F479401

General Info

Members Datasets Scaffolds Average Seq Length
757 339 757 101

Family's Representative Sequence

Representative Sequence 3300036401|Ga0373937_0318167|Ga0373937_0318167_134_502
Length 122
Sequence VRSRTSADLEHLTPPELAKRAQVDLTPREKDKLLLFTAALVAERRLARGLRLNYPEAVAYLSAAIVEGARDGRTVADLMSFGATLLTREQVMDGVPEMISEIQVEATFPDGTKLVTVHRPIP

Samples

Sample ID Description Type Environment
1 2162886006 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
4 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
5 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
14 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
15 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
16 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
77 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
89 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
90 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
92 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
104 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
105 3300012502 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 Metagenome Rhizosphere
106 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
107 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
108 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
109 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
110 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
111 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
112 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
113 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
114 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
115 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
116 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
117 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
118 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
119 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
120 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
125 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
126 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
129 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
130 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
132 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
194 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
199 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
200 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
201 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
202 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
203 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
204 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
205 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
210 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
213 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
214 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
215 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
216 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
217 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
218 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
219 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
220 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
225 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
226 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
227 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
228 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
229 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
230 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
231 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
232 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
233 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
234 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
235 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
236 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
237 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
240 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
241 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
242 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
243 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
246 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
247 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
248 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
249 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
250 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
251 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
252 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
253 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
254 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
255 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
256 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
257 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
258 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
259 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
260 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
261 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
264 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
265 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
266 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
267 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
268 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
269 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
270 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
271 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
272 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
275 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
276 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
277 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
278 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
279 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
280 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
281 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
282 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
283 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
288 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
289 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
290 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
291 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
292 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
293 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
294 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
295 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
296 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
297 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
298 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
299 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
303 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
304 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
305 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
309 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
314 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
315 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
316 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
317 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
318 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
319 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
320 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
321 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
322 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
323 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
324 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
325 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
326 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
327 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
328 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
329 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
330 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
331 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
332 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
333 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
335 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
336 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
337 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
338 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
339 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.3
Nodule 0
Rhizoplane 3.83
Rhizosphere 86
Stem 0
Stem Tuber 0
Unclassified 6.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL3b_contig_174203 2162886006 Bacteria 1070
2 JGI24749J21850_1023943 3300002076 Bacteria 868
3 JGI25152J39213_1001127 3300002773 Bacteria 12449
4 JGI25150J39212_1000188 3300002774 Bacteria 34828
5 JGI25151J46595_10000144 3300003187 Bacteria 94653
6 JGI25153J46596_10004242 3300003215 Bacteria 7757
7 Ga0006562J51391_1013837 3300003578 Bacteria 9818
8 Ga0055531_10000016 3300003794 Bacteria 181898
9 Ga0058860_11876603 3300004801 Unclassified 762
10 Ga0065712_10402592 3300005290 Bacteria 730
11 Ga0065715_10218623 3300005293 Bacteria 1278
12 Ga0065715_10483344 3300005293 Bacteria 795
13 Ga0065707_10089627 3300005295 Bacteria 4316
14 Ga0070658_10519064 3300005327 Bacteria 1030
15 Ga0070676_10021967 3300005328 Bacteria 3576
16 Ga0070676_10047155 3300005328 Bacteria 2515
17 Ga0070676_10646725 3300005328 Bacteria 767
18 Ga0070683_100001269 3300005329 Bacteria 19223
19 Ga0070683_102334735 3300005329 Bacteria 513
20 Ga0070690_100009590 3300005330 Bacteria 5612
21 Ga0070690_100142054 3300005330 Bacteria 1630
22 Ga0070690_100263557 3300005330 Bacteria 1223
23 Ga0070690_100313169 3300005330 Bacteria 1129
24 Ga0070690_100317765 3300005330 Bacteria 1121
25 Ga0070690_100821472 3300005330 Bacteria 722
26 Ga0070670_100022326 3300005331 Bacteria 5447
27 Ga0070670_100085419 3300005331 Bacteria 2711
28 Ga0070677_10018921 3300005333 Bacteria 2488
29 Ga0070677_10262136 3300005333 Bacteria 863
30 Ga0070677_10304148 3300005333 Bacteria 811
31 Ga0068869_100001950 3300005334 Bacteria 12358
32 Ga0068869_100004242 3300005334 Bacteria 8893
33 Ga0068869_100023317 3300005334 Bacteria 4272
34 Ga0068869_100440082 3300005334 Bacteria 1079
35 Ga0070666_10105159 3300005335 Bacteria 1949
36 Ga0070666_10114198 3300005335 Bacteria 1870
37 Ga0070682_100816746 3300005337 Bacteria 759
38 Ga0068868_100055282 3300005338 Bacteria 3131
39 Ga0068868_100153754 3300005338 Bacteria 1896
40 Ga0068868_100537997 3300005338 Bacteria 1028
41 Ga0068868_101453545 3300005338 Bacteria 641
42 Ga0070660_101631925 3300005339 Bacteria 549
43 Ga0070689_100022692 3300005340 Bacteria 4689
44 Ga0070691_10890182 3300005341 Bacteria 548
45 Ga0070687_100005582 3300005343 Bacteria 5103
46 Ga0070687_100367773 3300005343 Bacteria 933
47 Ga0070687_100528530 3300005343 Bacteria 799
48 Ga0070692_10137666 3300005345 Bacteria 1379
49 Ga0070692_11275733 3300005345 Bacteria 526
50 Ga0070668_100018888 3300005347 Bacteria 5179
51 Ga0070668_100062328 3300005347 Bacteria 2889
52 Ga0070668_100562195 3300005347 Bacteria 994
53 Ga0070669_100805034 3300005353 Bacteria 799
54 Ga0070671_100044597 3300005355 Bacteria 3685
55 Ga0070671_100323505 3300005355 Bacteria 1314
56 Ga0070671_100328198 3300005355 Bacteria 1304
57 Ga0070671_100476966 3300005355 Bacteria 1072
58 Ga0070674_100067262 3300005356 Bacteria 2520
59 Ga0070674_100464027 3300005356 Bacteria 1048
60 Ga0070673_100012165 3300005364 Bacteria 5898
61 Ga0070673_100119998 3300005364 Bacteria 2192
62 Ga0070673_100206006 3300005364 Bacteria 1696
63 Ga0070673_100814492 3300005364 Bacteria 863
64 Ga0070673_102208374 3300005364 Bacteria 523
65 Ga0070688_100132455 3300005365 Bacteria 1684
66 Ga0070659_100005665 3300005366 Bacteria 8979
67 Ga0070659_100293260 3300005366 Bacteria 1355
68 Ga0070659_101307836 3300005366 Bacteria 643
69 Ga0070667_100036887 3300005367 Bacteria 4098
70 Ga0070667_100164905 3300005367 Bacteria 1954
71 Ga0070667_100293370 3300005367 Bacteria 1463
72 Ga0070667_101067443 3300005367 Bacteria 754
73 Ga0070703_10198427 3300005406 Bacteria 786
74 Ga0070714_100141653 3300005435 Bacteria 2159
75 Ga0070714_100923287 3300005435 Bacteria 848
76 Ga0070714_102478166 3300005435 Bacteria 503
77 Ga0070713_101299495 3300005436 Bacteria 705
78 Ga0070701_10154661 3300005438 Bacteria 1323
79 Ga0070701_10393920 3300005438 Bacteria 876
80 Ga0070701_10545045 3300005438 Bacteria 760
81 Ga0070701_10653305 3300005438 Bacteria 702
82 Ga0070705_100099878 3300005440 Bacteria 1830
83 Ga0070705_100142372 3300005440 Bacteria 1580
84 Ga0070700_100247275 3300005441 Bacteria 1277
85 Ga0070700_101395585 3300005441 Bacteria 592
86 Ga0070694_101099014 3300005444 Bacteria 663
87 Ga0070708_100782917 3300005445 Bacteria 897
88 Ga0070708_101572116 3300005445 Bacteria 612
89 Ga0070663_100041108 3300005455 Bacteria 3240
90 Ga0070663_100525545 3300005455 Bacteria 986
91 Ga0070678_100040424 3300005456 Unclassified 3300
92 Ga0070678_100183155 3300005456 Bacteria 1716
93 Ga0070678_100345348 3300005456 Bacteria 1278
94 Ga0070678_100361993 3300005456 Bacteria 1250
95 Ga0070678_100510258 3300005456 Bacteria 1062
96 Ga0070662_100275970 3300005457 Bacteria 1359
97 Ga0068867_100002417 3300005459 Bacteria 13127
98 Ga0068867_100175454 3300005459 Unclassified 1700
99 Ga0068867_100432941 3300005459 Bacteria 1117
100 Ga0068867_100672655 3300005459 Bacteria 911
101 Ga0070685_10002936 3300005466 Bacteria 8713
102 Ga0070685_10271149 3300005466 Bacteria 1132
103 Ga0070706_100008183 3300005467 Bacteria 9756
104 Ga0070707_100268319 3300005468 Bacteria 1660
105 Ga0070707_100713285 3300005468 Bacteria 966
106 Ga0070684_100038607 3300005535 Bacteria 4103
107 Ga0070697_100051475 3300005536 Bacteria 3345
108 Ga0068853_100091069 3300005539 Bacteria 2681
109 Ga0068853_100447911 3300005539 Bacteria 1214
110 Ga0070672_100074657 3300005543 Bacteria 2705
111 Ga0070672_100266915 3300005543 Bacteria 1444
112 Ga0070672_100284460 3300005543 Bacteria 1399
113 Ga0070672_101204137 3300005543 Bacteria 675
114 Ga0070672_101804567 3300005543 Bacteria 550
115 Ga0070695_100082935 3300005545 Bacteria 2123
116 Ga0070695_101500815 3300005545 Bacteria 561
117 Ga0070695_101725436 3300005545 Bacteria 524
118 Ga0070696_100260072 3300005546 Bacteria 1316
119 Ga0070696_100461079 3300005546 Bacteria 1004
120 Ga0070696_100712420 3300005546 Bacteria 819
121 Ga0070696_101568302 3300005546 Bacteria 565
122 Ga0070693_100046196 3300005547 Bacteria 2472
123 Ga0070693_100867161 3300005547 Bacteria 674
124 Ga0070665_100231596 3300005548 Bacteria 1847
125 Ga0070665_100453481 3300005548 Bacteria 1292
126 Ga0070704_100507774 3300005549 Bacteria 1047
127 Ga0070704_100563638 3300005549 Bacteria 997
128 Ga0070704_100800570 3300005549 Bacteria 842
129 Ga0070704_101498009 3300005549 Bacteria 620
130 Ga0068855_100155160 3300005563 Bacteria 2602
131 Ga0068855_100190496 3300005563 Bacteria 2314
132 Ga0068855_100645153 3300005563 Bacteria 1137
133 Ga0070664_100095292 3300005564 Bacteria 2581
134 Ga0070664_100298787 3300005564 Bacteria 1455
135 Ga0068857_100038087 3300005577 Bacteria 4258
136 Ga0068857_100378661 3300005577 Bacteria 1314
137 Ga0068857_100519881 3300005577 Bacteria 1119
138 Ga0068857_101029673 3300005577 Bacteria 793
139 Ga0068854_100097670 3300005578 Bacteria 2196
140 Ga0068856_101701191 3300005614 Bacteria 643
141 Ga0070702_100057345 3300005615 Bacteria 2252
142 Ga0070702_100629936 3300005615 Bacteria 808
143 Ga0070702_101697150 3300005615 Bacteria 525
144 Ga0068852_100052141 3300005616 Bacteria 3515
145 Ga0068852_100355784 3300005616 Bacteria 1431
146 Ga0068852_100705934 3300005616 Bacteria 1019
147 Ga0068859_100006120 3300005617 Bacteria 12223
148 Ga0068859_100026047 3300005617 Bacteria 5868
149 Ga0068859_100052757 3300005617 Bacteria 4089
150 Ga0068859_100499965 3300005617 Bacteria 1311
151 Ga0068859_100762010 3300005617 Bacteria 1056
152 Ga0068859_102177964 3300005617 Bacteria 612
153 Ga0068864_100000600 3300005618 Bacteria 30574
154 Ga0068864_100004298 3300005618 Bacteria 11712
155 Ga0068864_100518495 3300005618 Bacteria 1149
156 Ga0068866_10037854 3300005718 Bacteria 2372
157 Ga0068866_10056076 3300005718 Bacteria 2026
158 Ga0068861_100007311 3300005719 Bacteria 7569
159 Ga0068861_100752076 3300005719 Bacteria 911
160 Ga0068861_101799218 3300005719 Bacteria 608
161 Ga0068851_10102068 3300005834 Bacteria 1523
162 Ga0068851_10124015 3300005834 Bacteria 1391
163 Ga0068870_10003580 3300005840 Bacteria 6586
164 Ga0068870_10297723 3300005840 Bacteria 1017
165 Ga0068863_100000563 3300005841 Bacteria 37653
166 Ga0068863_100083649 3300005841 Bacteria 3024
167 Ga0068863_100220340 3300005841 Bacteria 1828
168 Ga0068863_100291206 3300005841 Bacteria 1582
169 Ga0068863_101946986 3300005841 Bacteria 598
170 Ga0068858_100002972 3300005842 Bacteria 17016
171 Ga0068858_100022537 3300005842 Bacteria 5877
172 Ga0068858_100141545 3300005842 Bacteria 2258
173 Ga0068858_100348162 3300005842 Bacteria 1419
174 Ga0068858_100372386 3300005842 Bacteria 1370
175 Ga0068860_100026286 3300005843 Bacteria 5612
176 Ga0068860_100046827 3300005843 Unclassified 4122
177 Ga0068860_100049100 3300005843 Bacteria 4021
178 Ga0068860_100050809 3300005843 Bacteria 3946
179 Ga0068860_100095533 3300005843 Bacteria 2833
180 Ga0068862_100006488 3300005844 Bacteria 9713
181 Ga0068862_100044301 3300005844 Bacteria 3794
182 Ga0068862_100136363 3300005844 Bacteria 2175
183 Ga0068862_100612293 3300005844 Bacteria 1047
184 Ga0081455_10020855 3300005937 Bacteria 6160
185 Ga0075365_10135592 3300006038 Bacteria 1706
186 Ga0075365_10712191 3300006038 Bacteria 709
187 Ga0075365_11189469 3300006038 Bacteria 536
188 Ga0075364_10039619 3300006051 Bacteria 3055
189 Ga0075364_10349933 3300006051 Bacteria 1007
190 Ga0070715_10777341 3300006163 Bacteria 579
191 Ga0070716_101401744 3300006173 Bacteria 568
192 Ga0075367_10766291 3300006178 Bacteria 614
193 Ga0097621_100006633 3300006237 Bacteria 8226
194 Ga0097621_100558662 3300006237 Bacteria 1042
195 Ga0097621_101229560 3300006237 Bacteria 706
196 Ga0068871_100072093 3300006358 Bacteria 2843
197 Ga0068871_100094134 3300006358 Unclassified 2500
198 Ga0068871_100796543 3300006358 Bacteria 871
199 Ga0075434_100528269 3300006871 Bacteria 1200
200 Ga0068865_100084405 3300006881 Bacteria 2289
201 Ga0068865_100125116 3300006881 Bacteria 1918
202 Ga0068865_100342552 3300006881 Bacteria 1208
203 Ga0068865_100547267 3300006881 Bacteria 971
204 Ga0097620_100006120 3300006931 Bacteria 12223
205 Ga0097620_100026046 3300006931 Bacteria 5868
206 Ga0097620_100052758 3300006931 Bacteria 4089
207 Ga0097620_100499974 3300006931 Bacteria 1311
208 Ga0097620_100762020 3300006931 Bacteria 1056
209 Ga0097620_102178219 3300006931 Bacteria 612
210 Ga0105250_10000022 3300009092 Bacteria 231610
211 Ga0105240_10000026 3300009093 Bacteria 355569
212 Ga0105240_10819122 3300009093 Bacteria 1007
213 Ga0111539_10026150 3300009094 Bacteria 7142
214 Ga0111539_10196938 3300009094 Bacteria 2350
215 Ga0105245_10357918 3300009098 Bacteria 1448
216 Ga0105245_10765097 3300009098 Bacteria 1002
217 Ga0105245_10907629 3300009098 Bacteria 923
218 Ga0105245_10920519 3300009098 Bacteria 916
219 Ga0105247_10040149 3300009101 Bacteria 2860
220 Ga0105247_10074240 3300009101 Bacteria 2132
221 Ga0114129_10325110 3300009147 Bacteria 2044
222 Ga0114129_12081915 3300009147 Bacteria 685
223 Ga0105243_10029350 3300009148 Bacteria 4229
224 Ga0105243_10094163 3300009148 Unclassified 2473
225 Ga0105241_10252081 3300009174 Bacteria 1497
226 Ga0105241_11125109 3300009174 Bacteria 740
227 Ga0105241_11134512 3300009174 Bacteria 738
228 Ga0105241_12078431 3300009174 Bacteria 561
229 Ga0105242_10086903 3300009176 Unclassified 2625
230 Ga0105242_11163689 3300009176 Bacteria 789
231 Ga0105242_11207624 3300009176 Bacteria 776
232 Ga0105242_11318742 3300009176 Bacteria 746
233 Ga0105242_13212389 3300009176 Bacteria 507
234 Ga0105248_10008221 3300009177 Bacteria 11464
235 Ga0105248_10046396 3300009177 Bacteria 4870
236 Ga0105248_10084147 3300009177 Bacteria 3578
237 Ga0105248_10299117 3300009177 Bacteria 1812
238 Ga0105248_10891688 3300009177 Bacteria 1004
239 Ga0105248_11301863 3300009177 Bacteria 822
240 Ga0105237_10946318 3300009545 Bacteria 868
241 Ga0105238_11204128 3300009551 Bacteria 782
242 Ga0105249_10229729 3300009553 Bacteria 1829
243 Ga0105249_10292693 3300009553 Bacteria 1630
244 Ga0105249_10415973 3300009553 Bacteria 1377
245 Ga0105249_10507008 3300009553 Bacteria 1252
246 Ga0105249_11165016 3300009553 Bacteria 842
247 Ga0105239_10535674 3300010375 Bacteria 1333
248 Ga0105239_11689259 3300010375 Bacteria 733
249 Ga0105239_11733445 3300010375 Bacteria 723
250 Ga0105246_10122130 3300011119 Bacteria 1932
251 Ga0105246_10520297 3300011119 Bacteria 1014
252 Ga0105246_10898414 3300011119 Bacteria 794
253 Ga0105246_11920296 3300011119 Bacteria 569
254 Ga0157323_1026169 3300012495 Bacteria 590
255 Ga0157319_1025564 3300012497 Bacteria 605
256 Ga0157347_1027228 3300012502 Bacteria 700
257 Ga0157315_1011824 3300012508 Bacteria 794
258 Ga0157371_10356988 3300013102 Bacteria 1065
259 Ga0157370_11326111 3300013104 Bacteria 648
260 Ga0157374_10091416 3300013296 Bacteria 2902
261 Ga0157374_10098171 3300013296 Unclassified 2804
262 Ga0157374_10510094 3300013296 Bacteria 1208
263 Ga0157378_10006203 3300013297 Bacteria 10464
264 Ga0157378_10061392 3300013297 Bacteria 3354
265 Ga0157378_10181319 3300013297 Bacteria 1981
266 Ga0157378_10481719 3300013297 Bacteria 1236
267 Ga0157378_10635794 3300013297 Bacteria 1081
268 Ga0157378_11696641 3300013297 Bacteria 679
269 Ga0163162_10014221 3300013306 Bacteria 7774
270 Ga0163162_10035656 3300013306 Unclassified 4956
271 Ga0163162_10194409 3300013306 Bacteria 2157
272 Ga0163162_10348689 3300013306 Bacteria 1613
273 Ga0163162_10714802 3300013306 Bacteria 1123
274 Ga0157372_10172545 3300013307 Bacteria 2502
275 Ga0157372_10866498 3300013307 Bacteria 1048
276 Ga0157372_11337715 3300013307 Bacteria 826
277 Ga0157375_10014567 3300013308 Bacteria 7020
278 Ga0157375_10026377 3300013308 Bacteria 5413
279 Ga0157375_10054492 3300013308 Bacteria 3939
280 Ga0157375_10084541 3300013308 Bacteria 3222
281 Ga0157375_10216524 3300013308 Unclassified 2073
282 Ga0157375_10247174 3300013308 Bacteria 1944
283 Ga0157375_12599766 3300013308 Bacteria 605
284 Ga0157375_13190090 3300013308 Bacteria 547
285 Ga0163163_10132130 3300014325 Bacteria 2537
286 Ga0163163_10174607 3300014325 Bacteria 2195
287 Ga0157380_10135568 3300014326 Bacteria 2106
288 Ga0157380_10274986 3300014326 Bacteria 1538
289 Ga0157380_10425925 3300014326 Bacteria 1267
290 Ga0157380_11229016 3300014326 Bacteria 794
291 Ga0157380_11693693 3300014326 Bacteria 690
292 Ga0182008_10087804 3300014497 Bacteria 1532
293 Ga0157377_10024330 3300014745 Bacteria 3218
294 Ga0157377_10331330 3300014745 Bacteria 1015
295 Ga0157379_10000029 3300014968 Bacteria 85625
296 Ga0157379_10018885 3300014968 Bacteria 6083
297 Ga0157379_10029724 3300014968 Bacteria 4859
298 Ga0157379_10065580 3300014968 Unclassified 3246
299 Ga0157379_10106915 3300014968 Bacteria 2512
300 Ga0157376_10017976 3300014969 Bacteria 5408
301 Ga0157376_10023767 3300014969 Bacteria 4803
302 Ga0157376_10045491 3300014969 Bacteria 3614
303 Ga0157376_10665376 3300014969 Bacteria 1043
304 Ga0182005_1008576 3300015265 Bacteria 3006
305 Ga0163161_10079509 3300017792 Bacteria 2411
306 Ga0163161_10235180 3300017792 Bacteria 1423
307 Ga0163161_11874897 3300017792 Bacteria 534
308 Ga0213876_10521858 3300021384 Bacteria 632
309 Ga0213875_10107622 3300021388 Bacteria 1301
310 Ga0207425_1000086 3300025245 Bacteria 94681
311 Ga0209129_1000174 3300025258 Bacteria 94671
312 Ga0207666_1011320 3300025271 Bacteria 1232
313 Ga0209673_1005117 3300025273 Bacteria 6719
314 Ga0207673_1009415 3300025290 Bacteria 1248
315 Ga0209676_1058010 3300025292 Bacteria 978
316 Ga0209025_1000367 3300025294 Bacteria 95238
317 Ga0209758_1000305 3300025297 Bacteria 95644
318 Ga0209050_1000026 3300025298 Bacteria 499134
319 Ga0209256_1041671 3300025299 Bacteria 1165
320 Ga0209051_1059104 3300025303 Bacteria 1217
321 Ga0209257_1000009 3300025304 Bacteria 1205047
322 Ga0207697_10000114 3300025315 Bacteria 37714
323 Ga0207656_10184825 3300025321 Bacteria 1002
324 Ga0207696_1000153 3300025711 Bacteria 119213
325 Ga0207682_10000010 3300025893 Bacteria 85697
326 Ga0207682_10592591 3300025893 Bacteria 523
327 Ga0207642_10026105 3300025899 Unclassified 2374
328 Ga0207642_10064600 3300025899 Bacteria 1716
329 Ga0207688_10000190 3300025901 Bacteria 27202
330 Ga0207688_10276936 3300025901 Bacteria 1021
331 Ga0207680_10026838 3300025903 Bacteria 3197
332 Ga0207680_10109193 3300025903 Unclassified 1791
333 Ga0207680_10135990 3300025903 Bacteria 1624
334 Ga0207647_10101760 3300025904 Bacteria 1704
335 Ga0207645_10017678 3300025907 Bacteria 4701
336 Ga0207645_10018159 3300025907 Bacteria 4635
337 Ga0207645_11054705 3300025907 Bacteria 549
338 Ga0207643_10000683 3300025908 Bacteria 21203
339 Ga0207643_10006779 3300025908 Bacteria 6145
340 Ga0207643_10018458 3300025908 Bacteria 3820
341 Ga0207705_11096104 3300025909 Bacteria 613
342 Ga0207684_10006867 3300025910 Bacteria 10303
343 Ga0207684_11662988 3300025910 Bacteria 515
344 Ga0207654_11166273 3300025911 Bacteria 561
345 Ga0207671_11513779 3300025914 Bacteria 518
346 Ga0207662_10000676 3300025918 Bacteria 15515
347 Ga0207662_11307836 3300025918 Bacteria 515
348 Ga0207657_11027114 3300025919 Bacteria 632
349 Ga0207649_11423502 3300025920 Bacteria 549
350 Ga0207646_10216351 3300025922 Bacteria 1731
351 Ga0207681_10051469 3300025923 Bacteria 2790
352 Ga0207681_10574329 3300025923 Bacteria 930
353 Ga0207694_11519263 3300025924 Bacteria 565
354 Ga0207694_11654451 3300025924 Bacteria 539
355 Ga0207650_10009050 3300025925 Bacteria 6806
356 Ga0207650_10018823 3300025925 Bacteria 4850
357 Ga0207650_10093729 3300025925 Bacteria 2299
358 Ga0207659_10095339 3300025926 Bacteria 2231
359 Ga0207659_10219368 3300025926 Bacteria 1528
360 Ga0207687_10305190 3300025927 Bacteria 1283
361 Ga0207687_10615678 3300025927 Bacteria 916
362 Ga0207687_10814082 3300025927 Bacteria 797
363 Ga0207687_11213768 3300025927 Bacteria 648
364 Ga0207700_11525963 3300025928 Bacteria 592
365 Ga0207664_10052474 3300025929 Bacteria 3225
366 Ga0207664_10652415 3300025929 Bacteria 946
367 Ga0207664_11525623 3300025929 Bacteria 590
368 Ga0207644_10059075 3300025931 Bacteria 2773
369 Ga0207644_10074314 3300025931 Bacteria 2494
370 Ga0207644_10091634 3300025931 Bacteria 2267
371 Ga0207644_10139187 3300025931 Bacteria 1867
372 Ga0207644_10312034 3300025931 Bacteria 1270
373 Ga0207690_10083812 3300025932 Bacteria 2233
374 Ga0207690_10086244 3300025932 Bacteria 2206
375 Ga0207690_11139141 3300025932 Bacteria 651
376 Ga0207706_10003578 3300025933 Bacteria 14835
377 Ga0207706_10340506 3300025933 Bacteria 1305
378 Ga0207706_11550379 3300025933 Bacteria 538
379 Ga0207709_10097580 3300025935 Bacteria 1936
380 Ga0207709_11167135 3300025935 Bacteria 634
381 Ga0207670_10101539 3300025936 Bacteria 2055
382 Ga0207670_10218421 3300025936 Bacteria 1458
383 Ga0207670_11857629 3300025936 Bacteria 512
384 Ga0207669_10049655 3300025937 Bacteria 2502
385 Ga0207669_10202695 3300025937 Bacteria 1441
386 Ga0207669_10416829 3300025937 Bacteria 1056
387 Ga0207704_10055435 3300025938 Bacteria 2422
388 Ga0207704_10907274 3300025938 Bacteria 741
389 Ga0207704_11486456 3300025938 Bacteria 581
390 Ga0207704_11631534 3300025938 Bacteria 554
391 Ga0207691_10003554 3300025940 Bacteria 15162
392 Ga0207691_10011788 3300025940 Bacteria 8390
393 Ga0207691_10158837 3300025940 Bacteria 1984
394 Ga0207691_10463599 3300025940 Bacteria 1078
395 Ga0207691_10762699 3300025940 Bacteria 814
396 Ga0207711_10033860 3300025941 Bacteria 4325
397 Ga0207711_10319576 3300025941 Bacteria 1434
398 Ga0207711_11056286 3300025941 Bacteria 752
399 Ga0207711_11144665 3300025941 Bacteria 719
400 Ga0207689_10000236 3300025942 Bacteria 49281
401 Ga0207689_10001266 3300025942 Bacteria 24364
402 Ga0207689_10004515 3300025942 Bacteria 12601
403 Ga0207689_10374826 3300025942 Bacteria 1185
404 Ga0207661_10066031 3300025944 Bacteria 2938
405 Ga0207679_10139832 3300025945 Bacteria 1955
406 Ga0207679_11414136 3300025945 Bacteria 638
407 Ga0207667_10148052 3300025949 Bacteria 2417
408 Ga0207667_11264495 3300025949 Bacteria 715
409 Ga0207667_12120217 3300025949 Bacteria 520
410 Ga0207651_10022645 3300025960 Bacteria 3846
411 Ga0207651_10141088 3300025960 Bacteria 1861
412 Ga0207651_10444403 3300025960 Bacteria 1111
413 Ga0207651_10492159 3300025960 Bacteria 1059
414 Ga0207651_10739022 3300025960 Bacteria 869
415 Ga0207651_11583830 3300025960 Bacteria 590
416 Ga0207712_10145971 3300025961 Bacteria 1821
417 Ga0207712_10179853 3300025961 Bacteria 1660
418 Ga0207712_10290695 3300025961 Bacteria 1337
419 Ga0207712_10654140 3300025961 Bacteria 913
420 Ga0207668_10022121 3300025972 Bacteria 4065
421 Ga0207668_10283880 3300025972 Bacteria 1359
422 Ga0207668_10830226 3300025972 Bacteria 819
423 Ga0207668_11067815 3300025972 Bacteria 723
424 Ga0207658_10006487 3300025986 Bacteria 7987
425 Ga0207658_10079951 3300025986 Bacteria 2502
426 Ga0207658_10246850 3300025986 Bacteria 1515
427 Ga0207658_10404861 3300025986 Bacteria 1200
428 Ga0207658_10479518 3300025986 Bacteria 1105
429 Ga0207658_10641937 3300025986 Bacteria 956
430 Ga0207658_10744425 3300025986 Bacteria 887
431 Ga0207677_10284799 3300026023 Bacteria 1358
432 Ga0207677_10293082 3300026023 Bacteria 1341
433 Ga0207677_10414914 3300026023 Bacteria 1145
434 Ga0207677_10925917 3300026023 Bacteria 787
435 Ga0207703_10001159 3300026035 Bacteria 24878
436 Ga0207703_10050347 3300026035 Bacteria 3371
437 Ga0207703_10051835 3300026035 Unclassified 3328
438 Ga0207703_10477004 3300026035 Bacteria 1168
439 Ga0207703_10774475 3300026035 Bacteria 915
440 Ga0207639_10276985 3300026041 Bacteria 1474
441 Ga0207678_10013427 3300026067 Bacteria 7190
442 Ga0207678_10044680 3300026067 Bacteria 3831
443 Ga0207678_11765326 3300026067 Bacteria 542
444 Ga0207708_10002325 3300026075 Bacteria 13957
445 Ga0207708_10930214 3300026075 Bacteria 753
446 Ga0207708_11282923 3300026075 Bacteria 641
447 Ga0207702_10309153 3300026078 Bacteria 1502
448 Ga0207702_11393532 3300026078 Bacteria 695
449 Ga0207641_10110952 3300026088 Bacteria 2431
450 Ga0207641_10121508 3300026088 Bacteria 2331
451 Ga0207641_10187798 3300026088 Bacteria 1897
452 Ga0207641_11070724 3300026088 Bacteria 804
453 Ga0207648_10000823 3300026089 Bacteria 35061
454 Ga0207648_10001240 3300026089 Bacteria 28641
455 Ga0207648_10008577 3300026089 Bacteria 9887
456 Ga0207648_10036889 3300026089 Unclassified 4306
457 Ga0207648_10710924 3300026089 Bacteria 931
458 Ga0207676_10005653 3300026095 Bacteria 8852
459 Ga0207676_10012924 3300026095 Bacteria 5996
460 Ga0207676_10429666 3300026095 Bacteria 1241
461 Ga0207674_10001726 3300026116 Bacteria 27948
462 Ga0207674_10145192 3300026116 Bacteria 2331
463 Ga0207674_10174241 3300026116 Bacteria 2104
464 Ga0207675_100000242 3300026118 Bacteria 52003
465 Ga0207675_100000778 3300026118 Bacteria 31816
466 Ga0207675_100001080 3300026118 Bacteria 27005
467 Ga0207675_100020960 3300026118 Bacteria 6095
468 Ga0207675_100557029 3300026118 Bacteria 1146
469 Ga0207683_10088493 3300026121 Bacteria 2755
470 Ga0207683_10582512 3300026121 Bacteria 1035
471 Ga0207683_10871809 3300026121 Bacteria 836
472 Ga0207698_10146646 3300026142 Bacteria 2042
473 Ga0207698_10219685 3300026142 Bacteria 1716
474 Ga0207698_10697497 3300026142 Bacteria 1010
475 Ga0207698_11338828 3300026142 Bacteria 731
476 Ga0209966_1127403 3300027695 Bacteria 587
477 Ga0209998_10024852 3300027717 Bacteria 1302
478 Ga0207428_10111867 3300027907 Bacteria 2101
479 Ga0268266_10023814 3300028379 Bacteria 5211
480 Ga0268266_10333845 3300028379 Unclassified 1421
481 Ga0268266_10781564 3300028379 Bacteria 922
482 Ga0268266_11500417 3300028379 Bacteria 650
483 Ga0268265_10020966 3300028380 Bacteria 4569
484 Ga0268265_10034277 3300028380 Bacteria 3698
485 Ga0268265_10134764 3300028380 Bacteria 2058
486 Ga0268265_10382245 3300028380 Bacteria 1296
487 Ga0268265_12565811 3300028380 Bacteria 515
488 Ga0268264_10005449 3300028381 Bacteria 10782
489 Ga0268264_10019372 3300028381 Bacteria 5562
490 Ga0268264_10039488 3300028381 Bacteria 3900
491 Ga0268264_10052175 3300028381 Unclassified 3409
492 Ga0268264_10467069 3300028381 Bacteria 1225
493 Ga0265338_10026205 3300028800 Bacteria 5889
494 Ga0307511_10069347 3300030521 Bacteria 2593
495 Ga0265340_10150008 3300031247 Bacteria 1063
496 Ga0307408_101077452 3300031548 Bacteria 744
497 Ga0307408_101718259 3300031548 Bacteria 598
498 Ga0316575_10004749 3300031665 Bacteria 4794
499 Ga0316575_10096260 3300031665 Bacteria 1201
500 Ga0316576_10146198 3300031727 Bacteria 1781
501 Ga0307405_10636523 3300031731 Bacteria 875
502 Ga0307413_11756787 3300031824 Bacteria 554
503 Ga0307406_10024801 3300031901 Bacteria 3585
504 Ga0307412_10001601 3300031911 Bacteria 12474
505 Ga0307412_11953158 3300031911 Bacteria 542
506 Ga0307409_101530957 3300031995 Bacteria 695
507 Ga0307416_100229851 3300032002 Bacteria 1787
508 Ga0307414_10124795 3300032004 Bacteria 1987
509 Ga0316585_10056829 3300032137 Bacteria 1260
510 Ga0373923_0499689 3300035111 Bacteria 593
511 Ga0373936_0254074 3300035113 Bacteria 786
512 Ga0373953_0176442 3300035117 Bacteria 921
513 Ga0373956_0466330 3300035119 Bacteria 603
514 Ga0373957_0072571 3300035120 Bacteria 1348
515 Ga0373957_0117486 3300035120 Bacteria 1075
516 Ga0373943_0568647 3300035170 Bacteria 666
517 Ga0373946_0517419 3300035171 Bacteria 613
518 Ga0316574_0067500 3300035398 Bacteria 2255
519 Ga0316574_0432706 3300035398 Bacteria 826
520 Ga0373924_0101564 3300035410 Bacteria 1238
521 Ga0373935_1259469 3300035692 Bacteria 552
522 Ga0373933_0094901 3300035724 Bacteria 1845
523 Ga0373933_0444202 3300035724 Bacteria 848
524 Ga0373947_0357278 3300035725 Bacteria 981
525 Ga0373937_0058885 3300036401 Bacteria 3529
526 Ga0373937_0110376 3300036401 Bacteria 2558
527 Ga0373937_0145259 3300036401 Bacteria 2220
528 Ga0373937_0318167 3300036401 Unclassified 1472
529 Ga0373937_0470314 3300036401 Bacteria 1194
530 Ga0373937_1727602 3300036401 Bacteria 572
531 Ga0316582_0221359 3300036647 Bacteria 1294
532 Ga0316582_0822652 3300036647 Bacteria 636
533 Ga0316584_0095501 3300036712 Bacteria 2225
534 Ga0316584_0631090 3300036712 Bacteria 740
535 Ga0373925_0831893 3300037068 Bacteria 761
536 Ga0436364_0530696 3300037853 Bacteria 8047
537 Ga0237819_09762 3300038705 Bacteria 1278
538 Ga0400483_098493 3300039062 Unclassified 1014
539 Ga0400483_237847 3300039062 Bacteria 1961
540 Ga0436365_1286208 3300039437 Bacteria 4755
541 Ga0451800_1669862 3300041459 Bacteria 584
542 Ga0451802_2113515 3300041460 Bacteria 568
543 Ga0451807_1509185 3300041486 Bacteria 550
544 Ga0451833_0514785 3300041491 Bacteria 674
545 Ga0451841_0243136 3300041498 Bacteria 2234
546 Ga0451849_1308335 3300041505 Bacteria 639
547 Ga0451853_0008175 3300041512 Bacteria 1646
548 Ga0451853_3871611 3300041512 Bacteria 1140
549 Ga0439448_0314555 3300042005 Bacteria 557
550 Ga0450914_033132 3300042118 Bacteria 630
551 Ga0451577_0081527 3300042876 Bacteria 2886
552 Ga0453684_0000019 3300044712 Bacteria 908702
553 Ga0495592_0301233 3300046454 Bacteria 1042
554 Ga0495603_0607043 3300046455 Bacteria 626
555 Ga0495629_0149722 3300046459 Bacteria 1622
556 Ga0495629_0654201 3300046459 Bacteria 700
557 Ga0495651_0199424 3300046462 Bacteria 1402
558 Ga0495580_0127379 3300046472 Bacteria 1767
559 Ga0495580_0585166 3300046472 Bacteria 739
560 Ga0495582_0069700 3300046473 Bacteria 1945
561 Ga0495639_0138700 3300046475 Bacteria 1168
562 Ga0495664_0137173 3300046477 Unclassified 1482
563 Ga0495596_0336123 3300046500 Bacteria 588
564 Ga0495608_0282497 3300046511 Bacteria 1030
565 Ga0495628_0145659 3300046516 Bacteria 1806
566 Ga0495628_0256122 3300046516 Bacteria 1305
567 Ga0495652_0816741 3300046529 Bacteria 620
568 Ga0495665_0006822 3300046531 Bacteria 6160
569 Ga0495640_0211533 3300046533 Bacteria 1226
570 Ga0495587_0220054 3300046536 Bacteria 1071
571 Ga0495598_0125823 3300046537 Bacteria 874
572 Ga0495621_0005534 3300046539 Bacteria 3635
573 Ga0495621_0010634 3300046539 Bacteria 2823
574 Ga0495645_0081321 3300046543 Bacteria 2324
575 Ga0495633_0220641 3300046558 Bacteria 868
576 Ga0495667_0202727 3300046559 Bacteria 1269
577 Ga0495635_0265162 3300046663 Bacteria 1156
578 Ga0495635_0887865 3300046663 Bacteria 571
579 Ga0495657_0160222 3300046675 Bacteria 1393
580 Ga0495623_0307090 3300046679 Bacteria 875
581 Ga0495647_0002277 3300046681 Bacteria 6022
582 Ga0495647_0100865 3300046681 Bacteria 1195
583 Ga0495658_0005339 3300046683 Bacteria 6320
584 Ga0495658_0399019 3300046683 Bacteria 877
585 Ga0495658_0547379 3300046683 Bacteria 741
586 Ga0495658_1051791 3300046683 Bacteria 519
587 Ga0495613_0324243 3300046689 Bacteria 1063
588 Ga0495589_0031426 3300046794 Bacteria 2673
589 Ga0495600_0251627 3300046809 Bacteria 1124
590 Ga0495600_0324470 3300046809 Bacteria 968
591 Ga0495581_0102655 3300047315 Bacteria 1661
592 Ga0495676_0704610 3300047321 Bacteria 653
593 Ga0495681_0086463 3300047470 Bacteria 1391
594 Ga0495684_0175701 3300047471 Bacteria 1590
595 Ga0496100_0178514 3300048903 Bacteria 1534
596 Ga0496101_0006056 3300048904 Bacteria 7761
597 Ga0496101_0009385 3300048904 Bacteria 6430
598 Ga0496101_0080612 3300048904 Bacteria 2405
599 Ga0496101_1154045 3300048904 Bacteria 608
600 Ga0496102_0224056 3300048905 Bacteria 1773
601 Ga0496102_1263885 3300048905 Bacteria 657
602 Ga0496104_0054565 3300048907 Bacteria 3777
603 Ga0496105_0065146 3300048908 Bacteria 3008
604 Ga0496106_0084629 3300048909 Bacteria 2440
605 Ga0496107_0017330 3300048910 Bacteria 5065
606 Ga0496108_0007375 3300048911 Bacteria 8915
607 Ga0496108_1034796 3300048911 Bacteria 700
608 Ga0496108_1767876 3300048911 Bacteria 507
609 Ga0496109_0020123 3300048912 Bacteria 5895
610 Ga0496109_0037719 3300048912 Bacteria 4367
611 Ga0496110_0011869 3300048913 Bacteria 7156
612 Ga0496110_0865500 3300048913 Bacteria 809
613 Ga0496110_1438136 3300048913 Bacteria 599
614 Ga0496112_0800977 3300048915 Bacteria 867
615 Ga0496112_1703263 3300048915 Bacteria 543
616 Ga0496113_0042905 3300048916 Bacteria 3344
617 Ga0496114_0139321 3300048917 Bacteria 2099
618 Ga0496114_0456892 3300048917 Bacteria 1131
619 Ga0496114_0518678 3300048917 Bacteria 1054
620 Ga0496114_1539661 3300048917 Bacteria 553
621 Ga0496116_0000216 3300048919 Bacteria 108542
622 Ga0496116_0003659 3300048919 Bacteria 15088
623 Ga0496116_0061770 3300048919 Bacteria 2424
624 Ga0496117_0001639 3300048920 Bacteria 31496
625 Ga0496117_0041934 3300048920 Bacteria 3345
626 Ga0496118_0002026 3300048921 Bacteria 28649
627 Ga0496118_0004361 3300048921 Bacteria 16835
628 Ga0496119_0006934 3300048922 Bacteria 10334
629 Ga0496119_0021874 3300048922 Bacteria 4601
630 Ga0496120_0201897 3300048923 Bacteria 962
631 Ga0496121_0013219 3300048924 Bacteria 8894
632 Ga0496121_0377350 3300048924 Bacteria 936
633 Ga0496122_0002437 3300048925 Bacteria 26428
634 Ga0496122_0011284 3300048925 Bacteria 9074
635 Ga0496122_0020568 3300048925 Bacteria 5954
636 Ga0496122_0023441 3300048925 Bacteria 5441
637 Ga0496122_0065708 3300048925 Bacteria 2628
638 Ga0496122_0340553 3300048925 Bacteria 788
639 Ga0496123_0030486 3300048926 Bacteria 3947
640 Ga0496123_0036742 3300048926 Bacteria 3467
641 Ga0496123_0037020 3300048926 Bacteria 3450
642 Ga0496123_0062629 3300048926 Bacteria 2382
643 Ga0496123_0251344 3300048926 Bacteria 872
644 Ga0496124_0000023 3300048927 Bacteria 415226
645 Ga0496124_0000507 3300048927 Bacteria 66974
646 Ga0496124_0041869 3300048927 Bacteria 3947
647 Ga0496124_0201922 3300048927 Bacteria 1511
648 Ga0496125_0000178 3300048928 Bacteria 139900
649 Ga0496125_0001277 3300048928 Bacteria 37394
650 Ga0496125_0053178 3300048928 Bacteria 3322
651 Ga0496125_0065656 3300048928 Bacteria 2873
652 Ga0496125_0112912 3300048928 Bacteria 1962
653 Ga0496125_0547530 3300048928 Bacteria 642
654 Ga0496125_0671305 3300048928 Bacteria 554
655 Ga0496126_0047707 3300048929 Bacteria 3920
656 Ga0496126_0131230 3300048929 Bacteria 2165
657 Ga0496126_0132341 3300048929 Bacteria 2154
658 Ga0501031_0001266 3300049568 Bacteria 15469
659 Ga0501031_0001923 3300049568 Bacteria 13094
660 Ga0501031_0012669 3300049568 Bacteria 5506
661 Ga0501032_0018403 3300049569 Bacteria 4896
662 Ga0501032_0098350 3300049569 Bacteria 1939
663 Ga0501032_0116940 3300049569 Unclassified 1763
664 Ga0501033_0105762 3300049570 Bacteria 2051
665 Ga0501034_0001318 3300049571 Bacteria 33588
666 Ga0501034_0093979 3300049571 Bacteria 2995
667 Ga0501034_0096167 3300049571 Bacteria 2958
668 Ga0501036_0004316 3300049572 Bacteria 11478
669 Ga0501036_0028421 3300049572 Unclassified 4726
670 Ga0501036_0117763 3300049572 Bacteria 2243
671 Ga0501036_0766214 3300049572 Bacteria 796
672 Ga0501036_1079471 3300049572 Bacteria 656
673 Ga0501036_1419019 3300049572 Bacteria 563
674 Ga0501037_0018188 3300049573 Bacteria 5178
675 Ga0501037_0039289 3300049573 Bacteria 3484
676 Ga0501037_0057540 3300049573 Unclassified 2838
677 Ga0501038_0029848 3300049574 Bacteria 4830
678 Ga0501038_0079400 3300049574 Bacteria 2767
679 Ga0501038_0128551 3300049574 Unclassified 2083
680 Ga0501039_0035622 3300049575 Bacteria 3841
681 Ga0501039_0058508 3300049575 Bacteria 2985
682 Ga0501039_0066129 3300049575 Bacteria 2806
683 Ga0501039_0162707 3300049575 Unclassified 1754
684 Ga0501039_0249574 3300049575 Bacteria 1395
685 Ga0501039_0483755 3300049575 Unclassified 972
686 Ga0501039_0639407 3300049575 Bacteria 833
687 Ga0501039_0868111 3300049575 Bacteria 703
688 Ga0501039_0886344 3300049575 Bacteria 695
689 Ga0501040_0051118 3300049576 Bacteria 2828
690 Ga0501040_0122931 3300049576 Bacteria 1822
691 Ga0501040_0167533 3300049576 Bacteria 1555
692 Ga0501041_0000706 3300049577 Bacteria 17758
693 Ga0501041_0125523 3300049577 Unclassified 1597
694 Ga0501042_0013627 3300049578 Bacteria 5536
695 Ga0501042_0049642 3300049578 Bacteria 2993
696 Ga0501042_0103710 3300049578 Bacteria 2046
697 Ga0501042_0898333 3300049578 Bacteria 645
698 Ga0501043_0083636 3300049579 Bacteria 2509
699 Ga0501043_0209855 3300049579 Unclassified 1510
700 Ga0501043_0305559 3300049579 Bacteria 1215
701 Ga0501043_0430864 3300049579 Bacteria 993
702 Ga0501043_0525314 3300049579 Bacteria 882
703 Ga0501046_0013301 3300049580 Bacteria 6971
704 Ga0501046_0026917 3300049580 Unclassified 4696
705 Ga0501046_0214055 3300049580 Bacteria 1429
706 Ga0501047_0471383 3300049581 Bacteria 1084
707 Ga0501048_0018522 3300049582 Bacteria 5118
708 Ga0501048_0071133 3300049582 Unclassified 2456
709 Ga0501048_1376991 3300049582 Bacteria 507
710 Ga0501068_0005874 3300049584 Bacteria 6735
711 Ga0501068_0971986 3300049584 Bacteria 560
712 Ga0501070_0378919 3300049586 Bacteria 1146
713 Ga0501071_0270343 3300049587 Bacteria 1285
714 Ga0501071_1282916 3300049587 Bacteria 566
715 Ga0501072_0024480 3300049588 Bacteria 4696
716 Ga0501072_0769328 3300049588 Bacteria 755
717 Ga0501073_0167027 3300049589 Bacteria 1523
718 Ga0501073_0197323 3300049589 Bacteria 1392
719 Ga0501074_0096127 3300049590 Bacteria 2121
720 Ga0501074_0391910 3300049590 Bacteria 985
721 Ga0501074_1050650 3300049590 Bacteria 572
722 Ga0501076_0102647 3300049592 Bacteria 2306
723 Ga0501076_0115424 3300049592 Bacteria 2173
724 Ga0501076_0605323 3300049592 Bacteria 904
725 Ga0501077_0056116 3300049593 Bacteria 2500
726 Ga0501261_010250 3300049690 Bacteria 1232
727 Ga0501079_0906223 3300049741 Bacteria 694
728 Ga0501080_0113382 3300049742 Bacteria 2513
729 Ga0501080_0299886 3300049742 Bacteria 1458
730 Ga0501080_1319046 3300049742 Bacteria 618
731 Ga0501083_0021948 3300049744 Bacteria 4433
732 Ga0501083_0181865 3300049744 Bacteria 1373
733 Ga0501083_0514492 3300049744 Bacteria 779
734 Ga0501035_0153789 3300049822 Bacteria 1995
735 Ga0501035_0389346 3300049822 Bacteria 1161
736 Ga0501044_0455603 3300049823 Bacteria 1185
737 Ga0501045_0706658 3300049824 Bacteria 744
738 Ga0501045_1316376 3300049824 Bacteria 526
739 nmdc:mga00v17_159201_c1 3300050491 Bacteria 1453
740 nmdc:mga00v17_335070_c1 3300050491 Bacteria 983
741 nmdc:mga0yw44_663256_c1 3300050492 Bacteria 709
742 nmdc:mga0k408_486055_c1 3300050493 Bacteria 732
743 nmdc:mga08y16_22414_c1 3300050511 Bacteria 6666
744 nmdc:mga08y16_640413_c1 3300050511 Bacteria 1068
745 nmdc:mga0n895_467063_c1 3300050512 Bacteria 1273
746 nmdc:mga0rr50_1664064_c1 3300050513 Bacteria 538
747 Ga0495601_0296851 3300053077 Bacteria 1053
748 Ga0495601_0798166 3300053077 Bacteria 599
749 Ga0495619_0161688 3300053085 Bacteria 1547
750 Ga0495619_0331678 3300053085 Bacteria 1053
751 Ga0501084_0693247 3300054114 Bacteria 859
752 Ga0501084_1834987 3300054114 Bacteria 506
753 Ga0590071_131006 3300059421 Bacteria 644
754 Ga0501082_0020590 3300060353 Bacteria 5686
755 Ga0501082_0135038 3300060353 Bacteria 2141
756 Ga0530510_0143760 3300061734 Bacteria 1759
757 Ga0530510_1459567 3300061734 Bacteria 525

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 2162886006 SwRhRL3b_contig_174203 SwRhRL3b_0888.00000170 100
2 3300002076 JGI24749J21850_1023943 JGI24749J21850_10239432 100
3 3300002773 JGI25152J39213_1001127 JGI25152J39213_100112713 100
4 3300002774 JGI25150J39212_1000188 JGI25150J39212_100018819 100
5 3300003187 JGI25151J46595_10000144 JGI25151J46595_1000014470 100
6 3300003215 JGI25153J46596_10004242 JGI25153J46596_100042426 100
7 3300003578 Ga0006562J51391_1013837 Ga0006562J51391_10138378 100
8 3300003794 Ga0055531_10000016 Ga0055531_1000001695 100
9 3300004801 Ga0058860_11876603 Ga0058860_118766032 100
10 3300005290 Ga0065712_10402592 Ga0065712_104025921 100
11 3300005293 Ga0065715_10218623 Ga0065715_102186231 100
12 3300005293 Ga0065715_10483344 Ga0065715_104833442 100
13 3300005295 Ga0065707_10089627 Ga0065707_100896273 100
14 3300005327 Ga0070658_10519064 Ga0070658_105190642 100
15 3300005328 Ga0070676_10021967 Ga0070676_100219673 100
16 3300005328 Ga0070676_10047155 Ga0070676_100471554 100
17 3300005328 Ga0070676_10646725 Ga0070676_106467252 100
18 3300005329 Ga0070683_100001269 Ga0070683_1000012692 100
19 3300005329 Ga0070683_102334735 Ga0070683_1023347351 100
20 3300005330 Ga0070690_100009590 Ga0070690_1000095907 100
21 3300005330 Ga0070690_100142054 Ga0070690_1001420542 100
22 3300005330 Ga0070690_100263557 Ga0070690_1002635572 100
23 3300005330 Ga0070690_100313169 Ga0070690_1003131692 100
24 3300005330 Ga0070690_100317765 Ga0070690_1003177652 100
25 3300005330 Ga0070690_100821472 Ga0070690_1008214721 100
26 3300005331 Ga0070670_100022326 Ga0070670_1000223266 100
27 3300005331 Ga0070670_100085419 Ga0070670_1000854192 100
28 3300005333 Ga0070677_10018921 Ga0070677_100189212 100
29 3300005333 Ga0070677_10262136 Ga0070677_102621362 100
30 3300005333 Ga0070677_10304148 Ga0070677_103041482 100
31 3300005334 Ga0068869_100001950 Ga0068869_1000019503 100
32 3300005334 Ga0068869_100004242 Ga0068869_1000042424 100
33 3300005334 Ga0068869_100023317 Ga0068869_1000233173 100
34 3300005334 Ga0068869_100440082 Ga0068869_1004400823 100
35 3300005335 Ga0070666_10105159 Ga0070666_101051592 100
36 3300005335 Ga0070666_10114198 Ga0070666_101141983 100
37 3300005337 Ga0070682_100816746 Ga0070682_1008167461 100
38 3300005338 Ga0068868_100055282 Ga0068868_1000552822 100
39 3300005338 Ga0068868_100153754 Ga0068868_1001537543 100
40 3300005338 Ga0068868_100537997 Ga0068868_1005379972 100
41 3300005338 Ga0068868_101453545 Ga0068868_1014535452 100
42 3300005339 Ga0070660_101631925 Ga0070660_1016319252 100
43 3300005340 Ga0070689_100022692 Ga0070689_1000226925 100
44 3300005341 Ga0070691_10890182 Ga0070691_108901821 100
45 3300005343 Ga0070687_100005582 Ga0070687_1000055825 100
46 3300005343 Ga0070687_100367773 Ga0070687_1003677733 100
47 3300005343 Ga0070687_100528530 Ga0070687_1005285302 100
48 3300005345 Ga0070692_10137666 Ga0070692_101376662 100
49 3300005345 Ga0070692_11275733 Ga0070692_112757331 100
50 3300005347 Ga0070668_100018888 Ga0070668_1000188882 100
51 3300005347 Ga0070668_100062328 Ga0070668_1000623283 100
52 3300005347 Ga0070668_100562195 Ga0070668_1005621952 100
53 3300005353 Ga0070669_100805034 Ga0070669_1008050342 100
54 3300005355 Ga0070671_100044597 Ga0070671_1000445973 100
55 3300005355 Ga0070671_100323505 Ga0070671_1003235053 100
56 3300005355 Ga0070671_100328198 Ga0070671_1003281983 100
57 3300005355 Ga0070671_100476966 Ga0070671_1004769661 100
58 3300005356 Ga0070674_100067262 Ga0070674_1000672623 100
59 3300005356 Ga0070674_100464027 Ga0070674_1004640271 100
60 3300005364 Ga0070673_100012165 Ga0070673_1000121653 100
61 3300005364 Ga0070673_100119998 Ga0070673_1001199982 100
62 3300005364 Ga0070673_100206006 Ga0070673_1002060063 100
63 3300005364 Ga0070673_100814492 Ga0070673_1008144922 100
64 3300005364 Ga0070673_102208374 Ga0070673_1022083741 100
65 3300005365 Ga0070688_100132455 Ga0070688_1001324552 100
66 3300005366 Ga0070659_100005665 Ga0070659_1000056657 100
67 3300005366 Ga0070659_100293260 Ga0070659_1002932601 100
68 3300005366 Ga0070659_101307836 Ga0070659_1013078362 100
69 3300005367 Ga0070667_100036887 Ga0070667_1000368873 100
70 3300005367 Ga0070667_100164905 Ga0070667_1001649051 100
71 3300005367 Ga0070667_100293370 Ga0070667_1002933702 100
72 3300005367 Ga0070667_101067443 Ga0070667_1010674432 100
73 3300005406 Ga0070703_10198427 Ga0070703_101984271 100
74 3300005435 Ga0070714_100141653 Ga0070714_1001416533 100
75 3300005435 Ga0070714_100923287 Ga0070714_1009232872 100
76 3300005435 Ga0070714_102478166 Ga0070714_1024781661 100
77 3300005436 Ga0070713_101299495 Ga0070713_1012994952 100
78 3300005438 Ga0070701_10154661 Ga0070701_101546612 100
79 3300005438 Ga0070701_10393920 Ga0070701_103939202 100
80 3300005438 Ga0070701_10545045 Ga0070701_105450452 100
81 3300005438 Ga0070701_10653305 Ga0070701_106533051 100
82 3300005440 Ga0070705_100099878 Ga0070705_1000998783 100
83 3300005440 Ga0070705_100142372 Ga0070705_1001423722 100
84 3300005441 Ga0070700_100247275 Ga0070700_1002472753 100
85 3300005441 Ga0070700_101395585 Ga0070700_1013955852 100
86 3300005444 Ga0070694_101099014 Ga0070694_1010990141 100
87 3300005445 Ga0070708_100782917 Ga0070708_1007829172 100
88 3300005445 Ga0070708_101572116 Ga0070708_1015721161 100
89 3300005455 Ga0070663_100041108 Ga0070663_1000411084 100
90 3300005455 Ga0070663_100525545 Ga0070663_1005255452 100
91 3300005456 Ga0070678_100040424 Ga0070678_1000404242 100
92 3300005456 Ga0070678_100183155 Ga0070678_1001831552 100
93 3300005456 Ga0070678_100345348 Ga0070678_1003453482 100
94 3300005456 Ga0070678_100361993 Ga0070678_1003619932 100
95 3300005456 Ga0070678_100510258 Ga0070678_1005102583 100
96 3300005457 Ga0070662_100275970 Ga0070662_1002759703 100
97 3300005459 Ga0068867_100002417 Ga0068867_10000241712 100
98 3300005459 Ga0068867_100175454 Ga0068867_1001754541 100
99 3300005459 Ga0068867_100432941 Ga0068867_1004329412 100
100 3300005459 Ga0068867_100672655 Ga0068867_1006726551 100
101 3300005466 Ga0070685_10002936 Ga0070685_100029364 100
102 3300005466 Ga0070685_10271149 Ga0070685_102711492 100
103 3300005467 Ga0070706_100008183 Ga0070706_1000081833 100
104 3300005468 Ga0070707_100268319 Ga0070707_1002683192 100
105 3300005468 Ga0070707_100713285 Ga0070707_1007132853 100
106 3300005535 Ga0070684_100038607 Ga0070684_1000386072 100
107 3300005536 Ga0070697_100051475 Ga0070697_1000514753 100
108 3300005539 Ga0068853_100091069 Ga0068853_1000910693 100
109 3300005539 Ga0068853_100447911 Ga0068853_1004479112 100
110 3300005543 Ga0070672_100074657 Ga0070672_1000746573 100
111 3300005543 Ga0070672_100266915 Ga0070672_1002669152 100
112 3300005543 Ga0070672_100284460 Ga0070672_1002844604 100
113 3300005543 Ga0070672_101204137 Ga0070672_1012041372 100
114 3300005543 Ga0070672_101804567 Ga0070672_1018045672 100
115 3300005545 Ga0070695_100082935 Ga0070695_1000829351 100
116 3300005545 Ga0070695_101500815 Ga0070695_1015008151 100
117 3300005545 Ga0070695_101725436 Ga0070695_1017254361 100
118 3300005546 Ga0070696_100260072 Ga0070696_1002600722 100
119 3300005546 Ga0070696_100461079 Ga0070696_1004610792 100
120 3300005546 Ga0070696_100712420 Ga0070696_1007124202 100
121 3300005546 Ga0070696_101568302 Ga0070696_1015683022 100
122 3300005547 Ga0070693_100046196 Ga0070693_1000461962 100
123 3300005547 Ga0070693_100867161 Ga0070693_1008671612 100
124 3300005548 Ga0070665_100231596 Ga0070665_1002315963 100
125 3300005548 Ga0070665_100453481 Ga0070665_1004534811 100
126 3300005549 Ga0070704_100507774 Ga0070704_1005077742 100
127 3300005549 Ga0070704_100563638 Ga0070704_1005636383 100
128 3300005549 Ga0070704_100800570 Ga0070704_1008005702 100
129 3300005549 Ga0070704_101498009 Ga0070704_1014980092 100
130 3300005563 Ga0068855_100155160 Ga0068855_1001551603 100
131 3300005563 Ga0068855_100190496 Ga0068855_1001904963 100
132 3300005563 Ga0068855_100645153 Ga0068855_1006451533 100
133 3300005564 Ga0070664_100095292 Ga0070664_1000952923 100
134 3300005564 Ga0070664_100298787 Ga0070664_1002987873 100
135 3300005577 Ga0068857_100038087 Ga0068857_1000380875 100
136 3300005577 Ga0068857_100378661 Ga0068857_1003786612 100
137 3300005577 Ga0068857_100519881 Ga0068857_1005198812 100
138 3300005577 Ga0068857_101029673 Ga0068857_1010296732 100
139 3300005578 Ga0068854_100097670 Ga0068854_1000976703 100
140 3300005614 Ga0068856_101701191 Ga0068856_1017011911 100
141 3300005615 Ga0070702_100057345 Ga0070702_1000573453 100
142 3300005615 Ga0070702_100629936 Ga0070702_1006299361 100
143 3300005615 Ga0070702_101697150 Ga0070702_1016971501 100
144 3300005616 Ga0068852_100052141 Ga0068852_1000521414 100
145 3300005616 Ga0068852_100355784 Ga0068852_1003557842 100
146 3300005616 Ga0068852_100705934 Ga0068852_1007059341 100
147 3300005617 Ga0068859_100006120 Ga0068859_10000612010 100
148 3300005617 Ga0068859_100026047 Ga0068859_1000260472 100
149 3300005617 Ga0068859_100052757 Ga0068859_1000527574 100
150 3300005617 Ga0068859_100499965 Ga0068859_1004999652 100
151 3300005617 Ga0068859_100762010 Ga0068859_1007620102 100
152 3300005617 Ga0068859_102177964 Ga0068859_1021779641 100
153 3300005618 Ga0068864_100000600 Ga0068864_10000060027 100
154 3300005618 Ga0068864_100004298 Ga0068864_1000042984 100
155 3300005618 Ga0068864_100518495 Ga0068864_1005184952 100
156 3300005718 Ga0068866_10037854 Ga0068866_100378543 100
157 3300005718 Ga0068866_10056076 Ga0068866_100560763 100
158 3300005719 Ga0068861_100007311 Ga0068861_1000073114 100
159 3300005719 Ga0068861_100752076 Ga0068861_1007520762 100
160 3300005719 Ga0068861_101799218 Ga0068861_1017992181 100
161 3300005834 Ga0068851_10102068 Ga0068851_101020683 100
162 3300005834 Ga0068851_10124015 Ga0068851_101240152 100
163 3300005840 Ga0068870_10003580 Ga0068870_100035808 100
164 3300005840 Ga0068870_10297723 Ga0068870_102977233 100
165 3300005841 Ga0068863_100000563 Ga0068863_10000056339 100
166 3300005841 Ga0068863_100083649 Ga0068863_1000836493 100
167 3300005841 Ga0068863_100220340 Ga0068863_1002203403 100
168 3300005841 Ga0068863_100291206 Ga0068863_1002912062 100
169 3300005841 Ga0068863_101946986 Ga0068863_1019469862 100
170 3300005842 Ga0068858_100002972 Ga0068858_1000029722 100
171 3300005842 Ga0068858_100022537 Ga0068858_1000225373 100
172 3300005842 Ga0068858_100141545 Ga0068858_1001415452 100
173 3300005842 Ga0068858_100348162 Ga0068858_1003481623 100
174 3300005842 Ga0068858_100372386 Ga0068858_1003723863 100
175 3300005843 Ga0068860_100026286 Ga0068860_1000262863 100
176 3300005843 Ga0068860_100046827 Ga0068860_1000468274 100
177 3300005843 Ga0068860_100049100 Ga0068860_1000491005 100
178 3300005843 Ga0068860_100050809 Ga0068860_1000508093 100
179 3300005843 Ga0068860_100095533 Ga0068860_1000955335 100
180 3300005844 Ga0068862_100006488 Ga0068862_1000064883 100
181 3300005844 Ga0068862_100044301 Ga0068862_1000443013 100
182 3300005844 Ga0068862_100136363 Ga0068862_1001363632 100
183 3300005844 Ga0068862_100612293 Ga0068862_1006122933 100
184 3300005937 Ga0081455_10020855 Ga0081455_100208553 100
185 3300006038 Ga0075365_10135592 Ga0075365_101355923 100
186 3300006038 Ga0075365_10712191 Ga0075365_107121911 100
187 3300006038 Ga0075365_11189469 Ga0075365_111894692 100
188 3300006051 Ga0075364_10039619 Ga0075364_100396192 100
189 3300006051 Ga0075364_10349933 Ga0075364_103499332 100
190 3300006163 Ga0070715_10777341 Ga0070715_107773412 100
191 3300006173 Ga0070716_101401744 Ga0070716_1014017442 100
192 3300006178 Ga0075367_10766291 Ga0075367_107662911 100
193 3300006237 Ga0097621_100006633 Ga0097621_1000066332 100
194 3300006237 Ga0097621_100558662 Ga0097621_1005586622 100
195 3300006237 Ga0097621_101229560 Ga0097621_1012295602 100
196 3300006358 Ga0068871_100072093 Ga0068871_1000720935 100
197 3300006358 Ga0068871_100094134 Ga0068871_1000941341 100
198 3300006358 Ga0068871_100796543 Ga0068871_1007965432 100
199 3300006871 Ga0075434_100528269 Ga0075434_1005282692 100
200 3300006881 Ga0068865_100084405 Ga0068865_1000844053 100
201 3300006881 Ga0068865_100125116 Ga0068865_1001251164 100
202 3300006881 Ga0068865_100342552 Ga0068865_1003425522 100
203 3300006881 Ga0068865_100547267 Ga0068865_1005472672 100
204 3300006931 Ga0097620_100006120 Ga0097620_10000612010 100
205 3300006931 Ga0097620_100026046 Ga0097620_1000260462 100
206 3300006931 Ga0097620_100052758 Ga0097620_1000527584 100
207 3300006931 Ga0097620_100499974 Ga0097620_1004999742 100
208 3300006931 Ga0097620_100762020 Ga0097620_1007620202 100
209 3300006931 Ga0097620_102178219 Ga0097620_1021782191 100
210 3300009092 Ga0105250_10000022 Ga0105250_1000002223 100
211 3300009093 Ga0105240_10000026 Ga0105240_10000026213 100
212 3300009093 Ga0105240_10819122 Ga0105240_108191222 100
213 3300009094 Ga0111539_10026150 Ga0111539_100261503 100
214 3300009094 Ga0111539_10196938 Ga0111539_101969381 100
215 3300009098 Ga0105245_10357918 Ga0105245_103579182 100
216 3300009098 Ga0105245_10765097 Ga0105245_107650971 100
217 3300009098 Ga0105245_10907629 Ga0105245_109076292 100
218 3300009098 Ga0105245_10920519 Ga0105245_109205192 100
219 3300009101 Ga0105247_10040149 Ga0105247_100401493 100
220 3300009101 Ga0105247_10074240 Ga0105247_100742403 100
221 3300009147 Ga0114129_10325110 Ga0114129_103251101 100
222 3300009147 Ga0114129_12081915 Ga0114129_120819152 100
223 3300009148 Ga0105243_10029350 Ga0105243_100293505 100
224 3300009148 Ga0105243_10094163 Ga0105243_100941633 100
225 3300009174 Ga0105241_10252081 Ga0105241_102520813 100
226 3300009174 Ga0105241_11125109 Ga0105241_111251092 100
227 3300009174 Ga0105241_11134512 Ga0105241_111345121 100
228 3300009174 Ga0105241_12078431 Ga0105241_120784312 100
229 3300009176 Ga0105242_10086903 Ga0105242_100869033 100
230 3300009176 Ga0105242_11163689 Ga0105242_111636892 100
231 3300009176 Ga0105242_11207624 Ga0105242_112076241 100
232 3300009176 Ga0105242_11318742 Ga0105242_113187422 100
233 3300009176 Ga0105242_13212389 Ga0105242_132123891 100
234 3300009177 Ga0105248_10008221 Ga0105248_1000822111 100
235 3300009177 Ga0105248_10046396 Ga0105248_100463964 100
236 3300009177 Ga0105248_10084147 Ga0105248_100841473 100
237 3300009177 Ga0105248_10299117 Ga0105248_102991173 100
238 3300009177 Ga0105248_10891688 Ga0105248_108916882 100
239 3300009177 Ga0105248_11301863 Ga0105248_113018632 100
240 3300009545 Ga0105237_10946318 Ga0105237_109463182 100
241 3300009551 Ga0105238_11204128 Ga0105238_112041282 100
242 3300009553 Ga0105249_10229729 Ga0105249_102297294 100
243 3300009553 Ga0105249_10292693 Ga0105249_102926933 100
244 3300009553 Ga0105249_10415973 Ga0105249_104159732 100
245 3300009553 Ga0105249_10507008 Ga0105249_105070083 100
246 3300009553 Ga0105249_11165016 Ga0105249_111650163 100
247 3300010375 Ga0105239_10535674 Ga0105239_105356742 100
248 3300010375 Ga0105239_11689259 Ga0105239_116892591 100
249 3300010375 Ga0105239_11733445 Ga0105239_117334452 100
250 3300011119 Ga0105246_10122130 Ga0105246_101221303 100
251 3300011119 Ga0105246_10520297 Ga0105246_105202973 100
252 3300011119 Ga0105246_10898414 Ga0105246_108984143 100
253 3300011119 Ga0105246_11920296 Ga0105246_119202962 100
254 3300012495 Ga0157323_1026169 Ga0157323_10261691 100
255 3300012497 Ga0157319_1025564 Ga0157319_10255642 100
256 3300012502 Ga0157347_1027228 Ga0157347_10272281 100
257 3300012508 Ga0157315_1011824 Ga0157315_10118242 100
258 3300013102 Ga0157371_10356988 Ga0157371_103569881 100
259 3300013104 Ga0157370_11326111 Ga0157370_113261112 100
260 3300013296 Ga0157374_10091416 Ga0157374_100914163 100
261 3300013296 Ga0157374_10098171 Ga0157374_100981713 100
262 3300013296 Ga0157374_10510094 Ga0157374_105100941 100
263 3300013297 Ga0157378_10006203 Ga0157378_100062032 100
264 3300013297 Ga0157378_10061392 Ga0157378_100613923 100
265 3300013297 Ga0157378_10181319 Ga0157378_101813192 100
266 3300013297 Ga0157378_10481719 Ga0157378_104817192 100
267 3300013297 Ga0157378_10635794 Ga0157378_106357942 100
268 3300013297 Ga0157378_11696641 Ga0157378_116966412 100
269 3300013306 Ga0163162_10014221 Ga0163162_1001422110 100
270 3300013306 Ga0163162_10035656 Ga0163162_100356567 100
271 3300013306 Ga0163162_10194409 Ga0163162_101944092 100
272 3300013306 Ga0163162_10348689 Ga0163162_103486892 100
273 3300013306 Ga0163162_10714802 Ga0163162_107148022 100
274 3300013307 Ga0157372_10172545 Ga0157372_101725454 100
275 3300013307 Ga0157372_10866498 Ga0157372_108664982 100
276 3300013307 Ga0157372_11337715 Ga0157372_113377152 100
277 3300013308 Ga0157375_10014567 Ga0157375_100145678 100
278 3300013308 Ga0157375_10026377 Ga0157375_100263775 100
279 3300013308 Ga0157375_10054492 Ga0157375_100544923 100
280 3300013308 Ga0157375_10084541 Ga0157375_100845413 100
281 3300013308 Ga0157375_10216524 Ga0157375_102165242 100
282 3300013308 Ga0157375_10247174 Ga0157375_102471743 100
283 3300013308 Ga0157375_12599766 Ga0157375_125997662 100
284 3300013308 Ga0157375_13190090 Ga0157375_131900902 100
285 3300014325 Ga0163163_10132130 Ga0163163_101321303 100
286 3300014325 Ga0163163_10174607 Ga0163163_101746073 100
287 3300014326 Ga0157380_10135568 Ga0157380_101355682 100
288 3300014326 Ga0157380_10274986 Ga0157380_102749862 100
289 3300014326 Ga0157380_10425925 Ga0157380_104259253 100
290 3300014326 Ga0157380_11229016 Ga0157380_112290162 100
291 3300014326 Ga0157380_11693693 Ga0157380_116936931 100
292 3300014497 Ga0182008_10087804 Ga0182008_100878042 100
293 3300014745 Ga0157377_10024330 Ga0157377_100243304 100
294 3300014745 Ga0157377_10331330 Ga0157377_103313303 100
295 3300014968 Ga0157379_10000029 Ga0157379_1000002950 100
296 3300014968 Ga0157379_10018885 Ga0157379_100188853 100
297 3300014968 Ga0157379_10029724 Ga0157379_100297248 100
298 3300014968 Ga0157379_10065580 Ga0157379_100655804 100
299 3300014968 Ga0157379_10106915 Ga0157379_101069151 100
300 3300014969 Ga0157376_10017976 Ga0157376_100179766 100
301 3300014969 Ga0157376_10023767 Ga0157376_100237673 100
302 3300014969 Ga0157376_10045491 Ga0157376_100454916 100
303 3300014969 Ga0157376_10665376 Ga0157376_106653762 100
304 3300015265 Ga0182005_1008576 Ga0182005_10085763 100
305 3300017792 Ga0163161_10079509 Ga0163161_100795094 100
306 3300017792 Ga0163161_10235180 Ga0163161_102351802 100
307 3300017792 Ga0163161_11874897 Ga0163161_118748972 100
308 3300021384 Ga0213876_10521858 Ga0213876_105218582 100
309 3300021388 Ga0213875_10107622 Ga0213875_101076222 100
310 3300025245 Ga0207425_1000086 Ga0207425_100008613 100
311 3300025258 Ga0209129_1000174 Ga0209129_100017413 100
312 3300025271 Ga0207666_1011320 Ga0207666_10113202 100
313 3300025273 Ga0209673_1005117 Ga0209673_10051176 100
314 3300025290 Ga0207673_1009415 Ga0207673_10094152 100
315 3300025292 Ga0209676_1058010 Ga0209676_10580101 100
316 3300025294 Ga0209025_1000367 Ga0209025_100036714 100
317 3300025297 Ga0209758_1000305 Ga0209758_100030514 100
318 3300025298 Ga0209050_1000026 Ga0209050_1000026361 100
319 3300025299 Ga0209256_1041671 Ga0209256_10416712 100
320 3300025303 Ga0209051_1059104 Ga0209051_10591041 100
321 3300025304 Ga0209257_1000009 Ga0209257_1000009361 100
322 3300025315 Ga0207697_10000114 Ga0207697_1000011413 100
323 3300025321 Ga0207656_10184825 Ga0207656_101848252 100
324 3300025711 Ga0207696_1000153 Ga0207696_100015351 100
325 3300025893 Ga0207682_10000010 Ga0207682_100000104 100
326 3300025893 Ga0207682_10592591 Ga0207682_105925912 100
327 3300025899 Ga0207642_10026105 Ga0207642_100261053 100
328 3300025899 Ga0207642_10064600 Ga0207642_100646002 100
329 3300025901 Ga0207688_10000190 Ga0207688_1000019010 100
330 3300025901 Ga0207688_10276936 Ga0207688_102769362 100
331 3300025903 Ga0207680_10026838 Ga0207680_100268384 100
332 3300025903 Ga0207680_10109193 Ga0207680_101091931 100
333 3300025903 Ga0207680_10135990 Ga0207680_101359903 100
334 3300025904 Ga0207647_10101760 Ga0207647_101017601 100
335 3300025907 Ga0207645_10017678 Ga0207645_100176787 100
336 3300025907 Ga0207645_10018159 Ga0207645_100181595 100
337 3300025907 Ga0207645_11054705 Ga0207645_110547052 100
338 3300025908 Ga0207643_10000683 Ga0207643_1000068312 100
339 3300025908 Ga0207643_10006779 Ga0207643_100067795 100
340 3300025908 Ga0207643_10018458 Ga0207643_100184586 100
341 3300025909 Ga0207705_11096104 Ga0207705_110961042 100
342 3300025910 Ga0207684_10006867 Ga0207684_100068674 100
343 3300025910 Ga0207684_11662988 Ga0207684_116629882 100
344 3300025911 Ga0207654_11166273 Ga0207654_111662731 100
345 3300025914 Ga0207671_11513779 Ga0207671_115137792 100
346 3300025918 Ga0207662_10000676 Ga0207662_100006769 100
347 3300025918 Ga0207662_11307836 Ga0207662_113078361 100
348 3300025919 Ga0207657_11027114 Ga0207657_110271142 100
349 3300025920 Ga0207649_11423502 Ga0207649_114235021 100
350 3300025922 Ga0207646_10216351 Ga0207646_102163512 100
351 3300025923 Ga0207681_10051469 Ga0207681_100514692 100
352 3300025923 Ga0207681_10574329 Ga0207681_105743292 100
353 3300025924 Ga0207694_11519263 Ga0207694_115192631 100
354 3300025924 Ga0207694_11654451 Ga0207694_116544511 100
355 3300025925 Ga0207650_10009050 Ga0207650_100090508 100
356 3300025925 Ga0207650_10018823 Ga0207650_100188232 100
357 3300025925 Ga0207650_10093729 Ga0207650_100937293 100
358 3300025926 Ga0207659_10095339 Ga0207659_100953392 100
359 3300025926 Ga0207659_10219368 Ga0207659_102193682 100
360 3300025927 Ga0207687_10305190 Ga0207687_103051903 100
361 3300025927 Ga0207687_10615678 Ga0207687_106156781 100
362 3300025927 Ga0207687_10814082 Ga0207687_108140822 100
363 3300025927 Ga0207687_11213768 Ga0207687_112137682 100
364 3300025928 Ga0207700_11525963 Ga0207700_115259632 100
365 3300025929 Ga0207664_10052474 Ga0207664_100524744 100
366 3300025929 Ga0207664_10652415 Ga0207664_106524152 100
367 3300025929 Ga0207664_11525623 Ga0207664_115256232 100
368 3300025931 Ga0207644_10059075 Ga0207644_100590753 100
369 3300025931 Ga0207644_10074314 Ga0207644_100743142 100
370 3300025931 Ga0207644_10091634 Ga0207644_100916343 100
371 3300025931 Ga0207644_10139187 Ga0207644_101391873 100
372 3300025931 Ga0207644_10312034 Ga0207644_103120341 100
373 3300025932 Ga0207690_10083812 Ga0207690_100838123 100
374 3300025932 Ga0207690_10086244 Ga0207690_100862443 100
375 3300025932 Ga0207690_11139141 Ga0207690_111391412 100
376 3300025933 Ga0207706_10003578 Ga0207706_1000357811 100
377 3300025933 Ga0207706_10340506 Ga0207706_103405062 100
378 3300025933 Ga0207706_11550379 Ga0207706_115503791 100
379 3300025935 Ga0207709_10097580 Ga0207709_100975802 100
380 3300025935 Ga0207709_11167135 Ga0207709_111671351 100
381 3300025936 Ga0207670_10101539 Ga0207670_101015393 100
382 3300025936 Ga0207670_10218421 Ga0207670_102184213 100
383 3300025936 Ga0207670_11857629 Ga0207670_118576292 100
384 3300025937 Ga0207669_10049655 Ga0207669_100496552 100
385 3300025937 Ga0207669_10202695 Ga0207669_102026952 100
386 3300025937 Ga0207669_10416829 Ga0207669_104168292 100
387 3300025938 Ga0207704_10055435 Ga0207704_100554354 100
388 3300025938 Ga0207704_10907274 Ga0207704_109072742 100
389 3300025938 Ga0207704_11486456 Ga0207704_114864562 100
390 3300025938 Ga0207704_11631534 Ga0207704_116315342 100
391 3300025940 Ga0207691_10003554 Ga0207691_1000355414 100
392 3300025940 Ga0207691_10011788 Ga0207691_100117888 100
393 3300025940 Ga0207691_10158837 Ga0207691_101588374 100
394 3300025940 Ga0207691_10463599 Ga0207691_104635991 100
395 3300025940 Ga0207691_10762699 Ga0207691_107626992 100
396 3300025941 Ga0207711_10033860 Ga0207711_100338607 100
397 3300025941 Ga0207711_10319576 Ga0207711_103195762 100
398 3300025941 Ga0207711_11056286 Ga0207711_110562862 100
399 3300025941 Ga0207711_11144665 Ga0207711_111446651 100
400 3300025942 Ga0207689_10000236 Ga0207689_1000023613 100
401 3300025942 Ga0207689_10001266 Ga0207689_1000126619 100
402 3300025942 Ga0207689_10004515 Ga0207689_100045153 100
403 3300025942 Ga0207689_10374826 Ga0207689_103748262 100
404 3300025944 Ga0207661_10066031 Ga0207661_100660312 100
405 3300025945 Ga0207679_10139832 Ga0207679_101398322 100
406 3300025945 Ga0207679_11414136 Ga0207679_114141362 100
407 3300025949 Ga0207667_10148052 Ga0207667_101480523 100
408 3300025949 Ga0207667_11264495 Ga0207667_112644952 100
409 3300025949 Ga0207667_12120217 Ga0207667_121202172 100
410 3300025960 Ga0207651_10022645 Ga0207651_100226453 100
411 3300025960 Ga0207651_10141088 Ga0207651_101410882 100
412 3300025960 Ga0207651_10444403 Ga0207651_104444033 100
413 3300025960 Ga0207651_10492159 Ga0207651_104921592 100
414 3300025960 Ga0207651_10739022 Ga0207651_107390221 100
415 3300025960 Ga0207651_11583830 Ga0207651_115838301 100
416 3300025961 Ga0207712_10145971 Ga0207712_101459713 100
417 3300025961 Ga0207712_10179853 Ga0207712_101798533 100
418 3300025961 Ga0207712_10290695 Ga0207712_102906952 100
419 3300025961 Ga0207712_10654140 Ga0207712_106541403 100
420 3300025972 Ga0207668_10022121 Ga0207668_100221212 100
421 3300025972 Ga0207668_10283880 Ga0207668_102838802 100
422 3300025972 Ga0207668_10830226 Ga0207668_108302262 100
423 3300025972 Ga0207668_11067815 Ga0207668_110678152 100
424 3300025986 Ga0207658_10006487 Ga0207658_100064872 100
425 3300025986 Ga0207658_10079951 Ga0207658_100799513 100
426 3300025986 Ga0207658_10246850 Ga0207658_102468502 100
427 3300025986 Ga0207658_10404861 Ga0207658_104048611 100
428 3300025986 Ga0207658_10479518 Ga0207658_104795182 100
429 3300025986 Ga0207658_10641937 Ga0207658_106419372 100
430 3300025986 Ga0207658_10744425 Ga0207658_107444252 100
431 3300026023 Ga0207677_10284799 Ga0207677_102847993 100
432 3300026023 Ga0207677_10293082 Ga0207677_102930822 100
433 3300026023 Ga0207677_10414914 Ga0207677_104149142 100
434 3300026023 Ga0207677_10925917 Ga0207677_109259172 100
435 3300026035 Ga0207703_10001159 Ga0207703_1000115916 100
436 3300026035 Ga0207703_10050347 Ga0207703_100503472 100
437 3300026035 Ga0207703_10051835 Ga0207703_100518351 100
438 3300026035 Ga0207703_10477004 Ga0207703_104770043 100
439 3300026035 Ga0207703_10774475 Ga0207703_107744751 100
440 3300026041 Ga0207639_10276985 Ga0207639_102769852 100
441 3300026067 Ga0207678_10013427 Ga0207678_100134277 100
442 3300026067 Ga0207678_10044680 Ga0207678_100446803 100
443 3300026067 Ga0207678_11765326 Ga0207678_117653261 100
444 3300026075 Ga0207708_10002325 Ga0207708_100023253 100
445 3300026075 Ga0207708_10930214 Ga0207708_109302142 100
446 3300026075 Ga0207708_11282923 Ga0207708_112829232 100
447 3300026078 Ga0207702_10309153 Ga0207702_103091532 100
448 3300026078 Ga0207702_11393532 Ga0207702_113935322 100
449 3300026088 Ga0207641_10110952 Ga0207641_101109523 100
450 3300026088 Ga0207641_10121508 Ga0207641_101215083 100
451 3300026088 Ga0207641_10187798 Ga0207641_101877982 100
452 3300026088 Ga0207641_11070724 Ga0207641_110707242 100
453 3300026089 Ga0207648_10000823 Ga0207648_1000082339 100
454 3300026089 Ga0207648_10001240 Ga0207648_1000124026 100
455 3300026089 Ga0207648_10008577 Ga0207648_100085776 100
456 3300026089 Ga0207648_10036889 Ga0207648_100368894 100
457 3300026089 Ga0207648_10710924 Ga0207648_107109242 100
458 3300026095 Ga0207676_10005653 Ga0207676_1000565310 100
459 3300026095 Ga0207676_10012924 Ga0207676_100129242 100
460 3300026095 Ga0207676_10429666 Ga0207676_104296662 100
461 3300026116 Ga0207674_10001726 Ga0207674_100017269 100
462 3300026116 Ga0207674_10145192 Ga0207674_101451923 100
463 3300026116 Ga0207674_10174241 Ga0207674_101742413 100
464 3300026118 Ga0207675_100000242 Ga0207675_10000024219 100
465 3300026118 Ga0207675_100000778 Ga0207675_1000007787 100
466 3300026118 Ga0207675_100001080 Ga0207675_10000108015 100
467 3300026118 Ga0207675_100020960 Ga0207675_10002096010 100
468 3300026118 Ga0207675_100557029 Ga0207675_1005570292 100
469 3300026121 Ga0207683_10088493 Ga0207683_100884933 100
470 3300026121 Ga0207683_10582512 Ga0207683_105825121 100
471 3300026121 Ga0207683_10871809 Ga0207683_108718092 100
472 3300026142 Ga0207698_10146646 Ga0207698_101466463 100
473 3300026142 Ga0207698_10219685 Ga0207698_102196852 100
474 3300026142 Ga0207698_10697497 Ga0207698_106974972 100
475 3300026142 Ga0207698_11338828 Ga0207698_113388282 100
476 3300027695 Ga0209966_1127403 Ga0209966_11274031 100
477 3300027717 Ga0209998_10024852 Ga0209998_100248522 100
478 3300027907 Ga0207428_10111867 Ga0207428_101118673 100
479 3300028379 Ga0268266_10023814 Ga0268266_100238145 100
480 3300028379 Ga0268266_10333845 Ga0268266_103338453 100
481 3300028379 Ga0268266_10781564 Ga0268266_107815642 100
482 3300028379 Ga0268266_11500417 Ga0268266_115004172 100
483 3300028380 Ga0268265_10020966 Ga0268265_100209664 100
484 3300028380 Ga0268265_10034277 Ga0268265_100342772 100
485 3300028380 Ga0268265_10134764 Ga0268265_101347642 100
486 3300028380 Ga0268265_10382245 Ga0268265_103822452 100
487 3300028380 Ga0268265_12565811 Ga0268265_125658112 100
488 3300028381 Ga0268264_10005449 Ga0268264_100054499 100
489 3300028381 Ga0268264_10019372 Ga0268264_100193724 100
490 3300028381 Ga0268264_10039488 Ga0268264_100394883 100
491 3300028381 Ga0268264_10052175 Ga0268264_100521752 100
492 3300028381 Ga0268264_10467069 Ga0268264_104670692 100
493 3300028800 Ga0265338_10026205 Ga0265338_100262057 100
494 3300030521 Ga0307511_10069347 Ga0307511_100693472 100
495 3300031247 Ga0265340_10150008 Ga0265340_101500082 100
496 3300031548 Ga0307408_101077452 Ga0307408_1010774522 100
497 3300031548 Ga0307408_101718259 Ga0307408_1017182591 100
498 3300031665 Ga0316575_10004749 Ga0316575_100047493 100
499 3300031665 Ga0316575_10096260 Ga0316575_100962603 100
500 3300031727 Ga0316576_10146198 Ga0316576_101461982 100
501 3300031731 Ga0307405_10636523 Ga0307405_106365231 100
502 3300031824 Ga0307413_11756787 Ga0307413_117567872 100
503 3300031901 Ga0307406_10024801 Ga0307406_100248015 100
504 3300031911 Ga0307412_10001601 Ga0307412_100016018 100
505 3300031911 Ga0307412_11953158 Ga0307412_119531582 100
506 3300031995 Ga0307409_101530957 Ga0307409_1015309572 100
507 3300032002 Ga0307416_100229851 Ga0307416_1002298513 100
508 3300032004 Ga0307414_10124795 Ga0307414_101247953 100
509 3300032137 Ga0316585_10056829 Ga0316585_100568292 100
510 3300035111 Ga0373923_0499689 Ga0373923_0499689_14_316 100
511 3300035113 Ga0373936_0254074 Ga0373936_0254074_395_697 100
512 3300035117 Ga0373953_0176442 Ga0373953_0176442_196_498 100
513 3300035119 Ga0373956_0466330 Ga0373956_0466330_282_584 100
514 3300035120 Ga0373957_0072571 Ga0373957_0072571_592_894 100
515 3300035120 Ga0373957_0117486 Ga0373957_0117486_292_594 100
516 3300035170 Ga0373943_0568647 Ga0373943_0568647_138_440 100
517 3300035171 Ga0373946_0517419 Ga0373946_0517419_16_318 100
518 3300035398 Ga0316574_0067500 Ga0316574_0067500_678_980 100
519 3300035398 Ga0316574_0432706 Ga0316574_0432706_474_776 100
520 3300035410 Ga0373924_0101564 Ga0373924_0101564_217_519 100
521 3300035692 Ga0373935_1259469 Ga0373935_1259469_180_482 100
522 3300035724 Ga0373933_0094901 Ga0373933_0094901_1177_1512 100
523 3300035724 Ga0373933_0444202 Ga0373933_0444202_420_722 100
524 3300035725 Ga0373947_0357278 Ga0373947_0357278_106_441 100
525 3300036401 Ga0373937_0058885 Ga0373937_0058885_2499_2834 100
526 3300036401 Ga0373937_0110376 Ga0373937_0110376_26_328 100
527 3300036401 Ga0373937_0145259 Ga0373937_0145259_860_1162 100
528 3300036401 Ga0373937_0318167 Ga0373937_0318167_134_502 100
529 3300036401 Ga0373937_0470314 Ga0373937_0470314_619_921 100
530 3300036401 Ga0373937_1727602 Ga0373937_1727602_199_501 100
531 3300036647 Ga0316582_0221359 Ga0316582_0221359_948_1250 100
532 3300036647 Ga0316582_0822652 Ga0316582_0822652_151_453 100
533 3300036712 Ga0316584_0095501 Ga0316584_0095501_1627_1929 100
534 3300036712 Ga0316584_0631090 Ga0316584_0631090_264_566 100
535 3300037068 Ga0373925_0831893 Ga0373925_0831893_128_430 100
536 3300037853 Ga0436364_0530696 Ga0436364_0530696_4519_4821 100
537 3300038705 Ga0237819_09762 Ga0237819_09762_753_1055 100
538 3300039062 Ga0400483_098493 Ga0400483_098493_187_489 100
539 3300039062 Ga0400483_237847 Ga0400483_237847_387_689 100
540 3300039437 Ga0436365_1286208 Ga0436365_1286208_546_848 100
541 3300041459 Ga0451800_1669862 Ga0451800_1669862_85_387 100
542 3300041460 Ga0451802_2113515 Ga0451802_2113515_159_461 100
543 3300041486 Ga0451807_1509185 Ga0451807_1509185_109_411 100
544 3300041491 Ga0451833_0514785 Ga0451833_0514785_40_342 100
545 3300041498 Ga0451841_0243136 Ga0451841_0243136_655_957 100
546 3300041505 Ga0451849_1308335 Ga0451849_1308335_300_602 100
547 3300041512 Ga0451853_0008175 Ga0451853_0008175_547_849 100
548 3300041512 Ga0451853_3871611 Ga0451853_3871611_651_953 100
549 3300042005 Ga0439448_0314555 Ga0439448_0314555_86_388 100
550 3300042118 Ga0450914_033132 Ga0450914_033132_83_385 100
551 3300042876 Ga0451577_0081527 Ga0451577_0081527_2470_2772 100
552 3300044712 Ga0453684_0000019 Ga0453684_0000019_765244_765546 100
553 3300046454 Ga0495592_0301233 Ga0495592_0301233_610_912 100
554 3300046455 Ga0495603_0607043 Ga0495603_0607043_23_349 100
555 3300046459 Ga0495629_0149722 Ga0495629_0149722_476_778 100
556 3300046459 Ga0495629_0654201 Ga0495629_0654201_212_514 100
557 3300046462 Ga0495651_0199424 Ga0495651_0199424_1039_1341 100
558 3300046472 Ga0495580_0127379 Ga0495580_0127379_173_475 100
559 3300046472 Ga0495580_0585166 Ga0495580_0585166_17_319 100
560 3300046473 Ga0495582_0069700 Ga0495582_0069700_1528_1830 100
561 3300046475 Ga0495639_0138700 Ga0495639_0138700_273_575 100
562 3300046477 Ga0495664_0137173 Ga0495664_0137173_1083_1385 100
563 3300046500 Ga0495596_0336123 Ga0495596_0336123_70_372 100
564 3300046511 Ga0495608_0282497 Ga0495608_0282497_334_636 100
565 3300046516 Ga0495628_0145659 Ga0495628_0145659_1139_1441 100
566 3300046516 Ga0495628_0256122 Ga0495628_0256122_230_532 100
567 3300046529 Ga0495652_0816741 Ga0495652_0816741_111_413 100
568 3300046531 Ga0495665_0006822 Ga0495665_0006822_4645_4947 100
569 3300046533 Ga0495640_0211533 Ga0495640_0211533_442_744 100
570 3300046536 Ga0495587_0220054 Ga0495587_0220054_340_642 100
571 3300046537 Ga0495598_0125823 Ga0495598_0125823_125_427 100
572 3300046539 Ga0495621_0005534 Ga0495621_0005534_3033_3335 100
573 3300046539 Ga0495621_0010634 Ga0495621_0010634_2260_2562 100
574 3300046543 Ga0495645_0081321 Ga0495645_0081321_1672_1974 100
575 3300046558 Ga0495633_0220641 Ga0495633_0220641_214_516 100
576 3300046559 Ga0495667_0202727 Ga0495667_0202727_761_1063 100
577 3300046663 Ga0495635_0265162 Ga0495635_0265162_492_794 100
578 3300046663 Ga0495635_0887865 Ga0495635_0887865_253_555 100
579 3300046675 Ga0495657_0160222 Ga0495657_0160222_183_485 100
580 3300046679 Ga0495623_0307090 Ga0495623_0307090_485_787 100
581 3300046681 Ga0495647_0002277 Ga0495647_0002277_1099_1401 100
582 3300046681 Ga0495647_0100865 Ga0495647_0100865_104_439 100
583 3300046683 Ga0495658_0005339 Ga0495658_0005339_4811_5113 100
584 3300046683 Ga0495658_0399019 Ga0495658_0399019_305_640 100
585 3300046683 Ga0495658_0547379 Ga0495658_0547379_17_319 100
586 3300046683 Ga0495658_1051791 Ga0495658_1051791_26_328 100
587 3300046689 Ga0495613_0324243 Ga0495613_0324243_676_978 100
588 3300046794 Ga0495589_0031426 Ga0495589_0031426_1781_2092 100
589 3300046809 Ga0495600_0251627 Ga0495600_0251627_455_757 100
590 3300046809 Ga0495600_0324470 Ga0495600_0324470_194_529 100
591 3300047315 Ga0495581_0102655 Ga0495581_0102655_180_482 100
592 3300047321 Ga0495676_0704610 Ga0495676_0704610_224_526 100
593 3300047470 Ga0495681_0086463 Ga0495681_0086463_217_519 100
594 3300047471 Ga0495684_0175701 Ga0495684_0175701_1015_1317 100
595 3300048903 Ga0496100_0178514 Ga0496100_0178514_410_745 100
596 3300048904 Ga0496101_0006056 Ga0496101_0006056_5913_6248 100
597 3300048904 Ga0496101_0009385 Ga0496101_0009385_2752_3054 100
598 3300048904 Ga0496101_0080612 Ga0496101_0080612_1636_1938 100
599 3300048904 Ga0496101_1154045 Ga0496101_1154045_109_411 100
600 3300048905 Ga0496102_0224056 Ga0496102_0224056_1361_1696 100
601 3300048905 Ga0496102_1263885 Ga0496102_1263885_282_584 100
602 3300048907 Ga0496104_0054565 Ga0496104_0054565_1498_1833 100
603 3300048908 Ga0496105_0065146 Ga0496105_0065146_822_1157 100
604 3300048909 Ga0496106_0084629 Ga0496106_0084629_947_1282 100
605 3300048910 Ga0496107_0017330 Ga0496107_0017330_1082_1417 100
606 3300048911 Ga0496108_0007375 Ga0496108_0007375_2694_3029 100
607 3300048911 Ga0496108_1034796 Ga0496108_1034796_244_546 100
608 3300048911 Ga0496108_1767876 Ga0496108_1767876_179_481 100
609 3300048912 Ga0496109_0020123 Ga0496109_0020123_411_746 100
610 3300048912 Ga0496109_0037719 Ga0496109_0037719_1502_1804 100
611 3300048913 Ga0496110_0011869 Ga0496110_0011869_1399_1734 100
612 3300048913 Ga0496110_0865500 Ga0496110_0865500_466_768 100
613 3300048913 Ga0496110_1438136 Ga0496110_1438136_123_425 100
614 3300048915 Ga0496112_0800977 Ga0496112_0800977_509_811 100
615 3300048915 Ga0496112_1703263 Ga0496112_1703263_190_492 100
616 3300048916 Ga0496113_0042905 Ga0496113_0042905_1289_1591 100
617 3300048917 Ga0496114_0139321 Ga0496114_0139321_646_981 100
618 3300048917 Ga0496114_0456892 Ga0496114_0456892_65_367 100
619 3300048917 Ga0496114_0518678 Ga0496114_0518678_511_813 100
620 3300048917 Ga0496114_1539661 Ga0496114_1539661_76_378 100
621 3300048919 Ga0496116_0000216 Ga0496116_0000216_58522_58830 100
622 3300048919 Ga0496116_0003659 Ga0496116_0003659_12605_12907 100
623 3300048919 Ga0496116_0061770 Ga0496116_0061770_1969_2271 100
624 3300048920 Ga0496117_0001639 Ga0496117_0001639_1676_1984 100
625 3300048920 Ga0496117_0041934 Ga0496117_0041934_526_828 100
626 3300048921 Ga0496118_0002026 Ga0496118_0002026_18395_18703 100
627 3300048921 Ga0496118_0004361 Ga0496118_0004361_8115_8417 100
628 3300048922 Ga0496119_0006934 Ga0496119_0006934_7918_8220 100
629 3300048922 Ga0496119_0021874 Ga0496119_0021874_2912_3214 100
630 3300048923 Ga0496120_0201897 Ga0496120_0201897_300_602 100
631 3300048924 Ga0496121_0013219 Ga0496121_0013219_3724_4026 100
632 3300048924 Ga0496121_0377350 Ga0496121_0377350_545_847 100
633 3300048925 Ga0496122_0002437 Ga0496122_0002437_23572_23880 100
634 3300048925 Ga0496122_0011284 Ga0496122_0011284_7321_7623 100
635 3300048925 Ga0496122_0020568 Ga0496122_0020568_4384_4686 100
636 3300048925 Ga0496122_0023441 Ga0496122_0023441_1615_1917 100
637 3300048925 Ga0496122_0065708 Ga0496122_0065708_475_777 100
638 3300048925 Ga0496122_0340553 Ga0496122_0340553_162_464 100
639 3300048926 Ga0496123_0030486 Ga0496123_0030486_2646_2948 100
640 3300048926 Ga0496123_0036742 Ga0496123_0036742_2990_3298 100
641 3300048926 Ga0496123_0037020 Ga0496123_0037020_1645_1947 100
642 3300048926 Ga0496123_0062629 Ga0496123_0062629_1337_1639 100
643 3300048926 Ga0496123_0251344 Ga0496123_0251344_541_843 100
644 3300048927 Ga0496124_0000023 Ga0496124_0000023_383820_384128 100
645 3300048927 Ga0496124_0000507 Ga0496124_0000507_55548_55850 100
646 3300048927 Ga0496124_0041869 Ga0496124_0041869_1452_1754 100
647 3300048927 Ga0496124_0201922 Ga0496124_0201922_461_763 100
648 3300048928 Ga0496125_0000178 Ga0496125_0000178_67807_68109 100
649 3300048928 Ga0496125_0001277 Ga0496125_0001277_17101_17403 100
650 3300048928 Ga0496125_0053178 Ga0496125_0053178_1645_1947 100
651 3300048928 Ga0496125_0065656 Ga0496125_0065656_1457_1759 100
652 3300048928 Ga0496125_0112912 Ga0496125_0112912_1446_1754 100
653 3300048928 Ga0496125_0547530 Ga0496125_0547530_225_527 100
654 3300048928 Ga0496125_0671305 Ga0496125_0671305_66_368 100
655 3300048929 Ga0496126_0047707 Ga0496126_0047707_428_730 100
656 3300048929 Ga0496126_0131230 Ga0496126_0131230_480_782 100
657 3300048929 Ga0496126_0132341 Ga0496126_0132341_947_1249 100
658 3300049568 Ga0501031_0001266 Ga0501031_0001266_11700_12002 100
659 3300049568 Ga0501031_0001923 Ga0501031_0001923_4939_5241 100
660 3300049568 Ga0501031_0012669 Ga0501031_0012669_4262_4564 100
661 3300049569 Ga0501032_0018403 Ga0501032_0018403_1325_1627 100
662 3300049569 Ga0501032_0098350 Ga0501032_0098350_26_328 100
663 3300049569 Ga0501032_0116940 Ga0501032_0116940_357_659 100
664 3300049570 Ga0501033_0105762 Ga0501033_0105762_1187_1489 100
665 3300049571 Ga0501034_0001318 Ga0501034_0001318_27343_27645 100
666 3300049571 Ga0501034_0093979 Ga0501034_0093979_1661_1963 100
667 3300049571 Ga0501034_0096167 Ga0501034_0096167_2194_2496 100
668 3300049572 Ga0501036_0004316 Ga0501036_0004316_9668_9970 100
669 3300049572 Ga0501036_0028421 Ga0501036_0028421_2014_2316 100
670 3300049572 Ga0501036_0117763 Ga0501036_0117763_1821_2123 100
671 3300049572 Ga0501036_0766214 Ga0501036_0766214_324_626 100
672 3300049572 Ga0501036_1079471 Ga0501036_1079471_305_607 100
673 3300049572 Ga0501036_1419019 Ga0501036_1419019_231_533 100
674 3300049573 Ga0501037_0018188 Ga0501037_0018188_2223_2525 100
675 3300049573 Ga0501037_0039289 Ga0501037_0039289_481_783 100
676 3300049573 Ga0501037_0057540 Ga0501037_0057540_2299_2601 100
677 3300049574 Ga0501038_0029848 Ga0501038_0029848_28_330 100
678 3300049574 Ga0501038_0079400 Ga0501038_0079400_2216_2518 100
679 3300049574 Ga0501038_0128551 Ga0501038_0128551_85_387 100
680 3300049575 Ga0501039_0035622 Ga0501039_0035622_3475_3777 100
681 3300049575 Ga0501039_0058508 Ga0501039_0058508_2078_2380 100
682 3300049575 Ga0501039_0066129 Ga0501039_0066129_1896_2198 100
683 3300049575 Ga0501039_0162707 Ga0501039_0162707_142_444 100
684 3300049575 Ga0501039_0249574 Ga0501039_0249574_362_664 100
685 3300049575 Ga0501039_0483755 Ga0501039_0483755_433_735 100
686 3300049575 Ga0501039_0639407 Ga0501039_0639407_279_581 100
687 3300049575 Ga0501039_0868111 Ga0501039_0868111_291_593 100
688 3300049575 Ga0501039_0886344 Ga0501039_0886344_84_386 100
689 3300049576 Ga0501040_0051118 Ga0501040_0051118_2214_2516 100
690 3300049576 Ga0501040_0122931 Ga0501040_0122931_1388_1690 100
691 3300049576 Ga0501040_0167533 Ga0501040_0167533_1029_1331 100
692 3300049577 Ga0501041_0000706 Ga0501041_0000706_9283_9585 100
693 3300049577 Ga0501041_0125523 Ga0501041_0125523_1219_1521 100
694 3300049578 Ga0501042_0013627 Ga0501042_0013627_1425_1727 100
695 3300049578 Ga0501042_0049642 Ga0501042_0049642_1438_1740 100
696 3300049578 Ga0501042_0103710 Ga0501042_0103710_610_912 100
697 3300049578 Ga0501042_0898333 Ga0501042_0898333_34_336 100
698 3300049579 Ga0501043_0083636 Ga0501043_0083636_804_1106 100
699 3300049579 Ga0501043_0209855 Ga0501043_0209855_185_487 100
700 3300049579 Ga0501043_0305559 Ga0501043_0305559_122_424 100
701 3300049579 Ga0501043_0430864 Ga0501043_0430864_20_322 100
702 3300049579 Ga0501043_0525314 Ga0501043_0525314_230_532 100
703 3300049580 Ga0501046_0013301 Ga0501046_0013301_2934_3236 100
704 3300049580 Ga0501046_0026917 Ga0501046_0026917_2463_2765 100
705 3300049580 Ga0501046_0214055 Ga0501046_0214055_133_435 100
706 3300049581 Ga0501047_0471383 Ga0501047_0471383_702_1004 100
707 3300049582 Ga0501048_0018522 Ga0501048_0018522_2203_2505 100
708 3300049582 Ga0501048_0071133 Ga0501048_0071133_21_323 100
709 3300049582 Ga0501048_1376991 Ga0501048_1376991_13_315 100
710 3300049584 Ga0501068_0005874 Ga0501068_0005874_5961_6263 100
711 3300049584 Ga0501068_0971986 Ga0501068_0971986_58_360 100
712 3300049586 Ga0501070_0378919 Ga0501070_0378919_116_418 100
713 3300049587 Ga0501071_0270343 Ga0501071_0270343_743_1045 100
714 3300049587 Ga0501071_1282916 Ga0501071_1282916_254_556 100
715 3300049588 Ga0501072_0024480 Ga0501072_0024480_3056_3358 100
716 3300049588 Ga0501072_0769328 Ga0501072_0769328_250_552 100
717 3300049589 Ga0501073_0167027 Ga0501073_0167027_1095_1397 100
718 3300049589 Ga0501073_0197323 Ga0501073_0197323_679_981 100
719 3300049590 Ga0501074_0096127 Ga0501074_0096127_1213_1515 100
720 3300049590 Ga0501074_0391910 Ga0501074_0391910_88_390 100
721 3300049590 Ga0501074_1050650 Ga0501074_1050650_152_454 100
722 3300049592 Ga0501076_0102647 Ga0501076_0102647_986_1288 100
723 3300049592 Ga0501076_0115424 Ga0501076_0115424_436_738 100
724 3300049592 Ga0501076_0605323 Ga0501076_0605323_173_475 100
725 3300049593 Ga0501077_0056116 Ga0501077_0056116_341_643 100
726 3300049690 Ga0501261_010250 Ga0501261_010250_894_1196 100
727 3300049741 Ga0501079_0906223 Ga0501079_0906223_345_647 100
728 3300049742 Ga0501080_0113382 Ga0501080_0113382_859_1161 100
729 3300049742 Ga0501080_0299886 Ga0501080_0299886_920_1222 100
730 3300049742 Ga0501080_1319046 Ga0501080_1319046_209_511 100
731 3300049744 Ga0501083_0021948 Ga0501083_0021948_432_734 100
732 3300049744 Ga0501083_0181865 Ga0501083_0181865_69_371 100
733 3300049744 Ga0501083_0514492 Ga0501083_0514492_291_593 100
734 3300049822 Ga0501035_0153789 Ga0501035_0153789_1295_1597 100
735 3300049822 Ga0501035_0389346 Ga0501035_0389346_200_502 100
736 3300049823 Ga0501044_0455603 Ga0501044_0455603_597_899 100
737 3300049824 Ga0501045_0706658 Ga0501045_0706658_270_572 100
738 3300049824 Ga0501045_1316376 Ga0501045_1316376_184_486 100
739 3300050491 nmdc:mga00v17_159201_c1 nmdc:mga00v17_159201_c1_355_657 100
740 3300050491 nmdc:mga00v17_335070_c1 nmdc:mga00v17_335070_c1_474_776 100
741 3300050492 nmdc:mga0yw44_663256_c1 nmdc:mga0yw44_663256_c1_90_392 100
742 3300050493 nmdc:mga0k408_486055_c1 nmdc:mga0k408_486055_c1_136_471 100
743 3300050511 nmdc:mga08y16_22414_c1 nmdc:mga08y16_22414_c1_3957_4292 100
744 3300050511 nmdc:mga08y16_640413_c1 nmdc:mga08y16_640413_c1_241_543 100
745 3300050512 nmdc:mga0n895_467063_c1 nmdc:mga0n895_467063_c1_140_442 100
746 3300050513 nmdc:mga0rr50_1664064_c1 nmdc:mga0rr50_1664064_c1_191_493 100
747 3300053077 Ga0495601_0296851 Ga0495601_0296851_76_378 100
748 3300053077 Ga0495601_0798166 Ga0495601_0798166_171_473 100
749 3300053085 Ga0495619_0161688 Ga0495619_0161688_691_993 100
750 3300053085 Ga0495619_0331678 Ga0495619_0331678_525_827 100
751 3300054114 Ga0501084_0693247 Ga0501084_0693247_387_689 100
752 3300054114 Ga0501084_1834987 Ga0501084_1834987_71_373 100
753 3300059421 Ga0590071_131006 Ga0590071_131006_284_586 100
754 3300060353 Ga0501082_0020590 Ga0501082_0020590_943_1245 100
755 3300060353 Ga0501082_0135038 Ga0501082_0135038_433_735 100
756 3300061734 Ga0530510_0143760 Ga0530510_0143760_1428_1730 100
757 3300061734 Ga0530510_1459567 Ga0530510_1459567_40_342 100

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00547

Urease_gamma

Urease, gamma subunit

23

121

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
2fvh-assembly1.cif.gz_C crystal structure of rv1848, a urease gamma subunit urea (urea amidohydrolase), from mycobacterium tuberculosis 0.969 2 100
2fvh-assembly1.cif.gz_C crystal structure of rv1848, a urease gamma subunit urea (urea amidohydrolase), from mycobacterium tuberculosis 0.9595 2 100
1a5k-assembly1.cif.gz_A k217e variant of klebsiella aerogenes urease 0.9593 1 100
8hc1-assembly1.cif.gz_A cryoem structure of helicobacter pylori urefd/urease complex 0.9591 1 100
6yl3-assembly1.cif.gz_A high resolution cryo-em structure of urease from the pathogen yersinia enterocolitica 0.9561 1 100
ID Description Score Start End Superfamily
1a5kA00 Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit 0.9593 1 100 3.30.280.10
4gy7A01 Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit 0.9573 4 100 3.30.280.10
4gy7A01 Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit 0.9204 4 100 3.30.280.10
af_K7TKX8_54_223_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.687 13 39 1.25.40.10
af_A0A1D6HLN3_275_403_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.6449 5 43 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A6M0C757-F1-model_v4 Urease subunit gamma (EC 3.5.1.5) 1.005 29 100 GO:0005737
GO:0009039
GO:0016151
GO:0043419
AF-A0A3D4KSV3-F1-model_v4 Urease subunit gamma (EC 3.5.1.5) 1.004 29 100 GO:0005737
GO:0009039
GO:0016151
GO:0043419
AF-T0ZPP4-F1-model_v4 Urease, gamma subunit region domain protein (EC 3.5.1.5) 1.004 40 100 GO:0009039
GO:0016151
GO:0043419
AF-Q8RJK1-F1-model_v4 Urease subunit gamma (EC 3.5.1.5) 1.003 31 100 GO:0005737
GO:0009039
GO:0016151
GO:0043419
AF-A0A4Q3TXH5-F1-model_v4 Multifunctional fusion protein [Includes: Urease subunit gamma (EC 3.5.1.5) (Urea amidohydrolase subunit gamma); Small ribosomal subunit protein uS2] 1.002 6 100 GO:0003735
GO:0006412
GO:0009039
GO:0016151
GO:0022627
GO:0043419

Feature Viewer

pLDDT pTM Quality
96.23 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map