_0003934 | 3300046462 | Bacteria | 11355 |
| 341 | Ga0495651_0010033 | 3300046462 | Bacteria | 7280 |
| 342 | Ga0495651_0035198 | 3300046462 | Bacteria | 3901 |
| 343 | Ga0495651_0038322 | 3300046462 | Bacteria | 3733 |
| 344 | Ga0495651_0191798 | 3300046462 | Bacteria | 1437 |
| 345 | Ga0495653_0231846 | 3300046463 | Bacteria | 1235 |
| 346 | Ga0495580_0028759 | 3300046472 | Bacteria | 4038 |
| 347 | Ga0495580_0192351 | 3300046472 | Bacteria | 1407 |
| 348 | Ga0495605_0001464 | 3300046474 | Bacteria | 15422 |
| 349 | Ga0495605_0009059 | 3300046474 | Bacteria | 5603 |
| 350 | Ga0495662_0002684 | 3300046476 | Bacteria | 8984 |
| 351 | Ga0495662_0042302 | 3300046476 | Bacteria | 2199 |
| 352 | Ga0495664_0001605 | 3300046477 | Bacteria | 12024 |
| 353 | Ga0495664_0079574 | 3300046477 | Bacteria | 1964 |
| 354 | Ga0495585_0063938 | 3300046492 | Bacteria | 2018 |
| 355 | Ga0495594_0004036 | 3300046499 | Bacteria | 7552 |
| 356 | Ga0495594_0010260 | 3300046499 | Bacteria | 4853 |
| 357 | Ga0495594_0022491 | 3300046499 | Bacteria | 3372 |
| 358 | Ga0495594_0037253 | 3300046499 | Bacteria | 2653 |
| 359 | Ga0495607_0010980 | 3300046501 | Bacteria | 6055 |
| 360 | Ga0495583_0005674 | 3300046506 | Bacteria | 8397 |
| 361 | Ga0495583_0049245 | 3300046506 | Bacteria | 1930 |
| 362 | Ga0495606_0024232 | 3300046507 | Bacteria | 4379 |
| 363 | Ga0495608_0017280 | 3300046511 | Bacteria | 4992 |
| 364 | Ga0495608_0023706 | 3300046511 | Bacteria | 4203 |
| 365 | Ga0495610_0057477 | 3300046512 | Bacteria | 1865 |
| 366 | Ga0495610_0086092 | 3300046512 | Bacteria | 1432 |
| 367 | Ga0495610_0100765 | 3300046512 | Bacteria | 1294 |
| 368 | Ga0495616_0003623 | 3300046513 | Bacteria | 9870 |
| 369 | Ga0495618_0023361 | 3300046514 | Bacteria | 3822 |
| 370 | Ga0495620_0011710 | 3300046515 | Bacteria | 4561 |
| 371 | Ga0495620_0011920 | 3300046515 | Bacteria | 4516 |
| 372 | Ga0495620_0032034 | 3300046515 | Bacteria | 2400 |
| 373 | Ga0495628_0008151 | 3300046516 | Bacteria | 9014 |
| 374 | Ga0495628_0079845 | 3300046516 | Bacteria | 2543 |
| 375 | Ga0495630_0239422 | 3300046517 | Bacteria | 1387 |
| 376 | Ga0495631_0002744 | 3300046518 | Bacteria | 9760 |
| 377 | Ga0495631_0055508 | 3300046518 | Bacteria | 1726 |
| 378 | Ga0495632_0030339 | 3300046519 | Bacteria | 2807 |
| 379 | Ga0495643_0001461 | 3300046522 | Bacteria | 21642 |
| 380 | Ga0495643_0002615 | 3300046522 | Bacteria | 14014 |
| 381 | Ga0495648_0007727 | 3300046524 | Bacteria | 8564 |
| 382 | Ga0495648_0150717 | 3300046524 | Bacteria | 1213 |
| 383 | Ga0495642_0051214 | 3300046528 | Bacteria | 1698 |
| 384 | Ga0495652_0003943 | 3300046529 | Bacteria | 14406 |
| 385 | Ga0495652_0016428 | 3300046529 | Bacteria | 6622 |
| 386 | Ga0495654_0041408 | 3300046530 | Bacteria | 2291 |
| 387 | Ga0495654_0109047 | 3300046530 | Bacteria | 1265 |
| 388 | Ga0495640_0005159 | 3300046533 | Bacteria | 10386 |
| 389 | Ga0495640_0119162 | 3300046533 | Bacteria | 1717 |
| 390 | Ga0495587_0136261 | 3300046536 | Bacteria | 1402 |
| 391 | Ga0495609_0043885 | 3300046538 | Bacteria | 2006 |
| 392 | Ga0495597_0013328 | 3300046542 | Bacteria | 3942 |
| 393 | Ga0495597_0093314 | 3300046542 | Bacteria | 1275 |
| 394 | Ga0495645_0017788 | 3300046543 | Bacteria | 5098 |
| 395 | Ga0495645_0075474 | 3300046543 | Bacteria | 2426 |
| 396 | Ga0495622_0039732 | 3300046557 | Bacteria | 2190 |
| 397 | Ga0495633_0008115 | 3300046558 | Bacteria | 5954 |
| 398 | Ga0495668_0004244 | 3300046616 | Bacteria | 10297 |
| 399 | Ga0495668_0056109 | 3300046616 | Bacteria | 2174 |
| 400 | Ga0495668_0061984 | 3300046616 | Bacteria | 2061 |
| 401 | Ga0495634_0000745 | 3300046642 | Bacteria | 31538 |
| 402 | Ga0495634_0040422 | 3300046642 | Bacteria | 3172 |
| 403 | Ga0495634_0051933 | 3300046642 | Bacteria | 2750 |
| 404 | Ga0495611_0070609 | 3300046648 | Bacteria | 1596 |
| 405 | Ga0495611_0113928 | 3300046648 | Bacteria | 1259 |
| 406 | Ga0495625_0000716 | 3300046660 | Bacteria | 46718 |
| 407 | Ga0495625_0003926 | 3300046660 | Bacteria | 14294 |
| 408 | Ga0495625_0038206 | 3300046660 | Bacteria | 3516 |
| 409 | Ga0495625_0043973 | 3300046660 | Bacteria | 3236 |
| 410 | Ga0495625_0046547 | 3300046660 | Bacteria | 3129 |
| 411 | Ga0495625_0175179 | 3300046660 | Bacteria | 1429 |
| 412 | Ga0495635_0003608 | 3300046663 | Bacteria | 10717 |
| 413 | Ga0495635_0007408 | 3300046663 | Bacteria | 7657 |
| 414 | Ga0495635_0052328 | 3300046663 | Bacteria | 2813 |
| 415 | Ga0495661_0015815 | 3300046665 | Bacteria | 5025 |
| 416 | Ga0495661_0027183 | 3300046665 | Bacteria | 3675 |
| 417 | Ga0495588_0006810 | 3300046674 | Bacteria | 5173 |
| 418 | Ga0495588_0014053 | 3300046674 | Bacteria | 3826 |
| 419 | Ga0495657_0003773 | 3300046675 | Bacteria | 12271 |
| 420 | Ga0495657_0032694 | 3300046675 | Bacteria | 3628 |
| 421 | Ga0495623_0005945 | 3300046679 | Bacteria | 7954 |
| 422 | Ga0495623_0011396 | 3300046679 | Bacteria | 5754 |
| 423 | Ga0495623_0040473 | 3300046679 | Bacteria | 2976 |
| 424 | Ga0495646_0000930 | 3300046680 | Bacteria | 16647 |
| 425 | Ga0495646_0108576 | 3300046680 | Bacteria | 1582 |
| 426 | Ga0495613_0007455 | 3300046689 | Bacteria | 8150 |
| 427 | Ga0495613_0036920 | 3300046689 | Bacteria | 3622 |
| 428 | Ga0495613_0085176 | 3300046689 | Bacteria | 2293 |
| 429 | Ga0495613_0111525 | 3300046689 | Bacteria | 1970 |
| 430 | Ga0495613_0149311 | 3300046689 | Bacteria | 1667 |
| 431 | Ga0495624_0110289 | 3300046690 | Bacteria | 1692 |
| 432 | Ga0495624_0129514 | 3300046690 | Bacteria | 1547 |
| 433 | Ga0495624_0164919 | 3300046690 | Bacteria | 1352 |
| 434 | Ga0495670_0075345 | 3300046691 | Bacteria | 1713 |
| 435 | Ga0495671_0006199 | 3300046692 | Bacteria | 6938 |
| 436 | Ga0495671_0068271 | 3300046692 | Bacteria | 1748 |
| 437 | Ga0495649_0190780 | 3300046694 | Bacteria | 1067 |
| 438 | Ga0495649_0214648 | 3300046694 | Bacteria | 996 |
| 439 | Ga0495589_0017668 | 3300046794 | Bacteria | 3660 |
| 440 | Ga0495589_0019866 | 3300046794 | Bacteria | 3437 |
| 441 | Ga0495589_0102965 | 3300046794 | Bacteria | 1380 |
| 442 | Ga0495589_0143118 | 3300046794 | Bacteria | 1144 |
| 443 | Ga0495600_0014454 | 3300046809 | Bacteria | 4975 |
| 444 | Ga0495600_0047004 | 3300046809 | Bacteria | 2815 |
| 445 | Ga0495600_0071443 | 3300046809 | Bacteria | 2267 |
| 446 | Ga0495581_0128366 | 3300047315 | Bacteria | 1477 |
| 447 | Ga0495604_0000558 | 3300047317 | Bacteria | 32740 |
| 448 | Ga0495604_0033881 | 3300047317 | Bacteria | 4041 |
| 449 | Ga0495604_0127657 | 3300047317 | Bacteria | 1831 |
| 450 | Ga0495636_0011685 | 3300047318 | Bacteria | 3478 |
| 451 | Ga0495636_0054113 | 3300047318 | Bacteria | 1686 |
| 452 | Ga0495674_0064437 | 3300047319 | Bacteria | 3186 |
| 453 | Ga0495674_0074986 | 3300047319 | Bacteria | 2912 |
| 454 | Ga0495676_0000768 | 3300047321 | Bacteria | 26771 |
| 455 | Ga0495676_0001734 | 3300047321 | Bacteria | 19047 |
| 456 | Ga0495676_0002784 | 3300047321 | Bacteria | 15725 |
| 457 | Ga0495676_0007466 | 3300047321 | Bacteria | 10026 |
| 458 | Ga0495676_0016330 | 3300047321 | Bacteria | 6593 |
| 459 | Ga0495676_0034542 | 3300047321 | Bacteria | 4242 |
| 460 | Ga0495680_0002951 | 3300047322 | Bacteria | 17021 |
| 461 | Ga0495680_0027354 | 3300047322 | Bacteria | 4688 |
| 462 | Ga0495680_0119389 | 3300047322 | Bacteria | 1948 |
| 463 | Ga0495683_0005247 | 3300047323 | Bacteria | 7200 |
| 464 | Ga0495683_0015981 | 3300047323 | Bacteria | 3898 |
| 465 | Ga0495683_0035571 | 3300047323 | Bacteria | 2531 |
| 466 | Ga0495683_0038615 | 3300047323 | Bacteria | 2417 |
| 467 | Ga0495687_003729 | 3300047443 | Bacteria | 10805 |
| 468 | Ga0495687_026079 | 3300047443 | Bacteria | 2755 |
| 469 | Ga0495687_030465 | 3300047443 | Bacteria | 2483 |
| 470 | Ga0495687_039268 | 3300047443 | Bacteria | 2095 |
| 471 | Ga0495687_070979 | 3300047443 | Bacteria | 1396 |
| 472 | Ga0495675_0011602 | 3300047444 | Bacteria | 5532 |
| 473 | Ga0495675_0085730 | 3300047444 | Bacteria | 1980 |
| 474 | Ga0495685_001450 | 3300047447 | Bacteria | 7268 |
| 475 | Ga0495685_005944 | 3300047447 | Bacteria | 3983 |
| 476 | Ga0495685_007130 | 3300047447 | Bacteria | 3683 |
| 477 | Ga0495685_008265 | 3300047447 | Bacteria | 3450 |
| 478 | Ga0495685_028691 | 3300047447 | Bacteria | 1914 |
| 479 | Ga0495685_057995 | 3300047447 | Bacteria | 1307 |
| 480 | Ga0495681_0009151 | 3300047470 | Bacteria | 6128 |
| 481 | Ga0495681_0016568 | 3300047470 | Bacteria | 4123 |
| 482 | Ga0495681_0046037 | 3300047470 | Bacteria | 2083 |
| 483 | Ga0495686_0064577 | 3300047472 | Bacteria | 2265 |
| 484 | Ga0495593_0027906 | 3300047673 | Bacteria | 3103 |
| 485 | Ga0495593_0110296 | 3300047673 | Bacteria | 1405 |
| 486 | Ga0495602_0034326 | 3300048088 | Bacteria | 4747 |
| 487 | Ga0495602_0069826 | 3300048088 | Bacteria | 3010 |
| 488 | Ga0495614_0000340 | 3300048089 | Bacteria | 18522 |
| 489 | Ga0495614_0001852 | 3300048089 | Bacteria | 9262 |
| 490 | Ga0495614_0007790 | 3300048089 | Bacteria | 4760 |
| 491 | Ga0495614_0025542 | 3300048089 | Bacteria | 2547 |
| 492 | Ga0495614_0095658 | 3300048089 | Bacteria | 1294 |
| 493 | Ga0495626_0000069 | 3300048091 | Bacteria | 139104 |
| 494 | Ga0495626_0008702 | 3300048091 | Bacteria | 5533 |
| 495 | Ga0495626_0106559 | 3300048091 | Bacteria | 1217 |
| 496 | Ga0496100_0014827 | 3300048903 | Bacteria | 4535 |
| 497 | Ga0496101_0041456 | 3300048904 | Bacteria | 3282 |
| 498 | Ga0496105_0038857 | 3300048908 | Bacteria | 3921 |
| 499 | Ga0496105_0174257 | 3300048908 | Bacteria | 1763 |
| 500 | Ga0496109_0026506 | 3300048912 | Bacteria | 5169 |
| 501 | Ga0496109_0279976 | 3300048912 | Bacteria | 1572 |
| 502 | Ga0496111_0222913 | 3300048914 | Bacteria | 1401 |
| 503 | Ga0496113_0020066 | 3300048916 | Bacteria | 4691 |
| 504 | Ga0496114_0028597 | 3300048917 | Bacteria | 4575 |
| 505 | Ga0496114_0091095 | 3300048917 | Bacteria | 2589 |
| 506 | Ga0496114_0179734 | 3300048917 | Bacteria | 1847 |
| 507 | Ga0496115_0016015 | 3300048918 | Bacteria | 5701 |
| 508 | Ga0496116_0015383 | 3300048919 | Bacteria | 6048 |
| 509 | Ga0496117_0000091 | 3300048920 | Bacteria | 203826 |
| 510 | Ga0496117_0007274 | 3300048920 | Bacteria | 10878 |
| 511 | Ga0496117_0013877 | 3300048920 | Bacteria | 6986 |
| 512 | Ga0496117_0050726 | 3300048920 | Bacteria | 2940 |
| 513 | Ga0496117_0061202 | 3300048920 | Bacteria | 2589 |
| 514 | Ga0496118_0009188 | 3300048921 | Bacteria | 10036 |
| 515 | Ga0496118_0019417 | 3300048921 | Bacteria | 6075 |
| 516 | Ga0496118_0033190 | 3300048921 | Bacteria | 4239 |
| 517 | Ga0496118_0038621 | 3300048921 | Bacteria | 3823 |
| 518 | Ga0496118_0113819 | 3300048921 | Bacteria | 1786 |
| 519 | Ga0496119_0002470 | 3300048922 | Bacteria | 20282 |
| 520 | Ga0496119_0003177 | 3300048922 | Bacteria | 17224 |
| 521 | Ga0496119_0013259 | 3300048922 | Bacteria | 6588 |
| 522 | Ga0496119_0019300 | 3300048922 | Bacteria | 5028 |
| 523 | Ga0496119_0046464 | 3300048922 | Bacteria | 2711 |
| 524 | Ga0496119_0157334 | 3300048922 | Bacteria | 1212 |
| 525 | Ga0496120_0002278 | 3300048923 | Bacteria | 19927 |
| 526 | Ga0496120_0009274 | 3300048923 | Bacteria | 7003 |
| 527 | Ga0496120_0022202 | 3300048923 | Bacteria | 3995 |
| 528 | Ga0496120_0094663 | 3300048923 | Bacteria | 1589 |
| 529 | Ga0496121_0018146 | 3300048924 | Bacteria | 7117 |
| 530 | Ga0496121_0046122 | 3300048924 | Bacteria | 3734 |
| 531 | Ga0496122_0000208 | 3300048925 | Bacteria | 131175 |
| 532 | Ga0496122_0002225 | 3300048925 | Bacteria | 28245 |
| 533 | Ga0496122_0004690 | 3300048925 | Bacteria | 16786 |
| 534 | Ga0496122_0025057 | 3300048925 | Bacteria | 5198 |
| 535 | Ga0496122_0043875 | 3300048925 | Bacteria | 3498 |
| 536 | Ga0496122_0075344 | 3300048925 | Bacteria | 2381 |
| 537 | Ga0496123_0000003 | 3300048926 | Bacteria | 866556 |
| 538 | Ga0496123_0086936 | 3300048926 | Bacteria | 1872 |
| 539 | Ga0496124_0005331 | 3300048927 | Bacteria | 14521 |
| 540 | Ga0496124_0029713 | 3300048927 | Bacteria | 4862 |
| 541 | Ga0496124_0104611 | 3300048927 | Bacteria | 2289 |
| 542 | Ga0496125_0000224 | 3300048928 | Bacteria | 115811 |
| 543 | Ga0496125_0002214 | 3300048928 | Bacteria | 25925 |
| 544 | Ga0496125_0003079 | 3300048928 | Bacteria | 20827 |
| 545 | Ga0496125_0022669 | 3300048928 | Bacteria | 5824 |
| 546 | Ga0496125_0036883 | 3300048928 | Bacteria | 4258 |
| 547 | Ga0496126_0004390 | 3300048929 | Bacteria | 16907 |
| 548 | Ga0496126_0014193 | 3300048929 | Bacteria | 8063 |
| 549 | Ga0496126_0037356 | 3300048929 | Bacteria | 4533 |
| 550 | Ga0496126_0041606 | 3300048929 | Bacteria | 4250 |
| 551 | Ga0496126_0054157 | 3300048929 | Bacteria | 3635 |
| 552 | Ga0496126_0123466 | 3300048929 | Bacteria | 2243 |
| 553 | Ga0495678_039791 | 3300049459 | Bacteria | 1894 |
| 554 | Ga0501316_000983 | 3300049532 | Bacteria | 2259 |
| 555 | Ga0501317_004626 | 3300049533 | Bacteria | 1441 |
| 556 | Ga0501325_003275 | 3300049541 | Bacteria | 1170 |
| 557 | Ga0501031_0000972 | 3300049568 | Bacteria | 17408 |
| 558 | Ga0501031_0007808 | 3300049568 | Bacteria | 6964 |
| 559 | Ga0501031_0051818 | 3300049568 | Bacteria | 2673 |
| 560 | Ga0501032_0012147 | 3300049569 | Bacteria | 6164 |
| 561 | Ga0501032_0053596 | 3300049569 | Bacteria | 2716 |
| 562 | Ga0501033_0020412 | 3300049570 | Bacteria | 5004 |
| 563 | Ga0501033_0026109 | 3300049570 | Bacteria | 4396 |
| 564 | Ga0501033_0167464 | 3300049570 | Bacteria | 1579 |
| 565 | Ga0501034_0006353 | 3300049571 | Bacteria | 12725 |
| 566 | Ga0501034_0027867 | 3300049571 | Bacteria | 5744 |
| 567 | Ga0501034_0029066 | 3300049571 | Bacteria | 5620 |
| 568 | Ga0501034_0074610 | 3300049571 | Bacteria | 3399 |
| 569 | Ga0501034_0081820 | 3300049571 | Bacteria | 3231 |
| 570 | Ga0501034_0081881 | 3300049571 | Bacteria | 3230 |
| 571 | Ga0501036_0009130 | 3300049572 | Bacteria | 8154 |
| 572 | Ga0501036_0011179 | 3300049572 | Bacteria | 7428 |
| 573 | Ga0501037_0001882 | 3300049573 | Bacteria | 15254 |
| 574 | Ga0501037_0010177 | 3300049573 | Bacteria | 6900 |
| 575 | Ga0501037_0012569 | 3300049573 | Bacteria | 6238 |
| 576 | Ga0501037_0186660 | 3300049573 | Bacteria | 1469 |
| 577 | Ga0501038_0017119 | 3300049574 | Bacteria | 6556 |
| 578 | Ga0501038_0023621 | 3300049574 | Bacteria | 5493 |
| 579 | Ga0501038_0032115 | 3300049574 | Bacteria | 4634 |
| 580 | Ga0501039_0027217 | 3300049575 | Bacteria | 4396 |
| 581 | Ga0501040_0013161 | 3300049576 | Bacteria | 5440 |
| 582 | Ga0501041_0010140 | 3300049577 | Bacteria | 5552 |
| 583 | Ga0501042_0098644 | 3300049578 | Bacteria | 2100 |
| 584 | Ga0501043_0002210 | 3300049579 | Bacteria | 16595 |
| 585 | Ga0501043_0003543 | 3300049579 | Bacteria | 12828 |
| 586 | Ga0501043_0060165 | 3300049579 | Bacteria | 2981 |
| 587 | Ga0501046_0005693 | 3300049580 | Bacteria | 11123 |
| 588 | Ga0501046_0025094 | 3300049580 | Bacteria | 4881 |
| 589 | Ga0501047_0000121 | 3300049581 | Bacteria | 95409 |
| 590 | Ga0501047_0003988 | 3300049581 | Bacteria | 13874 |
| 591 | Ga0501047_0021044 | 3300049581 | Bacteria | 6264 |
| 592 | Ga0501048_0002990 | 3300049582 | Bacteria | 12903 |
| 593 | Ga0501048_0056201 | 3300049582 | Bacteria | 2792 |
| 594 | Ga0501048_0297675 | 3300049582 | Bacteria | 1148 |
| 595 | Ga0501069_0016086 | 3300049585 | Bacteria | 4013 |
| 596 | Ga0501070_0003316 | 3300049586 | Bacteria | 13984 |
| 597 | Ga0501072_0015578 | 3300049588 | Bacteria | 5827 |
| 598 | Ga0501073_0021099 | 3300049589 | Bacteria | 4697 |
| 599 | Ga0501077_0041060 | 3300049593 | Bacteria | 2946 |
| 600 | Ga0501223_013986 | 3300049663 | Bacteria | 1594 |
| 601 | Ga0501221_032295 | 3300049704 | Bacteria | 1099 |
| 602 | Ga0501079_0001236 | 3300049741 | Bacteria | 17901 |
| 603 | Ga0501035_0003738 | 3300049822 | Bacteria | 14513 |
| 604 | Ga0501035_0005876 | 3300049822 | Bacteria | 11560 |
| 605 | Ga0501035_0104416 | 3300049822 | Bacteria | 2485 |
| 606 | Ga0501035_0185520 | 3300049822 | Bacteria | 1790 |
| 607 | Ga0501044_0003883 | 3300049823 | Bacteria | 16749 |
| 608 | Ga0501044_0041214 | 3300049823 | Bacteria | 4807 |
| 609 | Ga0501044_0052776 | 3300049823 | Bacteria | 4186 |
| 610 | Ga0501044_0111273 | 3300049823 | Bacteria | 2746 |
| 611 | Ga0501045_0059045 | 3300049824 | Bacteria | 2809 |
| 612 | nmdc:mga03n38_26092_c1 | 3300050490 | Bacteria | 2409 |
| 613 | nmdc:mga03n38_2870_c1 | 3300050490 | Bacteria | 5426 |
| 614 | nmdc:mga00v17_38795_c1 | 3300050491 | Bacteria | 2850 |
| 615 | nmdc:mga00v17_5124_c1 | 3300050491 | Bacteria | 6890 |
| 616 | nmdc:mga0yw44_28577_c1 | 3300050492 | Bacteria | 3210 |
| 617 | nmdc:mga0yw44_9209_c1 | 3300050492 | Bacteria | 4972 |
| 618 | nmdc:mga06z11_3762_c1 | 3300050494 | Bacteria | 5898 |
| 619 | nmdc:mga04h51_8599_c1 | 3300050495 | Bacteria | 2734 |
| 620 | nmdc:mga07m45_71397_c1 | 3300050496 | Bacteria | 1975 |
| 621 | nmdc:mga07m45_91993_c1 | 3300050496 | Bacteria | 1738 |
| 622 | nmdc:mga0sz30_23290_c1 | 3300050516 | Bacteria | 2518 |
| 623 | Ga0495612_0001248 | 3300053078 | Bacteria | 10486 |
| 624 | Ga0495619_0062154 | 3300053085 | Bacteria | 2486 |
| 625 | Ga0495619_0092287 | 3300053085 | Bacteria | 2051 |
| 626 | Ga0500644_0008624 | 3300053088 | Bacteria | 2696 |
| 627 | Ga0500644_0055941 | 3300053088 | Bacteria | 1372 |
| 628 | Ga0500646_0000126 | 3300053090 | Bacteria | 21536 |
| 629 | Ga0500651_0023360 | 3300053093 | Bacteria | 3873 |
| 630 | Ga0500641_0119771 | 3300053096 | Bacteria | 1134 |
| 631 | Ga0500560_000339 | 3300053107 | Bacteria | 6099 |
| 632 | Ga0500569_005054 | 3300053109 | Bacteria | 2813 |
| 633 | Ga0500573_0003653 | 3300053140 | Bacteria | 7992 |
| 634 | Ga0500573_0022965 | 3300053140 | Bacteria | 3581 |
| 635 | Ga0500573_0029601 | 3300053140 | Bacteria | 3156 |
| 636 | Ga0500577_0016442 | 3300053142 | Bacteria | 2332 |
| 637 | Ga0500577_0107400 | 3300053142 | Bacteria | 1148 |
| 638 | Ga0500579_030636 | 3300053143 | Bacteria | 3452 |
| 639 | Ga0500600_0027133 | 3300053149 | Bacteria | 3395 |
| 640 | Ga0500600_0215426 | 3300053149 | Bacteria | 891 |
| 641 | Ga0500616_0001029 | 3300053153 | Bacteria | 29567 |
| 642 | Ga0500616_0001796 | 3300053153 | Bacteria | 19540 |
| 643 | Ga0500633_0096863 | 3300053160 | Bacteria | 1083 |
| 644 | Ga0501084_0004162 | 3300054114 | Bacteria | 11796 |
| 645 | Ga0587080_013214 | 3300059503 | Bacteria | 1261 |
| 646 | Ga0587080_021017 | 3300059503 | Bacteria | 1071 |
| 647 | Ga0587088_003435 | 3300059508 | Bacteria | 1918 |
| 648 | Ga0587102_009367 | 3300059649 | Bacteria | 949 |
| 649 | Ga0501082_0015621 | 3300060353 | Bacteria | 6534 |
| 650 | Ga0466962_0002388 | 3300061719 | Bacteria | 8900 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046459 | Ga0495629_0055563 | Ga0495629_0055563_443_1258 | 225 |
| 2 | 3300005355 | Ga0070671_100063234 | Ga0070671_1000632341 | 228 |
| 3 | 3300009098 | Ga0105245_10065478 | Ga0105245_100654782 | 229 |
| 4 | 3300025927 | Ga0207687_10094070 | Ga0207687_100940702 | 229 |
| 5 | 3300005331 | Ga0070670_100028121 | Ga0070670_1000281214 | 232 |
| 6 | 3300005334 | Ga0068869_100124994 | Ga0068869_1001249941 | 232 |
| 7 | 3300005364 | Ga0070673_100147998 | Ga0070673_1001479982 | 232 |
| 8 | 3300005455 | Ga0070663_100064990 | Ga0070663_1000649902 | 232 |
| 9 | 3300005459 | Ga0068867_100361785 | Ga0068867_1003617851 | 232 |
| 10 | 3300005548 | Ga0070665_100064997 | Ga0070665_1000649973 | 232 |
| 11 | 3300005564 | Ga0070664_100190005 | Ga0070664_1001900051 | 232 |
| 12 | 3300014326 | Ga0157380_10056042 | Ga0157380_100560422 | 232 |
| 13 | 3300014497 | Ga0182008_10144203 | Ga0182008_101442032 | 232 |
| 14 | 3300025914 | Ga0207671_10186728 | Ga0207671_101867282 | 232 |
| 15 | 3300025936 | Ga0207670_10035180 | Ga0207670_100351802 | 232 |
| 16 | 3300025940 | Ga0207691_10081974 | Ga0207691_100819743 | 232 |
| 17 | 3300025942 | Ga0207689_10028916 | Ga0207689_100289162 | 232 |
| 18 | 3300026067 | Ga0207678_10014353 | Ga0207678_100143533 | 232 |
| 19 | 3300026116 | Ga0207674_10019601 | Ga0207674_100196013 | 232 |
| 20 | 3300026121 | Ga0207683_10126218 | Ga0207683_101262183 | 232 |
| 21 | 3300035091 | Ga0373951_0000049 | Ga0373951_0000049_43085_43972 | 232 |
| 22 | 3300005345 | Ga0070692_10067378 | Ga0070692_100673781 | 233 |
| 23 | 3300013307 | Ga0157372_10387850 | Ga0157372_103878502 | 233 |
| 24 | 3300049663 | Ga0501223_013986 | Ga0501223_013986_729_1547 | 233 |
| 25 | 3300014969 | Ga0157376_10332691 | Ga0157376_103326912 | 234 |
| 26 | 3300003203 | JGI25406J46586_10036378 | JGI25406J46586_100363782 | 235 |
| 27 | 3300005985 | Ga0081539_10000195 | Ga0081539_1000019540 | 235 |
| 28 | 3300048929 | Ga0496126_0123466 | Ga0496126_0123466_1033_1869 | 236 |
| 29 | 3300044765 | Ga0466970_0140333 | Ga0466970_0140333_150_1082 | 237 |
| 30 | 3300009551 | Ga0105238_10435019 | Ga0105238_104350191 | 240 |
| 31 | 3300025924 | Ga0207694_10115594 | Ga0207694_101155942 | 240 |
| 32 | 3300031995 | Ga0307409_100472629 | Ga0307409_1004726291 | 240 |
| 33 | 3300028794 | Ga0307515_10091252 | Ga0307515_100912523 | 242 |
| 34 | 3300048919 | Ga0496116_0015383 | Ga0496116_0015383_773_1693 | 242 |
| 35 | 3300048920 | Ga0496117_0061202 | Ga0496117_0061202_318_1238 | 242 |
| 36 | 3300048921 | Ga0496118_0009188 | Ga0496118_0009188_8114_9034 | 242 |
| 37 | 3300048922 | Ga0496119_0003177 | Ga0496119_0003177_4023_4943 | 242 |
| 38 | 3300048925 | Ga0496122_0000208 | Ga0496122_0000208_76479_77399 | 242 |
| 39 | 3300048925 | Ga0496122_0004690 | Ga0496122_0004690_2320_3255 | 242 |
| 40 | 3300048926 | Ga0496123_0000003 | Ga0496123_0000003_74113_75033 | 242 |
| 41 | 3300048927 | Ga0496124_0005331 | Ga0496124_0005331_6838_7758 | 242 |
| 42 | 3300048928 | Ga0496125_0003079 | Ga0496125_0003079_12549_13484 | 242 |
| 43 | 3300048928 | Ga0496125_0036883 | Ga0496125_0036883_641_1561 | 242 |
| 44 | 3300048929 | Ga0496126_0054157 | Ga0496126_0054157_446_1366 | 242 |
| 45 | 3300035692 | Ga0373935_0048201 | Ga0373935_0048201_1551_2456 | 243 |
| 46 | 3300049541 | Ga0501325_003275 | Ga0501325_003275_268_1116 | 243 |
| 47 | 3300005563 | Ga0068855_100017723 | Ga0068855_1000177237 | 244 |
| 48 | 3300005614 | Ga0068856_100167799 | Ga0068856_1001677992 | 244 |
| 49 | 3300009174 | Ga0105241_10007724 | Ga0105241_100077242 | 244 |
| 50 | 3300009545 | Ga0105237_10059324 | Ga0105237_100593242 | 244 |
| 51 | 3300025914 | Ga0207671_10019262 | Ga0207671_100192622 | 244 |
| 52 | 3300025949 | Ga0207667_10031611 | Ga0207667_100316113 | 244 |
| 53 | 3300026078 | Ga0207702_10238310 | Ga0207702_102383101 | 244 |
| 54 | 3300028786 | Ga0307517_10062302 | Ga0307517_100623023 | 244 |
| 55 | 3300047443 | Ga0495687_003729 | Ga0495687_003729_8309_9154 | 244 |
| 56 | 3300041503 | Ga0451847_0489115 | Ga0451847_0489115_81_1049 | 245 |
| 57 | 3300046477 | Ga0495664_0079574 | Ga0495664_0079574_1054_1872 | 245 |
| 58 | 3300046694 | Ga0495649_0214648 | Ga0495649_0214648_102_920 | 245 |
| 59 | 3300048089 | Ga0495614_0095658 | Ga0495614_0095658_411_1229 | 245 |
| 60 | 3300053096 | Ga0500641_0119771 | Ga0500641_0119771_261_1079 | 245 |
| 61 | 3300005367 | Ga0070667_100064126 | Ga0070667_1000641262 | 247 |
| 62 | 3300003285 | Ga0007423J48922_101173 | Ga0007423J48922_1011732 | 248 |
| 63 | 3300005616 | Ga0068852_100093308 | Ga0068852_1000933083 | 248 |
| 64 | 3300006048 | Ga0075363_100003846 | Ga0075363_1000038463 | 248 |
| 65 | 3300015688 | Ga0183367_1004 | Ga0183367_1004496 | 248 |
| 66 | 3300025924 | Ga0207694_10123285 | Ga0207694_101232852 | 248 |
| 67 | 3300033179 | Ga0307507_10045192 | Ga0307507_100451921 | 248 |
| 68 | 3300050490 | nmdc:mga03n38_2870_c1 | nmdc:mga03n38_2870_c1_3144_4022 | 248 |
| 69 | 3300046648 | Ga0495611_0070609 | Ga0495611_0070609_59_880 | 249 |
| 70 | 3300005327 | Ga0070658_10032918 | Ga0070658_100329183 | 250 |
| 71 | 3300005338 | Ga0068868_100121058 | Ga0068868_1001210582 | 250 |
| 72 | 3300005347 | Ga0070668_100120163 | Ga0070668_1001201632 | 250 |
| 73 | 3300005353 | Ga0070669_100350890 | Ga0070669_1003508901 | 250 |
| 74 | 3300005365 | Ga0070688_100029008 | Ga0070688_1000290082 | 250 |
| 75 | 3300005367 | Ga0070667_100058987 | Ga0070667_1000589873 | 250 |
| 76 | 3300005437 | Ga0070710_10035951 | Ga0070710_100359512 | 250 |
| 77 | 3300005535 | Ga0070684_100150625 | Ga0070684_1001506252 | 250 |
| 78 | 3300005539 | Ga0068853_100033935 | Ga0068853_1000339352 | 250 |
| 79 | 3300005543 | Ga0070672_100200057 | Ga0070672_1002000572 | 250 |
| 80 | 3300005547 | Ga0070693_100105415 | Ga0070693_1001054152 | 250 |
| 81 | 3300005577 | Ga0068857_100082953 | Ga0068857_1000829532 | 250 |
| 82 | 3300005719 | Ga0068861_100036096 | Ga0068861_1000360963 | 250 |
| 83 | 3300005841 | Ga0068863_100073776 | Ga0068863_1000737762 | 250 |
| 84 | 3300005843 | Ga0068860_100000631 | Ga0068860_1000006317 | 250 |
| 85 | 3300005843 | Ga0068860_100359322 | Ga0068860_1003593221 | 250 |
| 86 | 3300005844 | Ga0068862_100016342 | Ga0068862_1000163425 | 250 |
| 87 | 3300006173 | Ga0070716_100139241 | Ga0070716_1001392412 | 250 |
| 88 | 3300009098 | Ga0105245_10367355 | Ga0105245_103673551 | 250 |
| 89 | 3300011119 | Ga0105246_10335942 | Ga0105246_103359422 | 250 |
| 90 | 3300013105 | Ga0157369_10857486 | Ga0157369_108574861 | 250 |
| 91 | 3300013297 | Ga0157378_10022244 | Ga0157378_100222442 | 250 |
| 92 | 3300025898 | Ga0207692_10011327 | Ga0207692_100113272 | 250 |
| 93 | 3300025909 | Ga0207705_10033743 | Ga0207705_100337433 | 250 |
| 94 | 3300025938 | Ga0207704_10097954 | Ga0207704_100979542 | 250 |
| 95 | 3300025986 | Ga0207658_10222688 | Ga0207658_102226881 | 250 |
| 96 | 3300026023 | Ga0207677_10101993 | Ga0207677_101019932 | 250 |
| 97 | 3300026041 | Ga0207639_10112309 | Ga0207639_101123092 | 250 |
| 98 | 3300026116 | Ga0207674_10213929 | Ga0207674_102139292 | 250 |
| 99 | 3300026118 | Ga0207675_100012668 | Ga0207675_1000126683 | 250 |
| 100 | 3300028381 | Ga0268264_10001893 | Ga0268264_1000189317 | 250 |
| 101 | 3300028794 | Ga0307515_10013809 | Ga0307515_1001380912 | 250 |
| 102 | 3300031616 | Ga0307508_10025662 | Ga0307508_100256623 | 250 |
| 103 | 3300037068 | Ga0373925_0480753 | Ga0373925_0480753_114_1001 | 250 |
| 104 | 3300041452 | Ga0451793_0665654 | Ga0451793_0665654_417_1304 | 250 |
| 105 | 3300041486 | Ga0451807_0658772 | Ga0451807_0658772_76_963 | 250 |
| 106 | 3300041509 | Ga0451843_0451920 | Ga0451843_0451920_1806_2693 | 250 |
| 107 | 3300048917 | Ga0496114_0091095 | Ga0496114_0091095_535_1377 | 250 |
| 108 | 3300048923 | Ga0496120_0094663 | Ga0496120_0094663_158_1039 | 250 |
| 109 | 3300050492 | nmdc:mga0yw44_9209_c1 | nmdc:mga0yw44_9209_c1_3356_4216 | 250 |
| 110 | 3300053088 | Ga0500644_0055941 | Ga0500644_0055941_110_997 | 250 |
| 111 | 3300053093 | Ga0500651_0023360 | Ga0500651_0023360_650_1567 | 250 |
| 112 | 3300053109 | Ga0500569_005054 | Ga0500569_005054_1635_2552 | 250 |
| 113 | 3300001990 | JGI24737J22298_10006796 | JGI24737J22298_100067962 | 251 |
| 114 | 3300005843 | Ga0068860_100058287 | Ga0068860_1000582873 | 251 |
| 115 | 3300011119 | Ga0105246_10079086 | Ga0105246_100790862 | 251 |
| 116 | 3300013307 | Ga0157372_10439392 | Ga0157372_104393922 | 251 |
| 117 | 3300025904 | Ga0207647_10027659 | Ga0207647_100276593 | 251 |
| 118 | 3300025972 | Ga0207668_10055671 | Ga0207668_100556712 | 251 |
| 119 | 3300025986 | Ga0207658_10226131 | Ga0207658_102261312 | 251 |
| 120 | 3300026023 | Ga0207677_10114977 | Ga0207677_101149772 | 251 |
| 121 | 3300026035 | Ga0207703_10010084 | Ga0207703_100100844 | 251 |
| 122 | 3300005288 | Ga0065714_10070907 | Ga0065714_100709071 | 252 |
| 123 | 3300005564 | Ga0070664_100133943 | Ga0070664_1001339432 | 252 |
| 124 | 3300025929 | Ga0207664_10108718 | Ga0207664_101087182 | 252 |
| 125 | 3300028794 | Ga0307515_10083797 | Ga0307515_100837974 | 252 |
| 126 | 3300030522 | Ga0307512_10004340 | Ga0307512_100043409 | 252 |
| 127 | 3300031691 | Ga0316579_10000381 | Ga0316579_100003812 | 252 |
| 128 | 3300044901 | Ga0466960_0008373 | Ga0466960_0008373_3228_4136 | 252 |
| 129 | 3300046675 | Ga0495657_0003773 | Ga0495657_0003773_1803_2699 | 252 |
| 130 | 3300053142 | Ga0500577_0016442 | Ga0500577_0016442_854_1726 | 252 |
| 131 | 3300053160 | Ga0500633_0096863 | Ga0500633_0096863_98_970 | 252 |
| 132 | 3300059508 | Ga0587088_003435 | Ga0587088_003435_211_1119 | 252 |
| 133 | 3300059649 | Ga0587102_009367 | Ga0587102_009367_12_920 | 252 |
| 134 | 3300009551 | Ga0105238_10181378 | Ga0105238_101813782 | 253 |
| 135 | 3300010375 | Ga0105239_10600906 | Ga0105239_106009062 | 253 |
| 136 | 3300031901 | Ga0307406_10073390 | Ga0307406_100733902 | 253 |
| 137 | 3300044684 | Ga0466966_0212850 | Ga0466966_0212850_212_1081 | 253 |
| 138 | 3300048920 | Ga0496117_0000091 | Ga0496117_0000091_119841_120764 | 253 |
| 139 | 3300048920 | Ga0496117_0013877 | Ga0496117_0013877_322_1242 | 253 |
| 140 | 3300048921 | Ga0496118_0038621 | Ga0496118_0038621_327_1247 | 253 |
| 141 | 3300048922 | Ga0496119_0002470 | Ga0496119_0002470_7235_8158 | 253 |
| 142 | 3300048922 | Ga0496119_0019300 | Ga0496119_0019300_1401_2324 | 253 |
| 143 | 3300048923 | Ga0496120_0002278 | Ga0496120_0002278_12100_13023 | 253 |
| 144 | 3300048923 | Ga0496120_0009274 | Ga0496120_0009274_1346_2269 | 253 |
| 145 | 3300048925 | Ga0496122_0025057 | Ga0496122_0025057_3860_4780 | 253 |
| 146 | 3300048925 | Ga0496122_0043875 | Ga0496122_0043875_1363_2286 | 253 |
| 147 | 3300048926 | Ga0496123_0086936 | Ga0496123_0086936_731_1654 | 253 |
| 148 | 3300048927 | Ga0496124_0029713 | Ga0496124_0029713_2553_3476 | 253 |
| 149 | 3300048928 | Ga0496125_0002214 | Ga0496125_0002214_1322_2245 | 253 |
| 150 | 3300048929 | Ga0496126_0014193 | Ga0496126_0014193_1390_2313 | 253 |
| 151 | 3300049571 | Ga0501034_0029066 | Ga0501034_0029066_1209_2123 | 253 |
| 152 | 3300053149 | Ga0500600_0215426 | Ga0500600_0215426_16_840 | 253 |
| 153 | 3300005327 | Ga0070658_10075763 | Ga0070658_100757632 | 254 |
| 154 | 3300005455 | Ga0070663_100041340 | Ga0070663_1000413403 | 254 |
| 155 | 3300006048 | Ga0075363_100000519 | Ga0075363_10000051910 | 254 |
| 156 | 3300025944 | Ga0207661_10187649 | Ga0207661_101876491 | 254 |
| 157 | 3300049532 | Ga0501316_000983 | Ga0501316_000983_120_1046 | 254 |
| 158 | 3300049533 | Ga0501317_004626 | Ga0501317_004626_396_1322 | 254 |
| 159 | 3300006844 | Ga0075428_100121249 | Ga0075428_1001212493 | 255 |
| 160 | 3300015688 | Ga0183367_1012 | Ga0183367_1012225 | 255 |
| 161 | 3300042007 | Ga0439449_0001846 | Ga0439449_0001846_1951_2877 | 255 |
| 162 | 3300044656 | Ga0466969_0028115 | Ga0466969_0028115_1138_2070 | 255 |
| 163 | 3300044658 | Ga0466972_0006335 | Ga0466972_0006335_390_1289 | 255 |
| 164 | 3300044684 | Ga0466966_0005036 | Ga0466966_0005036_4728_5660 | 255 |
| 165 | 3300044693 | Ga0466961_0044020 | Ga0466961_0044020_142_1074 | 255 |
| 166 | 3300044719 | Ga0466971_0015473 | Ga0466971_0015473_965_1897 | 255 |
| 167 | 3300044765 | Ga0466970_0000015 | Ga0466970_0000015_40950_41849 | 255 |
| 168 | 3300045049 | Ga0466959_0008735 | Ga0466959_0008735_4073_5005 | 255 |
| 169 | 3300046454 | Ga0495592_0012547 | Ga0495592_0012547_3427_4350 | 255 |
| 170 | 3300046459 | Ga0495629_0051579 | Ga0495629_0051579_932_1855 | 255 |
| 171 | 3300046462 | Ga0495651_0191798 | Ga0495651_0191798_86_1009 | 255 |
| 172 | 3300046472 | Ga0495580_0028759 | Ga0495580_0028759_2131_3054 | 255 |
| 173 | 3300046476 | Ga0495662_0042302 | Ga0495662_0042302_1051_1974 | 255 |
| 174 | 3300046511 | Ga0495608_0023706 | Ga0495608_0023706_91_1014 | 255 |
| 175 | 3300046515 | Ga0495620_0032034 | Ga0495620_0032034_500_1423 | 255 |
| 176 | 3300046522 | Ga0495643_0001461 | Ga0495643_0001461_17389_18312 | 255 |
| 177 | 3300046528 | Ga0495642_0051214 | Ga0495642_0051214_489_1412 | 255 |
| 178 | 3300046533 | Ga0495640_0005159 | Ga0495640_0005159_693_1616 | 255 |
| 179 | 3300046542 | Ga0495597_0093314 | Ga0495597_0093314_116_1039 | 255 |
| 180 | 3300046616 | Ga0495668_0061984 | Ga0495668_0061984_337_1260 | 255 |
| 181 | 3300046642 | Ga0495634_0040422 | Ga0495634_0040422_726_1649 | 255 |
| 182 | 3300046663 | Ga0495635_0052328 | Ga0495635_0052328_1697_2620 | 255 |
| 183 | 3300046679 | Ga0495623_0040473 | Ga0495623_0040473_1489_2412 | 255 |
| 184 | 3300046680 | Ga0495646_0108576 | Ga0495646_0108576_558_1481 | 255 |
| 185 | 3300046689 | Ga0495613_0149311 | Ga0495613_0149311_243_1166 | 255 |
| 186 | 3300046794 | Ga0495589_0019866 | Ga0495589_0019866_1221_2144 | 255 |
| 187 | 3300047317 | Ga0495604_0033881 | Ga0495604_0033881_2086_3009 | 255 |
| 188 | 3300047319 | Ga0495674_0064437 | Ga0495674_0064437_1787_2710 | 255 |
| 189 | 3300047322 | Ga0495680_0027354 | Ga0495680_0027354_2521_3444 | 255 |
| 190 | 3300047443 | Ga0495687_039268 | Ga0495687_039268_978_1901 | 255 |
| 191 | 3300047673 | Ga0495593_0110296 | Ga0495593_0110296_472_1395 | 255 |
| 192 | 3300048927 | Ga0496124_0104611 | Ga0496124_0104611_1261_2184 | 255 |
| 193 | 3300049571 | Ga0501034_0081881 | Ga0501034_0081881_2124_3050 | 255 |
| 194 | 3300049573 | Ga0501037_0186660 | Ga0501037_0186660_155_1081 | 255 |
| 195 | 3300049581 | Ga0501047_0021044 | Ga0501047_0021044_1420_2346 | 255 |
| 196 | 3300049582 | Ga0501048_0297675 | Ga0501048_0297675_50_976 | 255 |
| 197 | 3300049822 | Ga0501035_0104416 | Ga0501035_0104416_1090_2016 | 255 |
| 198 | 3300049823 | Ga0501044_0052776 | Ga0501044_0052776_1966_2892 | 255 |
| 199 | 3300003320 | rootH2_10054494 | rootH2_100544943 | 256 |
| 200 | 3300030522 | Ga0307512_10004744 | Ga0307512_100047449 | 256 |
| 201 | 3300031456 | Ga0307513_10049850 | Ga0307513_100498502 | 256 |
| 202 | 3300031456 | Ga0307513_10188878 | Ga0307513_101888781 | 256 |
| 203 | 3300031616 | Ga0307508_10364419 | Ga0307508_103644191 | 256 |
| 204 | 3300041512 | Ga0451853_2189455 | Ga0451853_2189455_900_1826 | 256 |
| 205 | 3300044683 | Ga0466965_0022019 | Ga0466965_0022019_1184_2119 | 256 |
| 206 | 3300048920 | Ga0496117_0007274 | Ga0496117_0007274_6252_7190 | 256 |
| 207 | 3300048921 | Ga0496118_0113819 | Ga0496118_0113819_170_1108 | 256 |
| 208 | 3300048925 | Ga0496122_0075344 | Ga0496122_0075344_341_1276 | 256 |
| 209 | 3300048928 | Ga0496125_0022669 | Ga0496125_0022669_4758_5693 | 256 |
| 210 | 3300049570 | Ga0501033_0020412 | Ga0501033_0020412_1805_2800 | 256 |
| 211 | 3300049571 | Ga0501034_0081820 | Ga0501034_0081820_351_1310 | 256 |
| 212 | 3300049580 | Ga0501046_0005693 | Ga0501046_0005693_4909_5868 | 256 |
| 213 | 3300049823 | Ga0501044_0041214 | Ga0501044_0041214_697_1692 | 256 |
| 214 | 3300053090 | Ga0500646_0000126 | Ga0500646_0000126_18315_19235 | 256 |
| 215 | 3300053140 | Ga0500573_0022965 | Ga0500573_0022965_1456_2364 | 256 |
| 216 | 3300005841 | Ga0068863_100242204 | Ga0068863_1002422041 | 257 |
| 217 | 3300026088 | Ga0207641_10241982 | Ga0207641_102419822 | 257 |
| 218 | 3300028558 | Ga0265326_10000839 | Ga0265326_100008395 | 257 |
| 219 | 3300028563 | Ga0265319_1004853 | Ga0265319_10048532 | 257 |
| 220 | 3300028653 | Ga0265323_10038494 | Ga0265323_100384942 | 257 |
| 221 | 3300031238 | Ga0265332_10002167 | Ga0265332_100021677 | 257 |
| 222 | 3300031616 | Ga0307508_10231025 | Ga0307508_102310252 | 257 |
| 223 | 3300031711 | Ga0265314_10004475 | Ga0265314_100044753 | 257 |
| 224 | 3300033179 | Ga0307507_10029493 | Ga0307507_100294932 | 257 |
| 225 | 3300042007 | Ga0439449_0066101 | Ga0439449_0066101_294_1220 | 257 |
| 226 | 3300045976 | Ga0466967_0244944 | Ga0466967_0244944_127_1050 | 257 |
| 227 | 3300046454 | Ga0495592_0025591 | Ga0495592_0025591_1178_2074 | 257 |
| 228 | 3300046462 | Ga0495651_0038322 | Ga0495651_0038322_2509_3405 | 257 |
| 229 | 3300046476 | Ga0495662_0002684 | Ga0495662_0002684_4297_5193 | 257 |
| 230 | 3300046477 | Ga0495664_0001605 | Ga0495664_0001605_3806_4702 | 257 |
| 231 | 3300046536 | Ga0495587_0136261 | Ga0495587_0136261_50_946 | 257 |
| 232 | 3300046543 | Ga0495645_0075474 | Ga0495645_0075474_710_1606 | 257 |
| 233 | 3300046642 | Ga0495634_0000745 | Ga0495634_0000745_3828_4724 | 257 |
| 234 | 3300046660 | Ga0495625_0043973 | Ga0495625_0043973_1367_2293 | 257 |
| 235 | 3300046680 | Ga0495646_0000930 | Ga0495646_0000930_5047_5943 | 257 |
| 236 | 3300046689 | Ga0495613_0007455 | Ga0495613_0007455_486_1382 | 257 |
| 237 | 3300046809 | Ga0495600_0014454 | Ga0495600_0014454_2192_3088 | 257 |
| 238 | 3300047317 | Ga0495604_0000558 | Ga0495604_0000558_2378_3274 | 257 |
| 239 | 3300047444 | Ga0495675_0085730 | Ga0495675_0085730_639_1535 | 257 |
| 240 | 3300047447 | Ga0495685_057995 | Ga0495685_057995_353_1279 | 257 |
| 241 | 3300048088 | Ga0495602_0034326 | Ga0495602_0034326_1201_2097 | 257 |
| 242 | 3300048089 | Ga0495614_0000340 | Ga0495614_0000340_4471_5367 | 257 |
| 243 | 3300049568 | Ga0501031_0007808 | Ga0501031_0007808_1389_2315 | 257 |
| 244 | 3300049571 | Ga0501034_0027867 | Ga0501034_0027867_4668_5582 | 257 |
| 245 | 3300049571 | Ga0501034_0074610 | Ga0501034_0074610_681_1607 | 257 |
| 246 | 3300049572 | Ga0501036_0011179 | Ga0501036_0011179_467_1393 | 257 |
| 247 | 3300049573 | Ga0501037_0010177 | Ga0501037_0010177_5722_6648 | 257 |
| 248 | 3300049574 | Ga0501038_0032115 | Ga0501038_0032115_2354_3280 | 257 |
| 249 | 3300049579 | Ga0501043_0002210 | Ga0501043_0002210_4051_4977 | 257 |
| 250 | 3300049580 | Ga0501046_0025094 | Ga0501046_0025094_252_1178 | 257 |
| 251 | 3300049582 | Ga0501048_0002990 | Ga0501048_0002990_340_1266 | 257 |
| 252 | 3300049822 | Ga0501035_0185520 | Ga0501035_0185520_741_1667 | 257 |
| 253 | 3300049823 | Ga0501044_0111273 | Ga0501044_0111273_555_1481 | 257 |
| 254 | 3300053085 | Ga0495619_0062154 | Ga0495619_0062154_289_1185 | 257 |
| 255 | 3300053140 | Ga0500573_0029601 | Ga0500573_0029601_795_1691 | 257 |
| 256 | 3300005458 | Ga0070681_10507867 | Ga0070681_105078672 | 258 |
| 257 | 3300005614 | Ga0068856_100061526 | Ga0068856_1000615264 | 258 |
| 258 | 3300005981 | Ga0081538_10009829 | Ga0081538_100098293 | 258 |
| 259 | 3300026067 | Ga0207678_10001777 | Ga0207678_1000177711 | 258 |
| 260 | 3300026078 | Ga0207702_10155599 | Ga0207702_101555992 | 258 |
| 261 | 3300031616 | Ga0307508_10072113 | Ga0307508_100721132 | 258 |
| 262 | 3300046452 | Ga0495617_016044 | Ga0495617_016044_558_1484 | 258 |
| 263 | 3300046455 | Ga0495603_0012538 | Ga0495603_0012538_4194_5120 | 258 |
| 264 | 3300046459 | Ga0495629_0087060 | Ga0495629_0087060_1201_2127 | 258 |
| 265 | 3300046462 | Ga0495651_0035198 | Ga0495651_0035198_1294_2205 | 258 |
| 266 | 3300046463 | Ga0495653_0231846 | Ga0495653_0231846_286_1197 | 258 |
| 267 | 3300046474 | Ga0495605_0009059 | Ga0495605_0009059_3204_4130 | 258 |
| 268 | 3300046492 | Ga0495585_0063938 | Ga0495585_0063938_190_1116 | 258 |
| 269 | 3300046499 | Ga0495594_0010260 | Ga0495594_0010260_12_938 | 258 |
| 270 | 3300046507 | Ga0495606_0024232 | Ga0495606_0024232_997_1923 | 258 |
| 271 | 3300046512 | Ga0495610_0086092 | Ga0495610_0086092_37_963 | 258 |
| 272 | 3300046513 | Ga0495616_0003623 | Ga0495616_0003623_236_1162 | 258 |
| 273 | 3300046519 | Ga0495632_0030339 | Ga0495632_0030339_378_1304 | 258 |
| 274 | 3300046524 | Ga0495648_0150717 | Ga0495648_0150717_181_1107 | 258 |
| 275 | 3300046538 | Ga0495609_0043885 | Ga0495609_0043885_997_1923 | 258 |
| 276 | 3300046542 | Ga0495597_0013328 | Ga0495597_0013328_1715_2641 | 258 |
| 277 | 3300046557 | Ga0495622_0039732 | Ga0495622_0039732_194_1120 | 258 |
| 278 | 3300046660 | Ga0495625_0175179 | Ga0495625_0175179_210_1136 | 258 |
| 279 | 3300046665 | Ga0495661_0027183 | Ga0495661_0027183_364_1290 | 258 |
| 280 | 3300046690 | Ga0495624_0129514 | Ga0495624_0129514_148_1074 | 258 |
| 281 | 3300046692 | Ga0495671_0068271 | Ga0495671_0068271_680_1606 | 258 |
| 282 | 3300046794 | Ga0495589_0102965 | Ga0495589_0102965_443_1369 | 258 |
| 283 | 3300047321 | Ga0495676_0016330 | Ga0495676_0016330_34_960 | 258 |
| 284 | 3300047322 | Ga0495680_0119389 | Ga0495680_0119389_180_1091 | 258 |
| 285 | 3300047323 | Ga0495683_0015981 | Ga0495683_0015981_1628_2554 | 258 |
| 286 | 3300047447 | Ga0495685_007130 | Ga0495685_007130_159_1085 | 258 |
| 287 | 3300047470 | Ga0495681_0016568 | Ga0495681_0016568_2432_3358 | 258 |
| 288 | 3300047472 | Ga0495686_0064577 | Ga0495686_0064577_1047_1973 | 258 |
| 289 | 3300048091 | Ga0495626_0106559 | Ga0495626_0106559_113_1039 | 258 |
| 290 | 3300048920 | Ga0496117_0050726 | Ga0496117_0050726_748_1683 | 258 |
| 291 | 3300048921 | Ga0496118_0019417 | Ga0496118_0019417_5029_5964 | 258 |
| 292 | 3300048924 | Ga0496121_0046122 | Ga0496121_0046122_1814_2731 | 258 |
| 293 | 3300048929 | Ga0496126_0041606 | Ga0496126_0041606_3219_4154 | 258 |
| 294 | 3300049459 | Ga0495678_039791 | Ga0495678_039791_104_1030 | 258 |
| 295 | 3300050491 | nmdc:mga00v17_5124_c1 | nmdc:mga00v17_5124_c1_2666_3583 | 258 |
| 296 | 3300059503 | Ga0587080_021017 | Ga0587080_021017_41_949 | 258 |
| 297 | 3300030521 | Ga0307511_10038111 | Ga0307511_100381113 | 259 |
| 298 | 3300041443 | Ga0451789_0309907 | Ga0451789_0309907_143_1063 | 259 |
| 299 | 3300041498 | Ga0451841_0651592 | Ga0451841_0651592_260_1180 | 259 |
| 300 | 3300041512 | Ga0451853_2722946 | Ga0451853_2722946_124_1044 | 259 |
| 301 | 3300046455 | Ga0495603_0002711 | Ga0495603_0002711_6474_7400 | 259 |
| 302 | 3300047321 | Ga0495676_0002784 | Ga0495676_0002784_750_1676 | 259 |
| 303 | 3300047447 | Ga0495685_001450 | Ga0495685_001450_39_935 | 259 |
| 304 | 3300048908 | Ga0496105_0174257 | Ga0496105_0174257_626_1543 | 259 |
| 305 | 3300048921 | Ga0496118_0033190 | Ga0496118_0033190_1257_2180 | 259 |
| 306 | 3300048922 | Ga0496119_0013259 | Ga0496119_0013259_2112_3035 | 259 |
| 307 | 3300048925 | Ga0496122_0002225 | Ga0496122_0002225_6559_7482 | 259 |
| 308 | 3300048928 | Ga0496125_0000224 | Ga0496125_0000224_112485_113408 | 259 |
| 309 | 3300050496 | nmdc:mga07m45_91993_c1 | nmdc:mga07m45_91993_c1_80_997 | 259 |
| 310 | 3300009551 | Ga0105238_10457777 | Ga0105238_104577772 | 260 |
| 311 | 3300032004 | Ga0307414_10091639 | Ga0307414_100916392 | 260 |
| 312 | 3300032004 | Ga0307414_10102268 | Ga0307414_101022682 | 260 |
| 313 | 3300041501 | Ga0451845_0977945 | Ga0451845_0977945_188_1201 | 260 |
| 314 | 3300044656 | Ga0466969_0059461 | Ga0466969_0059461_41_985 | 260 |
| 315 | 3300044684 | Ga0466966_0062617 | Ga0466966_0062617_994_1938 | 260 |
| 316 | 3300044719 | Ga0466971_0012994 | Ga0466971_0012994_200_1144 | 260 |
| 317 | 3300044842 | Ga0466957_0031025 | Ga0466957_0031025_1754_2698 | 260 |
| 318 | 3300045049 | Ga0466959_0172711 | Ga0466959_0172711_427_1371 | 260 |
| 319 | 3300046453 | Ga0495627_000262 | Ga0495627_000262_37350_38297 | 260 |
| 320 | 3300046499 | Ga0495594_0037253 | Ga0495594_0037253_38_964 | 260 |
| 321 | 3300046518 | Ga0495631_0055508 | Ga0495631_0055508_380_1306 | 260 |
| 322 | 3300046694 | Ga0495649_0190780 | Ga0495649_0190780_22_918 | 260 |
| 323 | 3300047321 | Ga0495676_0034542 | Ga0495676_0034542_403_1329 | 260 |
| 324 | 3300047323 | Ga0495683_0038615 | Ga0495683_0038615_1414_2340 | 260 |
| 325 | 3300047447 | Ga0495685_028691 | Ga0495685_028691_405_1418 | 260 |
| 326 | 3300049581 | Ga0501047_0003988 | Ga0501047_0003988_6627_7475 | 260 |
| 327 | 3300061719 | Ga0466962_0002388 | Ga0466962_0002388_5039_5983 | 260 |
| 328 | 3300031731 | Ga0307405_10083030 | Ga0307405_100830302 | 261 |
| 329 | 3300049568 | Ga0501031_0000972 | Ga0501031_0000972_757_1692 | 261 |
| 330 | 3300005985 | Ga0081539_10023811 | Ga0081539_100238112 | 262 |
| 331 | 3300042438 | Ga0439459_0039893 | Ga0439459_0039893_22_924 | 262 |
| 332 | 3300044901 | Ga0466960_0027645 | Ga0466960_0027645_1377_2306 | 262 |
| 333 | 3300046460 | Ga0495638_0040207 | Ga0495638_0040207_538_1464 | 262 |
| 334 | 3300046501 | Ga0495607_0010980 | Ga0495607_0010980_3686_4612 | 262 |
| 335 | 3300046517 | Ga0495630_0239422 | Ga0495630_0239422_377_1234 | 262 |
| 336 | 3300046530 | Ga0495654_0109047 | Ga0495654_0109047_201_1127 | 262 |
| 337 | 3300046558 | Ga0495633_0008115 | Ga0495633_0008115_3179_4105 | 262 |
| 338 | 3300046648 | Ga0495611_0113928 | Ga0495611_0113928_12_938 | 262 |
| 339 | 3300050516 | nmdc:mga0sz30_23290_c1 | nmdc:mga0sz30_23290_c1_1006_1923 | 262 |
| 340 | 3300011119 | Ga0105246_10101360 | Ga0105246_101013602 | 263 |
| 341 | 3300031901 | Ga0307406_10000260 | Ga0307406_1000026017 | 263 |
| 342 | 3300048917 | Ga0496114_0179734 | Ga0496114_0179734_689_1606 | 263 |
| 343 | 3300053153 | Ga0500616_0001796 | Ga0500616_0001796_5389_6309 | 263 |
| 344 | iso_pu_bacteria | 2918501144 | 2918507936 | 263 |
| 345 | 3300009098 | Ga0105245_10449152 | Ga0105245_104491522 | 264 |
| 346 | 3300013307 | Ga0157372_10022312 | Ga0157372_100223123 | 264 |
| 347 | 3300030731 | Ga0316177_1029591 | Ga0316177_10295913 | 264 |
| 348 | 3300031911 | Ga0307412_10005767 | Ga0307412_100057676 | 264 |
| 349 | 3300049822 | Ga0501035_0005876 | Ga0501035_0005876_862_1713 | 264 |
| 350 | 3300053088 | Ga0500644_0008624 | Ga0500644_0008624_1722_2636 | 264 |
| 351 | iso_pu_bacteria | 2738541272 | 2738693978 | 264 |
| 352 | iso_pu_bacteria | 2738543027 | 2739327439 | 264 |
| 353 | iso_pu_bacteria | 2758568522 | 2760304874 | 264 |
| 354 | iso_pu_bacteria | 2862705112 | 2862709296 | 264 |
| 355 | iso_pu_bacteria | 2895660088 | 2895660408 | 264 |
| 356 | iso_pu_bacteria | 2912757875 | 2912764970 | 264 |
| 357 | 3300009177 | Ga0105248_10000365 | Ga0105248_1000036517 | 265 |
| 358 | 3300013296 | Ga0157374_10015647 | Ga0157374_100156472 | 265 |
| 359 | 3300033180 | Ga0307510_10106719 | Ga0307510_101067192 | 265 |
| 360 | 3300042012 | Ga0439455_0073895 | Ga0439455_0073895_85_909 | 265 |
| 361 | 3300046454 | Ga0495592_0079471 | Ga0495592_0079471_357_1193 | 265 |
| 362 | 3300046472 | Ga0495580_0192351 | Ga0495580_0192351_546_1370 | 265 |
| 363 | 3300046512 | Ga0495610_0100765 | Ga0495610_0100765_450_1274 | 265 |
| 364 | 3300046529 | Ga0495652_0003943 | Ga0495652_0003943_7556_8392 | 265 |
| 365 | 3300046543 | Ga0495645_0017788 | Ga0495645_0017788_2644_3480 | 265 |
| 366 | 3300046642 | Ga0495634_0051933 | Ga0495634_0051933_70_906 | 265 |
| 367 | 3300046663 | Ga0495635_0003608 | Ga0495635_0003608_8244_9080 | 265 |
| 368 | 3300046679 | Ga0495623_0005945 | Ga0495623_0005945_5180_6016 | 265 |
| 369 | 3300046689 | Ga0495613_0085176 | Ga0495613_0085176_578_1513 | 265 |
| 370 | 3300046690 | Ga0495624_0164919 | Ga0495624_0164919_212_1036 | 265 |
| 371 | 3300046809 | Ga0495600_0071443 | Ga0495600_0071443_1040_1876 | 265 |
| 372 | 3300047315 | Ga0495581_0128366 | Ga0495581_0128366_53_877 | 265 |
| 373 | 3300047447 | Ga0495685_008265 | Ga0495685_008265_1522_2448 | 265 |
| 374 | 3300048089 | Ga0495614_0025542 | Ga0495614_0025542_619_1554 | 265 |
| 375 | 3300049586 | Ga0501070_0003316 | Ga0501070_0003316_8619_9461 | 265 |
| 376 | 3300053078 | Ga0495612_0001248 | Ga0495612_0001248_2358_3194 | 265 |
| 377 | 3300053085 | Ga0495619_0092287 | Ga0495619_0092287_939_1775 | 265 |
| 378 | 3300053140 | Ga0500573_0003653 | Ga0500573_0003653_2674_3510 | 265 |
| 379 | iso_pu_bacteria | 2582581313 | 2585309623 | 265 |
| 380 | iso_pu_bacteria | 2643221575 | 2643886344 | 265 |
| 381 | 3300013306 | Ga0163162_10309527 | Ga0163162_103095272 | 266 |
| 382 | 3300046453 | Ga0495627_005954 | Ga0495627_005954_112_981 | 266 |
| 383 | 3300046459 | Ga0495629_0000729 | Ga0495629_0000729_18158_19084 | 266 |
| 384 | 3300046499 | Ga0495594_0004036 | Ga0495594_0004036_4153_5079 | 266 |
| 385 | 3300046674 | Ga0495588_0014053 | Ga0495588_0014053_402_1328 | 266 |
| 386 | 3300046794 | Ga0495589_0143118 | Ga0495589_0143118_148_1074 | 266 |
| 387 | 3300047321 | Ga0495676_0000768 | Ga0495676_0000768_18158_19084 | 266 |
| 388 | 3300059503 | Ga0587080_013214 | Ga0587080_013214_299_1240 | 266 |
| 389 | iso_pu_bacteria | 2739367654 | 2739607218 | 266 |
| 390 | 3300009093 | Ga0105240_10289365 | Ga0105240_102893652 | 267 |
| 391 | 3300009098 | Ga0105245_10082940 | Ga0105245_100829402 | 267 |
| 392 | 3300013104 | Ga0157370_10077269 | Ga0157370_100772692 | 267 |
| 393 | 3300013105 | Ga0157369_10251578 | Ga0157369_102515782 | 267 |
| 394 | 3300014968 | Ga0157379_10028337 | Ga0157379_100283374 | 267 |
| 395 | 3300035242 | Ga0373962_0002029 | Ga0373962_0002029_2330_3232 | 267 |
| 396 | 3300046506 | Ga0495583_0005674 | Ga0495583_0005674_6398_7333 | 267 |
| 397 | 3300046512 | Ga0495610_0057477 | Ga0495610_0057477_658_1593 | 267 |
| 398 | 3300046515 | Ga0495620_0011710 | Ga0495620_0011710_1068_2003 | 267 |
| 399 | 3300046522 | Ga0495643_0002615 | Ga0495643_0002615_3148_4083 | 267 |
| 400 | 3300047443 | Ga0495687_030465 | Ga0495687_030465_320_1255 | 267 |
| 401 | 3300048922 | Ga0496119_0157334 | Ga0496119_0157334_282_1178 | 267 |
| 402 | iso_pu_bacteria | 2811994878 | 2812349917 | 267 |
| 403 | 3300005937 | Ga0081455_10025631 | Ga0081455_100256315 | 268 |
| 404 | 3300009098 | Ga0105245_10128358 | Ga0105245_101283582 | 268 |
| 405 | 3300032126 | Ga0307415_100285683 | Ga0307415_1002856831 | 268 |
| 406 | 3300046460 | Ga0495638_0032867 | Ga0495638_0032867_2108_3049 | 268 |
| 407 | 3300046516 | Ga0495628_0079845 | Ga0495628_0079845_772_1704 | 268 |
| 408 | 3300046533 | Ga0495640_0119162 | Ga0495640_0119162_208_1140 | 268 |
| 409 | 3300046675 | Ga0495657_0032694 | Ga0495657_0032694_1376_2308 | 268 |
| 410 | 3300047673 | Ga0495593_0027906 | Ga0495593_0027906_1551_2483 | 268 |
| 411 | 3300049568 | Ga0501031_0051818 | Ga0501031_0051818_381_1316 | 268 |
| 412 | 3300049569 | Ga0501032_0012147 | Ga0501032_0012147_554_1489 | 268 |
| 413 | 3300049570 | Ga0501033_0026109 | Ga0501033_0026109_381_1316 | 268 |
| 414 | 3300049571 | Ga0501034_0006353 | Ga0501034_0006353_5086_6021 | 268 |
| 415 | 3300049572 | Ga0501036_0009130 | Ga0501036_0009130_5302_6237 | 268 |
| 416 | 3300049573 | Ga0501037_0001882 | Ga0501037_0001882_7876_8811 | 268 |
| 417 | 3300049574 | Ga0501038_0017119 | Ga0501038_0017119_5241_6176 | 268 |
| 418 | 3300049575 | Ga0501039_0027217 | Ga0501039_0027217_3081_4016 | 268 |
| 419 | 3300049576 | Ga0501040_0013161 | Ga0501040_0013161_1768_2703 | 268 |
| 420 | 3300049577 | Ga0501041_0010140 | Ga0501041_0010140_2260_3195 | 268 |
| 421 | 3300049578 | Ga0501042_0098644 | Ga0501042_0098644_554_1489 | 268 |
| 422 | 3300049579 | Ga0501043_0003543 | Ga0501043_0003543_4772_5707 | 268 |
| 423 | 3300049582 | Ga0501048_0056201 | Ga0501048_0056201_1804_2739 | 268 |
| 424 | 3300049585 | Ga0501069_0016086 | Ga0501069_0016086_727_1662 | 268 |
| 425 | 3300049588 | Ga0501072_0015578 | Ga0501072_0015578_4805_5740 | 268 |
| 426 | 3300049589 | Ga0501073_0021099 | Ga0501073_0021099_682_1617 | 268 |
| 427 | 3300049593 | Ga0501077_0041060 | Ga0501077_0041060_1935_2870 | 268 |
| 428 | 3300049741 | Ga0501079_0001236 | Ga0501079_0001236_8738_9673 | 268 |
| 429 | 3300049822 | Ga0501035_0003738 | Ga0501035_0003738_6457_7392 | 268 |
| 430 | 3300049823 | Ga0501044_0003883 | Ga0501044_0003883_8693_9628 | 268 |
| 431 | 3300049824 | Ga0501045_0059045 | Ga0501045_0059045_682_1617 | 268 |
| 432 | 3300054114 | Ga0501084_0004162 | Ga0501084_0004162_2102_3037 | 268 |
| 433 | 3300060353 | Ga0501082_0015621 | Ga0501082_0015621_181_1116 | 268 |
| 434 | iso_pu_bacteria | 2643221961 | 2645719913 | 268 |
| 435 | iso_pu_bacteria | 2832004796 | 2832009593 | 268 |
| 436 | iso_pu_bacteria | 2857720070 | 2857720809 | 268 |
| 437 | iso_pu_bacteria | 2866065130 | 2866071388 | 268 |
| 438 | iso_pu_bacteria | 2867507094 | 2867507563 | 268 |
| 439 | iso_pu_bacteria | 8008485437 | 8008486734 | 268 |
| 440 | iso_pu_bacteria | 8025524527 | 8025525976 | 268 |
| 441 | iso_pu_bacteria | 8056579771 | 8056579800 | 268 |
| 442 | 3300003354 | JGI25160J50197_1033347 | JGI25160J50197_10333471 | 269 |
| 443 | 3300005455 | Ga0070663_100087576 | Ga0070663_1000875762 | 269 |
| 444 | 3300005548 | Ga0070665_100392855 | Ga0070665_1003928552 | 269 |
| 445 | 3300025302 | Ga0207426_1013909 | Ga0207426_10139092 | 269 |
| 446 | 3300026067 | Ga0207678_10000268 | Ga0207678_100002682 | 269 |
| 447 | 3300044693 | Ga0466961_0216549 | Ga0466961_0216549_176_1102 | 269 |
| 448 | 3300044901 | Ga0466960_0001602 | Ga0466960_0001602_6854_7780 | 269 |
| 449 | 3300046453 | Ga0495627_013966 | Ga0495627_013966_1050_1943 | 269 |
| 450 | 3300046459 | Ga0495629_0053946 | Ga0495629_0053946_657_1583 | 269 |
| 451 | 3300046474 | Ga0495605_0001464 | Ga0495605_0001464_8746_9672 | 269 |
| 452 | 3300046499 | Ga0495594_0022491 | Ga0495594_0022491_1944_2870 | 269 |
| 453 | 3300046506 | Ga0495583_0049245 | Ga0495583_0049245_725_1651 | 269 |
| 454 | 3300046515 | Ga0495620_0011920 | Ga0495620_0011920_210_1136 | 269 |
| 455 | 3300046518 | Ga0495631_0002744 | Ga0495631_0002744_6854_7780 | 269 |
| 456 | 3300046524 | Ga0495648_0007727 | Ga0495648_0007727_6264_7190 | 269 |
| 457 | 3300046530 | Ga0495654_0041408 | Ga0495654_0041408_799_1725 | 269 |
| 458 | 3300046616 | Ga0495668_0056109 | Ga0495668_0056109_1204_2130 | 269 |
| 459 | 3300046660 | Ga0495625_0046547 | Ga0495625_0046547_2159_3085 | 269 |
| 460 | 3300046665 | Ga0495661_0015815 | Ga0495661_0015815_2018_2944 | 269 |
| 461 | 3300046691 | Ga0495670_0075345 | Ga0495670_0075345_450_1376 | 269 |
| 462 | 3300046794 | Ga0495589_0017668 | Ga0495589_0017668_1962_2888 | 269 |
| 463 | 3300047318 | Ga0495636_0011685 | Ga0495636_0011685_2022_2948 | 269 |
| 464 | 3300047318 | Ga0495636_0054113 | Ga0495636_0054113_728_1651 | 269 |
| 465 | 3300047321 | Ga0495676_0001734 | Ga0495676_0001734_16840_17766 | 269 |
| 466 | 3300047323 | Ga0495683_0035571 | Ga0495683_0035571_686_1612 | 269 |
| 467 | 3300047443 | Ga0495687_070979 | Ga0495687_070979_119_1045 | 269 |
| 468 | 3300047447 | Ga0495685_005944 | Ga0495685_005944_845_1771 | 269 |
| 469 | 3300047470 | Ga0495681_0046037 | Ga0495681_0046037_1044_1970 | 269 |
| 470 | 3300048091 | Ga0495626_0008702 | Ga0495626_0008702_864_1790 | 269 |
| 471 | 3300053143 | Ga0500579_030636 | Ga0500579_030636_808_1725 | 269 |
| 472 | 3300053149 | Ga0500600_0027133 | Ga0500600_0027133_1212_2129 | 269 |
| 473 | iso_pu_bacteria | 2643221549 | 2643768880 | 269 |
| 474 | iso_pu_bacteria | 2758568621 | 2760621293 | 269 |
| 475 | 3300005985 | Ga0081539_10007488 | Ga0081539_100074883 | 270 |
| 476 | 3300031911 | Ga0307412_10138111 | Ga0307412_101381112 | 270 |
| 477 | 3300049704 | Ga0501221_032295 | Ga0501221_032295_141_1040 | 270 |
| 478 | iso_pu_bacteria | 2643221548 | 2643760515 | 270 |
| 479 | iso_pu_bacteria | 2643221682 | 2644459598 | 270 |
| 480 | iso_pu_bacteria | 2818991472 | 2819744756 | 270 |
| 481 | iso_pu_bacteria | 2887478801 | 2887482793 | 270 |
| 482 | 3300005455 | Ga0070663_100040694 | Ga0070663_1000406942 | 271 |
| 483 | 3300005457 | Ga0070662_100054231 | Ga0070662_1000542312 | 271 |
| 484 | 3300005564 | Ga0070664_100007052 | Ga0070664_1000070523 | 271 |
| 485 | 3300011119 | Ga0105246_10172798 | Ga0105246_101727982 | 271 |
| 486 | 3300013308 | Ga0157375_10110663 | Ga0157375_101106632 | 271 |
| 487 | 3300025933 | Ga0207706_10024667 | Ga0207706_100246671 | 271 |
| 488 | 3300025945 | Ga0207679_10016223 | Ga0207679_100162234 | 271 |
| 489 | 3300026067 | Ga0207678_10062320 | Ga0207678_100623202 | 271 |
| 490 | 3300028786 | Ga0307517_10017578 | Ga0307517_100175783 | 271 |
| 491 | 3300031901 | Ga0307406_10183215 | Ga0307406_101832152 | 271 |
| 492 | 3300048924 | Ga0496121_0018146 | Ga0496121_0018146_5205_6140 | 271 |
| 493 | 3300049569 | Ga0501032_0053596 | Ga0501032_0053596_604_1533 | 271 |
| 494 | 3300049574 | Ga0501038_0023621 | Ga0501038_0023621_2812_3741 | 271 |
| 495 | 3300049579 | Ga0501043_0060165 | Ga0501043_0060165_1742_2671 | 271 |
| 496 | 3300050496 | nmdc:mga07m45_71397_c1 | nmdc:mga07m45_71397_c1_197_1120 | 271 |
| 497 | iso_pu_bacteria | 2547132111 | 2547405545 | 271 |
| 498 | iso_pu_bacteria | 2643221572 | 2643877727 | 271 |
| 499 | iso_pu_bacteria | 2643221669 | 2644384782 | 271 |
| 500 | iso_pu_bacteria | 2643221678 | 2644443507 | 271 |
| 501 | iso_pu_bacteria | 2643221714 | 2644627177 | 271 |
| 502 | iso_pu_bacteria | 2773857762 | 2774394121 | 271 |
| 503 | iso_pu_bacteria | 2784132148 | 2784585881 | 271 |
| 504 | iso_pu_bacteria | 2808606359 | 2808846020 | 271 |
| 505 | iso_pu_bacteria | 2808606448 | 2809229376 | 271 |
| 506 | iso_pu_bacteria | 2818991463 | 2819699974 | 271 |
| 507 | iso_pu_bacteria | 2839986021 | 2839986557 | 271 |
| 508 | iso_pu_bacteria | 2862281513 | 2862281732 | 271 |
| 509 | iso_pu_bacteria | 2862574272 | 2862581905 | 271 |
| 510 | iso_pu_bacteria | 2868088558 | 2868091359 | 271 |
| 511 | iso_pu_bacteria | 2891968417 | 2891972477 | 271 |
| 512 | iso_pu_bacteria | 2895660088 | 2895662580 | 271 |
| 513 | iso_pu_bacteria | 2919468124 | 2919474604 | 271 |
| 514 | iso_pu_bacteria | 2932431166 | 2932434387 | 271 |
| 515 | iso_pu_bacteria | 2946072368 | 2946079699 | 271 |
| 516 | iso_pu_bacteria | 2954002825 | 2954008696 | 271 |
| 517 | iso_pu_bacteria | 2966598605 | 2966604983 | 271 |
| 518 | iso_pu_bacteria | 3006493962 | 3006494000 | 271 |
| 519 | iso_pu_bacteria | 8023623736 | 8023627786 | 271 |
| 520 | 3300005985 | Ga0081539_10000448 | Ga0081539_1000044852 | 272 |
| 521 | 3300037466 | Ga0395898_0022084 | Ga0395898_0022084_239_1129 | 272 |
| 522 | 3300041404 | Ga0439436_0017158 | Ga0439436_0017158_1198_2118 | 272 |
| 523 | 3300042138 | Ga0450903_004374 | Ga0450903_004374_1278_2216 | 272 |
| 524 | 3300044656 | Ga0466969_0020497 | Ga0466969_0020497_1822_2760 | 272 |
| 525 | 3300044658 | Ga0466972_0012642 | Ga0466972_0012642_2953_3891 | 272 |
| 526 | 3300044683 | Ga0466965_0031318 | Ga0466965_0031318_1559_2497 | 272 |
| 527 | 3300044684 | Ga0466966_0005223 | Ga0466966_0005223_1555_2493 | 272 |
| 528 | 3300044693 | Ga0466961_0004724 | Ga0466961_0004724_1555_2493 | 272 |
| 529 | 3300044694 | Ga0466963_0000867 | Ga0466963_0000867_7862_8800 | 272 |
| 530 | 3300044706 | Ga0466964_0002993 | Ga0466964_0002993_5088_6026 | 272 |
| 531 | 3300044719 | Ga0466971_0000558 | Ga0466971_0000558_6074_7012 | 272 |
| 532 | 3300044765 | Ga0466970_0000414 | Ga0466970_0000414_13874_14812 | 272 |
| 533 | 3300044842 | Ga0466957_0002513 | Ga0466957_0002513_6443_7381 | 272 |
| 534 | 3300045049 | Ga0466959_0015694 | Ga0466959_0015694_4513_5451 | 272 |
| 535 | 3300045836 | Ga0466958_0027958 | Ga0466958_0027958_2330_3268 | 272 |
| 536 | 3300045976 | Ga0466967_0004720 | Ga0466967_0004720_4656_5594 | 272 |
| 537 | 3300046454 | Ga0495592_0001835 | Ga0495592_0001835_5970_6890 | 272 |
| 538 | 3300046459 | Ga0495629_0021514 | Ga0495629_0021514_1309_2235 | 272 |
| 539 | 3300046462 | Ga0495651_0010033 | Ga0495651_0010033_5586_6506 | 272 |
| 540 | 3300046511 | Ga0495608_0017280 | Ga0495608_0017280_2454_3374 | 272 |
| 541 | 3300046514 | Ga0495618_0023361 | Ga0495618_0023361_1954_2874 | 272 |
| 542 | 3300046516 | Ga0495628_0008151 | Ga0495628_0008151_6122_7042 | 272 |
| 543 | 3300046529 | Ga0495652_0016428 | Ga0495652_0016428_2160_3080 | 272 |
| 544 | 3300046663 | Ga0495635_0007408 | Ga0495635_0007408_2945_3865 | 272 |
| 545 | 3300046679 | Ga0495623_0011396 | Ga0495623_0011396_3635_4555 | 272 |
| 546 | 3300046689 | Ga0495613_0036920 | Ga0495613_0036920_2375_3301 | 272 |
| 547 | 3300046689 | Ga0495613_0111525 | Ga0495613_0111525_164_1084 | 272 |
| 548 | 3300046690 | Ga0495624_0110289 | Ga0495624_0110289_735_1655 | 272 |
| 549 | 3300046809 | Ga0495600_0047004 | Ga0495600_0047004_899_1819 | 272 |
| 550 | 3300047317 | Ga0495604_0127657 | Ga0495604_0127657_563_1483 | 272 |
| 551 | 3300047321 | Ga0495676_0007466 | Ga0495676_0007466_2422_3348 | 272 |
| 552 | 3300047322 | Ga0495680_0002951 | Ga0495680_0002951_13854_14774 | 272 |
| 553 | 3300047444 | Ga0495675_0011602 | Ga0495675_0011602_1674_2594 | 272 |
| 554 | 3300048088 | Ga0495602_0069826 | Ga0495602_0069826_486_1406 | 272 |
| 555 | 3300048089 | Ga0495614_0007790 | Ga0495614_0007790_2419_3345 | 272 |
| 556 | iso_pu_bacteria | 2558860280 | 2559432263 | 272 |
| 557 | iso_pu_bacteria | 2808606700 | 2810365146 | 272 |
| 558 | iso_pu_bacteria | 2945956166 | 2945956598 | 272 |
| 559 | iso_pu_bacteria | 2946003308 | 2946006657 | 272 |
| 560 | iso_pu_bacteria | 2946041624 | 2946043400 | 272 |
| 561 | iso_pu_bacteria | 2954691527 | 2954692519 | 272 |
| 562 | iso_pu_bacteria | 2954701450 | 2954707588 | 272 |
| 563 | iso_pu_bacteria | 8054107350 | 8054107394 | 272 |
| 564 | 3300001979 | JGI24740J21852_10006152 | JGI24740J21852_100061522 | 273 |
| 565 | 3300005337 | Ga0070682_100190302 | Ga0070682_1001903022 | 273 |
| 566 | 3300005339 | Ga0070660_100054899 | Ga0070660_1000548992 | 273 |
| 567 | 3300005366 | Ga0070659_100005438 | Ga0070659_1000054384 | 273 |
| 568 | 3300005435 | Ga0070714_100016573 | Ga0070714_1000165735 | 273 |
| 569 | 3300005436 | Ga0070713_100118526 | Ga0070713_1001185262 | 273 |
| 570 | 3300005539 | Ga0068853_100154855 | Ga0068853_1001548551 | 273 |
| 571 | 3300005563 | Ga0068855_100052979 | Ga0068855_1000529793 | 273 |
| 572 | 3300005578 | Ga0068854_100027500 | Ga0068854_1000275003 | 273 |
| 573 | 3300005616 | Ga0068852_100019092 | Ga0068852_1000190922 | 273 |
| 574 | 3300005617 | Ga0068859_100073431 | Ga0068859_1000734312 | 273 |
| 575 | 3300005842 | Ga0068858_100000023 | Ga0068858_10000002318 | 273 |
| 576 | 3300006931 | Ga0097620_100073434 | Ga0097620_1000734342 | 273 |
| 577 | 3300025909 | Ga0207705_10008870 | Ga0207705_100088705 | 273 |
| 578 | 3300025913 | Ga0207695_10009651 | Ga0207695_100096518 | 273 |
| 579 | 3300025920 | Ga0207649_10022261 | Ga0207649_100222613 | 273 |
| 580 | 3300025928 | Ga0207700_10061831 | Ga0207700_100618313 | 273 |
| 581 | 3300025929 | Ga0207664_10044114 | Ga0207664_100441142 | 273 |
| 582 | 3300025932 | Ga0207690_10001158 | Ga0207690_100011584 | 273 |
| 583 | 3300025935 | Ga0207709_10066605 | Ga0207709_100666052 | 273 |
| 584 | 3300025941 | Ga0207711_10143217 | Ga0207711_101432173 | 273 |
| 585 | 3300025949 | Ga0207667_10009261 | Ga0207667_100092614 | 273 |
| 586 | 3300025981 | Ga0207640_10080953 | Ga0207640_100809532 | 273 |
| 587 | 3300025986 | Ga0207658_10027115 | Ga0207658_100271154 | 273 |
| 588 | 3300026035 | Ga0207703_10000570 | Ga0207703_1000057032 | 273 |
| 589 | 3300026142 | Ga0207698_10012613 | Ga0207698_100126133 | 273 |
| 590 | 3300030733 | Ga0314311_1194712 | Ga0314311_11947123 | 273 |
| 591 | 3300047443 | Ga0495687_026079 | Ga0495687_026079_1328_2254 | 273 |
| 592 | 3300048929 | Ga0496126_0004390 | Ga0496126_0004390_13391_14338 | 273 |
| 593 | 3300049570 | Ga0501033_0167464 | Ga0501033_0167464_499_1407 | 273 |
| 594 | 3300049573 | Ga0501037_0012569 | Ga0501037_0012569_327_1262 | 273 |
| 595 | 3300049581 | Ga0501047_0000121 | Ga0501047_0000121_40653_41588 | 273 |
| 596 | 3300053142 | Ga0500577_0107400 | Ga0500577_0107400_165_1121 | 273 |
| 597 | iso_pu_bacteria | 2643221542 | 2643732176 | 273 |
| 598 | iso_pu_bacteria | 2643221553 | 2643785060 | 273 |
| 599 | iso_pu_bacteria | 2643221630 | 2644170994 | 273 |
| 600 | iso_pu_bacteria | 2643221724 | 2644679388 | 273 |
| 601 | iso_pu_bacteria | 2728369380 | 2730228906 | 273 |
| 602 | iso_pu_bacteria | 2739367654 | 2739606537 | 273 |
| 603 | iso_pu_bacteria | 2747842429 | 2747953031 | 273 |
| 604 | iso_pu_bacteria | 2758568522 | 2760306670 | 273 |
| 605 | iso_pu_bacteria | 2758568621 | 2760624851 | 273 |
| 606 | iso_pu_bacteria | 2857723135 | 2857727006 | 273 |
| 607 | iso_pu_bacteria | 2870622029 | 2870623235 | 273 |
| 608 | iso_pu_bacteria | 2945968032 | 2945971052 | 273 |
| 609 | iso_pu_bacteria | 2946080515 | 2946081672 | 273 |
| 610 | iso_pu_bacteria | 3006321560 | 3006324849 | 273 |
| 611 | iso_pu_bacteria | 8056579771 | 8056582932 | 273 |
| 612 | 3300005288 | Ga0065714_10134026 | Ga0065714_101340261 | 274 |
| 613 | 3300005347 | Ga0070668_100028603 | Ga0070668_1000286032 | 274 |
| 614 | 3300006038 | Ga0075365_10033648 | Ga0075365_100336482 | 274 |
| 615 | 3300006042 | Ga0075368_10016741 | Ga0075368_100167412 | 274 |
| 616 | 3300006048 | Ga0075363_100014117 | Ga0075363_1000141173 | 274 |
| 617 | 3300006051 | Ga0075364_10045923 | Ga0075364_100459233 | 274 |
| 618 | 3300009148 | Ga0105243_10133487 | Ga0105243_101334872 | 274 |
| 619 | 3300009553 | Ga0105249_10052646 | Ga0105249_100526462 | 274 |
| 620 | 3300011119 | Ga0105246_10021889 | Ga0105246_100218893 | 274 |
| 621 | 3300013308 | Ga0157375_10395411 | Ga0157375_103954112 | 274 |
| 622 | 3300025961 | Ga0207712_10053210 | Ga0207712_100532102 | 274 |
| 623 | 3300025972 | Ga0207668_10016593 | Ga0207668_100165933 | 274 |
| 624 | 3300027866 | Ga0209813_10007394 | Ga0209813_100073943 | 274 |
| 625 | 3300028786 | Ga0307517_10002208 | Ga0307517_100022083 | 274 |
| 626 | 3300028794 | Ga0307515_10000025 | Ga0307515_10000025258 | 274 |
| 627 | 3300030522 | Ga0307512_10025790 | Ga0307512_100257903 | 274 |
| 628 | 3300030522 | Ga0307512_10033438 | Ga0307512_100334383 | 274 |
| 629 | 3300031456 | Ga0307513_10069905 | Ga0307513_100699053 | 274 |
| 630 | 3300031507 | Ga0307509_10045377 | Ga0307509_100453774 | 274 |
| 631 | 3300031616 | Ga0307508_10051617 | Ga0307508_100516173 | 274 |
| 632 | 3300031649 | Ga0307514_10064241 | Ga0307514_100642412 | 274 |
| 633 | 3300031731 | Ga0307405_10116654 | Ga0307405_101166542 | 274 |
| 634 | 3300031995 | Ga0307409_100599658 | Ga0307409_1005996581 | 274 |
| 635 | 3300033179 | Ga0307507_10015152 | Ga0307507_100151527 | 274 |
| 636 | 3300033180 | Ga0307510_10090821 | Ga0307510_100908212 | 274 |
| 637 | 3300046459 | Ga0495629_0044899 | Ga0495629_0044899_411_1325 | 274 |
| 638 | 3300046460 | Ga0495638_0024173 | Ga0495638_0024173_477_1436 | 274 |
| 639 | 3300046616 | Ga0495668_0004244 | Ga0495668_0004244_4510_5436 | 274 |
| 640 | 3300046660 | Ga0495625_0000716 | Ga0495625_0000716_4535_5461 | 274 |
| 641 | 3300046660 | Ga0495625_0003926 | Ga0495625_0003926_5752_6666 | 274 |
| 642 | 3300046674 | Ga0495588_0006810 | Ga0495588_0006810_4166_5080 | 274 |
| 643 | 3300046692 | Ga0495671_0006199 | Ga0495671_0006199_1254_2168 | 274 |
| 644 | 3300047323 | Ga0495683_0005247 | Ga0495683_0005247_1727_2653 | 274 |
| 645 | 3300047470 | Ga0495681_0009151 | Ga0495681_0009151_3607_4521 | 274 |
| 646 | 3300048089 | Ga0495614_0001852 | Ga0495614_0001852_2791_3705 | 274 |
| 647 | 3300048091 | Ga0495626_0000069 | Ga0495626_0000069_4522_5448 | 274 |
| 648 | 3300048908 | Ga0496105_0038857 | Ga0496105_0038857_2482_3444 | 274 |
| 649 | 3300048912 | Ga0496109_0026506 | Ga0496109_0026506_450_1412 | 274 |
| 650 | 3300048912 | Ga0496109_0279976 | Ga0496109_0279976_28_987 | 274 |
| 651 | 3300048914 | Ga0496111_0222913 | Ga0496111_0222913_18_980 | 274 |
| 652 | 3300050490 | nmdc:mga03n38_26092_c1 | nmdc:mga03n38_26092_c1_641_1618 | 274 |
| 653 | 3300050491 | nmdc:mga00v17_38795_c1 | nmdc:mga00v17_38795_c1_436_1413 | 274 |
| 654 | 3300050492 | nmdc:mga0yw44_28577_c1 | nmdc:mga0yw44_28577_c1_1259_2236 | 274 |
| 655 | 3300050494 | nmdc:mga06z11_3762_c1 | nmdc:mga06z11_3762_c1_2635_3612 | 274 |
| 656 | 3300050495 | nmdc:mga04h51_8599_c1 | nmdc:mga04h51_8599_c1_147_1124 | 274 |
| 657 | 3300053107 | Ga0500560_000339 | Ga0500560_000339_2132_3046 | 274 |
| 658 | iso_pu_bacteria | 2616644814 | 2616698470 | 274 |
| 659 | iso_pu_bacteria | 2643221597 | 2643997761 | 274 |
| 660 | iso_pu_bacteria | 2654587600 | 2655034407 | 274 |
| 661 | iso_pu_bacteria | 2721755702 | 2723640801 | 274 |
| 662 | iso_pu_bacteria | 2773857758 | 2774379865 | 274 |
| 663 | iso_pu_bacteria | 2811994872 | 2812321934 | 274 |
| 664 | iso_pu_bacteria | 2904509784 | 2904513156 | 274 |
| 665 | iso_pu_bacteria | 2906799679 | 2906802215 | 274 |
| 666 | iso_pu_bacteria | 2908678064 | 2908679114 | 274 |
| 667 | iso_pu_bacteria | 2919069694 | 2919069745 | 274 |
| 668 | iso_pu_bacteria | 2919443155 | 2919443976 | 274 |
| 669 | iso_pu_bacteria | 2928090899 | 2928092949 | 274 |
| 670 | iso_pu_bacteria | 2974324384 | 2974327703 | 274 |
| 671 | iso_pu_bacteria | 2977228692 | 2977229320 | 274 |
| 672 | iso_pu_bacteria | 2977236895 | 2977238642 | 274 |
| 673 | iso_pu_bacteria | 2977251589 | 2977254523 | 274 |
| 674 | iso_pu_bacteria | 2977264416 | 2977264503 | 274 |
| 675 | iso_pu_bacteria | 2984542743 | 2984543576 | 274 |
| 676 | iso_pu_bacteria | 2984580707 | 2984583493 | 274 |
| 677 | iso_pu_bacteria | 8046352972 | 8046355299 | 274 |
| 678 | 3300020081 | Ga0206354_10736904 | Ga0206354_107369042 | 275 |
| 679 | 3300032002 | Ga0307416_100061247 | Ga0307416_1000612471 | 275 |
| 680 | 3300046462 | Ga0495651_0003934 | Ga0495651_0003934_3614_4540 | 275 |
| 681 | 3300047319 | Ga0495674_0074986 | Ga0495674_0074986_1353_2285 | 275 |
| 682 | 3300048929 | Ga0496126_0037356 | Ga0496126_0037356_2064_3020 | 275 |
| 683 | iso_pu_bacteria | 2643221631 | 2644179707 | 275 |
| 684 | iso_pu_bacteria | 2808606439 | 2809195030 | 275 |
| 685 | iso_pu_bacteria | 2919443155 | 2919443853 | 275 |
| 686 | 3300001990 | JGI24737J22298_10004249 | JGI24737J22298_100042494 | 276 |
| 687 | 3300002067 | JGI24735J21928_10009817 | JGI24735J21928_100098173 | 276 |
| 688 | 3300005335 | Ga0070666_10081315 | Ga0070666_100813152 | 276 |
| 689 | 3300005347 | Ga0070668_100098861 | Ga0070668_1000988612 | 276 |
| 690 | 3300005455 | Ga0070663_100364064 | Ga0070663_1003640641 | 276 |
| 691 | 3300005539 | Ga0068853_100216893 | Ga0068853_1002168932 | 276 |
| 692 | 3300005577 | Ga0068857_100136752 | Ga0068857_1001367522 | 276 |
| 693 | 3300005843 | Ga0068860_100282675 | Ga0068860_1002826752 | 276 |
| 694 | 3300009551 | Ga0105238_10469174 | Ga0105238_104691741 | 276 |
| 695 | 3300010375 | Ga0105239_10240254 | Ga0105239_102402542 | 276 |
| 696 | 3300013307 | Ga0157372_10038922 | Ga0157372_100389222 | 276 |
| 697 | 3300025925 | Ga0207650_10066765 | Ga0207650_100667652 | 276 |
| 698 | 3300025941 | Ga0207711_10000340 | Ga0207711_100003403 | 276 |
| 699 | 3300026041 | Ga0207639_10198348 | Ga0207639_101983481 | 276 |
| 700 | 3300026067 | Ga0207678_10335999 | Ga0207678_103359991 | 276 |
| 701 | 3300026116 | Ga0207674_10013828 | Ga0207674_1001382810 | 276 |
| 702 | 3300026142 | Ga0207698_10255720 | Ga0207698_102557202 | 276 |
| 703 | iso_pu_bacteria | 2808606372 | 2808903297 | 276 |
| 704 | 3300005288 | Ga0065714_10019207 | Ga0065714_100192072 | 277 |
| 705 | 3300005288 | Ga0065714_10124698 | Ga0065714_101246982 | 277 |
| 706 | 3300005338 | Ga0068868_100262897 | Ga0068868_1002628972 | 277 |
| 707 | 3300005614 | Ga0068856_100214592 | Ga0068856_1002145922 | 277 |
| 708 | 3300005616 | Ga0068852_100049796 | Ga0068852_1000497963 | 277 |
| 709 | 3300013100 | Ga0157373_10213522 | Ga0157373_102135222 | 277 |
| 710 | 3300013307 | Ga0157372_10106942 | Ga0157372_101069422 | 277 |
| 711 | 3300026078 | Ga0207702_10148764 | Ga0207702_101487642 | 277 |
| 712 | 3300031456 | Ga0307513_10000003 | Ga0307513_10000003264 | 277 |
| 713 | 3300037312 | Ga0395899_0000858 | Ga0395899_0000858_12854_13786 | 277 |
| 714 | 3300037466 | Ga0395898_0350728 | Ga0395898_0350728_190_1122 | 277 |
| 715 | 3300044656 | Ga0466969_0057630 | Ga0466969_0057630_629_1558 | 277 |
| 716 | 3300044684 | Ga0466966_0036400 | Ga0466966_0036400_455_1384 | 277 |
| 717 | 3300044693 | Ga0466961_0000884 | Ga0466961_0000884_15399_16328 | 277 |
| 718 | 3300046660 | Ga0495625_0038206 | Ga0495625_0038206_792_1733 | 277 |
| 719 | 3300048903 | Ga0496100_0014827 | Ga0496100_0014827_2394_3311 | 277 |
| 720 | 3300048904 | Ga0496101_0041456 | Ga0496101_0041456_2340_3257 | 277 |
| 721 | 3300048916 | Ga0496113_0020066 | Ga0496113_0020066_2546_3463 | 277 |
| 722 | 3300048917 | Ga0496114_0028597 | Ga0496114_0028597_1467_2384 | 277 |
| 723 | 3300048918 | Ga0496115_0016015 | Ga0496115_0016015_2412_3329 | 277 |
| 724 | iso_pu_bacteria | 2585427649 | 2586060846 | 277 |
| 725 | iso_pu_bacteria | 2643221649 | 2644278559 | 277 |
| 726 | iso_pu_bacteria | 2721755702 | 2723640881 | 277 |
| 727 | iso_pu_bacteria | 2799112218 | 2799183164 | 277 |
| 728 | iso_pu_bacteria | 2808606394 | 2809029763 | 277 |
| 729 | iso_pu_bacteria | 2870721527 | 2870724242 | 277 |
| 730 | iso_pu_bacteria | 2870721527 | 2870725031 | 277 |
| 731 | iso_pu_bacteria | 2915768154 | 2915769907 | 277 |
| 732 | 3300003762 | Ga0055542_1000019 | Ga0055542_1000019324 | 278 |
| 733 | 3300003763 | Ga0055529_1000008 | Ga0055529_100000842 | 278 |
| 734 | 3300009148 | Ga0105243_10049273 | Ga0105243_100492732 | 278 |
| 735 | 3300025228 | Ga0209672_100011 | Ga0209672_100011533 | 278 |
| 736 | 3300025229 | Ga0209147_100319 | Ga0209147_10031920 | 278 |
| 737 | 3300025254 | Ga0209148_1000023 | Ga0209148_1000023371 | 278 |
| 738 | 3300025272 | Ga0209455_1000023 | Ga0209455_1000023371 | 278 |
| 739 | 3300025935 | Ga0207709_10090664 | Ga0207709_100906642 | 278 |
| 740 | 3300028794 | Ga0307515_10109151 | Ga0307515_101091513 | 278 |
| 741 | 3300028794 | Ga0307515_10250106 | Ga0307515_102501061 | 278 |
| 742 | 3300053153 | Ga0500616_0001029 | Ga0500616_0001029_4240_5163 | 278 |
| 743 | iso_pu_bacteria | 2643221549 | 2643768744 | 278 |
| 744 | iso_pu_bacteria | 2643221619 | 2644112183 | 278 |
| 745 | iso_pu_bacteria | 2738543027 | 2739325470 | 278 |
| 746 | 3300001979 | JGI24740J21852_10005331 | JGI24740J21852_100053312 | 279 |
| 747 | 3300001989 | JGI24739J22299_10006370 | JGI24739J22299_100063704 | 279 |
| 748 | 3300001990 | JGI24737J22298_10004684 | JGI24737J22298_100046843 | 279 |
| 749 | 3300009036 | Ga0105244_10014945 | Ga0105244_100149454 | 279 |
| 750 | 3300009148 | Ga0105243_10056055 | Ga0105243_100560552 | 279 |
| 751 | 3300013105 | Ga0157369_10004513 | Ga0157369_100045138 | 279 |
| 752 | 3300013307 | Ga0157372_10084473 | Ga0157372_100844732 | 279 |
| 753 | 3300020080 | Ga0206350_10637427 | Ga0206350_106374272 | 279 |
| 754 | 3300025728 | Ga0207655_1009093 | Ga0207655_10090933 | 279 |
| 755 | 3300048922 | Ga0496119_0046464 | Ga0496119_0046464_332_1252 | 279 |
| 756 | 3300048923 | Ga0496120_0022202 | Ga0496120_0022202_1558_2478 | 279 |
| 757 | iso_pu_bacteria | 2721755702 | 2723643309 | 279 |
| 758 | iso_pu_bacteria | 2935409751 | 2935411946 | 279 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
26
320
0.83
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.8889 | 12 | 269 |
| 8ja7-assembly1.cif.gz_A | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.8884 | 14 | 269 |
| 4tqv-assembly4.cif.gz_M | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.8755 | 12 | 275 |
| 4tqu-assembly1.cif.gz_M | crystal structure of a bacterial abc transporter involved in the import of the acidic polysaccharide alginate | 0.8691 | 8 | 275 |
| 8hps-assembly1.cif.gz_A | lpqy-sugabc in state 5 | 0.8597 | 14 | 274 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.917 | 35 | 279 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9099 | 35 | 279 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9063 | 35 | 275 | 1.10.3720.10 |
| 4tquM01 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8957 | 35 | 275 | 1.10.3720.10 |
| af_P9WG03_18_293_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.8922 | 14 | 269 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A428XM38-F1-model_v4 | deleted | 0.9709 | 14 | 276 |
|
| AF-A0A3G8W6U8-F1-model_v4 | deleted | 0.9592 | 14 | 279 |
|
| AF-A0A1W7D0Z3-F1-model_v4 | ABC transmembrane type-1 domain-containing protein | 0.9588 | 14 | 277 |
GO:0005886
GO:0055085 |
| AF-A0A8A3TIC5-F1-model_v4 | deleted | 0.9509 | 14 | 279 |
|
| AF-A0A850D038-F1-model_v4 | deleted | 0.9508 | 126 | 273 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar