F479401
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 757 | 339 | 757 | 101 |
Family's Representative Sequence
| Representative Sequence | 3300036401|Ga0373937_0318167|Ga0373937_0318167_134_502 |
| Length | 122 |
| Sequence | VRSRTSADLEHLTPPELAKRAQVDLTPREKDKLLLFTAALVAERRLARGLRLNYPEAVAYLSAAIVEGARDGRTVADLMSFGATLLTREQVMDGVPEMISEIQVEATFPDGTKLVTVHRPIP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886006 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v1 | Metagenome | Rhizosphere |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 4 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 5 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 9 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 61 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 63 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 64 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 65 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 67 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 68 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 69 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 70 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 71 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 72 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 76 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 77 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 87 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012495 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 | Metagenome | Rhizosphere |
| 104 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 105 | 3300012502 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610 | Metagenome | Rhizosphere |
| 106 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 107 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 117 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 123 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 124 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 125 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 126 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 134 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 135 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 194 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 198 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 199 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 200 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 201 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 202 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 203 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 204 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 205 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 206 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 207 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 208 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 209 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 210 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 213 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 214 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 215 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 216 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 217 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 218 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 219 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 220 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 221 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 223 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 225 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 226 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 228 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 229 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 230 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 231 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 232 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 233 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 234 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 235 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 236 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 237 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 238 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 239 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 240 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 241 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 242 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 275 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 276 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 277 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 278 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 279 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 280 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 281 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 283 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 288 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 289 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 290 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 291 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 292 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 293 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 294 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 295 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 296 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 297 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 298 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 311 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 312 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 313 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 314 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 315 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 316 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 317 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 318 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 319 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 320 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 321 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 322 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 323 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 324 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 325 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 326 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 327 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 328 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 329 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 330 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 331 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 337 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 338 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 339 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.74 |
| Metatranscriptomes | 0.26 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.3 |
| Nodule | 0 |
| Rhizoplane | 3.83 |
| Rhizosphere | 86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 6.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL3b_contig_174203 | 2162886006 | Bacteria | 1070 |
| 2 | JGI24749J21850_1023943 | 3300002076 | Bacteria | 868 |
| 3 | JGI25152J39213_1001127 | 3300002773 | Bacteria | 12449 |
| 4 | JGI25150J39212_1000188 | 3300002774 | Bacteria | 34828 |
| 5 | JGI25151J46595_10000144 | 3300003187 | Bacteria | 94653 |
| 6 | JGI25153J46596_10004242 | 3300003215 | Bacteria | 7757 |
| 7 | Ga0006562J51391_1013837 | 3300003578 | Bacteria | 9818 |
| 8 | Ga0055531_10000016 | 3300003794 | Bacteria | 181898 |
| 9 | Ga0058860_11876603 | 3300004801 | Unclassified | 762 |
| 10 | Ga0065712_10402592 | 3300005290 | Bacteria | 730 |
| 11 | Ga0065715_10218623 | 3300005293 | Bacteria | 1278 |
| 12 | Ga0065715_10483344 | 3300005293 | Bacteria | 795 |
| 13 | Ga0065707_10089627 | 3300005295 | Bacteria | 4316 |
| 14 | Ga0070658_10519064 | 3300005327 | Bacteria | 1030 |
| 15 | Ga0070676_10021967 | 3300005328 | Bacteria | 3576 |
| 16 | Ga0070676_10047155 | 3300005328 | Bacteria | 2515 |
| 17 | Ga0070676_10646725 | 3300005328 | Bacteria | 767 |
| 18 | Ga0070683_100001269 | 3300005329 | Bacteria | 19223 |
| 19 | Ga0070683_102334735 | 3300005329 | Bacteria | 513 |
| 20 | Ga0070690_100009590 | 3300005330 | Bacteria | 5612 |
| 21 | Ga0070690_100142054 | 3300005330 | Bacteria | 1630 |
| 22 | Ga0070690_100263557 | 3300005330 | Bacteria | 1223 |
| 23 | Ga0070690_100313169 | 3300005330 | Bacteria | 1129 |
| 24 | Ga0070690_100317765 | 3300005330 | Bacteria | 1121 |
| 25 | Ga0070690_100821472 | 3300005330 | Bacteria | 722 |
| 26 | Ga0070670_100022326 | 3300005331 | Bacteria | 5447 |
| 27 | Ga0070670_100085419 | 3300005331 | Bacteria | 2711 |
| 28 | Ga0070677_10018921 | 3300005333 | Bacteria | 2488 |
| 29 | Ga0070677_10262136 | 3300005333 | Bacteria | 863 |
| 30 | Ga0070677_10304148 | 3300005333 | Bacteria | 811 |
| 31 | Ga0068869_100001950 | 3300005334 | Bacteria | 12358 |
| 32 | Ga0068869_100004242 | 3300005334 | Bacteria | 8893 |
| 33 | Ga0068869_100023317 | 3300005334 | Bacteria | 4272 |
| 34 | Ga0068869_100440082 | 3300005334 | Bacteria | 1079 |
| 35 | Ga0070666_10105159 | 3300005335 | Bacteria | 1949 |
| 36 | Ga0070666_10114198 | 3300005335 | Bacteria | 1870 |
| 37 | Ga0070682_100816746 | 3300005337 | Bacteria | 759 |
| 38 | Ga0068868_100055282 | 3300005338 | Bacteria | 3131 |
| 39 | Ga0068868_100153754 | 3300005338 | Bacteria | 1896 |
| 40 | Ga0068868_100537997 | 3300005338 | Bacteria | 1028 |
| 41 | Ga0068868_101453545 | 3300005338 | Bacteria | 641 |
| 42 | Ga0070660_101631925 | 3300005339 | Bacteria | 549 |
| 43 | Ga0070689_100022692 | 3300005340 | Bacteria | 4689 |
| 44 | Ga0070691_10890182 | 3300005341 | Bacteria | 548 |
| 45 | Ga0070687_100005582 | 3300005343 | Bacteria | 5103 |
| 46 | Ga0070687_100367773 | 3300005343 | Bacteria | 933 |
| 47 | Ga0070687_100528530 | 3300005343 | Bacteria | 799 |
| 48 | Ga0070692_10137666 | 3300005345 | Bacteria | 1379 |
| 49 | Ga0070692_11275733 | 3300005345 | Bacteria | 526 |
| 50 | Ga0070668_100018888 | 3300005347 | Bacteria | 5179 |
| 51 | Ga0070668_100062328 | 3300005347 | Bacteria | 2889 |
| 52 | Ga0070668_100562195 | 3300005347 | Bacteria | 994 |
| 53 | Ga0070669_100805034 | 3300005353 | Bacteria | 799 |
| 54 | Ga0070671_100044597 | 3300005355 | Bacteria | 3685 |
| 55 | Ga0070671_100323505 | 3300005355 | Bacteria | 1314 |
| 56 | Ga0070671_100328198 | 3300005355 | Bacteria | 1304 |
| 57 | Ga0070671_100476966 | 3300005355 | Bacteria | 1072 |
| 58 | Ga0070674_100067262 | 3300005356 | Bacteria | 2520 |
| 59 | Ga0070674_100464027 | 3300005356 | Bacteria | 1048 |
| 60 | Ga0070673_100012165 | 3300005364 | Bacteria | 5898 |
| 61 | Ga0070673_100119998 | 3300005364 | Bacteria | 2192 |
| 62 | Ga0070673_100206006 | 3300005364 | Bacteria | 1696 |
| 63 | Ga0070673_100814492 | 3300005364 | Bacteria | 863 |
| 64 | Ga0070673_102208374 | 3300005364 | Bacteria | 523 |
| 65 | Ga0070688_100132455 | 3300005365 | Bacteria | 1684 |
| 66 | Ga0070659_100005665 | 3300005366 | Bacteria | 8979 |
| 67 | Ga0070659_100293260 | 3300005366 | Bacteria | 1355 |
| 68 | Ga0070659_101307836 | 3300005366 | Bacteria | 643 |
| 69 | Ga0070667_100036887 | 3300005367 | Bacteria | 4098 |
| 70 | Ga0070667_100164905 | 3300005367 | Bacteria | 1954 |
| 71 | Ga0070667_100293370 | 3300005367 | Bacteria | 1463 |
| 72 | Ga0070667_101067443 | 3300005367 | Bacteria | 754 |
| 73 | Ga0070703_10198427 | 3300005406 | Bacteria | 786 |
| 74 | Ga0070714_100141653 | 3300005435 | Bacteria | 2159 |
| 75 | Ga0070714_100923287 | 3300005435 | Bacteria | 848 |
| 76 | Ga0070714_102478166 | 3300005435 | Bacteria | 503 |
| 77 | Ga0070713_101299495 | 3300005436 | Bacteria | 705 |
| 78 | Ga0070701_10154661 | 3300005438 | Bacteria | 1323 |
| 79 | Ga0070701_10393920 | 3300005438 | Bacteria | 876 |
| 80 | Ga0070701_10545045 | 3300005438 | Bacteria | 760 |
| 81 | Ga0070701_10653305 | 3300005438 | Bacteria | 702 |
| 82 | Ga0070705_100099878 | 3300005440 | Bacteria | 1830 |
| 83 | Ga0070705_100142372 | 3300005440 | Bacteria | 1580 |
| 84 | Ga0070700_100247275 | 3300005441 | Bacteria | 1277 |
| 85 | Ga0070700_101395585 | 3300005441 | Bacteria | 592 |
| 86 | Ga0070694_101099014 | 3300005444 | Bacteria | 663 |
| 87 | Ga0070708_100782917 | 3300005445 | Bacteria | 897 |
| 88 | Ga0070708_101572116 | 3300005445 | Bacteria | 612 |
| 89 | Ga0070663_100041108 | 3300005455 | Bacteria | 3240 |
| 90 | Ga0070663_100525545 | 3300005455 | Bacteria | 986 |
| 91 | Ga0070678_100040424 | 3300005456 | Unclassified | 3300 |
| 92 | Ga0070678_100183155 | 3300005456 | Bacteria | 1716 |
| 93 | Ga0070678_100345348 | 3300005456 | Bacteria | 1278 |
| 94 | Ga0070678_100361993 | 3300005456 | Bacteria | 1250 |
| 95 | Ga0070678_100510258 | 3300005456 | Bacteria | 1062 |
| 96 | Ga0070662_100275970 | 3300005457 | Bacteria | 1359 |
| 97 | Ga0068867_100002417 | 3300005459 | Bacteria | 13127 |
| 98 | Ga0068867_100175454 | 3300005459 | Unclassified | 1700 |
| 99 | Ga0068867_100432941 | 3300005459 | Bacteria | 1117 |
| 100 | Ga0068867_100672655 | 3300005459 | Bacteria | 911 |
| 101 | Ga0070685_10002936 | 3300005466 | Bacteria | 8713 |
| 102 | Ga0070685_10271149 | 3300005466 | Bacteria | 1132 |
| 103 | Ga0070706_100008183 | 3300005467 | Bacteria | 9756 |
| 104 | Ga0070707_100268319 | 3300005468 | Bacteria | 1660 |
| 105 | Ga0070707_100713285 | 3300005468 | Bacteria | 966 |
| 106 | Ga0070684_100038607 | 3300005535 | Bacteria | 4103 |
| 107 | Ga0070697_100051475 | 3300005536 | Bacteria | 3345 |
| 108 | Ga0068853_100091069 | 3300005539 | Bacteria | 2681 |
| 109 | Ga0068853_100447911 | 3300005539 | Bacteria | 1214 |
| 110 | Ga0070672_100074657 | 3300005543 | Bacteria | 2705 |
| 111 | Ga0070672_100266915 | 3300005543 | Bacteria | 1444 |
| 112 | Ga0070672_100284460 | 3300005543 | Bacteria | 1399 |
| 113 | Ga0070672_101204137 | 3300005543 | Bacteria | 675 |
| 114 | Ga0070672_101804567 | 3300005543 | Bacteria | 550 |
| 115 | Ga0070695_100082935 | 3300005545 | Bacteria | 2123 |
| 116 | Ga0070695_101500815 | 3300005545 | Bacteria | 561 |
| 117 | Ga0070695_101725436 | 3300005545 | Bacteria | 524 |
| 118 | Ga0070696_100260072 | 3300005546 | Bacteria | 1316 |
| 119 | Ga0070696_100461079 | 3300005546 | Bacteria | 1004 |
| 120 | Ga0070696_100712420 | 3300005546 | Bacteria | 819 |
| 121 | Ga0070696_101568302 | 3300005546 | Bacteria | 565 |
| 122 | Ga0070693_100046196 | 3300005547 | Bacteria | 2472 |
| 123 | Ga0070693_100867161 | 3300005547 | Bacteria | 674 |
| 124 | Ga0070665_100231596 | 3300005548 | Bacteria | 1847 |
| 125 | Ga0070665_100453481 | 3300005548 | Bacteria | 1292 |
| 126 | Ga0070704_100507774 | 3300005549 | Bacteria | 1047 |
| 127 | Ga0070704_100563638 | 3300005549 | Bacteria | 997 |
| 128 | Ga0070704_100800570 | 3300005549 | Bacteria | 842 |
| 129 | Ga0070704_101498009 | 3300005549 | Bacteria | 620 |
| 130 | Ga0068855_100155160 | 3300005563 | Bacteria | 2602 |
| 131 | Ga0068855_100190496 | 3300005563 | Bacteria | 2314 |
| 132 | Ga0068855_100645153 | 3300005563 | Bacteria | 1137 |
| 133 | Ga0070664_100095292 | 3300005564 | Bacteria | 2581 |
| 134 | Ga0070664_100298787 | 3300005564 | Bacteria | 1455 |
| 135 | Ga0068857_100038087 | 3300005577 | Bacteria | 4258 |
| 136 | Ga0068857_100378661 | 3300005577 | Bacteria | 1314 |
| 137 | Ga0068857_100519881 | 3300005577 | Bacteria | 1119 |
| 138 | Ga0068857_101029673 | 3300005577 | Bacteria | 793 |
| 139 | Ga0068854_100097670 | 3300005578 | Bacteria | 2196 |
| 140 | Ga0068856_101701191 | 3300005614 | Bacteria | 643 |
| 141 | Ga0070702_100057345 | 3300005615 | Bacteria | 2252 |
| 142 | Ga0070702_100629936 | 3300005615 | Bacteria | 808 |
| 143 | Ga0070702_101697150 | 3300005615 | Bacteria | 525 |
| 144 | Ga0068852_100052141 | 3300005616 | Bacteria | 3515 |
| 145 | Ga0068852_100355784 | 3300005616 | Bacteria | 1431 |
| 146 | Ga0068852_100705934 | 3300005616 | Bacteria | 1019 |
| 147 | Ga0068859_100006120 | 3300005617 | Bacteria | 12223 |
| 148 | Ga0068859_100026047 | 3300005617 | Bacteria | 5868 |
| 149 | Ga0068859_100052757 | 3300005617 | Bacteria | 4089 |
| 150 | Ga0068859_100499965 | 3300005617 | Bacteria | 1311 |
| 151 | Ga0068859_100762010 | 3300005617 | Bacteria | 1056 |
| 152 | Ga0068859_102177964 | 3300005617 | Bacteria | 612 |
| 153 | Ga0068864_100000600 | 3300005618 | Bacteria | 30574 |
| 154 | Ga0068864_100004298 | 3300005618 | Bacteria | 11712 |
| 155 | Ga0068864_100518495 | 3300005618 | Bacteria | 1149 |
| 156 | Ga0068866_10037854 | 3300005718 | Bacteria | 2372 |
| 157 | Ga0068866_10056076 | 3300005718 | Bacteria | 2026 |
| 158 | Ga0068861_100007311 | 3300005719 | Bacteria | 7569 |
| 159 | Ga0068861_100752076 | 3300005719 | Bacteria | 911 |
| 160 | Ga0068861_101799218 | 3300005719 | Bacteria | 608 |
| 161 | Ga0068851_10102068 | 3300005834 | Bacteria | 1523 |
| 162 | Ga0068851_10124015 | 3300005834 | Bacteria | 1391 |
| 163 | Ga0068870_10003580 | 3300005840 | Bacteria | 6586 |
| 164 | Ga0068870_10297723 | 3300005840 | Bacteria | 1017 |
| 165 | Ga0068863_100000563 | 3300005841 | Bacteria | 37653 |
| 166 | Ga0068863_100083649 | 3300005841 | Bacteria | 3024 |
| 167 | Ga0068863_100220340 | 3300005841 | Bacteria | 1828 |
| 168 | Ga0068863_100291206 | 3300005841 | Bacteria | 1582 |
| 169 | Ga0068863_101946986 | 3300005841 | Bacteria | 598 |
| 170 | Ga0068858_100002972 | 3300005842 | Bacteria | 17016 |
| 171 | Ga0068858_100022537 | 3300005842 | Bacteria | 5877 |
| 172 | Ga0068858_100141545 | 3300005842 | Bacteria | 2258 |
| 173 | Ga0068858_100348162 | 3300005842 | Bacteria | 1419 |
| 174 | Ga0068858_100372386 | 3300005842 | Bacteria | 1370 |
| 175 | Ga0068860_100026286 | 3300005843 | Bacteria | 5612 |
| 176 | Ga0068860_100046827 | 3300005843 | Unclassified | 4122 |
| 177 | Ga0068860_100049100 | 3300005843 | Bacteria | 4021 |
| 178 | Ga0068860_100050809 | 3300005843 | Bacteria | 3946 |
| 179 | Ga0068860_100095533 | 3300005843 | Bacteria | 2833 |
| 180 | Ga0068862_100006488 | 3300005844 | Bacteria | 9713 |
| 181 | Ga0068862_100044301 | 3300005844 | Bacteria | 3794 |
| 182 | Ga0068862_100136363 | 3300005844 | Bacteria | 2175 |
| 183 | Ga0068862_100612293 | 3300005844 | Bacteria | 1047 |
| 184 | Ga0081455_10020855 | 3300005937 | Bacteria | 6160 |
| 185 | Ga0075365_10135592 | 3300006038 | Bacteria | 1706 |
| 186 | Ga0075365_10712191 | 3300006038 | Bacteria | 709 |
| 187 | Ga0075365_11189469 | 3300006038 | Bacteria | 536 |
| 188 | Ga0075364_10039619 | 3300006051 | Bacteria | 3055 |
| 189 | Ga0075364_10349933 | 3300006051 | Bacteria | 1007 |
| 190 | Ga0070715_10777341 | 3300006163 | Bacteria | 579 |
| 191 | Ga0070716_101401744 | 3300006173 | Bacteria | 568 |
| 192 | Ga0075367_10766291 | 3300006178 | Bacteria | 614 |
| 193 | Ga0097621_100006633 | 3300006237 | Bacteria | 8226 |
| 194 | Ga0097621_100558662 | 3300006237 | Bacteria | 1042 |
| 195 | Ga0097621_101229560 | 3300006237 | Bacteria | 706 |
| 196 | Ga0068871_100072093 | 3300006358 | Bacteria | 2843 |
| 197 | Ga0068871_100094134 | 3300006358 | Unclassified | 2500 |
| 198 | Ga0068871_100796543 | 3300006358 | Bacteria | 871 |
| 199 | Ga0075434_100528269 | 3300006871 | Bacteria | 1200 |
| 200 | Ga0068865_100084405 | 3300006881 | Bacteria | 2289 |
| 201 | Ga0068865_100125116 | 3300006881 | Bacteria | 1918 |
| 202 | Ga0068865_100342552 | 3300006881 | Bacteria | 1208 |
| 203 | Ga0068865_100547267 | 3300006881 | Bacteria | 971 |
| 204 | Ga0097620_100006120 | 3300006931 | Bacteria | 12223 |
| 205 | Ga0097620_100026046 | 3300006931 | Bacteria | 5868 |
| 206 | Ga0097620_100052758 | 3300006931 | Bacteria | 4089 |
| 207 | Ga0097620_100499974 | 3300006931 | Bacteria | 1311 |
| 208 | Ga0097620_100762020 | 3300006931 | Bacteria | 1056 |
| 209 | Ga0097620_102178219 | 3300006931 | Bacteria | 612 |
| 210 | Ga0105250_10000022 | 3300009092 | Bacteria | 231610 |
| 211 | Ga0105240_10000026 | 3300009093 | Bacteria | 355569 |
| 212 | Ga0105240_10819122 | 3300009093 | Bacteria | 1007 |
| 213 | Ga0111539_10026150 | 3300009094 | Bacteria | 7142 |
| 214 | Ga0111539_10196938 | 3300009094 | Bacteria | 2350 |
| 215 | Ga0105245_10357918 | 3300009098 | Bacteria | 1448 |
| 216 | Ga0105245_10765097 | 3300009098 | Bacteria | 1002 |
| 217 | Ga0105245_10907629 | 3300009098 | Bacteria | 923 |
| 218 | Ga0105245_10920519 | 3300009098 | Bacteria | 916 |
| 219 | Ga0105247_10040149 | 3300009101 | Bacteria | 2860 |
| 220 | Ga0105247_10074240 | 3300009101 | Bacteria | 2132 |
| 221 | Ga0114129_10325110 | 3300009147 | Bacteria | 2044 |
| 222 | Ga0114129_12081915 | 3300009147 | Bacteria | 685 |
| 223 | Ga0105243_10029350 | 3300009148 | Bacteria | 4229 |
| 224 | Ga0105243_10094163 | 3300009148 | Unclassified | 2473 |
| 225 | Ga0105241_10252081 | 3300009174 | Bacteria | 1497 |
| 226 | Ga0105241_11125109 | 3300009174 | Bacteria | 740 |
| 227 | Ga0105241_11134512 | 3300009174 | Bacteria | 738 |
| 228 | Ga0105241_12078431 | 3300009174 | Bacteria | 561 |
| 229 | Ga0105242_10086903 | 3300009176 | Unclassified | 2625 |
| 230 | Ga0105242_11163689 | 3300009176 | Bacteria | 789 |
| 231 | Ga0105242_11207624 | 3300009176 | Bacteria | 776 |
| 232 | Ga0105242_11318742 | 3300009176 | Bacteria | 746 |
| 233 | Ga0105242_13212389 | 3300009176 | Bacteria | 507 |
| 234 | Ga0105248_10008221 | 3300009177 | Bacteria | 11464 |
| 235 | Ga0105248_10046396 | 3300009177 | Bacteria | 4870 |
| 236 | Ga0105248_10084147 | 3300009177 | Bacteria | 3578 |
| 237 | Ga0105248_10299117 | 3300009177 | Bacteria | 1812 |
| 238 | Ga0105248_10891688 | 3300009177 | Bacteria | 1004 |
| 239 | Ga0105248_11301863 | 3300009177 | Bacteria | 822 |
| 240 | Ga0105237_10946318 | 3300009545 | Bacteria | 868 |
| 241 | Ga0105238_11204128 | 3300009551 | Bacteria | 782 |
| 242 | Ga0105249_10229729 | 3300009553 | Bacteria | 1829 |
| 243 | Ga0105249_10292693 | 3300009553 | Bacteria | 1630 |
| 244 | Ga0105249_10415973 | 3300009553 | Bacteria | 1377 |
| 245 | Ga0105249_10507008 | 3300009553 | Bacteria | 1252 |
| 246 | Ga0105249_11165016 | 3300009553 | Bacteria | 842 |
| 247 | Ga0105239_10535674 | 3300010375 | Bacteria | 1333 |
| 248 | Ga0105239_11689259 | 3300010375 | Bacteria | 733 |
| 249 | Ga0105239_11733445 | 3300010375 | Bacteria | 723 |
| 250 | Ga0105246_10122130 | 3300011119 | Bacteria | 1932 |
| 251 | Ga0105246_10520297 | 3300011119 | Bacteria | 1014 |
| 252 | Ga0105246_10898414 | 3300011119 | Bacteria | 794 |
| 253 | Ga0105246_11920296 | 3300011119 | Bacteria | 569 |
| 254 | Ga0157323_1026169 | 3300012495 | Bacteria | 590 |
| 255 | Ga0157319_1025564 | 3300012497 | Bacteria | 605 |
| 256 | Ga0157347_1027228 | 3300012502 | Bacteria | 700 |
| 257 | Ga0157315_1011824 | 3300012508 | Bacteria | 794 |
| 258 | Ga0157371_10356988 | 3300013102 | Bacteria | 1065 |
| 259 | Ga0157370_11326111 | 3300013104 | Bacteria | 648 |
| 260 | Ga0157374_10091416 | 3300013296 | Bacteria | 2902 |
| 261 | Ga0157374_10098171 | 3300013296 | Unclassified | 2804 |
| 262 | Ga0157374_10510094 | 3300013296 | Bacteria | 1208 |
| 263 | Ga0157378_10006203 | 3300013297 | Bacteria | 10464 |
| 264 | Ga0157378_10061392 | 3300013297 | Bacteria | 3354 |
| 265 | Ga0157378_10181319 | 3300013297 | Bacteria | 1981 |
| 266 | Ga0157378_10481719 | 3300013297 | Bacteria | 1236 |
| 267 | Ga0157378_10635794 | 3300013297 | Bacteria | 1081 |
| 268 | Ga0157378_11696641 | 3300013297 | Bacteria | 679 |
| 269 | Ga0163162_10014221 | 3300013306 | Bacteria | 7774 |
| 270 | Ga0163162_10035656 | 3300013306 | Unclassified | 4956 |
| 271 | Ga0163162_10194409 | 3300013306 | Bacteria | 2157 |
| 272 | Ga0163162_10348689 | 3300013306 | Bacteria | 1613 |
| 273 | Ga0163162_10714802 | 3300013306 | Bacteria | 1123 |
| 274 | Ga0157372_10172545 | 3300013307 | Bacteria | 2502 |
| 275 | Ga0157372_10866498 | 3300013307 | Bacteria | 1048 |
| 276 | Ga0157372_11337715 | 3300013307 | Bacteria | 826 |
| 277 | Ga0157375_10014567 | 3300013308 | Bacteria | 7020 |
| 278 | Ga0157375_10026377 | 3300013308 | Bacteria | 5413 |
| 279 | Ga0157375_10054492 | 3300013308 | Bacteria | 3939 |
| 280 | Ga0157375_10084541 | 3300013308 | Bacteria | 3222 |
| 281 | Ga0157375_10216524 | 3300013308 | Unclassified | 2073 |
| 282 | Ga0157375_10247174 | 3300013308 | Bacteria | 1944 |
| 283 | Ga0157375_12599766 | 3300013308 | Bacteria | 605 |
| 284 | Ga0157375_13190090 | 3300013308 | Bacteria | 547 |
| 285 | Ga0163163_10132130 | 3300014325 | Bacteria | 2537 |
| 286 | Ga0163163_10174607 | 3300014325 | Bacteria | 2195 |
| 287 | Ga0157380_10135568 | 3300014326 | Bacteria | 2106 |
| 288 | Ga0157380_10274986 | 3300014326 | Bacteria | 1538 |
| 289 | Ga0157380_10425925 | 3300014326 | Bacteria | 1267 |
| 290 | Ga0157380_11229016 | 3300014326 | Bacteria | 794 |
| 291 | Ga0157380_11693693 | 3300014326 | Bacteria | 690 |
| 292 | Ga0182008_10087804 | 3300014497 | Bacteria | 1532 |
| 293 | Ga0157377_10024330 | 3300014745 | Bacteria | 3218 |
| 294 | Ga0157377_10331330 | 3300014745 | Bacteria | 1015 |
| 295 | Ga0157379_10000029 | 3300014968 | Bacteria | 85625 |
| 296 | Ga0157379_10018885 | 3300014968 | Bacteria | 6083 |
| 297 | Ga0157379_10029724 | 3300014968 | Bacteria | 4859 |
| 298 | Ga0157379_10065580 | 3300014968 | Unclassified | 3246 |
| 299 | Ga0157379_10106915 | 3300014968 | Bacteria | 2512 |
| 300 | Ga0157376_10017976 | 3300014969 | Bacteria | 5408 |
| 301 | Ga0157376_10023767 | 3300014969 | Bacteria | 4803 |
| 302 | Ga0157376_10045491 | 3300014969 | Bacteria | 3614 |
| 303 | Ga0157376_10665376 | 3300014969 | Bacteria | 1043 |
| 304 | Ga0182005_1008576 | 3300015265 | Bacteria | 3006 |
| 305 | Ga0163161_10079509 | 3300017792 | Bacteria | 2411 |
| 306 | Ga0163161_10235180 | 3300017792 | Bacteria | 1423 |
| 307 | Ga0163161_11874897 | 3300017792 | Bacteria | 534 |
| 308 | Ga0213876_10521858 | 3300021384 | Bacteria | 632 |
| 309 | Ga0213875_10107622 | 3300021388 | Bacteria | 1301 |
| 310 | Ga0207425_1000086 | 3300025245 | Bacteria | 94681 |
| 311 | Ga0209129_1000174 | 3300025258 | Bacteria | 94671 |
| 312 | Ga0207666_1011320 | 3300025271 | Bacteria | 1232 |
| 313 | Ga0209673_1005117 | 3300025273 | Bacteria | 6719 |
| 314 | Ga0207673_1009415 | 3300025290 | Bacteria | 1248 |
| 315 | Ga0209676_1058010 | 3300025292 | Bacteria | 978 |
| 316 | Ga0209025_1000367 | 3300025294 | Bacteria | 95238 |
| 317 | Ga0209758_1000305 | 3300025297 | Bacteria | 95644 |
| 318 | Ga0209050_1000026 | 3300025298 | Bacteria | 499134 |
| 319 | Ga0209256_1041671 | 3300025299 | Bacteria | 1165 |
| 320 | Ga0209051_1059104 | 3300025303 | Bacteria | 1217 |
| 321 | Ga0209257_1000009 | 3300025304 | Bacteria | 1205047 |
| 322 | Ga0207697_10000114 | 3300025315 | Bacteria | 37714 |
| 323 | Ga0207656_10184825 | 3300025321 | Bacteria | 1002 |
| 324 | Ga0207696_1000153 | 3300025711 | Bacteria | 119213 |
| 325 | Ga0207682_10000010 | 3300025893 | Bacteria | 85697 |
| 326 | Ga0207682_10592591 | 3300025893 | Bacteria | 523 |
| 327 | Ga0207642_10026105 | 3300025899 | Unclassified | 2374 |
| 328 | Ga0207642_10064600 | 3300025899 | Bacteria | 1716 |
| 329 | Ga0207688_10000190 | 3300025901 | Bacteria | 27202 |
| 330 | Ga0207688_10276936 | 3300025901 | Bacteria | 1021 |
| 331 | Ga0207680_10026838 | 3300025903 | Bacteria | 3197 |
| 332 | Ga0207680_10109193 | 3300025903 | Unclassified | 1791 |
| 333 | Ga0207680_10135990 | 3300025903 | Bacteria | 1624 |
| 334 | Ga0207647_10101760 | 3300025904 | Bacteria | 1704 |
| 335 | Ga0207645_10017678 | 3300025907 | Bacteria | 4701 |
| 336 | Ga0207645_10018159 | 3300025907 | Bacteria | 4635 |
| 337 | Ga0207645_11054705 | 3300025907 | Bacteria | 549 |
| 338 | Ga0207643_10000683 | 3300025908 | Bacteria | 21203 |
| 339 | Ga0207643_10006779 | 3300025908 | Bacteria | 6145 |
| 340 | Ga0207643_10018458 | 3300025908 | Bacteria | 3820 |
| 341 | Ga0207705_11096104 | 3300025909 | Bacteria | 613 |
| 342 | Ga0207684_10006867 | 3300025910 | Bacteria | 10303 |
| 343 | Ga0207684_11662988 | 3300025910 | Bacteria | 515 |
| 344 | Ga0207654_11166273 | 3300025911 | Bacteria | 561 |
| 345 | Ga0207671_11513779 | 3300025914 | Bacteria | 518 |
| 346 | Ga0207662_10000676 | 3300025918 | Bacteria | 15515 |
| 347 | Ga0207662_11307836 | 3300025918 | Bacteria | 515 |
| 348 | Ga0207657_11027114 | 3300025919 | Bacteria | 632 |
| 349 | Ga0207649_11423502 | 3300025920 | Bacteria | 549 |
| 350 | Ga0207646_10216351 | 3300025922 | Bacteria | 1731 |
| 351 | Ga0207681_10051469 | 3300025923 | Bacteria | 2790 |
| 352 | Ga0207681_10574329 | 3300025923 | Bacteria | 930 |
| 353 | Ga0207694_11519263 | 3300025924 | Bacteria | 565 |
| 354 | Ga0207694_11654451 | 3300025924 | Bacteria | 539 |
| 355 | Ga0207650_10009050 | 3300025925 | Bacteria | 6806 |
| 356 | Ga0207650_10018823 | 3300025925 | Bacteria | 4850 |
| 357 | Ga0207650_10093729 | 3300025925 | Bacteria | 2299 |
| 358 | Ga0207659_10095339 | 3300025926 | Bacteria | 2231 |
| 359 | Ga0207659_10219368 | 3300025926 | Bacteria | 1528 |
| 360 | Ga0207687_10305190 | 3300025927 | Bacteria | 1283 |
| 361 | Ga0207687_10615678 | 3300025927 | Bacteria | 916 |
| 362 | Ga0207687_10814082 | 3300025927 | Bacteria | 797 |
| 363 | Ga0207687_11213768 | 3300025927 | Bacteria | 648 |
| 364 | Ga0207700_11525963 | 3300025928 | Bacteria | 592 |
| 365 | Ga0207664_10052474 | 3300025929 | Bacteria | 3225 |
| 366 | Ga0207664_10652415 | 3300025929 | Bacteria | 946 |
| 367 | Ga0207664_11525623 | 3300025929 | Bacteria | 590 |
| 368 | Ga0207644_10059075 | 3300025931 | Bacteria | 2773 |
| 369 | Ga0207644_10074314 | 3300025931 | Bacteria | 2494 |
| 370 | Ga0207644_10091634 | 3300025931 | Bacteria | 2267 |
| 371 | Ga0207644_10139187 | 3300025931 | Bacteria | 1867 |
| 372 | Ga0207644_10312034 | 3300025931 | Bacteria | 1270 |
| 373 | Ga0207690_10083812 | 3300025932 | Bacteria | 2233 |
| 374 | Ga0207690_10086244 | 3300025932 | Bacteria | 2206 |
| 375 | Ga0207690_11139141 | 3300025932 | Bacteria | 651 |
| 376 | Ga0207706_10003578 | 3300025933 | Bacteria | 14835 |
| 377 | Ga0207706_10340506 | 3300025933 | Bacteria | 1305 |
| 378 | Ga0207706_11550379 | 3300025933 | Bacteria | 538 |
| 379 | Ga0207709_10097580 | 3300025935 | Bacteria | 1936 |
| 380 | Ga0207709_11167135 | 3300025935 | Bacteria | 634 |
| 381 | Ga0207670_10101539 | 3300025936 | Bacteria | 2055 |
| 382 | Ga0207670_10218421 | 3300025936 | Bacteria | 1458 |
| 383 | Ga0207670_11857629 | 3300025936 | Bacteria | 512 |
| 384 | Ga0207669_10049655 | 3300025937 | Bacteria | 2502 |
| 385 | Ga0207669_10202695 | 3300025937 | Bacteria | 1441 |
| 386 | Ga0207669_10416829 | 3300025937 | Bacteria | 1056 |
| 387 | Ga0207704_10055435 | 3300025938 | Bacteria | 2422 |
| 388 | Ga0207704_10907274 | 3300025938 | Bacteria | 741 |
| 389 | Ga0207704_11486456 | 3300025938 | Bacteria | 581 |
| 390 | Ga0207704_11631534 | 3300025938 | Bacteria | 554 |
| 391 | Ga0207691_10003554 | 3300025940 | Bacteria | 15162 |
| 392 | Ga0207691_10011788 | 3300025940 | Bacteria | 8390 |
| 393 | Ga0207691_10158837 | 3300025940 | Bacteria | 1984 |
| 394 | Ga0207691_10463599 | 3300025940 | Bacteria | 1078 |
| 395 | Ga0207691_10762699 | 3300025940 | Bacteria | 814 |
| 396 | Ga0207711_10033860 | 3300025941 | Bacteria | 4325 |
| 397 | Ga0207711_10319576 | 3300025941 | Bacteria | 1434 |
| 398 | Ga0207711_11056286 | 3300025941 | Bacteria | 752 |
| 399 | Ga0207711_11144665 | 3300025941 | Bacteria | 719 |
| 400 | Ga0207689_10000236 | 3300025942 | Bacteria | 49281 |
| 401 | Ga0207689_10001266 | 3300025942 | Bacteria | 24364 |
| 402 | Ga0207689_10004515 | 3300025942 | Bacteria | 12601 |
| 403 | Ga0207689_10374826 | 3300025942 | Bacteria | 1185 |
| 404 | Ga0207661_10066031 | 3300025944 | Bacteria | 2938 |
| 405 | Ga0207679_10139832 | 3300025945 | Bacteria | 1955 |
| 406 | Ga0207679_11414136 | 3300025945 | Bacteria | 638 |
| 407 | Ga0207667_10148052 | 3300025949 | Bacteria | 2417 |
| 408 | Ga0207667_11264495 | 3300025949 | Bacteria | 715 |
| 409 | Ga0207667_12120217 | 3300025949 | Bacteria | 520 |
| 410 | Ga0207651_10022645 | 3300025960 | Bacteria | 3846 |
| 411 | Ga0207651_10141088 | 3300025960 | Bacteria | 1861 |
| 412 | Ga0207651_10444403 | 3300025960 | Bacteria | 1111 |
| 413 | Ga0207651_10492159 | 3300025960 | Bacteria | 1059 |
| 414 | Ga0207651_10739022 | 3300025960 | Bacteria | 869 |
| 415 | Ga0207651_11583830 | 3300025960 | Bacteria | 590 |
| 416 | Ga0207712_10145971 | 3300025961 | Bacteria | 1821 |
| 417 | Ga0207712_10179853 | 3300025961 | Bacteria | 1660 |
| 418 | Ga0207712_10290695 | 3300025961 | Bacteria | 1337 |
| 419 | Ga0207712_10654140 | 3300025961 | Bacteria | 913 |
| 420 | Ga0207668_10022121 | 3300025972 | Bacteria | 4065 |
| 421 | Ga0207668_10283880 | 3300025972 | Bacteria | 1359 |
| 422 | Ga0207668_10830226 | 3300025972 | Bacteria | 819 |
| 423 | Ga0207668_11067815 | 3300025972 | Bacteria | 723 |
| 424 | Ga0207658_10006487 | 3300025986 | Bacteria | 7987 |
| 425 | Ga0207658_10079951 | 3300025986 | Bacteria | 2502 |
| 426 | Ga0207658_10246850 | 3300025986 | Bacteria | 1515 |
| 427 | Ga0207658_10404861 | 3300025986 | Bacteria | 1200 |
| 428 | Ga0207658_10479518 | 3300025986 | Bacteria | 1105 |
| 429 | Ga0207658_10641937 | 3300025986 | Bacteria | 956 |
| 430 | Ga0207658_10744425 | 3300025986 | Bacteria | 887 |
| 431 | Ga0207677_10284799 | 3300026023 | Bacteria | 1358 |
| 432 | Ga0207677_10293082 | 3300026023 | Bacteria | 1341 |
| 433 | Ga0207677_10414914 | 3300026023 | Bacteria | 1145 |
| 434 | Ga0207677_10925917 | 3300026023 | Bacteria | 787 |
| 435 | Ga0207703_10001159 | 3300026035 | Bacteria | 24878 |
| 436 | Ga0207703_10050347 | 3300026035 | Bacteria | 3371 |
| 437 | Ga0207703_10051835 | 3300026035 | Unclassified | 3328 |
| 438 | Ga0207703_10477004 | 3300026035 | Bacteria | 1168 |
| 439 | Ga0207703_10774475 | 3300026035 | Bacteria | 915 |
| 440 | Ga0207639_10276985 | 3300026041 | Bacteria | 1474 |
| 441 | Ga0207678_10013427 | 3300026067 | Bacteria | 7190 |
| 442 | Ga0207678_10044680 | 3300026067 | Bacteria | 3831 |
| 443 | Ga0207678_11765326 | 3300026067 | Bacteria | 542 |
| 444 | Ga0207708_10002325 | 3300026075 | Bacteria | 13957 |
| 445 | Ga0207708_10930214 | 3300026075 | Bacteria | 753 |
| 446 | Ga0207708_11282923 | 3300026075 | Bacteria | 641 |
| 447 | Ga0207702_10309153 | 3300026078 | Bacteria | 1502 |
| 448 | Ga0207702_11393532 | 3300026078 | Bacteria | 695 |
| 449 | Ga0207641_10110952 | 3300026088 | Bacteria | 2431 |
| 450 | Ga0207641_10121508 | 3300026088 | Bacteria | 2331 |
| 451 | Ga0207641_10187798 | 3300026088 | Bacteria | 1897 |
| 452 | Ga0207641_11070724 | 3300026088 | Bacteria | 804 |
| 453 | Ga0207648_10000823 | 3300026089 | Bacteria | 35061 |
| 454 | Ga0207648_10001240 | 3300026089 | Bacteria | 28641 |
| 455 | Ga0207648_10008577 | 3300026089 | Bacteria | 9887 |
| 456 | Ga0207648_10036889 | 3300026089 | Unclassified | 4306 |
| 457 | Ga0207648_10710924 | 3300026089 | Bacteria | 931 |
| 458 | Ga0207676_10005653 | 3300026095 | Bacteria | 8852 |
| 459 | Ga0207676_10012924 | 3300026095 | Bacteria | 5996 |
| 460 | Ga0207676_10429666 | 3300026095 | Bacteria | 1241 |
| 461 | Ga0207674_10001726 | 3300026116 | Bacteria | 27948 |
| 462 | Ga0207674_10145192 | 3300026116 | Bacteria | 2331 |
| 463 | Ga0207674_10174241 | 3300026116 | Bacteria | 2104 |
| 464 | Ga0207675_100000242 | 3300026118 | Bacteria | 52003 |
| 465 | Ga0207675_100000778 | 3300026118 | Bacteria | 31816 |
| 466 | Ga0207675_100001080 | 3300026118 | Bacteria | 27005 |
| 467 | Ga0207675_100020960 | 3300026118 | Bacteria | 6095 |
| 468 | Ga0207675_100557029 | 3300026118 | Bacteria | 1146 |
| 469 | Ga0207683_10088493 | 3300026121 | Bacteria | 2755 |
| 470 | Ga0207683_10582512 | 3300026121 | Bacteria | 1035 |
| 471 | Ga0207683_10871809 | 3300026121 | Bacteria | 836 |
| 472 | Ga0207698_10146646 | 3300026142 | Bacteria | 2042 |
| 473 | Ga0207698_10219685 | 3300026142 | Bacteria | 1716 |
| 474 | Ga0207698_10697497 | 3300026142 | Bacteria | 1010 |
| 475 | Ga0207698_11338828 | 3300026142 | Bacteria | 731 |
| 476 | Ga0209966_1127403 | 3300027695 | Bacteria | 587 |
| 477 | Ga0209998_10024852 | 3300027717 | Bacteria | 1302 |
| 478 | Ga0207428_10111867 | 3300027907 | Bacteria | 2101 |
| 479 | Ga0268266_10023814 | 3300028379 | Bacteria | 5211 |
| 480 | Ga0268266_10333845 | 3300028379 | Unclassified | 1421 |
| 481 | Ga0268266_10781564 | 3300028379 | Bacteria | 922 |
| 482 | Ga0268266_11500417 | 3300028379 | Bacteria | 650 |
| 483 | Ga0268265_10020966 | 3300028380 | Bacteria | 4569 |
| 484 | Ga0268265_10034277 | 3300028380 | Bacteria | 3698 |
| 485 | Ga0268265_10134764 | 3300028380 | Bacteria | 2058 |
| 486 | Ga0268265_10382245 | 3300028380 | Bacteria | 1296 |
| 487 | Ga0268265_12565811 | 3300028380 | Bacteria | 515 |
| 488 | Ga0268264_10005449 | 3300028381 | Bacteria | 10782 |
| 489 | Ga0268264_10019372 | 3300028381 | Bacteria | 5562 |
| 490 | Ga0268264_10039488 | 3300028381 | Bacteria | 3900 |
| 491 | Ga0268264_10052175 | 3300028381 | Unclassified | 3409 |
| 492 | Ga0268264_10467069 | 3300028381 | Bacteria | 1225 |
| 493 | Ga0265338_10026205 | 3300028800 | Bacteria | 5889 |
| 494 | Ga0307511_10069347 | 3300030521 | Bacteria | 2593 |
| 495 | Ga0265340_10150008 | 3300031247 | Bacteria | 1063 |
| 496 | Ga0307408_101077452 | 3300031548 | Bacteria | 744 |
| 497 | Ga0307408_101718259 | 3300031548 | Bacteria | 598 |
| 498 | Ga0316575_10004749 | 3300031665 | Bacteria | 4794 |
| 499 | Ga0316575_10096260 | 3300031665 | Bacteria | 1201 |
| 500 | Ga0316576_10146198 | 3300031727 | Bacteria | 1781 |
| 501 | Ga0307405_10636523 | 3300031731 | Bacteria | 875 |
| 502 | Ga0307413_11756787 | 3300031824 | Bacteria | 554 |
| 503 | Ga0307406_10024801 | 3300031901 | Bacteria | 3585 |
| 504 | Ga0307412_10001601 | 3300031911 | Bacteria | 12474 |
| 505 | Ga0307412_11953158 | 3300031911 | Bacteria | 542 |
| 506 | Ga0307409_101530957 | 3300031995 | Bacteria | 695 |
| 507 | Ga0307416_100229851 | 3300032002 | Bacteria | 1787 |
| 508 | Ga0307414_10124795 | 3300032004 | Bacteria | 1987 |
| 509 | Ga0316585_10056829 | 3300032137 | Bacteria | 1260 |
| 510 | Ga0373923_0499689 | 3300035111 | Bacteria | 593 |
| 511 | Ga0373936_0254074 | 3300035113 | Bacteria | 786 |
| 512 | Ga0373953_0176442 | 3300035117 | Bacteria | 921 |
| 513 | Ga0373956_0466330 | 3300035119 | Bacteria | 603 |
| 514 | Ga0373957_0072571 | 3300035120 | Bacteria | 1348 |
| 515 | Ga0373957_0117486 | 3300035120 | Bacteria | 1075 |
| 516 | Ga0373943_0568647 | 3300035170 | Bacteria | 666 |
| 517 | Ga0373946_0517419 | 3300035171 | Bacteria | 613 |
| 518 | Ga0316574_0067500 | 3300035398 | Bacteria | 2255 |
| 519 | Ga0316574_0432706 | 3300035398 | Bacteria | 826 |
| 520 | Ga0373924_0101564 | 3300035410 | Bacteria | 1238 |
| 521 | Ga0373935_1259469 | 3300035692 | Bacteria | 552 |
| 522 | Ga0373933_0094901 | 3300035724 | Bacteria | 1845 |
| 523 | Ga0373933_0444202 | 3300035724 | Bacteria | 848 |
| 524 | Ga0373947_0357278 | 3300035725 | Bacteria | 981 |
| 525 | Ga0373937_0058885 | 3300036401 | Bacteria | 3529 |
| 526 | Ga0373937_0110376 | 3300036401 | Bacteria | 2558 |
| 527 | Ga0373937_0145259 | 3300036401 | Bacteria | 2220 |
| 528 | Ga0373937_0318167 | 3300036401 | Unclassified | 1472 |
| 529 | Ga0373937_0470314 | 3300036401 | Bacteria | 1194 |
| 530 | Ga0373937_1727602 | 3300036401 | Bacteria | 572 |
| 531 | Ga0316582_0221359 | 3300036647 | Bacteria | 1294 |
| 532 | Ga0316582_0822652 | 3300036647 | Bacteria | 636 |
| 533 | Ga0316584_0095501 | 3300036712 | Bacteria | 2225 |
| 534 | Ga0316584_0631090 | 3300036712 | Bacteria | 740 |
| 535 | Ga0373925_0831893 | 3300037068 | Bacteria | 761 |
| 536 | Ga0436364_0530696 | 3300037853 | Bacteria | 8047 |
| 537 | Ga0237819_09762 | 3300038705 | Bacteria | 1278 |
| 538 | Ga0400483_098493 | 3300039062 | Unclassified | 1014 |
| 539 | Ga0400483_237847 | 3300039062 | Bacteria | 1961 |
| 540 | Ga0436365_1286208 | 3300039437 | Bacteria | 4755 |
| 541 | Ga0451800_1669862 | 3300041459 | Bacteria | 584 |
| 542 | Ga0451802_2113515 | 3300041460 | Bacteria | 568 |
| 543 | Ga0451807_1509185 | 3300041486 | Bacteria | 550 |
| 544 | Ga0451833_0514785 | 3300041491 | Bacteria | 674 |
| 545 | Ga0451841_0243136 | 3300041498 | Bacteria | 2234 |
| 546 | Ga0451849_1308335 | 3300041505 | Bacteria | 639 |
| 547 | Ga0451853_0008175 | 3300041512 | Bacteria | 1646 |
| 548 | Ga0451853_3871611 | 3300041512 | Bacteria | 1140 |
| 549 | Ga0439448_0314555 | 3300042005 | Bacteria | 557 |
| 550 | Ga0450914_033132 | 3300042118 | Bacteria | 630 |
| 551 | Ga0451577_0081527 | 3300042876 | Bacteria | 2886 |
| 552 | Ga0453684_0000019 | 3300044712 | Bacteria | 908702 |
| 553 | Ga0495592_0301233 | 3300046454 | Bacteria | 1042 |
| 554 | Ga0495603_0607043 | 3300046455 | Bacteria | 626 |
| 555 | Ga0495629_0149722 | 3300046459 | Bacteria | 1622 |
| 556 | Ga0495629_0654201 | 3300046459 | Bacteria | 700 |
| 557 | Ga0495651_0199424 | 3300046462 | Bacteria | 1402 |
| 558 | Ga0495580_0127379 | 3300046472 | Bacteria | 1767 |
| 559 | Ga0495580_0585166 | 3300046472 | Bacteria | 739 |
| 560 | Ga0495582_0069700 | 3300046473 | Bacteria | 1945 |
| 561 | Ga0495639_0138700 | 3300046475 | Bacteria | 1168 |
| 562 | Ga0495664_0137173 | 3300046477 | Unclassified | 1482 |
| 563 | Ga0495596_0336123 | 3300046500 | Bacteria | 588 |
| 564 | Ga0495608_0282497 | 3300046511 | Bacteria | 1030 |
| 565 | Ga0495628_0145659 | 3300046516 | Bacteria | 1806 |
| 566 | Ga0495628_0256122 | 3300046516 | Bacteria | 1305 |
| 567 | Ga0495652_0816741 | 3300046529 | Bacteria | 620 |
| 568 | Ga0495665_0006822 | 3300046531 | Bacteria | 6160 |
| 569 | Ga0495640_0211533 | 3300046533 | Bacteria | 1226 |
| 570 | Ga0495587_0220054 | 3300046536 | Bacteria | 1071 |
| 571 | Ga0495598_0125823 | 3300046537 | Bacteria | 874 |
| 572 | Ga0495621_0005534 | 3300046539 | Bacteria | 3635 |
| 573 | Ga0495621_0010634 | 3300046539 | Bacteria | 2823 |
| 574 | Ga0495645_0081321 | 3300046543 | Bacteria | 2324 |
| 575 | Ga0495633_0220641 | 3300046558 | Bacteria | 868 |
| 576 | Ga0495667_0202727 | 3300046559 | Bacteria | 1269 |
| 577 | Ga0495635_0265162 | 3300046663 | Bacteria | 1156 |
| 578 | Ga0495635_0887865 | 3300046663 | Bacteria | 571 |
| 579 | Ga0495657_0160222 | 3300046675 | Bacteria | 1393 |
| 580 | Ga0495623_0307090 | 3300046679 | Bacteria | 875 |
| 581 | Ga0495647_0002277 | 3300046681 | Bacteria | 6022 |
| 582 | Ga0495647_0100865 | 3300046681 | Bacteria | 1195 |
| 583 | Ga0495658_0005339 | 3300046683 | Bacteria | 6320 |
| 584 | Ga0495658_0399019 | 3300046683 | Bacteria | 877 |
| 585 | Ga0495658_0547379 | 3300046683 | Bacteria | 741 |
| 586 | Ga0495658_1051791 | 3300046683 | Bacteria | 519 |
| 587 | Ga0495613_0324243 | 3300046689 | Bacteria | 1063 |
| 588 | Ga0495589_0031426 | 3300046794 | Bacteria | 2673 |
| 589 | Ga0495600_0251627 | 3300046809 | Bacteria | 1124 |
| 590 | Ga0495600_0324470 | 3300046809 | Bacteria | 968 |
| 591 | Ga0495581_0102655 | 3300047315 | Bacteria | 1661 |
| 592 | Ga0495676_0704610 | 3300047321 | Bacteria | 653 |
| 593 | Ga0495681_0086463 | 3300047470 | Bacteria | 1391 |
| 594 | Ga0495684_0175701 | 3300047471 | Bacteria | 1590 |
| 595 | Ga0496100_0178514 | 3300048903 | Bacteria | 1534 |
| 596 | Ga0496101_0006056 | 3300048904 | Bacteria | 7761 |
| 597 | Ga0496101_0009385 | 3300048904 | Bacteria | 6430 |
| 598 | Ga0496101_0080612 | 3300048904 | Bacteria | 2405 |
| 599 | Ga0496101_1154045 | 3300048904 | Bacteria | 608 |
| 600 | Ga0496102_0224056 | 3300048905 | Bacteria | 1773 |
| 601 | Ga0496102_1263885 | 3300048905 | Bacteria | 657 |
| 602 | Ga0496104_0054565 | 3300048907 | Bacteria | 3777 |
| 603 | Ga0496105_0065146 | 3300048908 | Bacteria | 3008 |
| 604 | Ga0496106_0084629 | 3300048909 | Bacteria | 2440 |
| 605 | Ga0496107_0017330 | 3300048910 | Bacteria | 5065 |
| 606 | Ga0496108_0007375 | 3300048911 | Bacteria | 8915 |
| 607 | Ga0496108_1034796 | 3300048911 | Bacteria | 700 |
| 608 | Ga0496108_1767876 | 3300048911 | Bacteria | 507 |
| 609 | Ga0496109_0020123 | 3300048912 | Bacteria | 5895 |
| 610 | Ga0496109_0037719 | 3300048912 | Bacteria | 4367 |
| 611 | Ga0496110_0011869 | 3300048913 | Bacteria | 7156 |
| 612 | Ga0496110_0865500 | 3300048913 | Bacteria | 809 |
| 613 | Ga0496110_1438136 | 3300048913 | Bacteria | 599 |
| 614 | Ga0496112_0800977 | 3300048915 | Bacteria | 867 |
| 615 | Ga0496112_1703263 | 3300048915 | Bacteria | 543 |
| 616 | Ga0496113_0042905 | 3300048916 | Bacteria | 3344 |
| 617 | Ga0496114_0139321 | 3300048917 | Bacteria | 2099 |
| 618 | Ga0496114_0456892 | 3300048917 | Bacteria | 1131 |
| 619 | Ga0496114_0518678 | 3300048917 | Bacteria | 1054 |
| 620 | Ga0496114_1539661 | 3300048917 | Bacteria | 553 |
| 621 | Ga0496116_0000216 | 3300048919 | Bacteria | 108542 |
| 622 | Ga0496116_0003659 | 3300048919 | Bacteria | 15088 |
| 623 | Ga0496116_0061770 | 3300048919 | Bacteria | 2424 |
| 624 | Ga0496117_0001639 | 3300048920 | Bacteria | 31496 |
| 625 | Ga0496117_0041934 | 3300048920 | Bacteria | 3345 |
| 626 | Ga0496118_0002026 | 3300048921 | Bacteria | 28649 |
| 627 | Ga0496118_0004361 | 3300048921 | Bacteria | 16835 |
| 628 | Ga0496119_0006934 | 3300048922 | Bacteria | 10334 |
| 629 | Ga0496119_0021874 | 3300048922 | Bacteria | 4601 |
| 630 | Ga0496120_0201897 | 3300048923 | Bacteria | 962 |
| 631 | Ga0496121_0013219 | 3300048924 | Bacteria | 8894 |
| 632 | Ga0496121_0377350 | 3300048924 | Bacteria | 936 |
| 633 | Ga0496122_0002437 | 3300048925 | Bacteria | 26428 |
| 634 | Ga0496122_0011284 | 3300048925 | Bacteria | 9074 |
| 635 | Ga0496122_0020568 | 3300048925 | Bacteria | 5954 |
| 636 | Ga0496122_0023441 | 3300048925 | Bacteria | 5441 |
| 637 | Ga0496122_0065708 | 3300048925 | Bacteria | 2628 |
| 638 | Ga0496122_0340553 | 3300048925 | Bacteria | 788 |
| 639 | Ga0496123_0030486 | 3300048926 | Bacteria | 3947 |
| 640 | Ga0496123_0036742 | 3300048926 | Bacteria | 3467 |
| 641 | Ga0496123_0037020 | 3300048926 | Bacteria | 3450 |
| 642 | Ga0496123_0062629 | 3300048926 | Bacteria | 2382 |
| 643 | Ga0496123_0251344 | 3300048926 | Bacteria | 872 |
| 644 | Ga0496124_0000023 | 3300048927 | Bacteria | 415226 |
| 645 | Ga0496124_0000507 | 3300048927 | Bacteria | 66974 |
| 646 | Ga0496124_0041869 | 3300048927 | Bacteria | 3947 |
| 647 | Ga0496124_0201922 | 3300048927 | Bacteria | 1511 |
| 648 | Ga0496125_0000178 | 3300048928 | Bacteria | 139900 |
| 649 | Ga0496125_0001277 | 3300048928 | Bacteria | 37394 |
| 650 | Ga0496125_0053178 | 3300048928 | Bacteria | 3322 |
| 651 | Ga0496125_0065656 | 3300048928 | Bacteria | 2873 |
| 652 | Ga0496125_0112912 | 3300048928 | Bacteria | 1962 |
| 653 | Ga0496125_0547530 | 3300048928 | Bacteria | 642 |
| 654 | Ga0496125_0671305 | 3300048928 | Bacteria | 554 |
| 655 | Ga0496126_0047707 | 3300048929 | Bacteria | 3920 |
| 656 | Ga0496126_0131230 | 3300048929 | Bacteria | 2165 |
| 657 | Ga0496126_0132341 | 3300048929 | Bacteria | 2154 |
| 658 | Ga0501031_0001266 | 3300049568 | Bacteria | 15469 |
| 659 | Ga0501031_0001923 | 3300049568 | Bacteria | 13094 |
| 660 | Ga0501031_0012669 | 3300049568 | Bacteria | 5506 |
| 661 | Ga0501032_0018403 | 3300049569 | Bacteria | 4896 |
| 662 | Ga0501032_0098350 | 3300049569 | Bacteria | 1939 |
| 663 | Ga0501032_0116940 | 3300049569 | Unclassified | 1763 |
| 664 | Ga0501033_0105762 | 3300049570 | Bacteria | 2051 |
| 665 | Ga0501034_0001318 | 3300049571 | Bacteria | 33588 |
| 666 | Ga0501034_0093979 | 3300049571 | Bacteria | 2995 |
| 667 | Ga0501034_0096167 | 3300049571 | Bacteria | 2958 |
| 668 | Ga0501036_0004316 | 3300049572 | Bacteria | 11478 |
| 669 | Ga0501036_0028421 | 3300049572 | Unclassified | 4726 |
| 670 | Ga0501036_0117763 | 3300049572 | Bacteria | 2243 |
| 671 | Ga0501036_0766214 | 3300049572 | Bacteria | 796 |
| 672 | Ga0501036_1079471 | 3300049572 | Bacteria | 656 |
| 673 | Ga0501036_1419019 | 3300049572 | Bacteria | 563 |
| 674 | Ga0501037_0018188 | 3300049573 | Bacteria | 5178 |
| 675 | Ga0501037_0039289 | 3300049573 | Bacteria | 3484 |
| 676 | Ga0501037_0057540 | 3300049573 | Unclassified | 2838 |
| 677 | Ga0501038_0029848 | 3300049574 | Bacteria | 4830 |
| 678 | Ga0501038_0079400 | 3300049574 | Bacteria | 2767 |
| 679 | Ga0501038_0128551 | 3300049574 | Unclassified | 2083 |
| 680 | Ga0501039_0035622 | 3300049575 | Bacteria | 3841 |
| 681 | Ga0501039_0058508 | 3300049575 | Bacteria | 2985 |
| 682 | Ga0501039_0066129 | 3300049575 | Bacteria | 2806 |
| 683 | Ga0501039_0162707 | 3300049575 | Unclassified | 1754 |
| 684 | Ga0501039_0249574 | 3300049575 | Bacteria | 1395 |
| 685 | Ga0501039_0483755 | 3300049575 | Unclassified | 972 |
| 686 | Ga0501039_0639407 | 3300049575 | Bacteria | 833 |
| 687 | Ga0501039_0868111 | 3300049575 | Bacteria | 703 |
| 688 | Ga0501039_0886344 | 3300049575 | Bacteria | 695 |
| 689 | Ga0501040_0051118 | 3300049576 | Bacteria | 2828 |
| 690 | Ga0501040_0122931 | 3300049576 | Bacteria | 1822 |
| 691 | Ga0501040_0167533 | 3300049576 | Bacteria | 1555 |
| 692 | Ga0501041_0000706 | 3300049577 | Bacteria | 17758 |
| 693 | Ga0501041_0125523 | 3300049577 | Unclassified | 1597 |
| 694 | Ga0501042_0013627 | 3300049578 | Bacteria | 5536 |
| 695 | Ga0501042_0049642 | 3300049578 | Bacteria | 2993 |
| 696 | Ga0501042_0103710 | 3300049578 | Bacteria | 2046 |
| 697 | Ga0501042_0898333 | 3300049578 | Bacteria | 645 |
| 698 | Ga0501043_0083636 | 3300049579 | Bacteria | 2509 |
| 699 | Ga0501043_0209855 | 3300049579 | Unclassified | 1510 |
| 700 | Ga0501043_0305559 | 3300049579 | Bacteria | 1215 |
| 701 | Ga0501043_0430864 | 3300049579 | Bacteria | 993 |
| 702 | Ga0501043_0525314 | 3300049579 | Bacteria | 882 |
| 703 | Ga0501046_0013301 | 3300049580 | Bacteria | 6971 |
| 704 | Ga0501046_0026917 | 3300049580 | Unclassified | 4696 |
| 705 | Ga0501046_0214055 | 3300049580 | Bacteria | 1429 |
| 706 | Ga0501047_0471383 | 3300049581 | Bacteria | 1084 |
| 707 | Ga0501048_0018522 | 3300049582 | Bacteria | 5118 |
| 708 | Ga0501048_0071133 | 3300049582 | Unclassified | 2456 |
| 709 | Ga0501048_1376991 | 3300049582 | Bacteria | 507 |
| 710 | Ga0501068_0005874 | 3300049584 | Bacteria | 6735 |
| 711 | Ga0501068_0971986 | 3300049584 | Bacteria | 560 |
| 712 | Ga0501070_0378919 | 3300049586 | Bacteria | 1146 |
| 713 | Ga0501071_0270343 | 3300049587 | Bacteria | 1285 |
| 714 | Ga0501071_1282916 | 3300049587 | Bacteria | 566 |
| 715 | Ga0501072_0024480 | 3300049588 | Bacteria | 4696 |
| 716 | Ga0501072_0769328 | 3300049588 | Bacteria | 755 |
| 717 | Ga0501073_0167027 | 3300049589 | Bacteria | 1523 |
| 718 | Ga0501073_0197323 | 3300049589 | Bacteria | 1392 |
| 719 | Ga0501074_0096127 | 3300049590 | Bacteria | 2121 |
| 720 | Ga0501074_0391910 | 3300049590 | Bacteria | 985 |
| 721 | Ga0501074_1050650 | 3300049590 | Bacteria | 572 |
| 722 | Ga0501076_0102647 | 3300049592 | Bacteria | 2306 |
| 723 | Ga0501076_0115424 | 3300049592 | Bacteria | 2173 |
| 724 | Ga0501076_0605323 | 3300049592 | Bacteria | 904 |
| 725 | Ga0501077_0056116 | 3300049593 | Bacteria | 2500 |
| 726 | Ga0501261_010250 | 3300049690 | Bacteria | 1232 |
| 727 | Ga0501079_0906223 | 3300049741 | Bacteria | 694 |
| 728 | Ga0501080_0113382 | 3300049742 | Bacteria | 2513 |
| 729 | Ga0501080_0299886 | 3300049742 | Bacteria | 1458 |
| 730 | Ga0501080_1319046 | 3300049742 | Bacteria | 618 |
| 731 | Ga0501083_0021948 | 3300049744 | Bacteria | 4433 |
| 732 | Ga0501083_0181865 | 3300049744 | Bacteria | 1373 |
| 733 | Ga0501083_0514492 | 3300049744 | Bacteria | 779 |
| 734 | Ga0501035_0153789 | 3300049822 | Bacteria | 1995 |
| 735 | Ga0501035_0389346 | 3300049822 | Bacteria | 1161 |
| 736 | Ga0501044_0455603 | 3300049823 | Bacteria | 1185 |
| 737 | Ga0501045_0706658 | 3300049824 | Bacteria | 744 |
| 738 | Ga0501045_1316376 | 3300049824 | Bacteria | 526 |
| 739 | nmdc:mga00v17_159201_c1 | 3300050491 | Bacteria | 1453 |
| 740 | nmdc:mga00v17_335070_c1 | 3300050491 | Bacteria | 983 |
| 741 | nmdc:mga0yw44_663256_c1 | 3300050492 | Bacteria | 709 |
| 742 | nmdc:mga0k408_486055_c1 | 3300050493 | Bacteria | 732 |
| 743 | nmdc:mga08y16_22414_c1 | 3300050511 | Bacteria | 6666 |
| 744 | nmdc:mga08y16_640413_c1 | 3300050511 | Bacteria | 1068 |
| 745 | nmdc:mga0n895_467063_c1 | 3300050512 | Bacteria | 1273 |
| 746 | nmdc:mga0rr50_1664064_c1 | 3300050513 | Bacteria | 538 |
| 747 | Ga0495601_0296851 | 3300053077 | Bacteria | 1053 |
| 748 | Ga0495601_0798166 | 3300053077 | Bacteria | 599 |
| 749 | Ga0495619_0161688 | 3300053085 | Bacteria | 1547 |
| 750 | Ga0495619_0331678 | 3300053085 | Bacteria | 1053 |
| 751 | Ga0501084_0693247 | 3300054114 | Bacteria | 859 |
| 752 | Ga0501084_1834987 | 3300054114 | Bacteria | 506 |
| 753 | Ga0590071_131006 | 3300059421 | Bacteria | 644 |
| 754 | Ga0501082_0020590 | 3300060353 | Bacteria | 5686 |
| 755 | Ga0501082_0135038 | 3300060353 | Bacteria | 2141 |
| 756 | Ga0530510_0143760 | 3300061734 | Bacteria | 1759 |
| 757 | Ga0530510_1459567 | 3300061734 | Bacteria | 525 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 2162886006 | SwRhRL3b_contig_174203 | SwRhRL3b_0888.00000170 | 100 |
| 2 | 3300002076 | JGI24749J21850_1023943 | JGI24749J21850_10239432 | 100 |
| 3 | 3300002773 | JGI25152J39213_1001127 | JGI25152J39213_100112713 | 100 |
| 4 | 3300002774 | JGI25150J39212_1000188 | JGI25150J39212_100018819 | 100 |
| 5 | 3300003187 | JGI25151J46595_10000144 | JGI25151J46595_1000014470 | 100 |
| 6 | 3300003215 | JGI25153J46596_10004242 | JGI25153J46596_100042426 | 100 |
| 7 | 3300003578 | Ga0006562J51391_1013837 | Ga0006562J51391_10138378 | 100 |
| 8 | 3300003794 | Ga0055531_10000016 | Ga0055531_1000001695 | 100 |
| 9 | 3300004801 | Ga0058860_11876603 | Ga0058860_118766032 | 100 |
| 10 | 3300005290 | Ga0065712_10402592 | Ga0065712_104025921 | 100 |
| 11 | 3300005293 | Ga0065715_10218623 | Ga0065715_102186231 | 100 |
| 12 | 3300005293 | Ga0065715_10483344 | Ga0065715_104833442 | 100 |
| 13 | 3300005295 | Ga0065707_10089627 | Ga0065707_100896273 | 100 |
| 14 | 3300005327 | Ga0070658_10519064 | Ga0070658_105190642 | 100 |
| 15 | 3300005328 | Ga0070676_10021967 | Ga0070676_100219673 | 100 |
| 16 | 3300005328 | Ga0070676_10047155 | Ga0070676_100471554 | 100 |
| 17 | 3300005328 | Ga0070676_10646725 | Ga0070676_106467252 | 100 |
| 18 | 3300005329 | Ga0070683_100001269 | Ga0070683_1000012692 | 100 |
| 19 | 3300005329 | Ga0070683_102334735 | Ga0070683_1023347351 | 100 |
| 20 | 3300005330 | Ga0070690_100009590 | Ga0070690_1000095907 | 100 |
| 21 | 3300005330 | Ga0070690_100142054 | Ga0070690_1001420542 | 100 |
| 22 | 3300005330 | Ga0070690_100263557 | Ga0070690_1002635572 | 100 |
| 23 | 3300005330 | Ga0070690_100313169 | Ga0070690_1003131692 | 100 |
| 24 | 3300005330 | Ga0070690_100317765 | Ga0070690_1003177652 | 100 |
| 25 | 3300005330 | Ga0070690_100821472 | Ga0070690_1008214721 | 100 |
| 26 | 3300005331 | Ga0070670_100022326 | Ga0070670_1000223266 | 100 |
| 27 | 3300005331 | Ga0070670_100085419 | Ga0070670_1000854192 | 100 |
| 28 | 3300005333 | Ga0070677_10018921 | Ga0070677_100189212 | 100 |
| 29 | 3300005333 | Ga0070677_10262136 | Ga0070677_102621362 | 100 |
| 30 | 3300005333 | Ga0070677_10304148 | Ga0070677_103041482 | 100 |
| 31 | 3300005334 | Ga0068869_100001950 | Ga0068869_1000019503 | 100 |
| 32 | 3300005334 | Ga0068869_100004242 | Ga0068869_1000042424 | 100 |
| 33 | 3300005334 | Ga0068869_100023317 | Ga0068869_1000233173 | 100 |
| 34 | 3300005334 | Ga0068869_100440082 | Ga0068869_1004400823 | 100 |
| 35 | 3300005335 | Ga0070666_10105159 | Ga0070666_101051592 | 100 |
| 36 | 3300005335 | Ga0070666_10114198 | Ga0070666_101141983 | 100 |
| 37 | 3300005337 | Ga0070682_100816746 | Ga0070682_1008167461 | 100 |
| 38 | 3300005338 | Ga0068868_100055282 | Ga0068868_1000552822 | 100 |
| 39 | 3300005338 | Ga0068868_100153754 | Ga0068868_1001537543 | 100 |
| 40 | 3300005338 | Ga0068868_100537997 | Ga0068868_1005379972 | 100 |
| 41 | 3300005338 | Ga0068868_101453545 | Ga0068868_1014535452 | 100 |
| 42 | 3300005339 | Ga0070660_101631925 | Ga0070660_1016319252 | 100 |
| 43 | 3300005340 | Ga0070689_100022692 | Ga0070689_1000226925 | 100 |
| 44 | 3300005341 | Ga0070691_10890182 | Ga0070691_108901821 | 100 |
| 45 | 3300005343 | Ga0070687_100005582 | Ga0070687_1000055825 | 100 |
| 46 | 3300005343 | Ga0070687_100367773 | Ga0070687_1003677733 | 100 |
| 47 | 3300005343 | Ga0070687_100528530 | Ga0070687_1005285302 | 100 |
| 48 | 3300005345 | Ga0070692_10137666 | Ga0070692_101376662 | 100 |
| 49 | 3300005345 | Ga0070692_11275733 | Ga0070692_112757331 | 100 |
| 50 | 3300005347 | Ga0070668_100018888 | Ga0070668_1000188882 | 100 |
| 51 | 3300005347 | Ga0070668_100062328 | Ga0070668_1000623283 | 100 |
| 52 | 3300005347 | Ga0070668_100562195 | Ga0070668_1005621952 | 100 |
| 53 | 3300005353 | Ga0070669_100805034 | Ga0070669_1008050342 | 100 |
| 54 | 3300005355 | Ga0070671_100044597 | Ga0070671_1000445973 | 100 |
| 55 | 3300005355 | Ga0070671_100323505 | Ga0070671_1003235053 | 100 |
| 56 | 3300005355 | Ga0070671_100328198 | Ga0070671_1003281983 | 100 |
| 57 | 3300005355 | Ga0070671_100476966 | Ga0070671_1004769661 | 100 |
| 58 | 3300005356 | Ga0070674_100067262 | Ga0070674_1000672623 | 100 |
| 59 | 3300005356 | Ga0070674_100464027 | Ga0070674_1004640271 | 100 |
| 60 | 3300005364 | Ga0070673_100012165 | Ga0070673_1000121653 | 100 |
| 61 | 3300005364 | Ga0070673_100119998 | Ga0070673_1001199982 | 100 |
| 62 | 3300005364 | Ga0070673_100206006 | Ga0070673_1002060063 | 100 |
| 63 | 3300005364 | Ga0070673_100814492 | Ga0070673_1008144922 | 100 |
| 64 | 3300005364 | Ga0070673_102208374 | Ga0070673_1022083741 | 100 |
| 65 | 3300005365 | Ga0070688_100132455 | Ga0070688_1001324552 | 100 |
| 66 | 3300005366 | Ga0070659_100005665 | Ga0070659_1000056657 | 100 |
| 67 | 3300005366 | Ga0070659_100293260 | Ga0070659_1002932601 | 100 |
| 68 | 3300005366 | Ga0070659_101307836 | Ga0070659_1013078362 | 100 |
| 69 | 3300005367 | Ga0070667_100036887 | Ga0070667_1000368873 | 100 |
| 70 | 3300005367 | Ga0070667_100164905 | Ga0070667_1001649051 | 100 |
| 71 | 3300005367 | Ga0070667_100293370 | Ga0070667_1002933702 | 100 |
| 72 | 3300005367 | Ga0070667_101067443 | Ga0070667_1010674432 | 100 |
| 73 | 3300005406 | Ga0070703_10198427 | Ga0070703_101984271 | 100 |
| 74 | 3300005435 | Ga0070714_100141653 | Ga0070714_1001416533 | 100 |
| 75 | 3300005435 | Ga0070714_100923287 | Ga0070714_1009232872 | 100 |
| 76 | 3300005435 | Ga0070714_102478166 | Ga0070714_1024781661 | 100 |
| 77 | 3300005436 | Ga0070713_101299495 | Ga0070713_1012994952 | 100 |
| 78 | 3300005438 | Ga0070701_10154661 | Ga0070701_101546612 | 100 |
| 79 | 3300005438 | Ga0070701_10393920 | Ga0070701_103939202 | 100 |
| 80 | 3300005438 | Ga0070701_10545045 | Ga0070701_105450452 | 100 |
| 81 | 3300005438 | Ga0070701_10653305 | Ga0070701_106533051 | 100 |
| 82 | 3300005440 | Ga0070705_100099878 | Ga0070705_1000998783 | 100 |
| 83 | 3300005440 | Ga0070705_100142372 | Ga0070705_1001423722 | 100 |
| 84 | 3300005441 | Ga0070700_100247275 | Ga0070700_1002472753 | 100 |
| 85 | 3300005441 | Ga0070700_101395585 | Ga0070700_1013955852 | 100 |
| 86 | 3300005444 | Ga0070694_101099014 | Ga0070694_1010990141 | 100 |
| 87 | 3300005445 | Ga0070708_100782917 | Ga0070708_1007829172 | 100 |
| 88 | 3300005445 | Ga0070708_101572116 | Ga0070708_1015721161 | 100 |
| 89 | 3300005455 | Ga0070663_100041108 | Ga0070663_1000411084 | 100 |
| 90 | 3300005455 | Ga0070663_100525545 | Ga0070663_1005255452 | 100 |
| 91 | 3300005456 | Ga0070678_100040424 | Ga0070678_1000404242 | 100 |
| 92 | 3300005456 | Ga0070678_100183155 | Ga0070678_1001831552 | 100 |
| 93 | 3300005456 | Ga0070678_100345348 | Ga0070678_1003453482 | 100 |
| 94 | 3300005456 | Ga0070678_100361993 | Ga0070678_1003619932 | 100 |
| 95 | 3300005456 | Ga0070678_100510258 | Ga0070678_1005102583 | 100 |
| 96 | 3300005457 | Ga0070662_100275970 | Ga0070662_1002759703 | 100 |
| 97 | 3300005459 | Ga0068867_100002417 | Ga0068867_10000241712 | 100 |
| 98 | 3300005459 | Ga0068867_100175454 | Ga0068867_1001754541 | 100 |
| 99 | 3300005459 | Ga0068867_100432941 | Ga0068867_1004329412 | 100 |
| 100 | 3300005459 | Ga0068867_100672655 | Ga0068867_1006726551 | 100 |
| 101 | 3300005466 | Ga0070685_10002936 | Ga0070685_100029364 | 100 |
| 102 | 3300005466 | Ga0070685_10271149 | Ga0070685_102711492 | 100 |
| 103 | 3300005467 | Ga0070706_100008183 | Ga0070706_1000081833 | 100 |
| 104 | 3300005468 | Ga0070707_100268319 | Ga0070707_1002683192 | 100 |
| 105 | 3300005468 | Ga0070707_100713285 | Ga0070707_1007132853 | 100 |
| 106 | 3300005535 | Ga0070684_100038607 | Ga0070684_1000386072 | 100 |
| 107 | 3300005536 | Ga0070697_100051475 | Ga0070697_1000514753 | 100 |
| 108 | 3300005539 | Ga0068853_100091069 | Ga0068853_1000910693 | 100 |
| 109 | 3300005539 | Ga0068853_100447911 | Ga0068853_1004479112 | 100 |
| 110 | 3300005543 | Ga0070672_100074657 | Ga0070672_1000746573 | 100 |
| 111 | 3300005543 | Ga0070672_100266915 | Ga0070672_1002669152 | 100 |
| 112 | 3300005543 | Ga0070672_100284460 | Ga0070672_1002844604 | 100 |
| 113 | 3300005543 | Ga0070672_101204137 | Ga0070672_1012041372 | 100 |
| 114 | 3300005543 | Ga0070672_101804567 | Ga0070672_1018045672 | 100 |
| 115 | 3300005545 | Ga0070695_100082935 | Ga0070695_1000829351 | 100 |
| 116 | 3300005545 | Ga0070695_101500815 | Ga0070695_1015008151 | 100 |
| 117 | 3300005545 | Ga0070695_101725436 | Ga0070695_1017254361 | 100 |
| 118 | 3300005546 | Ga0070696_100260072 | Ga0070696_1002600722 | 100 |
| 119 | 3300005546 | Ga0070696_100461079 | Ga0070696_1004610792 | 100 |
| 120 | 3300005546 | Ga0070696_100712420 | Ga0070696_1007124202 | 100 |
| 121 | 3300005546 | Ga0070696_101568302 | Ga0070696_1015683022 | 100 |
| 122 | 3300005547 | Ga0070693_100046196 | Ga0070693_1000461962 | 100 |
| 123 | 3300005547 | Ga0070693_100867161 | Ga0070693_1008671612 | 100 |
| 124 | 3300005548 | Ga0070665_100231596 | Ga0070665_1002315963 | 100 |
| 125 | 3300005548 | Ga0070665_100453481 | Ga0070665_1004534811 | 100 |
| 126 | 3300005549 | Ga0070704_100507774 | Ga0070704_1005077742 | 100 |
| 127 | 3300005549 | Ga0070704_100563638 | Ga0070704_1005636383 | 100 |
| 128 | 3300005549 | Ga0070704_100800570 | Ga0070704_1008005702 | 100 |
| 129 | 3300005549 | Ga0070704_101498009 | Ga0070704_1014980092 | 100 |
| 130 | 3300005563 | Ga0068855_100155160 | Ga0068855_1001551603 | 100 |
| 131 | 3300005563 | Ga0068855_100190496 | Ga0068855_1001904963 | 100 |
| 132 | 3300005563 | Ga0068855_100645153 | Ga0068855_1006451533 | 100 |
| 133 | 3300005564 | Ga0070664_100095292 | Ga0070664_1000952923 | 100 |
| 134 | 3300005564 | Ga0070664_100298787 | Ga0070664_1002987873 | 100 |
| 135 | 3300005577 | Ga0068857_100038087 | Ga0068857_1000380875 | 100 |
| 136 | 3300005577 | Ga0068857_100378661 | Ga0068857_1003786612 | 100 |
| 137 | 3300005577 | Ga0068857_100519881 | Ga0068857_1005198812 | 100 |
| 138 | 3300005577 | Ga0068857_101029673 | Ga0068857_1010296732 | 100 |
| 139 | 3300005578 | Ga0068854_100097670 | Ga0068854_1000976703 | 100 |
| 140 | 3300005614 | Ga0068856_101701191 | Ga0068856_1017011911 | 100 |
| 141 | 3300005615 | Ga0070702_100057345 | Ga0070702_1000573453 | 100 |
| 142 | 3300005615 | Ga0070702_100629936 | Ga0070702_1006299361 | 100 |
| 143 | 3300005615 | Ga0070702_101697150 | Ga0070702_1016971501 | 100 |
| 144 | 3300005616 | Ga0068852_100052141 | Ga0068852_1000521414 | 100 |
| 145 | 3300005616 | Ga0068852_100355784 | Ga0068852_1003557842 | 100 |
| 146 | 3300005616 | Ga0068852_100705934 | Ga0068852_1007059341 | 100 |
| 147 | 3300005617 | Ga0068859_100006120 | Ga0068859_10000612010 | 100 |
| 148 | 3300005617 | Ga0068859_100026047 | Ga0068859_1000260472 | 100 |
| 149 | 3300005617 | Ga0068859_100052757 | Ga0068859_1000527574 | 100 |
| 150 | 3300005617 | Ga0068859_100499965 | Ga0068859_1004999652 | 100 |
| 151 | 3300005617 | Ga0068859_100762010 | Ga0068859_1007620102 | 100 |
| 152 | 3300005617 | Ga0068859_102177964 | Ga0068859_1021779641 | 100 |
| 153 | 3300005618 | Ga0068864_100000600 | Ga0068864_10000060027 | 100 |
| 154 | 3300005618 | Ga0068864_100004298 | Ga0068864_1000042984 | 100 |
| 155 | 3300005618 | Ga0068864_100518495 | Ga0068864_1005184952 | 100 |
| 156 | 3300005718 | Ga0068866_10037854 | Ga0068866_100378543 | 100 |
| 157 | 3300005718 | Ga0068866_10056076 | Ga0068866_100560763 | 100 |
| 158 | 3300005719 | Ga0068861_100007311 | Ga0068861_1000073114 | 100 |
| 159 | 3300005719 | Ga0068861_100752076 | Ga0068861_1007520762 | 100 |
| 160 | 3300005719 | Ga0068861_101799218 | Ga0068861_1017992181 | 100 |
| 161 | 3300005834 | Ga0068851_10102068 | Ga0068851_101020683 | 100 |
| 162 | 3300005834 | Ga0068851_10124015 | Ga0068851_101240152 | 100 |
| 163 | 3300005840 | Ga0068870_10003580 | Ga0068870_100035808 | 100 |
| 164 | 3300005840 | Ga0068870_10297723 | Ga0068870_102977233 | 100 |
| 165 | 3300005841 | Ga0068863_100000563 | Ga0068863_10000056339 | 100 |
| 166 | 3300005841 | Ga0068863_100083649 | Ga0068863_1000836493 | 100 |
| 167 | 3300005841 | Ga0068863_100220340 | Ga0068863_1002203403 | 100 |
| 168 | 3300005841 | Ga0068863_100291206 | Ga0068863_1002912062 | 100 |
| 169 | 3300005841 | Ga0068863_101946986 | Ga0068863_1019469862 | 100 |
| 170 | 3300005842 | Ga0068858_100002972 | Ga0068858_1000029722 | 100 |
| 171 | 3300005842 | Ga0068858_100022537 | Ga0068858_1000225373 | 100 |
| 172 | 3300005842 | Ga0068858_100141545 | Ga0068858_1001415452 | 100 |
| 173 | 3300005842 | Ga0068858_100348162 | Ga0068858_1003481623 | 100 |
| 174 | 3300005842 | Ga0068858_100372386 | Ga0068858_1003723863 | 100 |
| 175 | 3300005843 | Ga0068860_100026286 | Ga0068860_1000262863 | 100 |
| 176 | 3300005843 | Ga0068860_100046827 | Ga0068860_1000468274 | 100 |
| 177 | 3300005843 | Ga0068860_100049100 | Ga0068860_1000491005 | 100 |
| 178 | 3300005843 | Ga0068860_100050809 | Ga0068860_1000508093 | 100 |
| 179 | 3300005843 | Ga0068860_100095533 | Ga0068860_1000955335 | 100 |
| 180 | 3300005844 | Ga0068862_100006488 | Ga0068862_1000064883 | 100 |
| 181 | 3300005844 | Ga0068862_100044301 | Ga0068862_1000443013 | 100 |
| 182 | 3300005844 | Ga0068862_100136363 | Ga0068862_1001363632 | 100 |
| 183 | 3300005844 | Ga0068862_100612293 | Ga0068862_1006122933 | 100 |
| 184 | 3300005937 | Ga0081455_10020855 | Ga0081455_100208553 | 100 |
| 185 | 3300006038 | Ga0075365_10135592 | Ga0075365_101355923 | 100 |
| 186 | 3300006038 | Ga0075365_10712191 | Ga0075365_107121911 | 100 |
| 187 | 3300006038 | Ga0075365_11189469 | Ga0075365_111894692 | 100 |
| 188 | 3300006051 | Ga0075364_10039619 | Ga0075364_100396192 | 100 |
| 189 | 3300006051 | Ga0075364_10349933 | Ga0075364_103499332 | 100 |
| 190 | 3300006163 | Ga0070715_10777341 | Ga0070715_107773412 | 100 |
| 191 | 3300006173 | Ga0070716_101401744 | Ga0070716_1014017442 | 100 |
| 192 | 3300006178 | Ga0075367_10766291 | Ga0075367_107662911 | 100 |
| 193 | 3300006237 | Ga0097621_100006633 | Ga0097621_1000066332 | 100 |
| 194 | 3300006237 | Ga0097621_100558662 | Ga0097621_1005586622 | 100 |
| 195 | 3300006237 | Ga0097621_101229560 | Ga0097621_1012295602 | 100 |
| 196 | 3300006358 | Ga0068871_100072093 | Ga0068871_1000720935 | 100 |
| 197 | 3300006358 | Ga0068871_100094134 | Ga0068871_1000941341 | 100 |
| 198 | 3300006358 | Ga0068871_100796543 | Ga0068871_1007965432 | 100 |
| 199 | 3300006871 | Ga0075434_100528269 | Ga0075434_1005282692 | 100 |
| 200 | 3300006881 | Ga0068865_100084405 | Ga0068865_1000844053 | 100 |
| 201 | 3300006881 | Ga0068865_100125116 | Ga0068865_1001251164 | 100 |
| 202 | 3300006881 | Ga0068865_100342552 | Ga0068865_1003425522 | 100 |
| 203 | 3300006881 | Ga0068865_100547267 | Ga0068865_1005472672 | 100 |
| 204 | 3300006931 | Ga0097620_100006120 | Ga0097620_10000612010 | 100 |
| 205 | 3300006931 | Ga0097620_100026046 | Ga0097620_1000260462 | 100 |
| 206 | 3300006931 | Ga0097620_100052758 | Ga0097620_1000527584 | 100 |
| 207 | 3300006931 | Ga0097620_100499974 | Ga0097620_1004999742 | 100 |
| 208 | 3300006931 | Ga0097620_100762020 | Ga0097620_1007620202 | 100 |
| 209 | 3300006931 | Ga0097620_102178219 | Ga0097620_1021782191 | 100 |
| 210 | 3300009092 | Ga0105250_10000022 | Ga0105250_1000002223 | 100 |
| 211 | 3300009093 | Ga0105240_10000026 | Ga0105240_10000026213 | 100 |
| 212 | 3300009093 | Ga0105240_10819122 | Ga0105240_108191222 | 100 |
| 213 | 3300009094 | Ga0111539_10026150 | Ga0111539_100261503 | 100 |
| 214 | 3300009094 | Ga0111539_10196938 | Ga0111539_101969381 | 100 |
| 215 | 3300009098 | Ga0105245_10357918 | Ga0105245_103579182 | 100 |
| 216 | 3300009098 | Ga0105245_10765097 | Ga0105245_107650971 | 100 |
| 217 | 3300009098 | Ga0105245_10907629 | Ga0105245_109076292 | 100 |
| 218 | 3300009098 | Ga0105245_10920519 | Ga0105245_109205192 | 100 |
| 219 | 3300009101 | Ga0105247_10040149 | Ga0105247_100401493 | 100 |
| 220 | 3300009101 | Ga0105247_10074240 | Ga0105247_100742403 | 100 |
| 221 | 3300009147 | Ga0114129_10325110 | Ga0114129_103251101 | 100 |
| 222 | 3300009147 | Ga0114129_12081915 | Ga0114129_120819152 | 100 |
| 223 | 3300009148 | Ga0105243_10029350 | Ga0105243_100293505 | 100 |
| 224 | 3300009148 | Ga0105243_10094163 | Ga0105243_100941633 | 100 |
| 225 | 3300009174 | Ga0105241_10252081 | Ga0105241_102520813 | 100 |
| 226 | 3300009174 | Ga0105241_11125109 | Ga0105241_111251092 | 100 |
| 227 | 3300009174 | Ga0105241_11134512 | Ga0105241_111345121 | 100 |
| 228 | 3300009174 | Ga0105241_12078431 | Ga0105241_120784312 | 100 |
| 229 | 3300009176 | Ga0105242_10086903 | Ga0105242_100869033 | 100 |
| 230 | 3300009176 | Ga0105242_11163689 | Ga0105242_111636892 | 100 |
| 231 | 3300009176 | Ga0105242_11207624 | Ga0105242_112076241 | 100 |
| 232 | 3300009176 | Ga0105242_11318742 | Ga0105242_113187422 | 100 |
| 233 | 3300009176 | Ga0105242_13212389 | Ga0105242_132123891 | 100 |
| 234 | 3300009177 | Ga0105248_10008221 | Ga0105248_1000822111 | 100 |
| 235 | 3300009177 | Ga0105248_10046396 | Ga0105248_100463964 | 100 |
| 236 | 3300009177 | Ga0105248_10084147 | Ga0105248_100841473 | 100 |
| 237 | 3300009177 | Ga0105248_10299117 | Ga0105248_102991173 | 100 |
| 238 | 3300009177 | Ga0105248_10891688 | Ga0105248_108916882 | 100 |
| 239 | 3300009177 | Ga0105248_11301863 | Ga0105248_113018632 | 100 |
| 240 | 3300009545 | Ga0105237_10946318 | Ga0105237_109463182 | 100 |
| 241 | 3300009551 | Ga0105238_11204128 | Ga0105238_112041282 | 100 |
| 242 | 3300009553 | Ga0105249_10229729 | Ga0105249_102297294 | 100 |
| 243 | 3300009553 | Ga0105249_10292693 | Ga0105249_102926933 | 100 |
| 244 | 3300009553 | Ga0105249_10415973 | Ga0105249_104159732 | 100 |
| 245 | 3300009553 | Ga0105249_10507008 | Ga0105249_105070083 | 100 |
| 246 | 3300009553 | Ga0105249_11165016 | Ga0105249_111650163 | 100 |
| 247 | 3300010375 | Ga0105239_10535674 | Ga0105239_105356742 | 100 |
| 248 | 3300010375 | Ga0105239_11689259 | Ga0105239_116892591 | 100 |
| 249 | 3300010375 | Ga0105239_11733445 | Ga0105239_117334452 | 100 |
| 250 | 3300011119 | Ga0105246_10122130 | Ga0105246_101221303 | 100 |
| 251 | 3300011119 | Ga0105246_10520297 | Ga0105246_105202973 | 100 |
| 252 | 3300011119 | Ga0105246_10898414 | Ga0105246_108984143 | 100 |
| 253 | 3300011119 | Ga0105246_11920296 | Ga0105246_119202962 | 100 |
| 254 | 3300012495 | Ga0157323_1026169 | Ga0157323_10261691 | 100 |
| 255 | 3300012497 | Ga0157319_1025564 | Ga0157319_10255642 | 100 |
| 256 | 3300012502 | Ga0157347_1027228 | Ga0157347_10272281 | 100 |
| 257 | 3300012508 | Ga0157315_1011824 | Ga0157315_10118242 | 100 |
| 258 | 3300013102 | Ga0157371_10356988 | Ga0157371_103569881 | 100 |
| 259 | 3300013104 | Ga0157370_11326111 | Ga0157370_113261112 | 100 |
| 260 | 3300013296 | Ga0157374_10091416 | Ga0157374_100914163 | 100 |
| 261 | 3300013296 | Ga0157374_10098171 | Ga0157374_100981713 | 100 |
| 262 | 3300013296 | Ga0157374_10510094 | Ga0157374_105100941 | 100 |
| 263 | 3300013297 | Ga0157378_10006203 | Ga0157378_100062032 | 100 |
| 264 | 3300013297 | Ga0157378_10061392 | Ga0157378_100613923 | 100 |
| 265 | 3300013297 | Ga0157378_10181319 | Ga0157378_101813192 | 100 |
| 266 | 3300013297 | Ga0157378_10481719 | Ga0157378_104817192 | 100 |
| 267 | 3300013297 | Ga0157378_10635794 | Ga0157378_106357942 | 100 |
| 268 | 3300013297 | Ga0157378_11696641 | Ga0157378_116966412 | 100 |
| 269 | 3300013306 | Ga0163162_10014221 | Ga0163162_1001422110 | 100 |
| 270 | 3300013306 | Ga0163162_10035656 | Ga0163162_100356567 | 100 |
| 271 | 3300013306 | Ga0163162_10194409 | Ga0163162_101944092 | 100 |
| 272 | 3300013306 | Ga0163162_10348689 | Ga0163162_103486892 | 100 |
| 273 | 3300013306 | Ga0163162_10714802 | Ga0163162_107148022 | 100 |
| 274 | 3300013307 | Ga0157372_10172545 | Ga0157372_101725454 | 100 |
| 275 | 3300013307 | Ga0157372_10866498 | Ga0157372_108664982 | 100 |
| 276 | 3300013307 | Ga0157372_11337715 | Ga0157372_113377152 | 100 |
| 277 | 3300013308 | Ga0157375_10014567 | Ga0157375_100145678 | 100 |
| 278 | 3300013308 | Ga0157375_10026377 | Ga0157375_100263775 | 100 |
| 279 | 3300013308 | Ga0157375_10054492 | Ga0157375_100544923 | 100 |
| 280 | 3300013308 | Ga0157375_10084541 | Ga0157375_100845413 | 100 |
| 281 | 3300013308 | Ga0157375_10216524 | Ga0157375_102165242 | 100 |
| 282 | 3300013308 | Ga0157375_10247174 | Ga0157375_102471743 | 100 |
| 283 | 3300013308 | Ga0157375_12599766 | Ga0157375_125997662 | 100 |
| 284 | 3300013308 | Ga0157375_13190090 | Ga0157375_131900902 | 100 |
| 285 | 3300014325 | Ga0163163_10132130 | Ga0163163_101321303 | 100 |
| 286 | 3300014325 | Ga0163163_10174607 | Ga0163163_101746073 | 100 |
| 287 | 3300014326 | Ga0157380_10135568 | Ga0157380_101355682 | 100 |
| 288 | 3300014326 | Ga0157380_10274986 | Ga0157380_102749862 | 100 |
| 289 | 3300014326 | Ga0157380_10425925 | Ga0157380_104259253 | 100 |
| 290 | 3300014326 | Ga0157380_11229016 | Ga0157380_112290162 | 100 |
| 291 | 3300014326 | Ga0157380_11693693 | Ga0157380_116936931 | 100 |
| 292 | 3300014497 | Ga0182008_10087804 | Ga0182008_100878042 | 100 |
| 293 | 3300014745 | Ga0157377_10024330 | Ga0157377_100243304 | 100 |
| 294 | 3300014745 | Ga0157377_10331330 | Ga0157377_103313303 | 100 |
| 295 | 3300014968 | Ga0157379_10000029 | Ga0157379_1000002950 | 100 |
| 296 | 3300014968 | Ga0157379_10018885 | Ga0157379_100188853 | 100 |
| 297 | 3300014968 | Ga0157379_10029724 | Ga0157379_100297248 | 100 |
| 298 | 3300014968 | Ga0157379_10065580 | Ga0157379_100655804 | 100 |
| 299 | 3300014968 | Ga0157379_10106915 | Ga0157379_101069151 | 100 |
| 300 | 3300014969 | Ga0157376_10017976 | Ga0157376_100179766 | 100 |
| 301 | 3300014969 | Ga0157376_10023767 | Ga0157376_100237673 | 100 |
| 302 | 3300014969 | Ga0157376_10045491 | Ga0157376_100454916 | 100 |
| 303 | 3300014969 | Ga0157376_10665376 | Ga0157376_106653762 | 100 |
| 304 | 3300015265 | Ga0182005_1008576 | Ga0182005_10085763 | 100 |
| 305 | 3300017792 | Ga0163161_10079509 | Ga0163161_100795094 | 100 |
| 306 | 3300017792 | Ga0163161_10235180 | Ga0163161_102351802 | 100 |
| 307 | 3300017792 | Ga0163161_11874897 | Ga0163161_118748972 | 100 |
| 308 | 3300021384 | Ga0213876_10521858 | Ga0213876_105218582 | 100 |
| 309 | 3300021388 | Ga0213875_10107622 | Ga0213875_101076222 | 100 |
| 310 | 3300025245 | Ga0207425_1000086 | Ga0207425_100008613 | 100 |
| 311 | 3300025258 | Ga0209129_1000174 | Ga0209129_100017413 | 100 |
| 312 | 3300025271 | Ga0207666_1011320 | Ga0207666_10113202 | 100 |
| 313 | 3300025273 | Ga0209673_1005117 | Ga0209673_10051176 | 100 |
| 314 | 3300025290 | Ga0207673_1009415 | Ga0207673_10094152 | 100 |
| 315 | 3300025292 | Ga0209676_1058010 | Ga0209676_10580101 | 100 |
| 316 | 3300025294 | Ga0209025_1000367 | Ga0209025_100036714 | 100 |
| 317 | 3300025297 | Ga0209758_1000305 | Ga0209758_100030514 | 100 |
| 318 | 3300025298 | Ga0209050_1000026 | Ga0209050_1000026361 | 100 |
| 319 | 3300025299 | Ga0209256_1041671 | Ga0209256_10416712 | 100 |
| 320 | 3300025303 | Ga0209051_1059104 | Ga0209051_10591041 | 100 |
| 321 | 3300025304 | Ga0209257_1000009 | Ga0209257_1000009361 | 100 |
| 322 | 3300025315 | Ga0207697_10000114 | Ga0207697_1000011413 | 100 |
| 323 | 3300025321 | Ga0207656_10184825 | Ga0207656_101848252 | 100 |
| 324 | 3300025711 | Ga0207696_1000153 | Ga0207696_100015351 | 100 |
| 325 | 3300025893 | Ga0207682_10000010 | Ga0207682_100000104 | 100 |
| 326 | 3300025893 | Ga0207682_10592591 | Ga0207682_105925912 | 100 |
| 327 | 3300025899 | Ga0207642_10026105 | Ga0207642_100261053 | 100 |
| 328 | 3300025899 | Ga0207642_10064600 | Ga0207642_100646002 | 100 |
| 329 | 3300025901 | Ga0207688_10000190 | Ga0207688_1000019010 | 100 |
| 330 | 3300025901 | Ga0207688_10276936 | Ga0207688_102769362 | 100 |
| 331 | 3300025903 | Ga0207680_10026838 | Ga0207680_100268384 | 100 |
| 332 | 3300025903 | Ga0207680_10109193 | Ga0207680_101091931 | 100 |
| 333 | 3300025903 | Ga0207680_10135990 | Ga0207680_101359903 | 100 |
| 334 | 3300025904 | Ga0207647_10101760 | Ga0207647_101017601 | 100 |
| 335 | 3300025907 | Ga0207645_10017678 | Ga0207645_100176787 | 100 |
| 336 | 3300025907 | Ga0207645_10018159 | Ga0207645_100181595 | 100 |
| 337 | 3300025907 | Ga0207645_11054705 | Ga0207645_110547052 | 100 |
| 338 | 3300025908 | Ga0207643_10000683 | Ga0207643_1000068312 | 100 |
| 339 | 3300025908 | Ga0207643_10006779 | Ga0207643_100067795 | 100 |
| 340 | 3300025908 | Ga0207643_10018458 | Ga0207643_100184586 | 100 |
| 341 | 3300025909 | Ga0207705_11096104 | Ga0207705_110961042 | 100 |
| 342 | 3300025910 | Ga0207684_10006867 | Ga0207684_100068674 | 100 |
| 343 | 3300025910 | Ga0207684_11662988 | Ga0207684_116629882 | 100 |
| 344 | 3300025911 | Ga0207654_11166273 | Ga0207654_111662731 | 100 |
| 345 | 3300025914 | Ga0207671_11513779 | Ga0207671_115137792 | 100 |
| 346 | 3300025918 | Ga0207662_10000676 | Ga0207662_100006769 | 100 |
| 347 | 3300025918 | Ga0207662_11307836 | Ga0207662_113078361 | 100 |
| 348 | 3300025919 | Ga0207657_11027114 | Ga0207657_110271142 | 100 |
| 349 | 3300025920 | Ga0207649_11423502 | Ga0207649_114235021 | 100 |
| 350 | 3300025922 | Ga0207646_10216351 | Ga0207646_102163512 | 100 |
| 351 | 3300025923 | Ga0207681_10051469 | Ga0207681_100514692 | 100 |
| 352 | 3300025923 | Ga0207681_10574329 | Ga0207681_105743292 | 100 |
| 353 | 3300025924 | Ga0207694_11519263 | Ga0207694_115192631 | 100 |
| 354 | 3300025924 | Ga0207694_11654451 | Ga0207694_116544511 | 100 |
| 355 | 3300025925 | Ga0207650_10009050 | Ga0207650_100090508 | 100 |
| 356 | 3300025925 | Ga0207650_10018823 | Ga0207650_100188232 | 100 |
| 357 | 3300025925 | Ga0207650_10093729 | Ga0207650_100937293 | 100 |
| 358 | 3300025926 | Ga0207659_10095339 | Ga0207659_100953392 | 100 |
| 359 | 3300025926 | Ga0207659_10219368 | Ga0207659_102193682 | 100 |
| 360 | 3300025927 | Ga0207687_10305190 | Ga0207687_103051903 | 100 |
| 361 | 3300025927 | Ga0207687_10615678 | Ga0207687_106156781 | 100 |
| 362 | 3300025927 | Ga0207687_10814082 | Ga0207687_108140822 | 100 |
| 363 | 3300025927 | Ga0207687_11213768 | Ga0207687_112137682 | 100 |
| 364 | 3300025928 | Ga0207700_11525963 | Ga0207700_115259632 | 100 |
| 365 | 3300025929 | Ga0207664_10052474 | Ga0207664_100524744 | 100 |
| 366 | 3300025929 | Ga0207664_10652415 | Ga0207664_106524152 | 100 |
| 367 | 3300025929 | Ga0207664_11525623 | Ga0207664_115256232 | 100 |
| 368 | 3300025931 | Ga0207644_10059075 | Ga0207644_100590753 | 100 |
| 369 | 3300025931 | Ga0207644_10074314 | Ga0207644_100743142 | 100 |
| 370 | 3300025931 | Ga0207644_10091634 | Ga0207644_100916343 | 100 |
| 371 | 3300025931 | Ga0207644_10139187 | Ga0207644_101391873 | 100 |
| 372 | 3300025931 | Ga0207644_10312034 | Ga0207644_103120341 | 100 |
| 373 | 3300025932 | Ga0207690_10083812 | Ga0207690_100838123 | 100 |
| 374 | 3300025932 | Ga0207690_10086244 | Ga0207690_100862443 | 100 |
| 375 | 3300025932 | Ga0207690_11139141 | Ga0207690_111391412 | 100 |
| 376 | 3300025933 | Ga0207706_10003578 | Ga0207706_1000357811 | 100 |
| 377 | 3300025933 | Ga0207706_10340506 | Ga0207706_103405062 | 100 |
| 378 | 3300025933 | Ga0207706_11550379 | Ga0207706_115503791 | 100 |
| 379 | 3300025935 | Ga0207709_10097580 | Ga0207709_100975802 | 100 |
| 380 | 3300025935 | Ga0207709_11167135 | Ga0207709_111671351 | 100 |
| 381 | 3300025936 | Ga0207670_10101539 | Ga0207670_101015393 | 100 |
| 382 | 3300025936 | Ga0207670_10218421 | Ga0207670_102184213 | 100 |
| 383 | 3300025936 | Ga0207670_11857629 | Ga0207670_118576292 | 100 |
| 384 | 3300025937 | Ga0207669_10049655 | Ga0207669_100496552 | 100 |
| 385 | 3300025937 | Ga0207669_10202695 | Ga0207669_102026952 | 100 |
| 386 | 3300025937 | Ga0207669_10416829 | Ga0207669_104168292 | 100 |
| 387 | 3300025938 | Ga0207704_10055435 | Ga0207704_100554354 | 100 |
| 388 | 3300025938 | Ga0207704_10907274 | Ga0207704_109072742 | 100 |
| 389 | 3300025938 | Ga0207704_11486456 | Ga0207704_114864562 | 100 |
| 390 | 3300025938 | Ga0207704_11631534 | Ga0207704_116315342 | 100 |
| 391 | 3300025940 | Ga0207691_10003554 | Ga0207691_1000355414 | 100 |
| 392 | 3300025940 | Ga0207691_10011788 | Ga0207691_100117888 | 100 |
| 393 | 3300025940 | Ga0207691_10158837 | Ga0207691_101588374 | 100 |
| 394 | 3300025940 | Ga0207691_10463599 | Ga0207691_104635991 | 100 |
| 395 | 3300025940 | Ga0207691_10762699 | Ga0207691_107626992 | 100 |
| 396 | 3300025941 | Ga0207711_10033860 | Ga0207711_100338607 | 100 |
| 397 | 3300025941 | Ga0207711_10319576 | Ga0207711_103195762 | 100 |
| 398 | 3300025941 | Ga0207711_11056286 | Ga0207711_110562862 | 100 |
| 399 | 3300025941 | Ga0207711_11144665 | Ga0207711_111446651 | 100 |
| 400 | 3300025942 | Ga0207689_10000236 | Ga0207689_1000023613 | 100 |
| 401 | 3300025942 | Ga0207689_10001266 | Ga0207689_1000126619 | 100 |
| 402 | 3300025942 | Ga0207689_10004515 | Ga0207689_100045153 | 100 |
| 403 | 3300025942 | Ga0207689_10374826 | Ga0207689_103748262 | 100 |
| 404 | 3300025944 | Ga0207661_10066031 | Ga0207661_100660312 | 100 |
| 405 | 3300025945 | Ga0207679_10139832 | Ga0207679_101398322 | 100 |
| 406 | 3300025945 | Ga0207679_11414136 | Ga0207679_114141362 | 100 |
| 407 | 3300025949 | Ga0207667_10148052 | Ga0207667_101480523 | 100 |
| 408 | 3300025949 | Ga0207667_11264495 | Ga0207667_112644952 | 100 |
| 409 | 3300025949 | Ga0207667_12120217 | Ga0207667_121202172 | 100 |
| 410 | 3300025960 | Ga0207651_10022645 | Ga0207651_100226453 | 100 |
| 411 | 3300025960 | Ga0207651_10141088 | Ga0207651_101410882 | 100 |
| 412 | 3300025960 | Ga0207651_10444403 | Ga0207651_104444033 | 100 |
| 413 | 3300025960 | Ga0207651_10492159 | Ga0207651_104921592 | 100 |
| 414 | 3300025960 | Ga0207651_10739022 | Ga0207651_107390221 | 100 |
| 415 | 3300025960 | Ga0207651_11583830 | Ga0207651_115838301 | 100 |
| 416 | 3300025961 | Ga0207712_10145971 | Ga0207712_101459713 | 100 |
| 417 | 3300025961 | Ga0207712_10179853 | Ga0207712_101798533 | 100 |
| 418 | 3300025961 | Ga0207712_10290695 | Ga0207712_102906952 | 100 |
| 419 | 3300025961 | Ga0207712_10654140 | Ga0207712_106541403 | 100 |
| 420 | 3300025972 | Ga0207668_10022121 | Ga0207668_100221212 | 100 |
| 421 | 3300025972 | Ga0207668_10283880 | Ga0207668_102838802 | 100 |
| 422 | 3300025972 | Ga0207668_10830226 | Ga0207668_108302262 | 100 |
| 423 | 3300025972 | Ga0207668_11067815 | Ga0207668_110678152 | 100 |
| 424 | 3300025986 | Ga0207658_10006487 | Ga0207658_100064872 | 100 |
| 425 | 3300025986 | Ga0207658_10079951 | Ga0207658_100799513 | 100 |
| 426 | 3300025986 | Ga0207658_10246850 | Ga0207658_102468502 | 100 |
| 427 | 3300025986 | Ga0207658_10404861 | Ga0207658_104048611 | 100 |
| 428 | 3300025986 | Ga0207658_10479518 | Ga0207658_104795182 | 100 |
| 429 | 3300025986 | Ga0207658_10641937 | Ga0207658_106419372 | 100 |
| 430 | 3300025986 | Ga0207658_10744425 | Ga0207658_107444252 | 100 |
| 431 | 3300026023 | Ga0207677_10284799 | Ga0207677_102847993 | 100 |
| 432 | 3300026023 | Ga0207677_10293082 | Ga0207677_102930822 | 100 |
| 433 | 3300026023 | Ga0207677_10414914 | Ga0207677_104149142 | 100 |
| 434 | 3300026023 | Ga0207677_10925917 | Ga0207677_109259172 | 100 |
| 435 | 3300026035 | Ga0207703_10001159 | Ga0207703_1000115916 | 100 |
| 436 | 3300026035 | Ga0207703_10050347 | Ga0207703_100503472 | 100 |
| 437 | 3300026035 | Ga0207703_10051835 | Ga0207703_100518351 | 100 |
| 438 | 3300026035 | Ga0207703_10477004 | Ga0207703_104770043 | 100 |
| 439 | 3300026035 | Ga0207703_10774475 | Ga0207703_107744751 | 100 |
| 440 | 3300026041 | Ga0207639_10276985 | Ga0207639_102769852 | 100 |
| 441 | 3300026067 | Ga0207678_10013427 | Ga0207678_100134277 | 100 |
| 442 | 3300026067 | Ga0207678_10044680 | Ga0207678_100446803 | 100 |
| 443 | 3300026067 | Ga0207678_11765326 | Ga0207678_117653261 | 100 |
| 444 | 3300026075 | Ga0207708_10002325 | Ga0207708_100023253 | 100 |
| 445 | 3300026075 | Ga0207708_10930214 | Ga0207708_109302142 | 100 |
| 446 | 3300026075 | Ga0207708_11282923 | Ga0207708_112829232 | 100 |
| 447 | 3300026078 | Ga0207702_10309153 | Ga0207702_103091532 | 100 |
| 448 | 3300026078 | Ga0207702_11393532 | Ga0207702_113935322 | 100 |
| 449 | 3300026088 | Ga0207641_10110952 | Ga0207641_101109523 | 100 |
| 450 | 3300026088 | Ga0207641_10121508 | Ga0207641_101215083 | 100 |
| 451 | 3300026088 | Ga0207641_10187798 | Ga0207641_101877982 | 100 |
| 452 | 3300026088 | Ga0207641_11070724 | Ga0207641_110707242 | 100 |
| 453 | 3300026089 | Ga0207648_10000823 | Ga0207648_1000082339 | 100 |
| 454 | 3300026089 | Ga0207648_10001240 | Ga0207648_1000124026 | 100 |
| 455 | 3300026089 | Ga0207648_10008577 | Ga0207648_100085776 | 100 |
| 456 | 3300026089 | Ga0207648_10036889 | Ga0207648_100368894 | 100 |
| 457 | 3300026089 | Ga0207648_10710924 | Ga0207648_107109242 | 100 |
| 458 | 3300026095 | Ga0207676_10005653 | Ga0207676_1000565310 | 100 |
| 459 | 3300026095 | Ga0207676_10012924 | Ga0207676_100129242 | 100 |
| 460 | 3300026095 | Ga0207676_10429666 | Ga0207676_104296662 | 100 |
| 461 | 3300026116 | Ga0207674_10001726 | Ga0207674_100017269 | 100 |
| 462 | 3300026116 | Ga0207674_10145192 | Ga0207674_101451923 | 100 |
| 463 | 3300026116 | Ga0207674_10174241 | Ga0207674_101742413 | 100 |
| 464 | 3300026118 | Ga0207675_100000242 | Ga0207675_10000024219 | 100 |
| 465 | 3300026118 | Ga0207675_100000778 | Ga0207675_1000007787 | 100 |
| 466 | 3300026118 | Ga0207675_100001080 | Ga0207675_10000108015 | 100 |
| 467 | 3300026118 | Ga0207675_100020960 | Ga0207675_10002096010 | 100 |
| 468 | 3300026118 | Ga0207675_100557029 | Ga0207675_1005570292 | 100 |
| 469 | 3300026121 | Ga0207683_10088493 | Ga0207683_100884933 | 100 |
| 470 | 3300026121 | Ga0207683_10582512 | Ga0207683_105825121 | 100 |
| 471 | 3300026121 | Ga0207683_10871809 | Ga0207683_108718092 | 100 |
| 472 | 3300026142 | Ga0207698_10146646 | Ga0207698_101466463 | 100 |
| 473 | 3300026142 | Ga0207698_10219685 | Ga0207698_102196852 | 100 |
| 474 | 3300026142 | Ga0207698_10697497 | Ga0207698_106974972 | 100 |
| 475 | 3300026142 | Ga0207698_11338828 | Ga0207698_113388282 | 100 |
| 476 | 3300027695 | Ga0209966_1127403 | Ga0209966_11274031 | 100 |
| 477 | 3300027717 | Ga0209998_10024852 | Ga0209998_100248522 | 100 |
| 478 | 3300027907 | Ga0207428_10111867 | Ga0207428_101118673 | 100 |
| 479 | 3300028379 | Ga0268266_10023814 | Ga0268266_100238145 | 100 |
| 480 | 3300028379 | Ga0268266_10333845 | Ga0268266_103338453 | 100 |
| 481 | 3300028379 | Ga0268266_10781564 | Ga0268266_107815642 | 100 |
| 482 | 3300028379 | Ga0268266_11500417 | Ga0268266_115004172 | 100 |
| 483 | 3300028380 | Ga0268265_10020966 | Ga0268265_100209664 | 100 |
| 484 | 3300028380 | Ga0268265_10034277 | Ga0268265_100342772 | 100 |
| 485 | 3300028380 | Ga0268265_10134764 | Ga0268265_101347642 | 100 |
| 486 | 3300028380 | Ga0268265_10382245 | Ga0268265_103822452 | 100 |
| 487 | 3300028380 | Ga0268265_12565811 | Ga0268265_125658112 | 100 |
| 488 | 3300028381 | Ga0268264_10005449 | Ga0268264_100054499 | 100 |
| 489 | 3300028381 | Ga0268264_10019372 | Ga0268264_100193724 | 100 |
| 490 | 3300028381 | Ga0268264_10039488 | Ga0268264_100394883 | 100 |
| 491 | 3300028381 | Ga0268264_10052175 | Ga0268264_100521752 | 100 |
| 492 | 3300028381 | Ga0268264_10467069 | Ga0268264_104670692 | 100 |
| 493 | 3300028800 | Ga0265338_10026205 | Ga0265338_100262057 | 100 |
| 494 | 3300030521 | Ga0307511_10069347 | Ga0307511_100693472 | 100 |
| 495 | 3300031247 | Ga0265340_10150008 | Ga0265340_101500082 | 100 |
| 496 | 3300031548 | Ga0307408_101077452 | Ga0307408_1010774522 | 100 |
| 497 | 3300031548 | Ga0307408_101718259 | Ga0307408_1017182591 | 100 |
| 498 | 3300031665 | Ga0316575_10004749 | Ga0316575_100047493 | 100 |
| 499 | 3300031665 | Ga0316575_10096260 | Ga0316575_100962603 | 100 |
| 500 | 3300031727 | Ga0316576_10146198 | Ga0316576_101461982 | 100 |
| 501 | 3300031731 | Ga0307405_10636523 | Ga0307405_106365231 | 100 |
| 502 | 3300031824 | Ga0307413_11756787 | Ga0307413_117567872 | 100 |
| 503 | 3300031901 | Ga0307406_10024801 | Ga0307406_100248015 | 100 |
| 504 | 3300031911 | Ga0307412_10001601 | Ga0307412_100016018 | 100 |
| 505 | 3300031911 | Ga0307412_11953158 | Ga0307412_119531582 | 100 |
| 506 | 3300031995 | Ga0307409_101530957 | Ga0307409_1015309572 | 100 |
| 507 | 3300032002 | Ga0307416_100229851 | Ga0307416_1002298513 | 100 |
| 508 | 3300032004 | Ga0307414_10124795 | Ga0307414_101247953 | 100 |
| 509 | 3300032137 | Ga0316585_10056829 | Ga0316585_100568292 | 100 |
| 510 | 3300035111 | Ga0373923_0499689 | Ga0373923_0499689_14_316 | 100 |
| 511 | 3300035113 | Ga0373936_0254074 | Ga0373936_0254074_395_697 | 100 |
| 512 | 3300035117 | Ga0373953_0176442 | Ga0373953_0176442_196_498 | 100 |
| 513 | 3300035119 | Ga0373956_0466330 | Ga0373956_0466330_282_584 | 100 |
| 514 | 3300035120 | Ga0373957_0072571 | Ga0373957_0072571_592_894 | 100 |
| 515 | 3300035120 | Ga0373957_0117486 | Ga0373957_0117486_292_594 | 100 |
| 516 | 3300035170 | Ga0373943_0568647 | Ga0373943_0568647_138_440 | 100 |
| 517 | 3300035171 | Ga0373946_0517419 | Ga0373946_0517419_16_318 | 100 |
| 518 | 3300035398 | Ga0316574_0067500 | Ga0316574_0067500_678_980 | 100 |
| 519 | 3300035398 | Ga0316574_0432706 | Ga0316574_0432706_474_776 | 100 |
| 520 | 3300035410 | Ga0373924_0101564 | Ga0373924_0101564_217_519 | 100 |
| 521 | 3300035692 | Ga0373935_1259469 | Ga0373935_1259469_180_482 | 100 |
| 522 | 3300035724 | Ga0373933_0094901 | Ga0373933_0094901_1177_1512 | 100 |
| 523 | 3300035724 | Ga0373933_0444202 | Ga0373933_0444202_420_722 | 100 |
| 524 | 3300035725 | Ga0373947_0357278 | Ga0373947_0357278_106_441 | 100 |
| 525 | 3300036401 | Ga0373937_0058885 | Ga0373937_0058885_2499_2834 | 100 |
| 526 | 3300036401 | Ga0373937_0110376 | Ga0373937_0110376_26_328 | 100 |
| 527 | 3300036401 | Ga0373937_0145259 | Ga0373937_0145259_860_1162 | 100 |
| 528 | 3300036401 | Ga0373937_0318167 | Ga0373937_0318167_134_502 | 100 |
| 529 | 3300036401 | Ga0373937_0470314 | Ga0373937_0470314_619_921 | 100 |
| 530 | 3300036401 | Ga0373937_1727602 | Ga0373937_1727602_199_501 | 100 |
| 531 | 3300036647 | Ga0316582_0221359 | Ga0316582_0221359_948_1250 | 100 |
| 532 | 3300036647 | Ga0316582_0822652 | Ga0316582_0822652_151_453 | 100 |
| 533 | 3300036712 | Ga0316584_0095501 | Ga0316584_0095501_1627_1929 | 100 |
| 534 | 3300036712 | Ga0316584_0631090 | Ga0316584_0631090_264_566 | 100 |
| 535 | 3300037068 | Ga0373925_0831893 | Ga0373925_0831893_128_430 | 100 |
| 536 | 3300037853 | Ga0436364_0530696 | Ga0436364_0530696_4519_4821 | 100 |
| 537 | 3300038705 | Ga0237819_09762 | Ga0237819_09762_753_1055 | 100 |
| 538 | 3300039062 | Ga0400483_098493 | Ga0400483_098493_187_489 | 100 |
| 539 | 3300039062 | Ga0400483_237847 | Ga0400483_237847_387_689 | 100 |
| 540 | 3300039437 | Ga0436365_1286208 | Ga0436365_1286208_546_848 | 100 |
| 541 | 3300041459 | Ga0451800_1669862 | Ga0451800_1669862_85_387 | 100 |
| 542 | 3300041460 | Ga0451802_2113515 | Ga0451802_2113515_159_461 | 100 |
| 543 | 3300041486 | Ga0451807_1509185 | Ga0451807_1509185_109_411 | 100 |
| 544 | 3300041491 | Ga0451833_0514785 | Ga0451833_0514785_40_342 | 100 |
| 545 | 3300041498 | Ga0451841_0243136 | Ga0451841_0243136_655_957 | 100 |
| 546 | 3300041505 | Ga0451849_1308335 | Ga0451849_1308335_300_602 | 100 |
| 547 | 3300041512 | Ga0451853_0008175 | Ga0451853_0008175_547_849 | 100 |
| 548 | 3300041512 | Ga0451853_3871611 | Ga0451853_3871611_651_953 | 100 |
| 549 | 3300042005 | Ga0439448_0314555 | Ga0439448_0314555_86_388 | 100 |
| 550 | 3300042118 | Ga0450914_033132 | Ga0450914_033132_83_385 | 100 |
| 551 | 3300042876 | Ga0451577_0081527 | Ga0451577_0081527_2470_2772 | 100 |
| 552 | 3300044712 | Ga0453684_0000019 | Ga0453684_0000019_765244_765546 | 100 |
| 553 | 3300046454 | Ga0495592_0301233 | Ga0495592_0301233_610_912 | 100 |
| 554 | 3300046455 | Ga0495603_0607043 | Ga0495603_0607043_23_349 | 100 |
| 555 | 3300046459 | Ga0495629_0149722 | Ga0495629_0149722_476_778 | 100 |
| 556 | 3300046459 | Ga0495629_0654201 | Ga0495629_0654201_212_514 | 100 |
| 557 | 3300046462 | Ga0495651_0199424 | Ga0495651_0199424_1039_1341 | 100 |
| 558 | 3300046472 | Ga0495580_0127379 | Ga0495580_0127379_173_475 | 100 |
| 559 | 3300046472 | Ga0495580_0585166 | Ga0495580_0585166_17_319 | 100 |
| 560 | 3300046473 | Ga0495582_0069700 | Ga0495582_0069700_1528_1830 | 100 |
| 561 | 3300046475 | Ga0495639_0138700 | Ga0495639_0138700_273_575 | 100 |
| 562 | 3300046477 | Ga0495664_0137173 | Ga0495664_0137173_1083_1385 | 100 |
| 563 | 3300046500 | Ga0495596_0336123 | Ga0495596_0336123_70_372 | 100 |
| 564 | 3300046511 | Ga0495608_0282497 | Ga0495608_0282497_334_636 | 100 |
| 565 | 3300046516 | Ga0495628_0145659 | Ga0495628_0145659_1139_1441 | 100 |
| 566 | 3300046516 | Ga0495628_0256122 | Ga0495628_0256122_230_532 | 100 |
| 567 | 3300046529 | Ga0495652_0816741 | Ga0495652_0816741_111_413 | 100 |
| 568 | 3300046531 | Ga0495665_0006822 | Ga0495665_0006822_4645_4947 | 100 |
| 569 | 3300046533 | Ga0495640_0211533 | Ga0495640_0211533_442_744 | 100 |
| 570 | 3300046536 | Ga0495587_0220054 | Ga0495587_0220054_340_642 | 100 |
| 571 | 3300046537 | Ga0495598_0125823 | Ga0495598_0125823_125_427 | 100 |
| 572 | 3300046539 | Ga0495621_0005534 | Ga0495621_0005534_3033_3335 | 100 |
| 573 | 3300046539 | Ga0495621_0010634 | Ga0495621_0010634_2260_2562 | 100 |
| 574 | 3300046543 | Ga0495645_0081321 | Ga0495645_0081321_1672_1974 | 100 |
| 575 | 3300046558 | Ga0495633_0220641 | Ga0495633_0220641_214_516 | 100 |
| 576 | 3300046559 | Ga0495667_0202727 | Ga0495667_0202727_761_1063 | 100 |
| 577 | 3300046663 | Ga0495635_0265162 | Ga0495635_0265162_492_794 | 100 |
| 578 | 3300046663 | Ga0495635_0887865 | Ga0495635_0887865_253_555 | 100 |
| 579 | 3300046675 | Ga0495657_0160222 | Ga0495657_0160222_183_485 | 100 |
| 580 | 3300046679 | Ga0495623_0307090 | Ga0495623_0307090_485_787 | 100 |
| 581 | 3300046681 | Ga0495647_0002277 | Ga0495647_0002277_1099_1401 | 100 |
| 582 | 3300046681 | Ga0495647_0100865 | Ga0495647_0100865_104_439 | 100 |
| 583 | 3300046683 | Ga0495658_0005339 | Ga0495658_0005339_4811_5113 | 100 |
| 584 | 3300046683 | Ga0495658_0399019 | Ga0495658_0399019_305_640 | 100 |
| 585 | 3300046683 | Ga0495658_0547379 | Ga0495658_0547379_17_319 | 100 |
| 586 | 3300046683 | Ga0495658_1051791 | Ga0495658_1051791_26_328 | 100 |
| 587 | 3300046689 | Ga0495613_0324243 | Ga0495613_0324243_676_978 | 100 |
| 588 | 3300046794 | Ga0495589_0031426 | Ga0495589_0031426_1781_2092 | 100 |
| 589 | 3300046809 | Ga0495600_0251627 | Ga0495600_0251627_455_757 | 100 |
| 590 | 3300046809 | Ga0495600_0324470 | Ga0495600_0324470_194_529 | 100 |
| 591 | 3300047315 | Ga0495581_0102655 | Ga0495581_0102655_180_482 | 100 |
| 592 | 3300047321 | Ga0495676_0704610 | Ga0495676_0704610_224_526 | 100 |
| 593 | 3300047470 | Ga0495681_0086463 | Ga0495681_0086463_217_519 | 100 |
| 594 | 3300047471 | Ga0495684_0175701 | Ga0495684_0175701_1015_1317 | 100 |
| 595 | 3300048903 | Ga0496100_0178514 | Ga0496100_0178514_410_745 | 100 |
| 596 | 3300048904 | Ga0496101_0006056 | Ga0496101_0006056_5913_6248 | 100 |
| 597 | 3300048904 | Ga0496101_0009385 | Ga0496101_0009385_2752_3054 | 100 |
| 598 | 3300048904 | Ga0496101_0080612 | Ga0496101_0080612_1636_1938 | 100 |
| 599 | 3300048904 | Ga0496101_1154045 | Ga0496101_1154045_109_411 | 100 |
| 600 | 3300048905 | Ga0496102_0224056 | Ga0496102_0224056_1361_1696 | 100 |
| 601 | 3300048905 | Ga0496102_1263885 | Ga0496102_1263885_282_584 | 100 |
| 602 | 3300048907 | Ga0496104_0054565 | Ga0496104_0054565_1498_1833 | 100 |
| 603 | 3300048908 | Ga0496105_0065146 | Ga0496105_0065146_822_1157 | 100 |
| 604 | 3300048909 | Ga0496106_0084629 | Ga0496106_0084629_947_1282 | 100 |
| 605 | 3300048910 | Ga0496107_0017330 | Ga0496107_0017330_1082_1417 | 100 |
| 606 | 3300048911 | Ga0496108_0007375 | Ga0496108_0007375_2694_3029 | 100 |
| 607 | 3300048911 | Ga0496108_1034796 | Ga0496108_1034796_244_546 | 100 |
| 608 | 3300048911 | Ga0496108_1767876 | Ga0496108_1767876_179_481 | 100 |
| 609 | 3300048912 | Ga0496109_0020123 | Ga0496109_0020123_411_746 | 100 |
| 610 | 3300048912 | Ga0496109_0037719 | Ga0496109_0037719_1502_1804 | 100 |
| 611 | 3300048913 | Ga0496110_0011869 | Ga0496110_0011869_1399_1734 | 100 |
| 612 | 3300048913 | Ga0496110_0865500 | Ga0496110_0865500_466_768 | 100 |
| 613 | 3300048913 | Ga0496110_1438136 | Ga0496110_1438136_123_425 | 100 |
| 614 | 3300048915 | Ga0496112_0800977 | Ga0496112_0800977_509_811 | 100 |
| 615 | 3300048915 | Ga0496112_1703263 | Ga0496112_1703263_190_492 | 100 |
| 616 | 3300048916 | Ga0496113_0042905 | Ga0496113_0042905_1289_1591 | 100 |
| 617 | 3300048917 | Ga0496114_0139321 | Ga0496114_0139321_646_981 | 100 |
| 618 | 3300048917 | Ga0496114_0456892 | Ga0496114_0456892_65_367 | 100 |
| 619 | 3300048917 | Ga0496114_0518678 | Ga0496114_0518678_511_813 | 100 |
| 620 | 3300048917 | Ga0496114_1539661 | Ga0496114_1539661_76_378 | 100 |
| 621 | 3300048919 | Ga0496116_0000216 | Ga0496116_0000216_58522_58830 | 100 |
| 622 | 3300048919 | Ga0496116_0003659 | Ga0496116_0003659_12605_12907 | 100 |
| 623 | 3300048919 | Ga0496116_0061770 | Ga0496116_0061770_1969_2271 | 100 |
| 624 | 3300048920 | Ga0496117_0001639 | Ga0496117_0001639_1676_1984 | 100 |
| 625 | 3300048920 | Ga0496117_0041934 | Ga0496117_0041934_526_828 | 100 |
| 626 | 3300048921 | Ga0496118_0002026 | Ga0496118_0002026_18395_18703 | 100 |
| 627 | 3300048921 | Ga0496118_0004361 | Ga0496118_0004361_8115_8417 | 100 |
| 628 | 3300048922 | Ga0496119_0006934 | Ga0496119_0006934_7918_8220 | 100 |
| 629 | 3300048922 | Ga0496119_0021874 | Ga0496119_0021874_2912_3214 | 100 |
| 630 | 3300048923 | Ga0496120_0201897 | Ga0496120_0201897_300_602 | 100 |
| 631 | 3300048924 | Ga0496121_0013219 | Ga0496121_0013219_3724_4026 | 100 |
| 632 | 3300048924 | Ga0496121_0377350 | Ga0496121_0377350_545_847 | 100 |
| 633 | 3300048925 | Ga0496122_0002437 | Ga0496122_0002437_23572_23880 | 100 |
| 634 | 3300048925 | Ga0496122_0011284 | Ga0496122_0011284_7321_7623 | 100 |
| 635 | 3300048925 | Ga0496122_0020568 | Ga0496122_0020568_4384_4686 | 100 |
| 636 | 3300048925 | Ga0496122_0023441 | Ga0496122_0023441_1615_1917 | 100 |
| 637 | 3300048925 | Ga0496122_0065708 | Ga0496122_0065708_475_777 | 100 |
| 638 | 3300048925 | Ga0496122_0340553 | Ga0496122_0340553_162_464 | 100 |
| 639 | 3300048926 | Ga0496123_0030486 | Ga0496123_0030486_2646_2948 | 100 |
| 640 | 3300048926 | Ga0496123_0036742 | Ga0496123_0036742_2990_3298 | 100 |
| 641 | 3300048926 | Ga0496123_0037020 | Ga0496123_0037020_1645_1947 | 100 |
| 642 | 3300048926 | Ga0496123_0062629 | Ga0496123_0062629_1337_1639 | 100 |
| 643 | 3300048926 | Ga0496123_0251344 | Ga0496123_0251344_541_843 | 100 |
| 644 | 3300048927 | Ga0496124_0000023 | Ga0496124_0000023_383820_384128 | 100 |
| 645 | 3300048927 | Ga0496124_0000507 | Ga0496124_0000507_55548_55850 | 100 |
| 646 | 3300048927 | Ga0496124_0041869 | Ga0496124_0041869_1452_1754 | 100 |
| 647 | 3300048927 | Ga0496124_0201922 | Ga0496124_0201922_461_763 | 100 |
| 648 | 3300048928 | Ga0496125_0000178 | Ga0496125_0000178_67807_68109 | 100 |
| 649 | 3300048928 | Ga0496125_0001277 | Ga0496125_0001277_17101_17403 | 100 |
| 650 | 3300048928 | Ga0496125_0053178 | Ga0496125_0053178_1645_1947 | 100 |
| 651 | 3300048928 | Ga0496125_0065656 | Ga0496125_0065656_1457_1759 | 100 |
| 652 | 3300048928 | Ga0496125_0112912 | Ga0496125_0112912_1446_1754 | 100 |
| 653 | 3300048928 | Ga0496125_0547530 | Ga0496125_0547530_225_527 | 100 |
| 654 | 3300048928 | Ga0496125_0671305 | Ga0496125_0671305_66_368 | 100 |
| 655 | 3300048929 | Ga0496126_0047707 | Ga0496126_0047707_428_730 | 100 |
| 656 | 3300048929 | Ga0496126_0131230 | Ga0496126_0131230_480_782 | 100 |
| 657 | 3300048929 | Ga0496126_0132341 | Ga0496126_0132341_947_1249 | 100 |
| 658 | 3300049568 | Ga0501031_0001266 | Ga0501031_0001266_11700_12002 | 100 |
| 659 | 3300049568 | Ga0501031_0001923 | Ga0501031_0001923_4939_5241 | 100 |
| 660 | 3300049568 | Ga0501031_0012669 | Ga0501031_0012669_4262_4564 | 100 |
| 661 | 3300049569 | Ga0501032_0018403 | Ga0501032_0018403_1325_1627 | 100 |
| 662 | 3300049569 | Ga0501032_0098350 | Ga0501032_0098350_26_328 | 100 |
| 663 | 3300049569 | Ga0501032_0116940 | Ga0501032_0116940_357_659 | 100 |
| 664 | 3300049570 | Ga0501033_0105762 | Ga0501033_0105762_1187_1489 | 100 |
| 665 | 3300049571 | Ga0501034_0001318 | Ga0501034_0001318_27343_27645 | 100 |
| 666 | 3300049571 | Ga0501034_0093979 | Ga0501034_0093979_1661_1963 | 100 |
| 667 | 3300049571 | Ga0501034_0096167 | Ga0501034_0096167_2194_2496 | 100 |
| 668 | 3300049572 | Ga0501036_0004316 | Ga0501036_0004316_9668_9970 | 100 |
| 669 | 3300049572 | Ga0501036_0028421 | Ga0501036_0028421_2014_2316 | 100 |
| 670 | 3300049572 | Ga0501036_0117763 | Ga0501036_0117763_1821_2123 | 100 |
| 671 | 3300049572 | Ga0501036_0766214 | Ga0501036_0766214_324_626 | 100 |
| 672 | 3300049572 | Ga0501036_1079471 | Ga0501036_1079471_305_607 | 100 |
| 673 | 3300049572 | Ga0501036_1419019 | Ga0501036_1419019_231_533 | 100 |
| 674 | 3300049573 | Ga0501037_0018188 | Ga0501037_0018188_2223_2525 | 100 |
| 675 | 3300049573 | Ga0501037_0039289 | Ga0501037_0039289_481_783 | 100 |
| 676 | 3300049573 | Ga0501037_0057540 | Ga0501037_0057540_2299_2601 | 100 |
| 677 | 3300049574 | Ga0501038_0029848 | Ga0501038_0029848_28_330 | 100 |
| 678 | 3300049574 | Ga0501038_0079400 | Ga0501038_0079400_2216_2518 | 100 |
| 679 | 3300049574 | Ga0501038_0128551 | Ga0501038_0128551_85_387 | 100 |
| 680 | 3300049575 | Ga0501039_0035622 | Ga0501039_0035622_3475_3777 | 100 |
| 681 | 3300049575 | Ga0501039_0058508 | Ga0501039_0058508_2078_2380 | 100 |
| 682 | 3300049575 | Ga0501039_0066129 | Ga0501039_0066129_1896_2198 | 100 |
| 683 | 3300049575 | Ga0501039_0162707 | Ga0501039_0162707_142_444 | 100 |
| 684 | 3300049575 | Ga0501039_0249574 | Ga0501039_0249574_362_664 | 100 |
| 685 | 3300049575 | Ga0501039_0483755 | Ga0501039_0483755_433_735 | 100 |
| 686 | 3300049575 | Ga0501039_0639407 | Ga0501039_0639407_279_581 | 100 |
| 687 | 3300049575 | Ga0501039_0868111 | Ga0501039_0868111_291_593 | 100 |
| 688 | 3300049575 | Ga0501039_0886344 | Ga0501039_0886344_84_386 | 100 |
| 689 | 3300049576 | Ga0501040_0051118 | Ga0501040_0051118_2214_2516 | 100 |
| 690 | 3300049576 | Ga0501040_0122931 | Ga0501040_0122931_1388_1690 | 100 |
| 691 | 3300049576 | Ga0501040_0167533 | Ga0501040_0167533_1029_1331 | 100 |
| 692 | 3300049577 | Ga0501041_0000706 | Ga0501041_0000706_9283_9585 | 100 |
| 693 | 3300049577 | Ga0501041_0125523 | Ga0501041_0125523_1219_1521 | 100 |
| 694 | 3300049578 | Ga0501042_0013627 | Ga0501042_0013627_1425_1727 | 100 |
| 695 | 3300049578 | Ga0501042_0049642 | Ga0501042_0049642_1438_1740 | 100 |
| 696 | 3300049578 | Ga0501042_0103710 | Ga0501042_0103710_610_912 | 100 |
| 697 | 3300049578 | Ga0501042_0898333 | Ga0501042_0898333_34_336 | 100 |
| 698 | 3300049579 | Ga0501043_0083636 | Ga0501043_0083636_804_1106 | 100 |
| 699 | 3300049579 | Ga0501043_0209855 | Ga0501043_0209855_185_487 | 100 |
| 700 | 3300049579 | Ga0501043_0305559 | Ga0501043_0305559_122_424 | 100 |
| 701 | 3300049579 | Ga0501043_0430864 | Ga0501043_0430864_20_322 | 100 |
| 702 | 3300049579 | Ga0501043_0525314 | Ga0501043_0525314_230_532 | 100 |
| 703 | 3300049580 | Ga0501046_0013301 | Ga0501046_0013301_2934_3236 | 100 |
| 704 | 3300049580 | Ga0501046_0026917 | Ga0501046_0026917_2463_2765 | 100 |
| 705 | 3300049580 | Ga0501046_0214055 | Ga0501046_0214055_133_435 | 100 |
| 706 | 3300049581 | Ga0501047_0471383 | Ga0501047_0471383_702_1004 | 100 |
| 707 | 3300049582 | Ga0501048_0018522 | Ga0501048_0018522_2203_2505 | 100 |
| 708 | 3300049582 | Ga0501048_0071133 | Ga0501048_0071133_21_323 | 100 |
| 709 | 3300049582 | Ga0501048_1376991 | Ga0501048_1376991_13_315 | 100 |
| 710 | 3300049584 | Ga0501068_0005874 | Ga0501068_0005874_5961_6263 | 100 |
| 711 | 3300049584 | Ga0501068_0971986 | Ga0501068_0971986_58_360 | 100 |
| 712 | 3300049586 | Ga0501070_0378919 | Ga0501070_0378919_116_418 | 100 |
| 713 | 3300049587 | Ga0501071_0270343 | Ga0501071_0270343_743_1045 | 100 |
| 714 | 3300049587 | Ga0501071_1282916 | Ga0501071_1282916_254_556 | 100 |
| 715 | 3300049588 | Ga0501072_0024480 | Ga0501072_0024480_3056_3358 | 100 |
| 716 | 3300049588 | Ga0501072_0769328 | Ga0501072_0769328_250_552 | 100 |
| 717 | 3300049589 | Ga0501073_0167027 | Ga0501073_0167027_1095_1397 | 100 |
| 718 | 3300049589 | Ga0501073_0197323 | Ga0501073_0197323_679_981 | 100 |
| 719 | 3300049590 | Ga0501074_0096127 | Ga0501074_0096127_1213_1515 | 100 |
| 720 | 3300049590 | Ga0501074_0391910 | Ga0501074_0391910_88_390 | 100 |
| 721 | 3300049590 | Ga0501074_1050650 | Ga0501074_1050650_152_454 | 100 |
| 722 | 3300049592 | Ga0501076_0102647 | Ga0501076_0102647_986_1288 | 100 |
| 723 | 3300049592 | Ga0501076_0115424 | Ga0501076_0115424_436_738 | 100 |
| 724 | 3300049592 | Ga0501076_0605323 | Ga0501076_0605323_173_475 | 100 |
| 725 | 3300049593 | Ga0501077_0056116 | Ga0501077_0056116_341_643 | 100 |
| 726 | 3300049690 | Ga0501261_010250 | Ga0501261_010250_894_1196 | 100 |
| 727 | 3300049741 | Ga0501079_0906223 | Ga0501079_0906223_345_647 | 100 |
| 728 | 3300049742 | Ga0501080_0113382 | Ga0501080_0113382_859_1161 | 100 |
| 729 | 3300049742 | Ga0501080_0299886 | Ga0501080_0299886_920_1222 | 100 |
| 730 | 3300049742 | Ga0501080_1319046 | Ga0501080_1319046_209_511 | 100 |
| 731 | 3300049744 | Ga0501083_0021948 | Ga0501083_0021948_432_734 | 100 |
| 732 | 3300049744 | Ga0501083_0181865 | Ga0501083_0181865_69_371 | 100 |
| 733 | 3300049744 | Ga0501083_0514492 | Ga0501083_0514492_291_593 | 100 |
| 734 | 3300049822 | Ga0501035_0153789 | Ga0501035_0153789_1295_1597 | 100 |
| 735 | 3300049822 | Ga0501035_0389346 | Ga0501035_0389346_200_502 | 100 |
| 736 | 3300049823 | Ga0501044_0455603 | Ga0501044_0455603_597_899 | 100 |
| 737 | 3300049824 | Ga0501045_0706658 | Ga0501045_0706658_270_572 | 100 |
| 738 | 3300049824 | Ga0501045_1316376 | Ga0501045_1316376_184_486 | 100 |
| 739 | 3300050491 | nmdc:mga00v17_159201_c1 | nmdc:mga00v17_159201_c1_355_657 | 100 |
| 740 | 3300050491 | nmdc:mga00v17_335070_c1 | nmdc:mga00v17_335070_c1_474_776 | 100 |
| 741 | 3300050492 | nmdc:mga0yw44_663256_c1 | nmdc:mga0yw44_663256_c1_90_392 | 100 |
| 742 | 3300050493 | nmdc:mga0k408_486055_c1 | nmdc:mga0k408_486055_c1_136_471 | 100 |
| 743 | 3300050511 | nmdc:mga08y16_22414_c1 | nmdc:mga08y16_22414_c1_3957_4292 | 100 |
| 744 | 3300050511 | nmdc:mga08y16_640413_c1 | nmdc:mga08y16_640413_c1_241_543 | 100 |
| 745 | 3300050512 | nmdc:mga0n895_467063_c1 | nmdc:mga0n895_467063_c1_140_442 | 100 |
| 746 | 3300050513 | nmdc:mga0rr50_1664064_c1 | nmdc:mga0rr50_1664064_c1_191_493 | 100 |
| 747 | 3300053077 | Ga0495601_0296851 | Ga0495601_0296851_76_378 | 100 |
| 748 | 3300053077 | Ga0495601_0798166 | Ga0495601_0798166_171_473 | 100 |
| 749 | 3300053085 | Ga0495619_0161688 | Ga0495619_0161688_691_993 | 100 |
| 750 | 3300053085 | Ga0495619_0331678 | Ga0495619_0331678_525_827 | 100 |
| 751 | 3300054114 | Ga0501084_0693247 | Ga0501084_0693247_387_689 | 100 |
| 752 | 3300054114 | Ga0501084_1834987 | Ga0501084_1834987_71_373 | 100 |
| 753 | 3300059421 | Ga0590071_131006 | Ga0590071_131006_284_586 | 100 |
| 754 | 3300060353 | Ga0501082_0020590 | Ga0501082_0020590_943_1245 | 100 |
| 755 | 3300060353 | Ga0501082_0135038 | Ga0501082_0135038_433_735 | 100 |
| 756 | 3300061734 | Ga0530510_0143760 | Ga0530510_0143760_1428_1730 | 100 |
| 757 | 3300061734 | Ga0530510_1459567 | Ga0530510_1459567_40_342 | 100 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2fvh-assembly1.cif.gz_C | crystal structure of rv1848, a urease gamma subunit urea (urea amidohydrolase), from mycobacterium tuberculosis | 0.969 | 2 | 100 |
| 2fvh-assembly1.cif.gz_C | crystal structure of rv1848, a urease gamma subunit urea (urea amidohydrolase), from mycobacterium tuberculosis | 0.9595 | 2 | 100 |
| 1a5k-assembly1.cif.gz_A | k217e variant of klebsiella aerogenes urease | 0.9593 | 1 | 100 |
| 8hc1-assembly1.cif.gz_A | cryoem structure of helicobacter pylori urefd/urease complex | 0.9591 | 1 | 100 |
| 6yl3-assembly1.cif.gz_A | high resolution cryo-em structure of urease from the pathogen yersinia enterocolitica | 0.9561 | 1 | 100 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1a5kA00 | Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit | 0.9593 | 1 | 100 | 3.30.280.10 |
| 4gy7A01 | Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit | 0.9573 | 4 | 100 | 3.30.280.10 |
| 4gy7A01 | Alpha Beta;2-Layer Sandwich;Urease; subunit A;Urease, gamma-like subunit | 0.9204 | 4 | 100 | 3.30.280.10 |
| af_K7TKX8_54_223_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.687 | 13 | 39 | 1.25.40.10 |
| af_A0A1D6HLN3_275_403_1.25.40.10 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain | 0.6449 | 5 | 43 | 1.25.40.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6M0C757-F1-model_v4 | Urease subunit gamma (EC 3.5.1.5) | 1.005 | 29 | 100 |
GO:0005737
GO:0009039 GO:0016151 GO:0043419 |
| AF-A0A3D4KSV3-F1-model_v4 | Urease subunit gamma (EC 3.5.1.5) | 1.004 | 29 | 100 |
GO:0005737
GO:0009039 GO:0016151 GO:0043419 |
| AF-T0ZPP4-F1-model_v4 | Urease, gamma subunit region domain protein (EC 3.5.1.5) | 1.004 | 40 | 100 |
GO:0009039
GO:0016151 GO:0043419 |
| AF-Q8RJK1-F1-model_v4 | Urease subunit gamma (EC 3.5.1.5) | 1.003 | 31 | 100 |
GO:0005737
GO:0009039 GO:0016151 GO:0043419 |
| AF-A0A4Q3TXH5-F1-model_v4 | Multifunctional fusion protein [Includes: Urease subunit gamma (EC 3.5.1.5) (Urea amidohydrolase subunit gamma); Small ribosomal subunit protein uS2] | 1.002 | 6 | 100 |
GO:0003735
GO:0006412 GO:0009039 GO:0016151 GO:0022627 GO:0043419 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar