F479441

General Info

Members Datasets Scaffolds Average Seq Length
758 638 373 351

Family's Representative Sequence

Representative Sequence 3300009093|Ga0105240_10016435|Ga0105240_100164358
Length 415
Sequence MVMARLGSLAKRRVLSVPAIRLVKSIKYARFSSRDCDFGGYRGALALRGLTPSQRIAMPPLPSALAFIPFVSVENMMRLVHHVGIETVLAELTDAVEADFLRWDSFEKAPRLASHSREGVIELMPTSDGALYSFKYVNGHPSNTAKGLQTVAAFGLLARVDNGYPLMLTEMTLLTALRTAATSAMAARRLAPRDAKVMAMIGNGAQAEFQALAMKAVLGIEEVRLYDIDPGATDKALRNLRDSGLRVVACATSQDAIEGAQIVTTCTADKAYATILTDNMVGAGIHINAIGGDCPGKTELHKDILDRARTFVEFEPQTRIEGEIQQMDASYPVTEFARVLQGEAEGRTDARQITLFDSVGFAIEDFSALRYIHGKLASTEFFQQIDILADPDDPRDLFGMLQRAHVRDRDLVGSI

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
3 2509276019 Ensifer aridi TW10 Isolate Nodule
4 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
5 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
6 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
7 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
8 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
9 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
10 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
11 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
12 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
13 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
14 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
15 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
16 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
17 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
18 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
19 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
20 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
21 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
22 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
23 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
24 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
25 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
26 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
27 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
28 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
29 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
30 2516143018 Ensifer sp. BR816 Isolate Nodule
31 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
32 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
33 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
34 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
35 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
36 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
37 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
38 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
39 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
40 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
41 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
42 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
43 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
44 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
45 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
46 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
47 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
48 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
49 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
50 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
51 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
52 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
53 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
54 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
55 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
56 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
57 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
58 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
59 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
60 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
61 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
62 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
63 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
64 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
65 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
66 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
67 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
68 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
69 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
70 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
71 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
72 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
73 2643221558 Rhizobium sp. Root149 Isolate Unclassified
74 2643221568 Rhizobium sp. Root564 Isolate Unclassified
75 2643221582 Rhizobium sp. Root651 Isolate Unclassified
76 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
77 2643221605 Sphingomonas sp. Root710 Isolate Unclassified
78 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
79 2643221607 Rhizobium sp. Root73 Isolate Unclassified
80 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
81 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
82 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
83 2643221688 Rhizobium sp. Root482 Isolate Unclassified
84 2643221693 Rhizobium sp. Root491 Isolate Unclassified
85 2643221733 Bosea sp. Root381 Isolate Unclassified
86 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
87 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
88 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
89 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
90 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
91 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
92 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
93 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
94 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
95 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
96 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
97 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
98 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
99 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
100 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
101 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
102 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
103 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
104 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
105 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
106 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
107 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
108 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
109 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
110 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
111 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
112 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
113 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
114 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
115 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
116 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
117 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
118 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
119 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
120 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
121 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
122 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
123 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
124 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
125 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
126 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
127 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
128 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
129 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
130 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
131 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
132 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
133 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
134 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
135 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
136 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
137 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
138 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
139 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
140 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
141 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
142 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
143 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
144 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
145 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
146 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
147 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
148 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
149 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
150 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
151 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
152 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
153 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
154 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
155 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
156 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
157 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
158 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
159 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
160 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
161 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
162 2899259804 Paracoccus aeridis JC501 Isolate Rhizosphere
163 2899275550 Paracoccus hibiscisoli CCTCC AB2016182 Isolate Rhizosphere
164 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
165 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
166 2909042592 Labrys sp. LIt4 Isolate Nodule
167 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
168 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
169 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
170 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
171 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
172 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
173 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
174 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
175 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
176 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
177 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
178 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
179 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
180 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
181 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
182 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
183 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
184 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
185 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
186 2919395869 Microbacterium resistens 2980 Isolate Unclassified
187 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
188 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
189 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
190 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
191 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
192 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
193 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
194 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
195 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
196 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
197 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
198 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
199 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
200 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
201 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
202 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
203 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
204 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
205 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
206 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
207 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
208 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
209 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
210 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
211 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
212 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
213 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
214 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
215 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
216 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
217 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
218 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
219 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
220 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
221 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
222 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
223 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
224 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
225 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
226 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
227 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
228 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
229 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
230 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
231 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
232 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
233 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
234 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
235 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
236 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
237 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
238 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
239 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
240 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
241 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
242 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
243 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
244 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
245 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
246 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
247 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
248 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
249 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
250 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
251 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
252 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
253 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
254 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
255 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
256 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
257 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
258 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
259 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
260 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
261 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
262 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
263 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
264 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
265 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
266 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
267 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
268 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
269 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
270 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
271 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
272 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
273 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
274 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
275 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
276 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
277 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
278 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
279 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
280 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
281 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
282 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
283 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
284 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
285 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
286 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
287 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
288 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
289 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
290 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
291 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
292 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
293 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
294 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
295 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
296 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
297 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
298 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
299 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
300 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
301 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
302 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
303 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
304 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
305 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
306 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
307 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
308 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
309 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
310 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
311 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
312 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
313 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
314 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
315 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
316 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
317 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
318 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
319 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
320 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
321 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
322 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
323 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
324 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
325 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
326 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
327 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
328 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
329 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
330 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
331 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
332 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
333 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
334 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
335 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
336 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
337 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
338 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
339 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
340 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
341 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
342 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
343 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
344 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
345 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
346 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
347 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
348 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
349 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
350 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
351 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
352 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
353 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
354 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
355 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
356 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
357 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
358 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
359 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
360 3004167301 Mesorhizobium loti 582 Isolate Unclassified
361 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
362 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
363 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
364 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
365 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
366 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
367 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
368 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
369 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
370 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
371 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
372 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
373 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
374 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
375 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
376 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
377 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
378 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
379 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
380 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
381 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
382 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
383 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
384 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
385 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
386 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
387 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
388 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
389 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
390 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
391 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
392 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
393 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
394 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
395 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
396 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
397 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
398 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
399 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
400 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
401 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
402 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
403 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
404 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
405 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
406 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
407 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
408 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
409 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
410 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
411 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
412 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
413 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
414 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
415 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
416 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
417 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
418 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
419 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
420 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
421 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
422 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
423 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
424 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
425 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
426 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
427 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
428 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
429 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
430 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
431 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
432 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
433 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
434 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
435 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
436 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
437 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
438 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
439 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
440 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
441 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
442 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
443 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
444 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
445 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
446 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
447 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
448 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
449 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
450 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
451 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
452 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
453 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
454 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
466 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
467 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
468 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
469 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
470 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
471 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
472 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
473 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
474 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
475 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
476 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
477 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
478 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
479 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
480 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
481 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
482 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
483 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
484 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
485 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
486 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
487 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
488 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
489 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
490 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
491 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
492 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
493 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
494 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
495 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
496 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
497 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
498 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
499 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
500 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
501 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
502 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
503 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
504 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
505 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
506 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
507 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
508 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
509 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
510 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
511 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
512 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
513 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
514 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
515 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
516 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
517 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
518 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
519 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
520 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
521 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
522 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
523 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
524 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
525 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
526 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
527 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
528 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
529 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
530 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
531 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
532 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
533 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
534 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
535 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
536 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
537 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
538 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
539 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
540 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
541 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
542 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
543 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
544 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
545 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
546 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
547 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
548 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
549 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
550 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
551 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
552 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
553 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
554 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
555 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
556 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
557 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
558 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
559 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
560 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
561 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
562 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
563 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
564 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
565 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
566 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
567 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
568 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
569 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
570 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
571 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
572 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
573 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
574 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
575 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
576 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
577 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
578 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
579 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
580 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
581 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
582 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
583 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
584 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
585 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
586 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
587 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
588 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
589 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
590 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
591 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
592 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
593 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
594 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
595 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
596 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
597 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
598 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
599 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
600 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
601 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
602 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
603 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
604 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
605 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
606 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
607 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
608 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
609 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
610 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
611 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
612 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
613 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
614 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
615 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
616 3300060243 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 1R_CW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
617 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
618 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
619 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
620 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
621 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
622 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
623 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
624 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
625 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
626 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
627 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
628 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
629 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
630 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
631 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
632 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
633 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
634 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
635 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
636 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
637 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
638 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 46.31
Metatranscriptomes 2.9
Isolates 50.79

Biome Distribution

Category Percentage (%)
Aerial Root 0.66
Bulb 0
Endosphere 8.44
Nodule 37.86
Rhizoplane 4.09
Rhizosphere 31.13
Stem 0
Stem Tuber 0
Unclassified 17.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_2580795 2162886007 Bacteria 31968
2 JGI24740J21852_10001288 3300001979 Bacteria 11388
3 JGI25155J39150_1000020 3300002704 Bacteria 152963
4 JGI25156J39149_1000021 3300002705 Bacteria 152968
5 JGI25162J39368_1000373 3300002737 Bacteria 38083
6 JGI25162J39368_1001499 3300002737 Bacteria 12175
7 JGI25154J39366_1000039 3300002738 Bacteria 152972
8 JGI25157J39369_1000019 3300002741 Bacteria 176591
9 JGI25159J45721_1001592 3300002987 Bacteria 9277
10 JGI25151J46595_10009208 3300003187 Bacteria 4695
11 JGI25151J46595_10039803 3300003187 Bacteria 1730
12 JGI25165J46597_1000010 3300003214 Bacteria 442113
13 JGI25165J46597_1000018 3300003214 Bacteria 374701
14 JGI25165J46597_1001267 3300003214 Bacteria 14802
15 JGI25165J46597_1001278 3300003214 Bacteria 14676
16 JGI25153J46596_10001443 3300003215 Bacteria 14226
17 rootH2_10058422 3300003320 Bacteria 3113
18 Ga0006562J51391_1014631 3300003578 Bacteria 2528
19 Ga0055526_1000318 3300003771 Bacteria 40039
20 Ga0055524_1018205 3300003775 Bacteria 2447
21 Ga0055528_1006655 3300003790 Bacteria 5215
22 Ga0055531_10004390 3300003794 Bacteria 8608
23 Ga0058692_1000942 3300003856 Bacteria 11449
24 Ga0058692_1001612 3300003856 Bacteria 8099
25 Ga0065165_1000306 3300005262 Bacteria 81181
26 Ga0065704_10070331 3300005289 Bacteria 32035
27 Ga0070690_100040838 3300005330 Bacteria 2935
28 Ga0070666_10000622 3300005335 Bacteria 21262
29 Ga0070668_100238305 3300005347 Bacteria 1506
30 Ga0070671_100030521 3300005355 Bacteria 4447
31 Ga0070667_100075459 3300005367 Bacteria 2878
32 Ga0070709_10011432 3300005434 Bacteria 4949
33 Ga0070709_10025965 3300005434 Bacteria 3466
34 Ga0070714_100001008 3300005435 Bacteria 20098
35 Ga0070714_100017192 3300005435 Bacteria 5856
36 Ga0070713_100001747 3300005436 Bacteria 13998
37 Ga0070681_10008322 3300005458 Bacteria 10161
38 Ga0070679_100125932 3300005530 Bacteria 2544
39 Ga0070695_100043780 3300005545 Bacteria 2848
40 Ga0070665_100017368 3300005548 Bacteria 7222
41 Ga0068856_100010718 3300005614 Bacteria 8906
42 Ga0068856_100015233 3300005614 Bacteria 7430
43 Ga0068856_100070780 3300005614 Bacteria 3451
44 Ga0068852_100332006 3300005616 Bacteria 1480
45 Ga0068863_100037723 3300005841 Bacteria 4599
46 Ga0068858_100059814 3300005842 Bacteria 3521
47 Ga0068860_100033763 3300005843 Bacteria 4909
48 Ga0070717_10002453 3300006028 Bacteria 13094
49 Ga0075365_10127278 3300006038 Bacteria 1761
50 Ga0070715_10006628 3300006163 Bacteria 3950
51 Ga0070716_100009004 3300006173 Bacteria 4966
52 Ga0070712_100004791 3300006175 Bacteria 8366
53 Ga0075367_10021777 3300006178 Bacteria 3587
54 Ga0075367_10040923 3300006178 Bacteria 2707
55 Ga0075369_10028588 3300006186 Bacteria 2337
56 Ga0097621_100011551 3300006237 Bacteria 6508
57 Ga0068871_100003420 3300006358 Bacteria 10914
58 Ga0068871_100258245 3300006358 Bacteria 1519
59 Ga0075428_100010434 3300006844 Bacteria 10317
60 Ga0075430_100049844 3300006846 Bacteria 3533
61 Ga0075434_100034612 3300006871 Bacteria 4990
62 Ga0068865_100002743 3300006881 Bacteria 10463
63 Ga0079104_1016597 3300006946 Bacteria 2147
64 Ga0099826_10010743 3300006948 Bacteria 6869
65 Ga0075435_100184766 3300007076 Bacteria 1763
66 Ga0099795_10010508 3300007788 Bacteria 2729
67 Ga0105240_10011499 3300009093 Bacteria 12321
68 Ga0105240_10016435 3300009093 Bacteria 10019
69 Ga0111539_10079634 3300009094 Bacteria 3854
70 Ga0105245_10056862 3300009098 Bacteria 3517
71 Ga0105245_10270429 3300009098 Bacteria 1657
72 Ga0105247_10079911 3300009101 Bacteria 2059
73 Ga0105242_10009930 3300009176 Bacteria 7289
74 Ga0105237_10008749 3300009545 Bacteria 10924
75 Ga0105237_10219805 3300009545 Bacteria 1900
76 Ga0105239_10000037 3300010375 Bacteria 206779
77 Ga0105239_10069104 3300010375 Bacteria 3881
78 Ga0105239_10473745 3300010375 Bacteria 1422
79 Ga0105246_10163295 3300011119 Bacteria 1699
80 Ga0157371_10000187 3300013102 Bacteria 91186
81 Ga0157370_10000037 3300013104 Bacteria 136803
82 Ga0157370_10005220 3300013104 Bacteria 14636
83 Ga0157374_10001449 3300013296 Bacteria 20059
84 Ga0157378_10018300 3300013297 Bacteria 6149
85 Ga0163162_10073816 3300013306 Bacteria 3468
86 Ga0163162_10110154 3300013306 Bacteria 2851
87 Ga0214542_1000082 3300021321 Bacteria 120825
88 Ga0214542_1017248 3300021321 Bacteria 6611
89 Ga0214543_1000005 3300021327 Bacteria 454523
90 Ga0214543_1000075 3300021327 Bacteria 120861
91 Ga0213872_10018885 3300021361 Bacteria 3177
92 Ga0224712_10070516 3300022467 Bacteria 1417
93 Ga0228711_1000045 3300022739 Bacteria 85435
94 Ga0228710_1000036 3300022740 Bacteria 91904
95 Ga0209435_100025 3300025206 Bacteria 198776
96 Ga0209672_103199 3300025228 Bacteria 3495
97 Ga0209437_100022 3300025233 Bacteria 625694
98 Ga0209437_100040 3300025233 Bacteria 448096
99 Ga0209646_1000083 3300025246 Bacteria 198777
100 Ga0209026_1000078 3300025250 Bacteria 198777
101 Ga0209677_101757 3300025253 Bacteria 8993
102 Ga0209148_1007907 3300025254 Bacteria 2172
103 Ga0209759_1000060 3300025256 Bacteria 198777
104 Ga0209129_1012688 3300025258 Bacteria 1910
105 Ga0209233_1000031 3300025261 Bacteria 624646
106 Ga0209233_1000044 3300025261 Bacteria 489783
107 Ga0209233_1000051 3300025261 Bacteria 447617
108 Ga0209233_1000146 3300025261 Bacteria 187269
109 Ga0209673_1018152 3300025273 Bacteria 2569
110 Ga0209130_1000111 3300025284 Bacteria 131855
111 Ga0209676_1001724 3300025292 Bacteria 18788
112 Ga0209025_1000276 3300025294 Bacteria 118715
113 Ga0209025_1000689 3300025294 Bacteria 57945
114 Ga0209025_1001992 3300025294 Bacteria 23425
115 Ga0209564_1000054 3300025295 Bacteria 350653
116 Ga0209758_1000236 3300025297 Bacteria 115906
117 Ga0209758_1009501 3300025297 Bacteria 6027
118 Ga0209256_1000128 3300025299 Bacteria 163833
119 Ga0207426_1000601 3300025302 Bacteria 47086
120 Ga0209051_1002420 3300025303 Bacteria 13413
121 Ga0209051_1009735 3300025303 Bacteria 4924
122 Ga0209257_1002824 3300025304 Bacteria 16317
123 Ga0207692_10014525 3300025898 Bacteria 3443
124 Ga0207699_10002648 3300025906 Bacteria 8449
125 Ga0207699_10077974 3300025906 Bacteria 2046
126 Ga0207707_10006451 3300025912 Bacteria 10248
127 Ga0207695_10000120 3300025913 Bacteria 234247
128 Ga0207695_10035641 3300025913 Bacteria 5391
129 Ga0207671_10001724 3300025914 Bacteria 24636
130 Ga0207693_10000596 3300025915 Bacteria 32329
131 Ga0207694_10026633 3300025924 Bacteria 4401
132 Ga0207687_10023525 3300025927 Bacteria 4108
133 Ga0207644_10006617 3300025931 Bacteria 7551
134 Ga0207665_10004118 3300025939 Bacteria 9700
135 Ga0207711_10052741 3300025941 Bacteria 3487
136 Ga0207640_10087200 3300025981 Bacteria 2151
137 Ga0207677_10035890 3300026023 Bacteria 3224
138 Ga0207702_10186215 3300026078 Bacteria 1915
139 Ga0209281_1000129 3300027111 Bacteria 194490
140 Ga0209281_1000178 3300027111 Bacteria 148152
141 Ga0209281_1000417 3300027111 Bacteria 64228
142 Ga0209371_1000901 3300027312 Bacteria 23610
143 Ga0209371_1001677 3300027312 Bacteria 14129
144 Ga0209282_1000023 3300027666 Bacteria 173309
145 Ga0209813_10000800 3300027866 Bacteria 7134
146 Ga0268266_10024005 3300028379 Bacteria 5189
147 Ga0268266_10314792 3300028379 Bacteria 1463
148 Ga0268264_10264861 3300028381 Bacteria 1603
149 Ga0307517_10099036 3300028786 Bacteria 2315
150 Ga0268256_1016586 3300030500 Bacteria 2104
151 Ga0265760_10018915 3300031090 Bacteria 1985
152 Ga0265327_10004841 3300031251 Bacteria 11669
153 Ga0307516_10003800 3300031730 Bacteria 19176
154 Ga0307516_10069005 3300031730 Bacteria 3401
155 Ga0307406_10124074 3300031901 Bacteria 1801
156 Ga0307412_10035923 3300031911 Bacteria 3170
157 Ga0315914_1000016 3300031967 Bacteria 126814
158 Ga0307416_100190899 3300032002 Bacteria 1932
159 Ga0307414_10000835 3300032004 Bacteria 15717
160 Ga0307414_10029917 3300032004 Bacteria 3551
161 Ga0307414_10045992 3300032004 Bacteria 2992
162 Ga0307510_10043890 3300033180 Bacteria 4852
163 Ga0315913_1000027 3300033430 Bacteria 83484
164 Ga0315915_1000007 3300033464 Bacteria 319225
165 Ga0373930_0002416 3300034816 Bacteria 2886
166 Ga0373936_0022850 3300035113 Bacteria 2435
167 Ga0373945_0084829 3300035116 Bacteria 1219
168 Ga0373927_0000075 3300035695 Bacteria 72822
169 Ga0373927_0035962 3300035695 Bacteria 3222
170 Ga0373937_0188941 3300036401 Bacteria 1935
171 Ga0395899_0072857 3300037312 Bacteria 2513
172 Ga0395900_0000679 3300037418 Bacteria 45322
173 Ga0395900_0046509 3300037418 Bacteria 4469
174 Ga0395898_0004592 3300037466 Bacteria 15070
175 Ga0395905_0000231 3300037471 Bacteria 84714
176 Ga0395901_0000388 3300038443 Bacteria 52630
177 Ga0400483_087805 3300039062 Bacteria 3595
178 Ga0400483_173215 3300039062 Bacteria 3630
179 Ga0436365_1838724 3300039437 Bacteria 1399
180 Ga0436360_1079675 3300039438 Bacteria 1830
181 Ga0436361_0039261 3300039447 Bacteria 16265
182 Ga0436361_0063582 3300039447 Bacteria 14694
183 Ga0436361_0207115 3300039447 Bacteria 4683
184 Ga0436361_0683750 3300039447 Bacteria 5154
185 Ga0436363_1454092 3300039450 Bacteria 10968
186 Ga0436362_0498094 3300039453 Bacteria 4599
187 Ga0451787_359602 3300041441 Bacteria 5493
188 Ga0451849_1483235 3300041505 Bacteria 1688
189 Ga0451843_0812862 3300041509 Bacteria 1703
190 Ga0451853_1095662 3300041512 Bacteria 7243
191 Ga0439445_0000112 3300042004 Bacteria 13658
192 Ga0439445_0012489 3300042004 Bacteria 2043
193 Ga0439449_0016803 3300042007 Bacteria 2749
194 Ga0466969_0018571 3300044656 Bacteria 3621
195 Ga0466969_0040337 3300044656 Bacteria 2339
196 Ga0466963_0017381 3300044694 Bacteria 4484
197 Ga0466964_0088528 3300044706 Bacteria 1343
198 Ga0466968_0000165 3300044735 Bacteria 20361
199 Ga0466970_0001422 3300044765 Bacteria 11577
200 Ga0466970_0107818 3300044765 Bacteria 1520
201 Ga0466959_0125721 3300045049 Bacteria 1820
202 Ga0466959_0271927 3300045049 Bacteria 1164
203 Ga0451576_0000661 3300045051 Bacteria 71055
204 Ga0495629_0110840 3300046459 Bacteria 1913
205 Ga0495638_0015869 3300046460 Bacteria 5047
206 Ga0495638_0141015 3300046460 Bacteria 1407
207 Ga0495580_0000695 3300046472 Bacteria 28722
208 Ga0495596_0001347 3300046500 Bacteria 14148
209 Ga0495607_0007077 3300046501 Bacteria 7802
210 Ga0495606_0008877 3300046507 Bacteria 8611
211 Ga0495610_0003237 3300046512 Bacteria 12879
212 Ga0495610_0031266 3300046512 Bacteria 2779
213 Ga0495620_0006705 3300046515 Bacteria 6304
214 Ga0495628_0243144 3300046516 Bacteria 1346
215 Ga0495631_0026454 3300046518 Bacteria 2664
216 Ga0495632_0018391 3300046519 Bacteria 3836
217 Ga0495643_0010188 3300046522 Bacteria 5794
218 Ga0495643_0013525 3300046522 Bacteria 4879
219 Ga0495643_0091006 3300046522 Bacteria 1573
220 Ga0495648_0027554 3300046524 Bacteria 3801
221 Ga0495654_0000122 3300046530 Bacteria 86717
222 Ga0495654_0023401 3300046530 Bacteria 3200
223 Ga0495597_0002416 3300046542 Bacteria 11881
224 Ga0495633_0098428 3300046558 Bacteria 1358
225 Ga0495625_0055366 3300046660 Bacteria 2829
226 Ga0495647_0058696 3300046681 Bacteria 1513
227 Ga0495658_0099448 3300046683 Bacteria 1734
228 Ga0495649_0012414 3300046694 Bacteria 4953
229 Ga0495600_0087580 3300046809 Bacteria 2031
230 Ga0495660_0044300 3300046810 Bacteria 2448
231 Ga0495604_0012850 3300047317 Bacteria 6667
232 Ga0495674_0030438 3300047319 Bacteria 4908
233 Ga0495686_0000476 3300047472 Bacteria 59699
234 Ga0495626_0001397 3300048091 Bacteria 19346
235 Ga0496100_0001446 3300048903 Bacteria 11630
236 Ga0496100_0088339 3300048903 Bacteria 2109
237 Ga0496101_0025917 3300048904 Bacteria 4072
238 Ga0496101_0066815 3300048904 Bacteria 2624
239 Ga0496102_0020871 3300048905 Bacteria 5790
240 Ga0496102_0024468 3300048905 Bacteria 5368
241 Ga0496102_0196891 3300048905 Bacteria 1899
242 Ga0496103_0006294 3300048906 Bacteria 7094
243 Ga0496103_0113023 3300048906 Bacteria 1726
244 Ga0496104_0095399 3300048907 Bacteria 2845
245 Ga0496104_0329915 3300048907 Bacteria 1439
246 Ga0496105_0091074 3300048908 Bacteria 2518
247 Ga0496106_0044358 3300048909 Bacteria 3338
248 Ga0496107_0009842 3300048910 Bacteria 6631
249 Ga0496108_0059809 3300048911 Bacteria 3204
250 Ga0496109_0051597 3300048912 Bacteria 3746
251 Ga0496110_0003530 3300048913 Bacteria 12009
252 Ga0496111_0001899 3300048914 Bacteria 12367
253 Ga0496111_0023569 3300048914 Bacteria 4323
254 Ga0496113_0004083 3300048916 Bacteria 8895
255 Ga0496113_0024593 3300048916 Bacteria 4283
256 Ga0496113_0041354 3300048916 Bacteria 3401
257 Ga0496114_0185566 3300048917 Bacteria 1817
258 Ga0496115_0021615 3300048918 Bacteria 4972
259 Ga0496116_0020083 3300048919 Bacteria 5086
260 Ga0496117_0000066 3300048920 Bacteria 253534
261 Ga0496117_0001348 3300048920 Bacteria 36026
262 Ga0496117_0003489 3300048920 Bacteria 18239
263 Ga0496117_0011948 3300048920 Bacteria 7717
264 Ga0496117_0015823 3300048920 Bacteria 6401
265 Ga0496117_0095190 3300048920 Bacteria 1904
266 Ga0496118_0002630 3300048921 Bacteria 23808
267 Ga0496118_0007705 3300048921 Bacteria 11319
268 Ga0496118_0085193 3300048921 Bacteria 2202
269 Ga0496118_0124572 3300048921 Bacteria 1671
270 Ga0496119_0006308 3300048922 Bacteria 11043
271 Ga0496119_0011243 3300048922 Bacteria 7445
272 Ga0496120_0000100 3300048923 Bacteria 143064
273 Ga0496120_0030291 3300048923 Bacteria 3291
274 Ga0496120_0058665 3300048923 Bacteria 2161
275 Ga0496121_0000066 3300048924 Bacteria 267065
276 Ga0496121_0000143 3300048924 Bacteria 159577
277 Ga0496121_0000567 3300048924 Bacteria 69706
278 Ga0496121_0000759 3300048924 Bacteria 59261
279 Ga0496121_0006947 3300048924 Bacteria 13794
280 Ga0496121_0070275 3300048924 Bacteria 2821
281 Ga0496122_0000057 3300048925 Bacteria 253452
282 Ga0496122_0000113 3300048925 Bacteria 186506
283 Ga0496122_0009001 3300048925 Bacteria 10611
284 Ga0496122_0015477 3300048925 Bacteria 7291
285 Ga0496122_0016145 3300048925 Bacteria 7093
286 Ga0496122_0079100 3300048925 Bacteria 2299
287 Ga0496123_0000096 3300048926 Bacteria 173914
288 Ga0496123_0000381 3300048926 Bacteria 83309
289 Ga0496123_0001243 3300048926 Bacteria 36926
290 Ga0496123_0009706 3300048926 Bacteria 8626
291 Ga0496123_0017132 3300048926 Bacteria 5846
292 Ga0496123_0078281 3300048926 Bacteria 2026
293 Ga0496123_0137415 3300048926 Bacteria 1342
294 Ga0496124_0000094 3300048927 Bacteria 189147
295 Ga0496124_0001939 3300048927 Bacteria 28328
296 Ga0496124_0053251 3300048927 Bacteria 3432
297 Ga0496124_0110627 3300048927 Bacteria 2211
298 Ga0496124_0110629 3300048927 Bacteria 2211
299 Ga0496124_0114867 3300048927 Bacteria 2161
300 Ga0496124_0148349 3300048927 Bacteria 1843
301 Ga0496125_0000206 3300048928 Bacteria 123625
302 Ga0496125_0000374 3300048928 Bacteria 83816
303 Ga0496125_0005688 3300048928 Bacteria 13748
304 Ga0496125_0007359 3300048928 Bacteria 11722
305 Ga0496125_0130356 3300048928 Bacteria 1771
306 Ga0496125_0171117 3300048928 Bacteria 1460
307 Ga0496126_0000051 3300048929 Bacteria 313169
308 Ga0496126_0000069 3300048929 Bacteria 246935
309 Ga0496126_0013950 3300048929 Bacteria 8151
310 Ga0496126_0035531 3300048929 Bacteria 4670
311 Ga0496126_0040215 3300048929 Bacteria 4335
312 Ga0496126_0206502 3300048929 Bacteria 1655
313 Ga0501031_0122308 3300049568 Bacteria 1700
314 Ga0501033_0044787 3300049570 Bacteria 3293
315 Ga0501034_0001454 3300049571 Bacteria 31350
316 Ga0501034_0024740 3300049571 Bacteria 6108
317 Ga0501034_0128576 3300049571 Bacteria 2517
318 Ga0501037_0048309 3300049573 Bacteria 3119
319 Ga0501043_0002226 3300049579 Bacteria 16524
320 Ga0501043_0264199 3300049579 Bacteria 1323
321 Ga0501047_0097241 3300049581 Bacteria 2822
322 Ga0501070_0004925 3300049586 Bacteria 11395
323 Ga0501073_0044212 3300049589 Bacteria 3139
324 Ga0501080_0000092 3300049742 Bacteria 60619
325 Ga0501083_0045634 3300049744 Bacteria 2964
326 Ga0501280_001046 3300049776 Bacteria 5662
327 Ga0501280_002353 3300049776 Bacteria 3182
328 Ga0501035_0003599 3300049822 Bacteria 14796
329 nmdc:mga03683_20662_c1 3300050489 Bacteria 2530
330 nmdc:mga03n38_10720_c1 3300050490 Bacteria 3386
331 nmdc:mga00v17_17_c1 3300050491 Bacteria 121949
332 nmdc:mga00v17_21284_c1 3300050491 Bacteria 3727
333 nmdc:mga00v17_36_c1 3300050491 Bacteria 85171
334 nmdc:mga0yw44_168650_c1 3300050492 Bacteria 1436
335 nmdc:mga0k408_8787_c1 3300050493 Bacteria 5436
336 nmdc:mga04h51_1306_c1 3300050495 Bacteria 5744
337 nmdc:mga08y16_20634_c1 3300050511 Bacteria 6953
338 nmdc:mga0n895_35503_c1 3300050512 Bacteria 4807
339 nmdc:mga0rr50_16395_c1 3300050513 Bacteria 4920
340 nmdc:mga0sz30_121_c1 3300050516 Bacteria 29087
341 Ga0495612_0027572 3300053078 Bacteria 2285
342 Ga0500560_003804 3300053107 Bacteria 3109
343 Ga0500618_000549 3300053125 Bacteria 23326
344 Ga0500618_000654 3300053125 Bacteria 20609
345 Ga0500658_0002721 3300053134 Bacteria 6795
346 Ga0500561_0000278 3300053137 Bacteria 8944
347 Ga0500624_000443 3300053157 Bacteria 12488
348 Ga0500634_0003280 3300053161 Bacteria 7149
349 Ga0500634_0052512 3300053161 Bacteria 2189
350 Ga0500636_0000201 3300053177 Bacteria 32360
351 Ga0500636_0000760 3300053177 Bacteria 17392
352 Ga0500596_005455 3300053735 Bacteria 2237
353 Ga0501084_0024613 3300054114 Bacteria 5024
354 Ga0587084_000344 3300059477 Bacteria 3453
355 Ga0587066_002008 3300059490 Bacteria 2170
356 Ga0587077_002422 3300059493 Bacteria 2207
357 Ga0587083_0005061 3300059505 Bacteria 1881
358 Ga0587090_000202 3300059510 Bacteria 4293
359 Ga0587091_000705 3300059511 Bacteria 3129
360 Ga0587101_006045 3300059623 Bacteria 1370
361 Ga0587109_002461 3300059624 Bacteria 2351
362 Ga0587115_002916 3300059626 Bacteria 1751
363 Ga0587062_000260 3300059639 Bacteria 3311
364 Ga0587068_003660 3300059641 Bacteria 1984
365 Ga0587069_001471 3300059642 Bacteria 2173
366 Ga0587072_000429 3300059643 Bacteria 4187
367 Ga0587076_004527 3300059645 Bacteria 1740
368 Ga0587102_004383 3300059649 Bacteria 1202
369 Ga0587108_001302 3300059653 Bacteria 1509
370 Ga0587060_001414 3300060243 Bacteria 1565
371 Ga0587111_0001096 3300060346 Bacteria 3070
372 Ga0587111_0004713 3300060346 Bacteria 2054
373 Ga0466962_0115905 3300061719 Bacteria 1291

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2899275550 2899278033 305
2 3300044706 Ga0466964_0088528 Ga0466964_0088528_314_1327 307
3 3300037312 Ga0395899_0072857 Ga0395899_0072857_438_1472 319
4 3300049573 Ga0501037_0048309 Ga0501037_0048309_1194_2195 326
5 3300049579 Ga0501043_0002226 Ga0501043_0002226_9535_10536 326
6 3300049581 Ga0501047_0097241 Ga0501047_0097241_1026_2027 326
7 3300049589 Ga0501073_0044212 Ga0501073_0044212_629_1630 326
8 3300049744 Ga0501083_0045634 Ga0501083_0045634_249_1250 326
9 3300054114 Ga0501084_0024613 Ga0501084_0024613_1549_2550 326
10 3300049586 Ga0501070_0004925 Ga0501070_0004925_3121_4137 331
11 3300049742 Ga0501080_0000092 Ga0501080_0000092_2824_3840 331
12 3300044765 Ga0466970_0107818 Ga0466970_0107818_244_1311 332
13 3300045049 Ga0466959_0271927 Ga0466959_0271927_17_1084 332
14 3300031251 Ga0265327_10004841 Ga0265327_100048413 334
15 3300048920 Ga0496117_0015823 Ga0496117_0015823_2511_3557 334
16 3300048924 Ga0496121_0070275 Ga0496121_0070275_1546_2592 334
17 3300048925 Ga0496122_0009001 Ga0496122_0009001_6350_7396 334
18 3300048926 Ga0496123_0078281 Ga0496123_0078281_474_1520 334
19 iso_pu_bacteria 2919395869 2919398556 335
20 3300005435 Ga0070714_100001008 Ga0070714_1000010085 336
21 3300005436 Ga0070713_100001747 Ga0070713_10000174712 336
22 3300005614 Ga0068856_100010718 Ga0068856_1000107185 336
23 3300006028 Ga0070717_10002453 Ga0070717_100024533 336
24 3300022467 Ga0224712_10070516 Ga0224712_100705161 336
25 3300039450 Ga0436363_1454092 Ga0436363_1454092_9599_10657 336
26 3300039453 Ga0436362_0498094 Ga0436362_0498094_1438_2496 336
27 3300048905 Ga0496102_0196891 Ga0496102_0196891_353_1423 336
28 3300048907 Ga0496104_0329915 Ga0496104_0329915_54_1124 336
29 3300006844 Ga0075428_100010434 Ga0075428_1000104347 337
30 3300006846 Ga0075430_100049844 Ga0075430_1000498442 337
31 3300009094 Ga0111539_10079634 Ga0111539_100796344 337
32 3300049571 Ga0501034_0024740 Ga0501034_0024740_2439_3470 337
33 3300049571 Ga0501034_0128576 Ga0501034_0128576_1208_2239 337
34 3300050511 nmdc:mga08y16_20634_c1 nmdc:mga08y16_20634_c1_62_1120 337
35 iso_pu_bacteria 2899259804 2899261455 337
36 iso_pu_bacteria 3004167301 3004171991 337
37 3300048928 Ga0496125_0171117 Ga0496125_0171117_162_1214 338
38 3300005330 Ga0070690_100040838 Ga0070690_1000408382 339
39 3300005335 Ga0070666_10000622 Ga0070666_100006224 339
40 3300005355 Ga0070671_100030521 Ga0070671_1000305215 339
41 3300005367 Ga0070667_100075459 Ga0070667_1000754594 339
42 3300005434 Ga0070709_10011432 Ga0070709_100114327 339
43 3300005434 Ga0070709_10025965 Ga0070709_100259654 339
44 3300005435 Ga0070714_100017192 Ga0070714_1000171922 339
45 3300005458 Ga0070681_10008322 Ga0070681_100083224 339
46 3300005530 Ga0070679_100125932 Ga0070679_1001259321 339
47 3300005545 Ga0070695_100043780 Ga0070695_1000437802 339
48 3300005614 Ga0068856_100015233 Ga0068856_1000152338 339
49 3300005841 Ga0068863_100037723 Ga0068863_1000377236 339
50 3300005842 Ga0068858_100059814 Ga0068858_1000598143 339
51 3300005843 Ga0068860_100033763 Ga0068860_1000337634 339
52 3300006163 Ga0070715_10006628 Ga0070715_100066284 339
53 3300006173 Ga0070716_100009004 Ga0070716_1000090045 339
54 3300006175 Ga0070712_100004791 Ga0070712_1000047914 339
55 3300006237 Ga0097621_100011551 Ga0097621_1000115513 339
56 3300006358 Ga0068871_100003420 Ga0068871_1000034207 339
57 3300006881 Ga0068865_100002743 Ga0068865_1000027433 339
58 3300009093 Ga0105240_10011499 Ga0105240_100114993 339
59 3300009098 Ga0105245_10056862 Ga0105245_100568621 339
60 3300009101 Ga0105247_10079911 Ga0105247_100799113 339
61 3300009176 Ga0105242_10009930 Ga0105242_100099304 339
62 3300013296 Ga0157374_10001449 Ga0157374_100014496 339
63 3300013297 Ga0157378_10018300 Ga0157378_100183006 339
64 3300013306 Ga0163162_10073816 Ga0163162_100738162 339
65 3300025284 Ga0209130_1000111 Ga0209130_100011128 339
66 3300025294 Ga0209025_1001992 Ga0209025_100199211 339
67 3300025898 Ga0207692_10014525 Ga0207692_100145254 339
68 3300025906 Ga0207699_10002648 Ga0207699_100026488 339
69 3300025906 Ga0207699_10077974 Ga0207699_100779742 339
70 3300025912 Ga0207707_10006451 Ga0207707_100064514 339
71 3300025915 Ga0207693_10000596 Ga0207693_1000059612 339
72 3300025927 Ga0207687_10023525 Ga0207687_100235253 339
73 3300025931 Ga0207644_10006617 Ga0207644_100066174 339
74 3300025939 Ga0207665_10004118 Ga0207665_100041188 339
75 3300026023 Ga0207677_10035890 Ga0207677_100358903 339
76 3300028379 Ga0268266_10314792 Ga0268266_103147922 339
77 3300028381 Ga0268264_10264861 Ga0268264_102648612 339
78 3300031090 Ga0265760_10018915 Ga0265760_100189151 339
79 3300035116 Ga0373945_0084829 Ga0373945_0084829_83_1153 339
80 3300035695 Ga0373927_0035962 Ga0373927_0035962_1773_2843 339
81 3300042007 Ga0439449_0016803 Ga0439449_0016803_1696_2715 339
82 3300044656 Ga0466969_0018571 Ga0466969_0018571_2299_3372 339
83 3300044656 Ga0466969_0040337 Ga0466969_0040337_627_1694 339
84 3300045049 Ga0466959_0125721 Ga0466959_0125721_606_1679 339
85 3300046472 Ga0495580_0000695 Ga0495580_0000695_23410_24480 339
86 3300046516 Ga0495628_0243144 Ga0495628_0243144_44_1114 339
87 3300046681 Ga0495647_0058696 Ga0495647_0058696_320_1390 339
88 3300047319 Ga0495674_0030438 Ga0495674_0030438_814_1884 339
89 3300048903 Ga0496100_0088339 Ga0496100_0088339_106_1176 339
90 3300048904 Ga0496101_0025917 Ga0496101_0025917_834_1904 339
91 3300048905 Ga0496102_0020871 Ga0496102_0020871_810_1880 339
92 3300048906 Ga0496103_0113023 Ga0496103_0113023_99_1169 339
93 3300048907 Ga0496104_0095399 Ga0496104_0095399_1208_2278 339
94 3300048908 Ga0496105_0091074 Ga0496105_0091074_1295_2365 339
95 3300048909 Ga0496106_0044358 Ga0496106_0044358_2182_3252 339
96 3300048910 Ga0496107_0009842 Ga0496107_0009842_5367_6437 339
97 3300048911 Ga0496108_0059809 Ga0496108_0059809_513_1583 339
98 3300048912 Ga0496109_0051597 Ga0496109_0051597_452_1522 339
99 3300048913 Ga0496110_0003530 Ga0496110_0003530_5473_6543 339
100 3300048914 Ga0496111_0023569 Ga0496111_0023569_1671_2741 339
101 3300048916 Ga0496113_0004083 Ga0496113_0004083_1471_2541 339
102 3300048917 Ga0496114_0185566 Ga0496114_0185566_224_1294 339
103 3300048918 Ga0496115_0021615 Ga0496115_0021615_783_1853 339
104 3300053078 Ga0495612_0027572 Ga0495612_0027572_95_1174 339
105 3300009545 Ga0105237_10219805 Ga0105237_102198052 340
106 3300049776 Ga0501280_002353 Ga0501280_002353_1943_2974 341
107 3300053177 Ga0500636_0000201 Ga0500636_0000201_4634_5677 341
108 iso_pu_bacteria 2511231221 2512037234 341
109 iso_pu_bacteria 2889914905 2889919247 341
110 iso_pu_bacteria 2958071322 2958076710 341
111 iso_pu_bacteria 8018150411 8018153749 341
112 iso_pu_bacteria 8054002106 8054008213 341
113 iso_pu_bacteria 2995392953 2995393704 342
114 3300045051 Ga0451576_0000661 Ga0451576_0000661_62055_63086 343
115 iso_pu_bacteria 2537561587 2537875329 343
116 iso_pu_bacteria 2537561587 2537876904 343
117 iso_pu_bacteria 2554235003 2554244951 343
118 iso_pu_bacteria 2558860242 2559297216 343
119 iso_pu_bacteria 2599185210 2599605165 343
120 iso_pu_bacteria 2599185236 2599720761 343
121 iso_pu_bacteria 2600255279 2601611680 343
122 iso_pu_bacteria 2600255308 2601748768 343
123 iso_pu_bacteria 2643221568 2643857851 343
124 iso_pu_bacteria 2643221582 2643921758 343
125 iso_pu_bacteria 2643221693 2644519726 343
126 iso_pu_bacteria 2808606387 2808988826 343
127 iso_pu_bacteria 2818991439 2819561311 343
128 iso_pu_bacteria 2821123053 2821127227 343
129 iso_pu_bacteria 2838675328 2838679540 343
130 iso_pu_bacteria 2838714209 2838718897 343
131 iso_pu_bacteria 2838719591 2838723896 343
132 iso_pu_bacteria 2838724970 2838729218 343
133 iso_pu_bacteria 2841840854 2841844471 343
134 iso_pu_bacteria 2841846520 2841851012 343
135 iso_pu_bacteria 2841859092 2841863820 343
136 iso_pu_bacteria 2842124991 2842129917 343
137 iso_pu_bacteria 2842130223 2842134341 343
138 iso_pu_bacteria 2842140634 2842144461 343
139 iso_pu_bacteria 2842152218 2842156337 343
140 iso_pu_bacteria 2842170452 2842175143 343
141 iso_pu_bacteria 2842175837 2842180059 343
142 iso_pu_bacteria 2842187318 2842191522 343
143 iso_pu_bacteria 2842211629 2842215839 343
144 iso_pu_bacteria 2842224351 2842228661 343
145 iso_pu_bacteria 2842515876 2842520602 343
146 iso_pu_bacteria 2857531043 2857534792 343
147 iso_pu_bacteria 2899792073 2899793259 343
148 iso_pu_bacteria 2899845264 2899850506 343
149 iso_pu_bacteria 2919114240 2919118728 343
150 iso_pu_bacteria 2919166419 2919168415 343
151 iso_pu_bacteria 2919171160 2919174478 343
152 iso_pu_bacteria 2926754445 2926758251 343
153 iso_pu_bacteria 2926760298 2926764184 343
154 iso_pu_bacteria 2929138655 2929141718 343
155 iso_pu_bacteria 2933006813 2933011111 343
156 iso_pu_bacteria 2933011516 2933016349 343
157 iso_pu_bacteria 2933594066 2933599059 343
158 iso_pu_bacteria 2978969890 2978971084 343
159 iso_pu_bacteria 2979089926 2979090717 343
160 iso_pu_bacteria 2979095461 2979096240 343
161 iso_pu_bacteria 2979100975 2979101766 343
162 iso_pu_bacteria 2984509177 2984510281 343
163 iso_pu_bacteria 2984518228 2984519014 343
164 iso_pu_bacteria 2984537506 2984538630 343
165 iso_pu_bacteria 2984587000 2984588245 343
166 iso_pu_bacteria 2984601300 2984605338 343
167 iso_pu_bacteria 650716007 650843643 343
168 iso_pu_bacteria 8003570095 8003574092 343
169 iso_pu_bacteria 8055431914 8055433144 343
170 3300049568 Ga0501031_0122308 Ga0501031_0122308_578_1630 344
171 iso_pu_bacteria 2510917021 2511127310 344
172 iso_pu_bacteria 2537561587 2537873004 344
173 iso_pu_bacteria 2599185156 2599334196 344
174 iso_pu_bacteria 2643221541 2643728760 344
175 iso_pu_bacteria 2643221558 2643814778 344
176 iso_pu_bacteria 2643221582 2643916804 344
177 iso_pu_bacteria 2643221598 2643999417 344
178 iso_pu_bacteria 2643221605 2644036833 344
179 iso_pu_bacteria 2643221606 2644044775 344
180 iso_pu_bacteria 2643221671 2644390948 344
181 iso_pu_bacteria 2775507049 2776911362 344
182 iso_pu_bacteria 2791355253 2793281523 344
183 iso_pu_bacteria 2842922631 2842925521 344
184 iso_pu_bacteria 2854896431 2854899991 344
185 iso_pu_bacteria 2854916844 2854922559 344
186 iso_pu_bacteria 8054460903 8054464686 344
187 iso_pu_bacteria 8054558443 8054561503 344
188 3300021361 Ga0213872_10018885 Ga0213872_100188852 345
189 3300039437 Ga0436365_1838724 Ga0436365_1838724_44_1135 345
190 3300039447 Ga0436361_0039261 Ga0436361_0039261_8964_10016 345
191 3300039447 Ga0436361_0063582 Ga0436361_0063582_7208_8260 345
192 3300039447 Ga0436361_0207115 Ga0436361_0207115_704_1756 345
193 3300039447 Ga0436361_0683750 Ga0436361_0683750_3584_4636 345
194 3300046460 Ga0495638_0015869 Ga0495638_0015869_1996_3039 345
195 3300046501 Ga0495607_0007077 Ga0495607_0007077_4130_5185 345
196 3300046522 Ga0495643_0091006 Ga0495643_0091006_55_1110 345
197 3300046660 Ga0495625_0055366 Ga0495625_0055366_1384_2427 345
198 3300049570 Ga0501033_0044787 Ga0501033_0044787_767_1822 345
199 3300049571 Ga0501034_0001454 Ga0501034_0001454_26389_27435 345
200 3300049822 Ga0501035_0003599 Ga0501035_0003599_9508_10563 345
201 iso_pu_bacteria 2508501122 2509110300 345
202 iso_pu_bacteria 2509276019 2509377266 345
203 iso_pu_bacteria 2510065057 2510308444 345
204 iso_pu_bacteria 2510461069 2510843231 345
205 iso_pu_bacteria 2510461076 2510895156 345
206 iso_pu_bacteria 2510917022 2511131276 345
207 iso_pu_bacteria 2510917028 2511181347 345
208 iso_pu_bacteria 2511231052 2511497614 345
209 iso_pu_bacteria 2512047086 2512530054 345
210 iso_pu_bacteria 2512875026 2512969707 345
211 iso_pu_bacteria 2513237085 2513576744 345
212 iso_pu_bacteria 2513237086 2513581785 345
213 iso_pu_bacteria 2513237089 2513603138 345
214 iso_pu_bacteria 2513237091 2513619333 345
215 iso_pu_bacteria 2513237093 2513629630 345
216 iso_pu_bacteria 2513237103 2513708274 345
217 iso_pu_bacteria 2513237140 2513886128 345
218 iso_pu_bacteria 2513237143 2513901490 345
219 iso_pu_bacteria 2513237156 2513985210 345
220 iso_pu_bacteria 2513237160 2514004492 345
221 iso_pu_bacteria 2513237162 2514020222 345
222 iso_pu_bacteria 2515154107 2515612785 345
223 iso_pu_bacteria 2515154113 2515634082 345
224 iso_pu_bacteria 2515154114 2515640737 345
225 iso_pu_bacteria 2515154116 2515655572 345
226 iso_pu_bacteria 2515154134 2515744042 345
227 iso_pu_bacteria 2516143018 2516206737 345
228 iso_pu_bacteria 2516653046 2516896723 345
229 iso_pu_bacteria 2516653085 2517076866 345
230 iso_pu_bacteria 2517487022 2517565415 345
231 iso_pu_bacteria 2524023207 2524451482 345
232 iso_pu_bacteria 2551306084 2551677184 345
233 iso_pu_bacteria 2551306085 2551688336 345
234 iso_pu_bacteria 2551306086 2551694061 345
235 iso_pu_bacteria 2551306087 2551702082 345
236 iso_pu_bacteria 2551306089 2551708800 345
237 iso_pu_bacteria 2551306090 2551721297 345
238 iso_pu_bacteria 2551306090 2551722749 345
239 iso_pu_bacteria 2551306091 2551726396 345
240 iso_pu_bacteria 2551306092 2551733398 345
241 iso_pu_bacteria 2551306093 2551743756 345
242 iso_pu_bacteria 2558860100 2558862209 345
243 iso_pu_bacteria 2582581283 2585169143 345
244 iso_pu_bacteria 2582581307 2585274516 345
245 iso_pu_bacteria 2582581308 2585278376 345
246 iso_pu_bacteria 2582581315 2585324780 345
247 iso_pu_bacteria 2582581316 2585332211 345
248 iso_pu_bacteria 2582581865 2585391510 345
249 iso_pu_bacteria 2582581867 2585403087 345
250 iso_pu_bacteria 2585427526 2585527242 345
251 iso_pu_bacteria 2585427527 2585531968 345
252 iso_pu_bacteria 2585427530 2585552327 345
253 iso_pu_bacteria 2585427531 2585561872 345
254 iso_pu_bacteria 2585427590 2585823910 345
255 iso_pu_bacteria 2585427608 2585902444 345
256 iso_pu_bacteria 2585427609 2585907604 345
257 iso_pu_bacteria 2585428125 2587983026 345
258 iso_pu_bacteria 2615840626 2616307894 345
259 iso_pu_bacteria 2615840698 2616552472 345
260 iso_pu_bacteria 2617270742 2617381788 345
261 iso_pu_bacteria 2643221607 2644051131 345
262 iso_pu_bacteria 2643221636 2644202155 345
263 iso_pu_bacteria 2643221686 2644484035 345
264 iso_pu_bacteria 2643221688 2644496137 345
265 iso_pu_bacteria 2643221733 2644730482 345
266 iso_pu_bacteria 2657244999 2657683437 345
267 iso_pu_bacteria 2667528174 2671112893 345
268 iso_pu_bacteria 2690316117 2692319159 345
269 iso_pu_bacteria 2751185821 2753463845 345
270 iso_pu_bacteria 2765235942 2766066679 345
271 iso_pu_bacteria 2775507266 2778178270 345
272 iso_pu_bacteria 2791355082 2792580164 345
273 iso_pu_bacteria 2791355091 2792621564 345
274 iso_pu_bacteria 2791355092 2792627748 345
275 iso_pu_bacteria 2791355094 2792640293 345
276 iso_pu_bacteria 2802428858 2802716133 345
277 iso_pu_bacteria 2802428859 2802722829 345
278 iso_pu_bacteria 2802428860 2802729026 345
279 iso_pu_bacteria 2802428861 2802735420 345
280 iso_pu_bacteria 2802428862 2802742004 345
281 iso_pu_bacteria 2802428863 2802748454 345
282 iso_pu_bacteria 2802429268 2804754617 345
283 iso_pu_bacteria 2818991272 2819245008 345
284 iso_pu_bacteria 2818991448 2819607994 345
285 iso_pu_bacteria 2818991453 2819640212 345
286 iso_pu_bacteria 2838029111 2838032746 345
287 iso_pu_bacteria 2838686498 2838687258 345
288 iso_pu_bacteria 2838729681 2838729770 345
289 iso_pu_bacteria 2838742623 2838743215 345
290 iso_pu_bacteria 2839993093 2839996361 345
291 iso_pu_bacteria 2841851746 2841852701 345
292 iso_pu_bacteria 2842110456 2842114751 345
293 iso_pu_bacteria 2842156927 2842156960 345
294 iso_pu_bacteria 2842163707 2842167617 345
295 iso_pu_bacteria 2842180545 2842181457 345
296 iso_pu_bacteria 2842217011 2842217702 345
297 iso_pu_bacteria 2842229732 2842230491 345
298 iso_pu_bacteria 2842243621 2842244393 345
299 iso_pu_bacteria 2842257432 2842257521 345
300 iso_pu_bacteria 2842271015 2842271204 345
301 iso_pu_bacteria 2842304105 2842304830 345
302 iso_pu_bacteria 2842475841 2842479478 345
303 iso_pu_bacteria 2842482326 2842484055 345
304 iso_pu_bacteria 2842502639 2842506856 345
305 iso_pu_bacteria 2844454524 2844458624 345
306 iso_pu_bacteria 2847417321 2847422333 345
307 iso_pu_bacteria 2848992105 2848998216 345
308 iso_pu_bacteria 2850079185 2850085404 345
309 iso_pu_bacteria 2855825444 2855828445 345
310 iso_pu_bacteria 2855839649 2855843557 345
311 iso_pu_bacteria 2855872281 2855875717 345
312 iso_pu_bacteria 2857516855 2857517656 345
313 iso_pu_bacteria 2858800743 2858807179 345
314 iso_pu_bacteria 2891373044 2891374895 345
315 iso_pu_bacteria 2909042592 2909045627 345
316 iso_pu_bacteria 2913295892 2913296660 345
317 iso_pu_bacteria 2915980308 2915983830 345
318 iso_pu_bacteria 2915986958 2915990764 345
319 iso_pu_bacteria 2915993759 2915998756 345
320 iso_pu_bacteria 2916000859 2916005373 345
321 iso_pu_bacteria 2916007675 2916009952 345
322 iso_pu_bacteria 2916014648 2916021374 345
323 iso_pu_bacteria 2916021584 2916022413 345
324 iso_pu_bacteria 2916028427 2916029912 345
325 iso_pu_bacteria 2916035215 2916039780 345
326 iso_pu_bacteria 2916041962 2916047245 345
327 iso_pu_bacteria 2916048683 2916052070 345
328 iso_pu_bacteria 2916055098 2916058779 345
329 iso_pu_bacteria 2916061851 2916068435 345
330 iso_pu_bacteria 2916068649 2916074402 345
331 iso_pu_bacteria 2916076590 2916077407 345
332 iso_pu_bacteria 2919408235 2919412681 345
333 iso_pu_bacteria 2921201388 2921201614 345
334 iso_pu_bacteria 2921208531 2921215197 345
335 iso_pu_bacteria 2921237296 2921243395 345
336 iso_pu_bacteria 2921244191 2921247626 345
337 iso_pu_bacteria 2921250672 2921257038 345
338 iso_pu_bacteria 2921257292 2921263364 345
339 iso_pu_bacteria 2921263974 2921265429 345
340 iso_pu_bacteria 2921282425 2921287099 345
341 iso_pu_bacteria 2921289301 2921296071 345
342 iso_pu_bacteria 2921296804 2921301659 345
343 iso_pu_bacteria 2923556063 2923559340 345
344 iso_pu_bacteria 2924144063 2924149562 345
345 iso_pu_bacteria 2924150972 2924155433 345
346 iso_pu_bacteria 2924158325 2924158687 345
347 iso_pu_bacteria 2924165586 2924172902 345
348 iso_pu_bacteria 2924172951 2924175886 345
349 iso_pu_bacteria 2924179722 2924184955 345
350 iso_pu_bacteria 2924186466 2924188005 345
351 iso_pu_bacteria 2924193448 2924194080 345
352 iso_pu_bacteria 2924200457 2924205299 345
353 iso_pu_bacteria 2924207177 2924210503 345
354 iso_pu_bacteria 2924214083 2924220173 345
355 iso_pu_bacteria 2924221636 2924223227 345
356 iso_pu_bacteria 2924228884 2924232596 345
357 iso_pu_bacteria 2933570622 2933570639 345
358 iso_pu_bacteria 2933586486 2933591124 345
359 iso_pu_bacteria 2935901341 2935902165 345
360 iso_pu_bacteria 2936996657 2937001658 345
361 iso_pu_bacteria 2937002841 2937008904 345
362 iso_pu_bacteria 2937009748 2937014509 345
363 iso_pu_bacteria 2937016420 2937020073 345
364 iso_pu_bacteria 2937023124 2937026330 345
365 iso_pu_bacteria 2937029754 2937035150 345
366 iso_pu_bacteria 2937036028 2937038257 345
367 iso_pu_bacteria 2937042894 2937043604 345
368 iso_pu_bacteria 2937049772 2937055516 345
369 iso_pu_bacteria 2937056579 2937063213 345
370 iso_pu_bacteria 2937063883 2937065332 345
371 iso_pu_bacteria 2937071275 2937076798 345
372 iso_pu_bacteria 2937078374 2937084193 345
373 iso_pu_bacteria 2937084907 2937089739 345
374 iso_pu_bacteria 2937091812 2937096721 345
375 iso_pu_bacteria 2937098957 2937104604 345
376 iso_pu_bacteria 2937106411 2937111781 345
377 iso_pu_bacteria 2937113482 2937116951 345
378 iso_pu_bacteria 2937119839 2937120591 345
379 iso_pu_bacteria 2937126314 2937131333 345
380 iso_pu_bacteria 2957375807 2957378488 345
381 iso_pu_bacteria 2957382221 2957387768 345
382 iso_pu_bacteria 2957388812 2957393572 345
383 iso_pu_bacteria 2957395598 2957401900 345
384 iso_pu_bacteria 2957402308 2957407495 345
385 iso_pu_bacteria 2957408893 2957412320 345
386 iso_pu_bacteria 2957415311 2957422151 345
387 iso_pu_bacteria 2957422303 2957422656 345
388 iso_pu_bacteria 2957430029 2957436305 345
389 iso_pu_bacteria 2957437181 2957440008 345
390 iso_pu_bacteria 2957443900 2957444031 345
391 iso_pu_bacteria 2957450854 2957454767 345
392 iso_pu_bacteria 2957457609 2957460811 345
393 iso_pu_bacteria 2957464669 2957469664 345
394 iso_pu_bacteria 2957471148 2957476985 345
395 iso_pu_bacteria 2957478035 2957479328 345
396 iso_pu_bacteria 2957484790 2957487174 345
397 iso_pu_bacteria 2957491536 2957496362 345
398 iso_pu_bacteria 2957498199 2957500429 345
399 iso_pu_bacteria 2957505466 2957506416 345
400 iso_pu_bacteria 2960584000 2960588775 345
401 iso_pu_bacteria 2960591022 2960596621 345
402 iso_pu_bacteria 2960597568 2960602786 345
403 iso_pu_bacteria 2960603979 2960610117 345
404 iso_pu_bacteria 2960610863 2960616680 345
405 iso_pu_bacteria 2960617483 2960619717 345
406 iso_pu_bacteria 2960624210 2960629169 345
407 iso_pu_bacteria 2960631154 2960634518 345
408 iso_pu_bacteria 2960637947 2960639483 345
409 iso_pu_bacteria 2960645483 2960646820 345
410 iso_pu_bacteria 2960652885 2960657307 345
411 iso_pu_bacteria 2960660292 2960662649 345
412 iso_pu_bacteria 2960667422 2960670858 345
413 iso_pu_bacteria 2960674078 2960680680 345
414 iso_pu_bacteria 2960680706 2960683117 345
415 iso_pu_bacteria 2960687367 2960693482 345
416 iso_pu_bacteria 2960693952 2960698647 345
417 iso_pu_bacteria 2964607997 2964613496 345
418 iso_pu_bacteria 2964615318 2964621954 345
419 iso_pu_bacteria 2964621998 2964626866 345
420 iso_pu_bacteria 2964628898 2964631818 345
421 iso_pu_bacteria 2964636051 2964639428 345
422 iso_pu_bacteria 2964643177 2964649856 345
423 iso_pu_bacteria 2964649959 2964653510 345
424 iso_pu_bacteria 2964656573 2964662205 345
425 iso_pu_bacteria 2964663802 2964666673 345
426 iso_pu_bacteria 2964670856 2964671742 345
427 iso_pu_bacteria 2964678106 2964679978 345
428 iso_pu_bacteria 2964685014 2964689937 345
429 iso_pu_bacteria 2964691889 2964696798 345
430 iso_pu_bacteria 2964698721 2964703558 345
431 iso_pu_bacteria 2964705432 2964708868 345
432 iso_pu_bacteria 2964712639 2964717637 345
433 iso_pu_bacteria 2964719344 2964721059 345
434 iso_pu_bacteria 2967664464 2967670817 345
435 iso_pu_bacteria 2967671571 2967678070 345
436 iso_pu_bacteria 2967678726 2967679577 345
437 iso_pu_bacteria 2967686174 2967687806 345
438 iso_pu_bacteria 2967693043 2967696586 345
439 iso_pu_bacteria 2967699805 2967700162 345
440 iso_pu_bacteria 2967706974 2967709430 345
441 iso_pu_bacteria 2967714385 2967717157 345
442 iso_pu_bacteria 2967721400 2967728455 345
443 iso_pu_bacteria 2967728569 2967728940 345
444 iso_pu_bacteria 2967735183 2967740099 345
445 iso_pu_bacteria 2967742019 2967743277 345
446 iso_pu_bacteria 2967748971 2967755417 345
447 iso_pu_bacteria 2967755722 2967761152 345
448 iso_pu_bacteria 2967762386 2967766131 345
449 iso_pu_bacteria 2967769361 2967771818 345
450 iso_pu_bacteria 2967775926 2967780147 345
451 iso_pu_bacteria 2970019648 2970025087 345
452 iso_pu_bacteria 2970026789 2970032088 345
453 iso_pu_bacteria 2970033650 2970039305 345
454 iso_pu_bacteria 2970040964 2970046185 345
455 iso_pu_bacteria 2970047711 2970053019 345
456 iso_pu_bacteria 2970054988 2970055314 345
457 iso_pu_bacteria 2970061556 2970067080 345
458 iso_pu_bacteria 2970068827 2970074452 345
459 iso_pu_bacteria 2970076120 2970081148 345
460 iso_pu_bacteria 2970082768 2970085779 345
461 iso_pu_bacteria 2970088815 2970092381 345
462 iso_pu_bacteria 2970095765 2970100703 345
463 iso_pu_bacteria 2970102677 2970106649 345
464 iso_pu_bacteria 2970109326 2970109685 345
465 iso_pu_bacteria 2970116247 2970122251 345
466 iso_pu_bacteria 2970122695 2970125029 345
467 iso_pu_bacteria 2970129317 2970132480 345
468 iso_pu_bacteria 2970136068 2970137232 345
469 iso_pu_bacteria 2970143518 2970143815 345
470 iso_pu_bacteria 2970149975 2970156119 345
471 iso_pu_bacteria 2970156795 2970160558 345
472 iso_pu_bacteria 2970164137 2970169912 345
473 iso_pu_bacteria 2970170962 2970176991 345
474 iso_pu_bacteria 2970177841 2970184100 345
475 iso_pu_bacteria 2970191845 2970198928 345
476 iso_pu_bacteria 2977516862 2977520467 345
477 iso_pu_bacteria 2977523885 2977523908 345
478 iso_pu_bacteria 2977523885 2977524185 345
479 iso_pu_bacteria 2977530762 2977532791 345
480 iso_pu_bacteria 2977537788 2977538384 345
481 iso_pu_bacteria 2977544691 2977547839 345
482 iso_pu_bacteria 2977551784 2977555626 345
483 iso_pu_bacteria 2977558990 2977565810 345
484 iso_pu_bacteria 2977565890 2977569685 345
485 iso_pu_bacteria 2977572785 2977572996 345
486 iso_pu_bacteria 2977579622 2977583066 345
487 iso_pu_bacteria 2989771324 2989775531 345
488 iso_pu_bacteria 2989776772 2989781370 345
489 iso_pu_bacteria 3005416602 3005421152 345
490 iso_pu_bacteria 639633055 639648969 345
491 iso_pu_bacteria 648276728 648740384 345
492 iso_pu_bacteria 8003992118 8003996137 345
493 iso_pu_bacteria 8003999396 8004003897 345
494 iso_pu_bacteria 8005246636 8005250670 345
495 iso_pu_bacteria 8005307578 8005312622 345
496 iso_pu_bacteria 8005314921 8005319113 345
497 iso_pu_bacteria 8005484373 8005489564 345
498 iso_pu_bacteria 8005645114 8005650429 345
499 iso_pu_bacteria 8005658619 8005661887 345
500 iso_pu_bacteria 8005682033 8005684070 345
501 iso_pu_bacteria 8023680758 8023683378 345
502 iso_pu_bacteria 8049293176 8049298566 345
503 iso_pu_bacteria 2582581866 2585395069 346
504 3300003187 JGI25151J46595_10039803 JGI25151J46595_100398032 347
505 3300003578 Ga0006562J51391_1014631 Ga0006562J51391_10146312 347
506 3300003794 Ga0055531_10004390 Ga0055531_1000439011 347
507 3300003856 Ga0058692_1000942 Ga0058692_10009427 347
508 3300003856 Ga0058692_1001612 Ga0058692_10016122 347
509 3300006178 Ga0075367_10021777 Ga0075367_100217773 347
510 3300006178 Ga0075367_10040923 Ga0075367_100409233 347
511 3300006948 Ga0099826_10010743 Ga0099826_100107438 347
512 3300013102 Ga0157371_10000187 Ga0157371_1000018779 347
513 3300013104 Ga0157370_10000037 Ga0157370_1000003769 347
514 3300025292 Ga0209676_1001724 Ga0209676_100172411 347
515 3300025294 Ga0209025_1000689 Ga0209025_100068936 347
516 3300025297 Ga0209758_1000236 Ga0209758_100023634 347
517 3300025303 Ga0209051_1002420 Ga0209051_100242010 347
518 3300025304 Ga0209257_1002824 Ga0209257_10028246 347
519 3300027111 Ga0209281_1000129 Ga0209281_1000129110 347
520 3300027312 Ga0209371_1000901 Ga0209371_10009019 347
521 3300027866 Ga0209813_10000800 Ga0209813_100008007 347
522 3300028379 Ga0268266_10024005 Ga0268266_100240054 347
523 3300030500 Ga0268256_1016586 Ga0268256_10165862 347
524 3300035695 Ga0373927_0000075 Ga0373927_0000075_67952_69007 347
525 3300037418 Ga0395900_0046509 Ga0395900_0046509_484_1533 347
526 3300042004 Ga0439445_0012489 Ga0439445_0012489_472_1527 347
527 3300046512 Ga0495610_0031266 Ga0495610_0031266_1426_2490 347
528 3300046530 Ga0495654_0000122 Ga0495654_0000122_64555_65619 347
529 3300048914 Ga0496111_0001899 Ga0496111_0001899_10706_11770 347
530 3300048920 Ga0496117_0000066 Ga0496117_0000066_179481_180536 347
531 3300048921 Ga0496118_0007705 Ga0496118_0007705_815_1870 347
532 3300048921 Ga0496118_0085193 Ga0496118_0085193_1072_2127 347
533 3300048923 Ga0496120_0000100 Ga0496120_0000100_71973_73028 347
534 3300048923 Ga0496120_0030291 Ga0496120_0030291_2017_3072 347
535 3300048923 Ga0496120_0058665 Ga0496120_0058665_770_1849 347
536 3300048924 Ga0496121_0000143 Ga0496121_0000143_156261_157316 347
537 3300048924 Ga0496121_0000759 Ga0496121_0000759_44625_45689 347
538 3300048925 Ga0496122_0000057 Ga0496122_0000057_71973_73028 347
539 3300048925 Ga0496122_0015477 Ga0496122_0015477_3807_4871 347
540 3300048926 Ga0496123_0000096 Ga0496123_0000096_100887_101942 347
541 3300048926 Ga0496123_0017132 Ga0496123_0017132_2653_3717 347
542 3300048927 Ga0496124_0110627 Ga0496124_0110627_206_1261 347
543 3300048927 Ga0496124_0110629 Ga0496124_0110629_206_1261 347
544 3300048927 Ga0496124_0114867 Ga0496124_0114867_228_1283 347
545 3300048927 Ga0496124_0148349 Ga0496124_0148349_554_1618 347
546 3300048928 Ga0496125_0000374 Ga0496125_0000374_2411_3466 347
547 3300048928 Ga0496125_0005688 Ga0496125_0005688_3330_4409 347
548 3300048928 Ga0496125_0130356 Ga0496125_0130356_464_1519 347
549 3300048929 Ga0496126_0000069 Ga0496126_0000069_75666_76754 347
550 3300048929 Ga0496126_0013950 Ga0496126_0013950_4706_5758 347
551 3300048929 Ga0496126_0040215 Ga0496126_0040215_1512_2567 347
552 3300048929 Ga0496126_0206502 Ga0496126_0206502_152_1207 347
553 3300050489 nmdc:mga03683_20662_c1 nmdc:mga03683_20662_c1_576_1631 347
554 3300050490 nmdc:mga03n38_10720_c1 nmdc:mga03n38_10720_c1_329_1384 347
555 3300050491 nmdc:mga00v17_17_c1 nmdc:mga00v17_17_c1_50005_51060 347
556 3300050491 nmdc:mga00v17_21284_c1 nmdc:mga00v17_21284_c1_2247_3302 347
557 3300050491 nmdc:mga00v17_36_c1 nmdc:mga00v17_36_c1_80307_81371 347
558 3300050493 nmdc:mga0k408_8787_c1 nmdc:mga0k408_8787_c1_2652_3707 347
559 3300050495 nmdc:mga04h51_1306_c1 nmdc:mga04h51_1306_c1_1646_2701 347
560 3300050516 nmdc:mga0sz30_121_c1 nmdc:mga0sz30_121_c1_13996_15051 347
561 3300053107 Ga0500560_003804 Ga0500560_003804_1100_2155 347
562 3300053125 Ga0500618_000654 Ga0500618_000654_7191_8255 347
563 3300053137 Ga0500561_0000278 Ga0500561_0000278_438_1493 347
564 3300053157 Ga0500624_000443 Ga0500624_000443_4876_5931 347
565 3300053161 Ga0500634_0003280 Ga0500634_0003280_1378_2433 347
566 3300053161 Ga0500634_0052512 Ga0500634_0052512_245_1300 347
567 3300053177 Ga0500636_0000760 Ga0500636_0000760_3255_4319 347
568 3300059477 Ga0587084_000344 Ga0587084_000344_1447_2502 347
569 3300059490 Ga0587066_002008 Ga0587066_002008_947_2002 347
570 3300059493 Ga0587077_002422 Ga0587077_002422_217_1272 347
571 3300059505 Ga0587083_0005061 Ga0587083_0005061_508_1563 347
572 3300059510 Ga0587090_000202 Ga0587090_000202_948_2003 347
573 3300059511 Ga0587091_000705 Ga0587091_000705_939_1994 347
574 3300059623 Ga0587101_006045 Ga0587101_006045_288_1343 347
575 3300059624 Ga0587109_002461 Ga0587109_002461_948_2003 347
576 3300059626 Ga0587115_002916 Ga0587115_002916_365_1420 347
577 3300059639 Ga0587062_000260 Ga0587062_000260_1323_2378 347
578 3300059641 Ga0587068_003660 Ga0587068_003660_174_1229 347
579 3300059642 Ga0587069_001471 Ga0587069_001471_319_1374 347
580 3300059643 Ga0587072_000429 Ga0587072_000429_2181_3236 347
581 3300059645 Ga0587076_004527 Ga0587076_004527_289_1344 347
582 3300059649 Ga0587102_004383 Ga0587102_004383_120_1175 347
583 3300059653 Ga0587108_001302 Ga0587108_001302_289_1344 347
584 3300060243 Ga0587060_001414 Ga0587060_001414_317_1372 347
585 3300060346 Ga0587111_0001096 Ga0587111_0001096_952_2007 347
586 3300060346 Ga0587111_0004713 Ga0587111_0004713_932_1990 347
587 2162886007 SwRhRL2b_contig_2580795 SwRhRL2b_0819.00016280 348
588 3300001979 JGI24740J21852_10001288 JGI24740J21852_1000128810 348
589 3300002704 JGI25155J39150_1000020 JGI25155J39150_100002070 348
590 3300002705 JGI25156J39149_1000021 JGI25156J39149_100002180 348
591 3300002737 JGI25162J39368_1000373 JGI25162J39368_100037317 348
592 3300002737 JGI25162J39368_1001499 JGI25162J39368_100149910 348
593 3300002738 JGI25154J39366_1000039 JGI25154J39366_100003970 348
594 3300002741 JGI25157J39369_1000019 JGI25157J39369_100001980 348
595 3300002987 JGI25159J45721_1001592 JGI25159J45721_10015923 348
596 3300003187 JGI25151J46595_10009208 JGI25151J46595_100092081 348
597 3300003214 JGI25165J46597_1000010 JGI25165J46597_1000010377 348
598 3300003214 JGI25165J46597_1000018 JGI25165J46597_1000018333 348
599 3300003214 JGI25165J46597_1001267 JGI25165J46597_10012676 348
600 3300003214 JGI25165J46597_1001278 JGI25165J46597_10012785 348
601 3300003215 JGI25153J46596_10001443 JGI25153J46596_100014439 348
602 3300003320 rootH2_10058422 rootH2_100584225 348
603 3300003771 Ga0055526_1000318 Ga0055526_10003187 348
604 3300003775 Ga0055524_1018205 Ga0055524_10182052 348
605 3300003790 Ga0055528_1006655 Ga0055528_10066552 348
606 3300005262 Ga0065165_1000306 Ga0065165_100030649 348
607 3300005289 Ga0065704_10070331 Ga0065704_100703319 348
608 3300005347 Ga0070668_100238305 Ga0070668_1002383052 348
609 3300005548 Ga0070665_100017368 Ga0070665_1000173686 348
610 3300005614 Ga0068856_100070780 Ga0068856_1000707802 348
611 3300005616 Ga0068852_100332006 Ga0068852_1003320062 348
612 3300006038 Ga0075365_10127278 Ga0075365_101272782 348
613 3300006186 Ga0075369_10028588 Ga0075369_100285882 348
614 3300006358 Ga0068871_100258245 Ga0068871_1002582452 348
615 3300006871 Ga0075434_100034612 Ga0075434_1000346123 348
616 3300006946 Ga0079104_1016597 Ga0079104_10165972 348
617 3300007076 Ga0075435_100184766 Ga0075435_1001847662 348
618 3300007788 Ga0099795_10010508 Ga0099795_100105083 348
619 3300009093 Ga0105240_10016435 Ga0105240_100164358 348
620 3300009098 Ga0105245_10270429 Ga0105245_102704292 348
621 3300009545 Ga0105237_10008749 Ga0105237_1000874910 348
622 3300010375 Ga0105239_10000037 Ga0105239_1000003740 348
623 3300010375 Ga0105239_10069104 Ga0105239_100691042 348
624 3300010375 Ga0105239_10473745 Ga0105239_104737451 348
625 3300011119 Ga0105246_10163295 Ga0105246_101632952 348
626 3300013104 Ga0157370_10005220 Ga0157370_100052202 348
627 3300013306 Ga0163162_10110154 Ga0163162_101101542 348
628 3300021321 Ga0214542_1000082 Ga0214542_100008250 348
629 3300021321 Ga0214542_1017248 Ga0214542_10172485 348
630 3300021327 Ga0214543_1000005 Ga0214543_1000005215 348
631 3300021327 Ga0214543_1000075 Ga0214543_100007550 348
632 3300022739 Ga0228711_1000045 Ga0228711_100004548 348
633 3300022740 Ga0228710_1000036 Ga0228710_100003654 348
634 3300025206 Ga0209435_100025 Ga0209435_10002591 348
635 3300025228 Ga0209672_103199 Ga0209672_1031991 348
636 3300025233 Ga0209437_100022 Ga0209437_100022393 348
637 3300025233 Ga0209437_100040 Ga0209437_100040264 348
638 3300025246 Ga0209646_1000083 Ga0209646_100008391 348
639 3300025250 Ga0209026_1000078 Ga0209026_100007891 348
640 3300025253 Ga0209677_101757 Ga0209677_1017575 348
641 3300025254 Ga0209148_1007907 Ga0209148_10079072 348
642 3300025256 Ga0209759_1000060 Ga0209759_100006091 348
643 3300025258 Ga0209129_1012688 Ga0209129_10126882 348
644 3300025261 Ga0209233_1000031 Ga0209233_1000031393 348
645 3300025261 Ga0209233_1000044 Ga0209233_1000044103 348
646 3300025261 Ga0209233_1000051 Ga0209233_1000051265 348
647 3300025261 Ga0209233_1000146 Ga0209233_100014693 348
648 3300025273 Ga0209673_1018152 Ga0209673_10181522 348
649 3300025294 Ga0209025_1000276 Ga0209025_100027697 348
650 3300025295 Ga0209564_1000054 Ga0209564_100005481 348
651 3300025297 Ga0209758_1009501 Ga0209758_10095012 348
652 3300025299 Ga0209256_1000128 Ga0209256_1000128118 348
653 3300025302 Ga0207426_1000601 Ga0207426_10006017 348
654 3300025303 Ga0209051_1009735 Ga0209051_10097355 348
655 3300025913 Ga0207695_10000120 Ga0207695_1000012094 348
656 3300025913 Ga0207695_10035641 Ga0207695_100356414 348
657 3300025914 Ga0207671_10001724 Ga0207671_1000172412 348
658 3300025924 Ga0207694_10026633 Ga0207694_100266332 348
659 3300025941 Ga0207711_10052741 Ga0207711_100527412 348
660 3300025981 Ga0207640_10087200 Ga0207640_100872002 348
661 3300026078 Ga0207702_10186215 Ga0207702_101862151 348
662 3300027111 Ga0209281_1000178 Ga0209281_100017865 348
663 3300027111 Ga0209281_1000417 Ga0209281_100041719 348
664 3300027312 Ga0209371_1001677 Ga0209371_10016776 348
665 3300027666 Ga0209282_1000023 Ga0209282_100002391 348
666 3300028786 Ga0307517_10099036 Ga0307517_100990363 348
667 3300031730 Ga0307516_10003800 Ga0307516_1000380015 348
668 3300031730 Ga0307516_10069005 Ga0307516_100690052 348
669 3300031901 Ga0307406_10124074 Ga0307406_101240741 348
670 3300031911 Ga0307412_10035923 Ga0307412_100359232 348
671 3300031967 Ga0315914_1000016 Ga0315914_100001648 348
672 3300032002 Ga0307416_100190899 Ga0307416_1001908991 348
673 3300032004 Ga0307414_10000835 Ga0307414_100008357 348
674 3300032004 Ga0307414_10029917 Ga0307414_100299173 348
675 3300032004 Ga0307414_10045992 Ga0307414_100459924 348
676 3300033180 Ga0307510_10043890 Ga0307510_100438904 348
677 3300033430 Ga0315913_1000027 Ga0315913_100002746 348
678 3300033464 Ga0315915_1000007 Ga0315915_1000007126 348
679 3300034816 Ga0373930_0002416 Ga0373930_0002416_488_1606 348
680 3300035113 Ga0373936_0022850 Ga0373936_0022850_649_1770 348
681 3300036401 Ga0373937_0188941 Ga0373937_0188941_371_1441 348
682 3300037418 Ga0395900_0000679 Ga0395900_0000679_25194_26243 348
683 3300037466 Ga0395898_0004592 Ga0395898_0004592_10922_11971 348
684 3300037471 Ga0395905_0000231 Ga0395905_0000231_58360_59409 348
685 3300038443 Ga0395901_0000388 Ga0395901_0000388_34993_36042 348
686 3300039062 Ga0400483_087805 Ga0400483_087805_1894_2955 348
687 3300039062 Ga0400483_173215 Ga0400483_173215_940_2007 348
688 3300039438 Ga0436360_1079675 Ga0436360_1079675_284_1330 348
689 3300041441 Ga0451787_359602 Ga0451787_359602_2931_3986 348
690 3300041505 Ga0451849_1483235 Ga0451849_1483235_522_1595 348
691 3300041509 Ga0451843_0812862 Ga0451843_0812862_536_1609 348
692 3300041512 Ga0451853_1095662 Ga0451853_1095662_4018_5091 348
693 3300042004 Ga0439445_0000112 Ga0439445_0000112_9544_10590 348
694 3300044694 Ga0466963_0017381 Ga0466963_0017381_1574_2653 348
695 3300044735 Ga0466968_0000165 Ga0466968_0000165_7252_8496 348
696 3300044765 Ga0466970_0001422 Ga0466970_0001422_4805_5884 348
697 3300046459 Ga0495629_0110840 Ga0495629_0110840_21_1070 348
698 3300046460 Ga0495638_0141015 Ga0495638_0141015_220_1293 348
699 3300046500 Ga0495596_0001347 Ga0495596_0001347_2461_3507 348
700 3300046507 Ga0495606_0008877 Ga0495606_0008877_4684_5757 348
701 3300046512 Ga0495610_0003237 Ga0495610_0003237_10677_11723 348
702 3300046515 Ga0495620_0006705 Ga0495620_0006705_4671_5744 348
703 3300046518 Ga0495631_0026454 Ga0495631_0026454_331_1404 348
704 3300046519 Ga0495632_0018391 Ga0495632_0018391_2248_3321 348
705 3300046522 Ga0495643_0010188 Ga0495643_0010188_2474_3547 348
706 3300046522 Ga0495643_0013525 Ga0495643_0013525_1075_2130 348
707 3300046524 Ga0495648_0027554 Ga0495648_0027554_1058_2131 348
708 3300046530 Ga0495654_0023401 Ga0495654_0023401_2064_3137 348
709 3300046542 Ga0495597_0002416 Ga0495597_0002416_10093_11166 348
710 3300046558 Ga0495633_0098428 Ga0495633_0098428_36_1085 348
711 3300046683 Ga0495658_0099448 Ga0495658_0099448_49_1227 348
712 3300046694 Ga0495649_0012414 Ga0495649_0012414_185_1258 348
713 3300046809 Ga0495600_0087580 Ga0495600_0087580_154_1203 348
714 3300046810 Ga0495660_0044300 Ga0495660_0044300_517_1590 348
715 3300047317 Ga0495604_0012850 Ga0495604_0012850_5560_6609 348
716 3300047472 Ga0495686_0000476 Ga0495686_0000476_24732_25778 348
717 3300048091 Ga0495626_0001397 Ga0495626_0001397_12144_13190 348
718 3300048903 Ga0496100_0001446 Ga0496100_0001446_10507_11586 348
719 3300048904 Ga0496101_0066815 Ga0496101_0066815_146_1225 348
720 3300048905 Ga0496102_0024468 Ga0496102_0024468_215_1294 348
721 3300048906 Ga0496103_0006294 Ga0496103_0006294_1791_2870 348
722 3300048916 Ga0496113_0024593 Ga0496113_0024593_3011_4060 348
723 3300048916 Ga0496113_0041354 Ga0496113_0041354_1307_2425 348
724 3300048919 Ga0496116_0020083 Ga0496116_0020083_3165_4244 348
725 3300048920 Ga0496117_0001348 Ga0496117_0001348_13375_14454 348
726 3300048920 Ga0496117_0003489 Ga0496117_0003489_1614_2663 348
727 3300048920 Ga0496117_0011948 Ga0496117_0011948_2865_3911 348
728 3300048920 Ga0496117_0095190 Ga0496117_0095190_156_1229 348
729 3300048921 Ga0496118_0002630 Ga0496118_0002630_1157_2236 348
730 3300048921 Ga0496118_0124572 Ga0496118_0124572_528_1574 348
731 3300048922 Ga0496119_0006308 Ga0496119_0006308_9618_10670 348
732 3300048922 Ga0496119_0011243 Ga0496119_0011243_4505_5578 348
733 3300048924 Ga0496121_0000066 Ga0496121_0000066_161184_162431 348
734 3300048924 Ga0496121_0000567 Ga0496121_0000567_44277_45371 348
735 3300048924 Ga0496121_0006947 Ga0496121_0006947_854_1933 348
736 3300048925 Ga0496122_0000113 Ga0496122_0000113_176406_177455 348
737 3300048925 Ga0496122_0016145 Ga0496122_0016145_2726_3799 348
738 3300048925 Ga0496122_0079100 Ga0496122_0079100_1223_2272 348
739 3300048926 Ga0496123_0000381 Ga0496123_0000381_71584_72633 348
740 3300048926 Ga0496123_0001243 Ga0496123_0001243_22984_24099 348
741 3300048926 Ga0496123_0009706 Ga0496123_0009706_3038_4111 348
742 3300048926 Ga0496123_0137415 Ga0496123_0137415_16_1095 348
743 3300048927 Ga0496124_0000094 Ga0496124_0000094_177616_178692 348
744 3300048927 Ga0496124_0001939 Ga0496124_0001939_14483_15562 348
745 3300048927 Ga0496124_0053251 Ga0496124_0053251_86_1159 348
746 3300048928 Ga0496125_0000206 Ga0496125_0000206_10987_12036 348
747 3300048928 Ga0496125_0007359 Ga0496125_0007359_381_1460 348
748 3300048929 Ga0496126_0000051 Ga0496126_0000051_311931_312980 348
749 3300048929 Ga0496126_0035531 Ga0496126_0035531_2082_3329 348
750 3300049579 Ga0501043_0264199 Ga0501043_0264199_44_1132 348
751 3300049776 Ga0501280_001046 Ga0501280_001046_1485_2537 348
752 3300050492 nmdc:mga0yw44_168650_c1 nmdc:mga0yw44_168650_c1_262_1332 348
753 3300050512 nmdc:mga0n895_35503_c1 nmdc:mga0n895_35503_c1_798_1907 348
754 3300050513 nmdc:mga0rr50_16395_c1 nmdc:mga0rr50_16395_c1_2801_3910 348
755 3300053125 Ga0500618_000549 Ga0500618_000549_19388_20437 348
756 3300053134 Ga0500658_0002721 Ga0500658_0002721_3670_4743 348
757 3300053735 Ga0500596_005455 Ga0500596_005455_471_1517 348
758 3300061719 Ga0466962_0115905 Ga0466962_0115905_61_1140 348

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02423

OCD_Mu_crystall

Ornithine cyclodeaminase/mu-crystallin family

73

380

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1x7d-assembly1.cif.gz_B crystal structure analysis of ornithine cyclodeaminase complexed with nad and ornithine to 1.6 angstroms 0.9493 12 345
1x7d-assembly1.cif.gz_B crystal structure analysis of ornithine cyclodeaminase complexed with nad and ornithine to 1.6 angstroms 0.933 12 345
1omo-assembly1.cif.gz_B alanine dehydrogenase dimer w/bound nad (archaeal) 0.9153 10 331
5yu0-assembly2.cif.gz_C structural basis for recognition of l-lysine, l-ornithine, and l-2,4-diamino butyric acid by lysine cyclodeaminase 0.9115 10 339
1omo-assembly1.cif.gz_B alanine dehydrogenase dimer w/bound nad (archaeal) 0.9098 10 331
ID Description Score Start End Superfamily
1x7dB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.964 135 303 3.40.50.720
1x7dB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9584 135 303 3.40.50.720
1vllA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9216 135 303 3.40.50.720
1vllA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9062 135 303 3.40.50.720
af_O54983_132_293_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9018 135 303 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A833L6L8-F1-model_v4 Ornithine 0.9671 138 244
AF-A0A2T0YKD6-F1-model_v4 Ornithine cyclodeaminase 0.9578 11 344
AF-A0A7C1CEH1-F1-model_v4 Ornithine cyclodeaminase 0.9569 101 347
AF-A0A841AB16-F1-model_v4 Ornithine cyclodeaminase (EC 4.3.1.12) 0.9563 11 348 GO:0016829
AF-A0A2N9VUP5-F1-model_v4 Ornithine cyclodeaminase 0.9562 6 348 GO:0016813
GO:0046872

Feature Viewer

pLDDT pTM Quality
91.76 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map