F479320

General Info

Members Datasets Scaffolds Average Seq Length
755 319 1509 443

Family's Representative Sequence

Representative Sequence 3300053153|Ga0500616_0000204|Ga0500616_0000204_28334_29833
Length 499
Sequence MDAKDAPGFPNNLLWTDPSLTRYPLRTLDADRHHRRAAPRIAPGPPWDSSPASPVTHTSRAPLPLGLTGYQWTVILAAWLGWGFDIFDGLLFNFVAPNCIPTLLGLPIGSPAARSATLFWTGLLTSVLLIGWAIXXTLFGRLADRIGRTRTLMLTMVLYAVGTSLCAIAPNVWVLGFFRLIASLGIGGEWAAGAAMVAEVVPERRRVEAGALLYTSAPVGLALATLVNFQIAGVWLRDRPDISWRYVFLAGLLPAGVALIVRLFVREPERWANVARHAAPPRLAELFHAANRPLVISGLITALTALITWWSCNAFIPVIASGLANVEAAQRSLDRGQTFALVEAWKAQATNWFNIGGLIGTLLTIPAAKLMGRRPMFATYFIVSGLSVLATFGLPLAPQTRIVMYFLIGLSVFGVFGSFTYYLPELFPTRLRGTGSGFCYNIGRIVAAAGPFLVGAIASRGVSALDTAMTALFWVGLVPFIGLAGLPWVIETRGQTLRD

Samples

Sample ID Description Type Environment
1 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
2 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
71 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
72 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
77 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
78 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
79 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
80 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
83 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
84 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
85 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
86 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
87 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
89 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
90 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
91 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
92 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
93 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
94 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
97 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
98 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
99 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
100 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
101 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
102 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
103 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
104 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
105 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
106 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
107 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
110 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
167 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
168 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
169 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
170 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
171 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
172 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
173 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
174 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
175 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
176 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
177 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
178 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
179 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
180 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
181 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
182 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
187 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
188 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
189 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
190 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
191 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
192 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
195 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
196 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
197 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
198 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
199 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
200 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
209 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
210 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
213 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
214 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
215 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
216 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
217 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
218 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
219 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
220 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
227 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
228 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
229 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
230 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
231 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
232 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
233 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
234 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
235 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
236 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
237 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
242 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
245 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
246 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
247 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
248 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
249 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
255 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
256 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
259 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
260 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
261 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
262 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
270 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
274 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
275 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
276 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
277 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
279 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
280 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
281 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
282 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
283 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
284 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
285 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
286 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
287 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
288 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
289 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
290 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
291 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
292 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
293 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
294 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
295 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
296 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
297 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
298 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
299 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
300 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
301 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
302 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
303 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
304 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
305 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
306 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
307 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
308 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
309 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
310 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
311 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
312 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
313 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
314 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
315 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
316 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
317 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
318 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
319 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.59
Nodule 0
Rhizoplane 2.91
Rhizosphere 92.85
Stem 0
Stem Tuber 0
Unclassified 7.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500616_0000204 3300053153 Bacteria 96997
2 rootH1_10050541 3300003316 Bacteria 6579
3 rootH1_10050541 3300003323 Bacteria 12318
4 Ga0065704_10002507 3300005289 Bacteria 5099
5 Ga0065715_10015077 3300005293 Bacteria 2981
6 Ga0065707_10002498 3300005295 Bacteria 9211
7 Ga0070658_10001502 3300005327 Bacteria 19810
8 Ga0070658_10008043 3300005327 Bacteria 8478
9 Ga0070658_10014962 3300005327 Bacteria 6210
10 Ga0070658_10178888 3300005327 Bacteria 1784
11 Ga0070676_10002848 3300005328 Bacteria 8930
12 Ga0070676_10017606 3300005328 Bacteria 3954
13 Ga0070676_10119406 3300005328 Bacteria 1652
14 Ga0070676_10124977 3300005328 Bacteria 1619
15 Ga0070683_100051531 3300005329 Bacteria 3811
16 Ga0070683_100061279 3300005329 Bacteria 3498
17 Ga0070683_100089296 3300005329 Bacteria 2892
18 Ga0070690_100003119 3300005330 Bacteria 9023
19 Ga0070690_100010799 3300005330 Bacteria 5326
20 Ga0070690_100018746 3300005330 Bacteria 4185
21 Ga0070690_100019068 3300005330 Bacteria 4156
22 Ga0070690_100078788 3300005330 Bacteria 2153
23 Ga0070670_100017844 3300005331 Bacteria 6091
24 Ga0070670_100137269 3300005331 Unclassified 2113
25 Ga0070670_100238016 3300005331 Bacteria 1585
26 Ga0070666_10015159 3300005335 Bacteria 4915
27 Ga0070666_10040910 3300005335 Bacteria 3095
28 Ga0070666_10061440 3300005335 Bacteria 2544
29 Ga0070666_10120327 3300005335 Bacteria 1820
30 Ga0070680_100002053 3300005336 Bacteria 14852
31 Ga0070680_100004832 3300005336 Bacteria 10144
32 Ga0070680_100088046 3300005336 Bacteria 2568
33 Ga0070680_100164773 3300005336 Bacteria 1864
34 Ga0068868_100006472 3300005338 Bacteria 8291
35 Ga0068868_100023884 3300005338 Bacteria 4632
36 Ga0068868_100078592 3300005338 Bacteria 2642
37 Ga0068868_100180540 3300005338 Bacteria 1751
38 Ga0070660_100201291 3300005339 Bacteria 1615
39 Ga0070689_100000015 3300005340 Bacteria 179920
40 Ga0070689_100005560 3300005340 Bacteria 8621
41 Ga0070689_100009154 3300005340 Bacteria 7013
42 Ga0070689_100014571 3300005340 Bacteria 5715
43 Ga0070689_100023875 3300005340 Bacteria 4583
44 Ga0070689_100063574 3300005340 Bacteria 2872
45 Ga0070689_100134666 3300005340 Bacteria 1983
46 Ga0070687_100003229 3300005343 Bacteria 6300
47 Ga0070661_100040619 3300005344 Unclassified 3394
48 Ga0070668_100046936 3300005347 Bacteria 3319
49 Ga0070669_100003184 3300005353 Bacteria 11802
50 Ga0070669_100006943 3300005353 Bacteria 8136
51 Ga0070669_100080876 3300005353 Bacteria 2419
52 Ga0070675_100008559 3300005354 Bacteria 7945
53 Ga0070675_100027213 3300005354 Bacteria 4593
54 Ga0070675_100155904 3300005354 Bacteria 1961
55 Ga0070671_100006515 3300005355 Bacteria 9333
56 Ga0070671_100048055 3300005355 Bacteria 3548
57 Ga0070671_100061608 3300005355 Bacteria 3125
58 Ga0070671_100109618 3300005355 Bacteria 2318
59 Ga0070674_100013787 3300005356 Bacteria 5005
60 Ga0070674_100071158 3300005356 Bacteria 2459
61 Ga0070673_100003963 3300005364 Bacteria 9305
62 Ga0070673_100029461 3300005364 Bacteria 4093
63 Ga0070688_100002244 3300005365 Bacteria 9747
64 Ga0070688_100101776 3300005365 Bacteria 1895
65 Ga0070688_100108970 3300005365 Bacteria 1839
66 Ga0070659_100053100 3300005366 Unclassified 3189
67 Ga0070667_100005556 3300005367 Bacteria 10521
68 Ga0070667_100044370 3300005367 Bacteria 3733
69 Ga0070709_10000047 3300005434 Bacteria 97230
70 Ga0070714_100086100 3300005435 Bacteria 2746
71 Ga0070713_100006106 3300005436 Bacteria 8309
72 Ga0070701_10006307 3300005438 Bacteria 4981
73 Ga0070701_10017361 3300005438 Bacteria 3361
74 Ga0070711_100015495 3300005439 Bacteria 4827
75 Ga0070705_100005687 3300005440 Bacteria 6091
76 Ga0070700_100013087 3300005441 Bacteria 4653
77 Ga0070694_100003107 3300005444 Bacteria 9891
78 Ga0070694_100010145 3300005444 Bacteria 5798
79 Ga0070678_100001136 3300005456 Bacteria 14048
80 Ga0070678_100103496 3300005456 Bacteria 2212
81 Ga0070662_100054340 3300005457 Unclassified 2902
82 Ga0070662_100059486 3300005457 Unclassified 2783
83 Ga0070681_10002868 3300005458 Bacteria 15929
84 Ga0070681_10002897 3300005458 Bacteria 15863
85 Ga0070681_10032836 3300005458 Bacteria 5211
86 Ga0068867_100027784 3300005459 Bacteria 4070
87 Ga0070685_10002729 3300005466 Bacteria 9039
88 Ga0070685_10030664 3300005466 Bacteria 2999
89 Ga0070707_100028306 3300005468 Bacteria 5333
90 Ga0070707_100175792 3300005468 Bacteria 2087
91 Ga0070698_100002282 3300005471 Bacteria 21228
92 Ga0070698_100006038 3300005471 Bacteria 13193
93 Ga0070698_100134573 3300005471 Unclassified 2426
94 Ga0070698_100140555 3300005471 Bacteria 2366
95 Ga0070699_100000763 3300005518 Bacteria 29746
96 Ga0070699_100004119 3300005518 Bacteria 12847
97 Ga0070699_100031167 3300005518 Bacteria 4604
98 Ga0070699_100080099 3300005518 Unclassified 2846
99 Ga0070679_100004061 3300005530 Bacteria 13485
100 Ga0070679_100005972 3300005530 Bacteria 11317
101 Ga0070679_100024463 3300005530 Bacteria 5917
102 Ga0070679_100055976 3300005530 Unclassified 3929
103 Ga0070679_100074372 3300005530 Bacteria 3388
104 Ga0070679_100101842 3300005530 Bacteria 2858
105 Ga0070684_100024485 3300005535 Bacteria 5064
106 Ga0070684_100164958 3300005535 Viruses 2010
107 Ga0070697_100050865 3300005536 Bacteria 3365
108 Ga0070697_100087387 3300005536 Bacteria 2574
109 Ga0068853_100001470 3300005539 Bacteria 17100
110 Ga0068853_100002336 3300005539 Bacteria 14180
111 Ga0068853_100002532 3300005539 Bacteria 13722
112 Ga0068853_100159670 3300005539 Bacteria 2033
113 Ga0070672_100000669 3300005543 Bacteria 20154
114 Ga0070672_100005776 3300005543 Bacteria 8252
115 Ga0070672_100017690 3300005543 Bacteria 5136
116 Ga0070672_100018021 3300005543 Bacteria 5096
117 Ga0070672_100024131 3300005543 Bacteria 4489
118 Ga0070686_100009848 3300005544 Bacteria 5372
119 Ga0070686_100110991 3300005544 Bacteria 1868
120 Ga0070695_100000165 3300005545 Bacteria 31530
121 Ga0070695_100042891 3300005545 Bacteria 2874
122 Ga0070696_100000299 3300005546 Bacteria 29928
123 Ga0070696_100002781 3300005546 Bacteria 11618
124 Ga0070696_100026257 3300005546 Bacteria 3962
125 Ga0070696_100054744 3300005546 Bacteria 2781
126 Ga0070693_100084563 3300005547 Unclassified 1899
127 Ga0070665_100000260 3300005548 Bacteria 86762
128 Ga0070665_100008165 3300005548 Bacteria 10598
129 Ga0070665_100023755 3300005548 Bacteria 6175
130 Ga0070665_100071031 3300005548 Bacteria 3488
131 Ga0070665_100080522 3300005548 Bacteria 3262
132 Ga0070704_100002093 3300005549 Bacteria 11099
133 Ga0070704_100012601 3300005549 Bacteria 5227
134 Ga0070704_100034592 3300005549 Bacteria 3428
135 Ga0068855_100001126 3300005563 Bacteria 33184
136 Ga0068855_100001559 3300005563 Bacteria 28805
137 Ga0068855_100006115 3300005563 Bacteria 14683
138 Ga0068855_100008548 3300005563 Bacteria 12374
139 Ga0068855_100020637 3300005563 Bacteria 7900
140 Ga0068855_100037427 3300005563 Bacteria 5769
141 Ga0068855_100038866 3300005563 Bacteria 5652
142 Ga0068855_100050061 3300005563 Unclassified 4924
143 Ga0068855_100084644 3300005563 Bacteria 3671
144 Ga0068855_100136545 3300005563 Unclassified 2798
145 Ga0070664_100005673 3300005564 Bacteria 10048
146 Ga0070664_100043922 3300005564 Unclassified 3772
147 Ga0070664_100071377 3300005564 Bacteria 2976
148 Ga0070664_100123647 3300005564 Bacteria 2268
149 Ga0068857_100018996 3300005577 Bacteria 6031
150 Ga0068856_100007009 3300005614 Bacteria 11008
151 Ga0068856_100021956 3300005614 Bacteria 6205
152 Ga0068856_100057710 3300005614 Bacteria 3833
153 Ga0068856_100085709 3300005614 Bacteria 3129
154 Ga0068856_100242413 3300005614 Unclassified 1818
155 Ga0070702_100015598 3300005615 Unclassified 3882
156 Ga0070702_100056815 3300005615 Bacteria 2262
157 Ga0068852_100091856 3300005616 Bacteria 2718
158 Ga0068852_100125197 3300005616 Bacteria 2359
159 Ga0068859_100000351 3300005617 Bacteria 45794
160 Ga0068859_100000928 3300005617 Bacteria 30038
161 Ga0068859_100003334 3300005617 Bacteria 16329
162 Ga0068859_100051668 3300005617 Bacteria 4131
163 Ga0068859_100056860 3300005617 Bacteria 3939
164 Ga0068859_100111494 3300005617 Bacteria 2798
165 Ga0068864_100043398 3300005618 Bacteria 3850
166 Ga0068864_100067834 3300005618 Bacteria 3098
167 Ga0068861_100054566 3300005719 Bacteria 3045
168 Ga0068863_100001670 3300005841 Bacteria 21939
169 Ga0068863_100012408 3300005841 Bacteria 8228
170 Ga0068863_100016086 3300005841 Bacteria 7175
171 Ga0068863_100039185 3300005841 Bacteria 4509
172 Ga0068863_100082719 3300005841 Bacteria 3042
173 Ga0068863_100347531 3300005841 Bacteria 1444
174 Ga0068858_100006466 3300005842 Bacteria 11409
175 Ga0068858_100010999 3300005842 Bacteria 8553
176 Ga0068858_100029932 3300005842 Bacteria 5057
177 Ga0068858_100039437 3300005842 Unclassified 4379
178 Ga0068858_100117982 3300005842 Bacteria 2480
179 Ga0068860_100000731 3300005843 Bacteria 37386
180 Ga0068860_100007945 3300005843 Bacteria 10582
181 Ga0068860_100040768 3300005843 Bacteria 4436
182 Ga0068860_100062100 3300005843 Bacteria 3551
183 Ga0068860_100140801 3300005843 Bacteria 2318
184 Ga0068860_100160122 3300005843 Bacteria 2170
185 Ga0068860_100194698 3300005843 Bacteria 1963
186 Ga0068860_100221245 3300005843 Bacteria 1838
187 Ga0068862_100004001 3300005844 Bacteria 12502
188 Ga0068862_100006668 3300005844 Bacteria 9579
189 Ga0068862_100058576 3300005844 Unclassified 3304
190 Ga0068862_100066020 3300005844 Unclassified 3117
191 Ga0070717_10075487 3300006028 Bacteria 2820
192 Ga0070715_10000168 3300006163 Bacteria 15210
193 Ga0070715_10016575 3300006163 Bacteria 2771
194 Ga0070715_10034067 3300006163 Unclassified 2085
195 Ga0070716_100008972 3300006173 Bacteria 4973
196 Ga0070712_100001910 3300006175 Bacteria 12744
197 Ga0075367_10012764 3300006178 Bacteria 4493
198 Ga0075366_10006277 3300006195 Bacteria 6501
199 Ga0097621_100036189 3300006237 Unclassified 3949
200 Ga0097621_100188098 3300006237 Bacteria 1787
201 Ga0068871_100068257 3300006358 Bacteria 2919
202 Ga0068871_100076048 3300006358 Bacteria 2773
203 Ga0075428_100000115 3300006844 Bacteria 68556
204 Ga0075433_10020643 3300006852 Bacteria 5512
205 Ga0075434_100006213 3300006871 Bacteria 10943
206 Ga0075434_100015024 3300006871 Bacteria 7414
207 Ga0075434_100027595 3300006871 Bacteria 5575
208 Ga0075434_100051931 3300006871 Bacteria 4073
209 Ga0075434_100082272 3300006871 Bacteria 3217
210 Ga0075434_100131017 3300006871 Bacteria 2526
211 Ga0075429_100000186 3300006880 Bacteria 40781
212 Ga0075429_100039240 3300006880 Bacteria 4122
213 Ga0075429_100046293 3300006880 Bacteria 3785
214 Ga0068865_100015529 3300006881 Bacteria 4858
215 Ga0068865_100030682 3300006881 Bacteria 3578
216 Ga0068865_100145630 3300006881 Bacteria 1791
217 Ga0075436_100015596 3300006914 Bacteria 5202
218 Ga0075436_100021475 3300006914 Bacteria 4431
219 Ga0075436_100080867 3300006914 Bacteria 2252
220 Ga0097620_100000351 3300006931 Bacteria 45794
221 Ga0097620_100000928 3300006931 Bacteria 30038
222 Ga0097620_100003334 3300006931 Bacteria 16329
223 Ga0097620_100051674 3300006931 Bacteria 4131
224 Ga0097620_100056861 3300006931 Bacteria 3939
225 Ga0097620_100111494 3300006931 Bacteria 2798
226 Ga0075435_100040210 3300007076 Bacteria 3733
227 Ga0075435_100199134 3300007076 Bacteria 1697
228 Ga0105240_10000995 3300009093 Bacteria 50634
229 Ga0105240_10001314 3300009093 Bacteria 42911
230 Ga0105240_10009806 3300009093 Bacteria 13518
231 Ga0105240_10013816 3300009093 Bacteria 11060
232 Ga0105240_10030890 3300009093 Bacteria 6958
233 Ga0105240_10112299 3300009093 Bacteria 3295
234 Ga0105240_10113191 3300009093 Unclassified 3279
235 Ga0105240_10200164 3300009093 Bacteria 2341
236 Ga0111539_10000002 3300009094 Bacteria 983359
237 Ga0111539_10015870 3300009094 Bacteria 9356
238 Ga0111539_10048997 3300009094 Bacteria 5041
239 Ga0105245_10018862 3300009098 Bacteria 6037
240 Ga0105247_10000150 3300009101 Bacteria 68542
241 Ga0105247_10001687 3300009101 Bacteria 15585
242 Ga0105247_10012121 3300009101 Bacteria 5183
243 Ga0114129_10000063 3300009147 Bacteria 96268
244 Ga0114129_10011672 3300009147 Bacteria 12503
245 Ga0114129_10019451 3300009147 Bacteria 9667
246 Ga0114129_10192637 3300009147 Bacteria 2767
247 Ga0114129_10293168 3300009147 Bacteria 2170
248 Ga0114129_10346072 3300009147 Bacteria 1970
249 Ga0105241_10039913 3300009174 Bacteria 3542
250 Ga0105241_10088657 3300009174 Bacteria 2436
251 Ga0105242_10000384 3300009176 Bacteria 35144
252 Ga0105242_10024301 3300009176 Bacteria 4784
253 Ga0105242_10066736 3300009176 Unclassified 2972
254 Ga0105242_10114816 3300009176 Bacteria 2301
255 Ga0105248_10018313 3300009177 Bacteria 7733
256 Ga0105248_10021309 3300009177 Bacteria 7183
257 Ga0105248_10096736 3300009177 Bacteria 3326
258 Ga0105248_10219800 3300009177 Bacteria 2139
259 Ga0105237_10000013 3300009545 Bacteria 297699
260 Ga0105237_10000044 3300009545 Bacteria 177828
261 Ga0105237_10002450 3300009545 Bacteria 23043
262 Ga0105237_10027347 3300009545 Bacteria 5823
263 Ga0105237_10206671 3300009545 Unclassified 1964
264 Ga0105238_10005655 3300009551 Bacteria 12354
265 Ga0105238_10011421 3300009551 Bacteria 8945
266 Ga0105238_10018450 3300009551 Bacteria 7100
267 Ga0105238_10018672 3300009551 Bacteria 7062
268 Ga0105238_10105531 3300009551 Unclassified 2799
269 Ga0105238_10148350 3300009551 Bacteria 2321
270 Ga0105238_10176834 3300009551 Bacteria 2111
271 Ga0105249_10030921 3300009553 Bacteria 4840
272 Ga0105249_10030956 3300009553 Unclassified 4838
273 Ga0105249_10101968 3300009553 Unclassified 2700
274 Ga0099796_10000823 3300010159 Bacteria 5653
275 Ga0105239_10052790 3300010375 Bacteria 4458
276 Ga0105239_10229965 3300010375 Bacteria 2080
277 Ga0105239_10328620 3300010375 Bacteria 1725
278 Ga0157373_10051729 3300013100 Unclassified 2925
279 Ga0157370_10005646 3300013104 Bacteria 13990
280 Ga0157370_10137974 3300013104 Unclassified 2272
281 Ga0157369_10214503 3300013105 Bacteria 2016
282 Ga0157374_10008063 3300013296 Bacteria 9006
283 Ga0157374_10015813 3300013296 Bacteria 6629
284 Ga0157374_10047894 3300013296 Bacteria 3964
285 Ga0157374_10141451 3300013296 Unclassified 2336
286 Ga0157378_10002033 3300013297 Bacteria 18118
287 Ga0157378_10016795 3300013297 Bacteria 6414
288 Ga0157378_10067266 3300013297 Bacteria 3210
289 Ga0163162_10015937 3300013306 Bacteria 7344
290 Ga0163162_10080932 3300013306 Bacteria 3317
291 Ga0157372_10077038 3300013307 Unclassified 3765
292 Ga0157375_10014390 3300013308 Bacteria 7056
293 Ga0157375_10018374 3300013308 Bacteria 6339
294 Ga0157375_10027917 3300013308 Bacteria 5281
295 Ga0157375_10107621 3300013308 Bacteria 2881
296 Ga0157375_10160521 3300013308 Unclassified 2389
297 Ga0157375_10278670 3300013308 Bacteria 1835
298 Ga0163163_10016495 3300014325 Bacteria 6868
299 Ga0163163_10052370 3300014325 Bacteria 4026
300 Ga0163163_10063626 3300014325 Bacteria 3658
301 Ga0163163_10067808 3300014325 Bacteria 3549
302 Ga0157380_10015453 3300014326 Bacteria 5611
303 Ga0157380_10033912 3300014326 Bacteria 3933
304 Ga0157380_10065110 3300014326 Bacteria 2928
305 Ga0157379_10032573 3300014968 Bacteria 4647
306 Ga0157379_10050280 3300014968 Bacteria 3721
307 Ga0157376_10039662 3300014969 Bacteria 3843
308 Ga0157376_10052165 3300014969 Bacteria 3399
309 Ga0157376_10141394 3300014969 Bacteria 2160
310 Ga0163161_10028574 3300017792 Bacteria 3961
311 Ga0163161_10092792 3300017792 Bacteria 2236
312 Ga0213875_10000028 3300021388 Bacteria 187813
313 Ga0213875_10004151 3300021388 Bacteria 8021
314 Ga0207692_10014851 3300025898 Bacteria 3412
315 Ga0207710_10000181 3300025900 Bacteria 63816
316 Ga0207710_10005863 3300025900 Bacteria 5268
317 Ga0207710_10019776 3300025900 Bacteria 2875
318 Ga0207680_10007549 3300025903 Bacteria 5312
319 Ga0207680_10008459 3300025903 Bacteria 5053
320 Ga0207680_10030688 3300025903 Bacteria 3036
321 Ga0207685_10000708 3300025905 Bacteria 6027
322 Ga0207699_10000056 3300025906 Bacteria 97208
323 Ga0207699_10003768 3300025906 Bacteria 7239
324 Ga0207645_10001962 3300025907 Bacteria 16550
325 Ga0207645_10023944 3300025907 Bacteria 3963
326 Ga0207645_10067345 3300025907 Bacteria 2289
327 Ga0207645_10102409 3300025907 Bacteria 1848
328 Ga0207643_10010972 3300025908 Bacteria 4888
329 Ga0207705_10002257 3300025909 Bacteria 14900
330 Ga0207705_10006510 3300025909 Bacteria 8654
331 Ga0207705_10006777 3300025909 Bacteria 8469
332 Ga0207707_10002766 3300025912 Bacteria 15638
333 Ga0207707_10003382 3300025912 Bacteria 14157
334 Ga0207707_10003871 3300025912 Bacteria 13279
335 Ga0207695_10006740 3300025913 Bacteria 14812
336 Ga0207695_10011497 3300025913 Bacteria 10714
337 Ga0207695_10020399 3300025913 Bacteria 7593
338 Ga0207695_10027837 3300025913 Bacteria 6284
339 Ga0207695_10080228 3300025913 Unclassified 3305
340 Ga0207695_10081333 3300025913 Unclassified 3278
341 Ga0207671_10000004 3300025914 Bacteria 1022356
342 Ga0207671_10000024 3300025914 Bacteria 274628
343 Ga0207671_10000819 3300025914 Bacteria 39379
344 Ga0207671_10061364 3300025914 Bacteria 2789
345 Ga0207693_10000385 3300025915 Bacteria 40463
346 Ga0207663_10055592 3300025916 Unclassified 2484
347 Ga0207663_10099267 3300025916 Bacteria 1951
348 Ga0207660_10027312 3300025917 Bacteria 3893
349 Ga0207660_10047569 3300025917 Unclassified 3033
350 Ga0207662_10003819 3300025918 Bacteria 7824
351 Ga0207662_10044681 3300025918 Bacteria 2616
352 Ga0207649_10012234 3300025920 Unclassified 4755
353 Ga0207652_10025697 3300025921 Bacteria 4898
354 Ga0207652_10037343 3300025921 Bacteria 4111
355 Ga0207652_10085502 3300025921 Bacteria 2764
356 Ga0207646_10067871 3300025922 Bacteria 3184
357 Ga0207646_10083960 3300025922 Bacteria 2849
358 Ga0207681_10004945 3300025923 Bacteria 8190
359 Ga0207681_10042660 3300025923 Bacteria 3031
360 Ga0207694_10012501 3300025924 Bacteria 6401
361 Ga0207694_10027566 3300025924 Bacteria 4327
362 Ga0207694_10088248 3300025924 Bacteria 2445
363 Ga0207694_10097497 3300025924 Bacteria 2326
364 Ga0207694_10165116 3300025924 Bacteria 1790
365 Ga0207694_10194253 3300025924 Unclassified 1650
366 Ga0207650_10132453 3300025925 Bacteria 1952
367 Ga0207659_10003748 3300025926 Bacteria 9163
368 Ga0207659_10081066 3300025926 Bacteria 2399
369 Ga0207659_10118434 3300025926 Bacteria 2025
370 Ga0207659_10284857 3300025926 Bacteria 1352
371 Ga0207700_10000880 3300025928 Bacteria 17286
372 Ga0207664_10085109 3300025929 Bacteria 2580
373 Ga0207644_10011875 3300025931 Bacteria 5772
374 Ga0207690_10047003 3300025932 Bacteria 2862
375 Ga0207690_10048286 3300025932 Bacteria 2829
376 Ga0207706_10070381 3300025933 Unclassified 3077
377 Ga0207670_10000008 3300025936 Bacteria 303208
378 Ga0207670_10000116 3300025936 Bacteria 54285
379 Ga0207670_10001594 3300025936 Bacteria 11831
380 Ga0207670_10019256 3300025936 Bacteria 4166
381 Ga0207670_10040474 3300025936 Bacteria 3059
382 Ga0207670_10050826 3300025936 Bacteria 2780
383 Ga0207670_10063066 3300025936 Bacteria 2534
384 Ga0207670_10100089 3300025936 Unclassified 2069
385 Ga0207704_10005027 3300025938 Bacteria 6082
386 Ga0207704_10041618 3300025938 Bacteria 2696
387 Ga0207704_10044082 3300025938 Bacteria 2640
388 Ga0207665_10046912 3300025939 Bacteria 2895
389 Ga0207691_10001300 3300025940 Bacteria 24914
390 Ga0207691_10005325 3300025940 Bacteria 12422
391 Ga0207691_10020171 3300025940 Bacteria 6305
392 Ga0207691_10027375 3300025940 Bacteria 5344
393 Ga0207691_10033701 3300025940 Bacteria 4768
394 Ga0207691_10057135 3300025940 Bacteria 3552
395 Ga0207691_10066241 3300025940 Bacteria 3268
396 Ga0207711_10023614 3300025941 Bacteria 5148
397 Ga0207661_10029288 3300025944 Bacteria 4227
398 Ga0207661_10141664 3300025944 Bacteria 2070
399 Ga0207661_10260705 3300025944 Bacteria 1544
400 Ga0207679_10046596 3300025945 Unclassified 3143
401 Ga0207667_10008172 3300025949 Bacteria 12451
402 Ga0207667_10052633 3300025949 Unclassified 4286
403 Ga0207667_10059829 3300025949 Bacteria 3988
404 Ga0207667_10120503 3300025949 Bacteria 2703
405 Ga0207667_10167494 3300025949 Bacteria 2259
406 Ga0207651_10000563 3300025960 Bacteria 15626
407 Ga0207651_10045531 3300025960 Bacteria 2944
408 Ga0207712_10026466 3300025961 Bacteria 3865
409 Ga0207668_10021824 3300025972 Bacteria 4088
410 Ga0207658_10018140 3300025986 Bacteria 4854
411 Ga0207658_10029385 3300025986 Bacteria 3882
412 Ga0207658_10109191 3300025986 Bacteria 2183
413 Ga0207658_10171140 3300025986 Unclassified 1789
414 Ga0207677_10119258 3300026023 Bacteria 1981
415 Ga0207703_10001369 3300026035 Bacteria 22262
416 Ga0207703_10069415 3300026035 Unclassified 2906
417 Ga0207639_10001254 3300026041 Bacteria 17195
418 Ga0207639_10008284 3300026041 Bacteria 7122
419 Ga0207639_10186678 3300026041 Unclassified 1768
420 Ga0207678_10072496 3300026067 Bacteria 2951
421 Ga0207708_10001158 3300026075 Bacteria 19848
422 Ga0207708_10024076 3300026075 Bacteria 4604
423 Ga0207708_10032461 3300026075 Bacteria 3965
424 Ga0207708_10155118 3300026075 Bacteria 1805
425 Ga0207702_10023308 3300026078 Bacteria 5133
426 Ga0207641_10004304 3300026088 Bacteria 12364
427 Ga0207641_10005080 3300026088 Bacteria 11280
428 Ga0207641_10020076 3300026088 Bacteria 5485
429 Ga0207641_10081795 3300026088 Bacteria 2805
430 Ga0207641_10097037 3300026088 Bacteria 2590
431 Ga0207641_10138077 3300026088 Bacteria 2196
432 Ga0207648_10006109 3300026089 Bacteria 12008
433 Ga0207648_10075705 3300026089 Bacteria 2934
434 Ga0207676_10008791 3300026095 Bacteria 7186
435 Ga0207676_10011343 3300026095 Bacteria 6371
436 Ga0207676_10035512 3300026095 Bacteria 3784
437 Ga0207676_10075547 3300026095 Bacteria 2719
438 Ga0207674_10011030 3300026116 Bacteria 10163
439 Ga0207674_10076534 3300026116 Bacteria 3354
440 Ga0207674_10130534 3300026116 Bacteria 2476
441 Ga0207675_100004447 3300026118 Bacteria 13547
442 Ga0207675_100019540 3300026118 Bacteria 6323
443 Ga0207675_100020653 3300026118 Bacteria 6138
444 Ga0207675_100066235 3300026118 Bacteria 3376
445 Ga0207675_100073431 3300026118 Bacteria 3201
446 Ga0207675_100116003 3300026118 Bacteria 2531
447 Ga0207675_100300512 3300026118 Bacteria 1563
448 Ga0207683_10005289 3300026121 Bacteria 11074
449 Ga0207683_10018751 3300026121 Bacteria 5903
450 Ga0207683_10027464 3300026121 Unclassified 4918
451 Ga0207698_10136682 3300026142 Bacteria 2104
452 Ga0207428_10000004 3300027907 Bacteria 727800
453 Ga0207428_10000918 3300027907 Bacteria 32957
454 Ga0268266_10000524 3300028379 Bacteria 53682
455 Ga0268266_10004397 3300028379 Bacteria 13505
456 Ga0268266_10035411 3300028379 Bacteria 4246
457 Ga0268265_10011774 3300028380 Bacteria 5914
458 Ga0268265_10055381 3300028380 Bacteria 3013
459 Ga0268264_10006697 3300028381 Bacteria 9684
460 Ga0268264_10008827 3300028381 Bacteria 8357
461 Ga0268264_10012411 3300028381 Bacteria 7013
462 Ga0268264_10051426 3300028381 Bacteria 3433
463 Ga0268264_10086895 3300028381 Bacteria 2688
464 Ga0268264_10148356 3300028381 Bacteria 2100
465 Ga0265319_1028733 3300028563 Bacteria 1958
466 Ga0265334_10024405 3300028573 Unclassified 2452
467 Ga0265318_10000085 3300028577 Bacteria 84720
468 Ga0265318_10000119 3300028577 Bacteria 72544
469 Ga0265336_10002471 3300028666 Bacteria 7589
470 Ga0307515_10000005 3300028794 Bacteria 758563
471 Ga0307515_10198752 3300028794 Bacteria 1888
472 Ga0265338_10016615 3300028800 Bacteria 7986
473 Ga0265338_10068245 3300028800 Bacteria 3065
474 Ga0307511_10000310 3300030521 Bacteria 51837
475 Ga0265330_10000058 3300031235 Bacteria 98884
476 Ga0265330_10000610 3300031235 Bacteria 23174
477 Ga0265332_10000105 3300031238 Bacteria 71116
478 Ga0265332_10013465 3300031238 Bacteria 3624
479 Ga0265328_10000179 3300031239 Bacteria 29488
480 Ga0265328_10000560 3300031239 Bacteria 17288
481 Ga0265320_10000025 3300031240 Bacteria 168565
482 Ga0265320_10000538 3300031240 Bacteria 29308
483 Ga0265320_10002141 3300031240 Bacteria 13857
484 Ga0265320_10030797 3300031240 Bacteria 2762
485 Ga0265325_10041473 3300031241 Bacteria 2412
486 Ga0265329_10000203 3300031242 Bacteria 30873
487 Ga0265329_10010576 3300031242 Bacteria 3379
488 Ga0265340_10061271 3300031247 Bacteria 1800
489 Ga0265339_10002553 3300031249 Bacteria 12982
490 Ga0265339_10013709 3300031249 Bacteria 4907
491 Ga0265339_10022112 3300031249 Bacteria 3688
492 Ga0265331_10000063 3300031250 Bacteria 166922
493 Ga0265331_10000531 3300031250 Bacteria 35033
494 Ga0265331_10002531 3300031250 Bacteria 12310
495 Ga0265316_10001697 3300031344 Bacteria 23362
496 Ga0265316_10147148 3300031344 Bacteria 1766
497 Ga0307513_10067024 3300031456 Bacteria 3769
498 Ga0307509_10000017 3300031507 Bacteria 265012
499 Ga0307408_100256556 3300031548 Unclassified 1445
500 Ga0265313_10000085 3300031595 Bacteria 91819
501 Ga0265313_10008445 3300031595 Bacteria 6836
502 Ga0307508_10187525 3300031616 Unclassified 1670
503 Ga0265314_10000057 3300031711 Bacteria 167860
504 Ga0265314_10001585 3300031711 Bacteria 25020
505 Ga0265314_10003605 3300031711 Bacteria 14895
506 Ga0265342_10000165 3300031712 Bacteria 74061
507 Ga0265342_10001074 3300031712 Bacteria 26551
508 Ga0265342_10002331 3300031712 Bacteria 16493
509 Ga0265342_10007332 3300031712 Bacteria 8093
510 Ga0316576_10001484 3300031727 Bacteria 12634
511 Ga0307405_10001448 3300031731 Bacteria 9996
512 Ga0307405_10017538 3300031731 Bacteria 3931
513 Ga0307407_10041050 3300031903 Bacteria 2585
514 Ga0307412_10006752 3300031911 Bacteria 6507
515 Ga0307412_10038406 3300031911 Bacteria 3083
516 Ga0307510_10000002 3300033180 Bacteria 801565
517 Ga0307510_10066594 3300033180 Unclassified 3635
518 Ga0373950_0000001 3300034818 Bacteria 1001987
519 Ga0373950_0000052 3300034818 Bacteria 83086
520 Ga0373936_0012241 3300035113 Bacteria 3261
521 Ga0373936_0050415 3300035113 Bacteria 1683
522 Ga0373956_0020807 3300035119 Unclassified 2796
523 Ga0373942_0016965 3300035207 Bacteria 1791
524 Ga0373961_0000214 3300035241 Bacteria 27320
525 Ga0316574_0000061 3300035398 Bacteria 28446
526 Ga0373935_0002307 3300035692 Bacteria 10884
527 Ga0373927_0006569 3300035695 Bacteria 7921
528 Ga0373933_0000343 3300035724 Bacteria 29930
529 Ga0373947_0144572 3300035725 Bacteria 1528
530 Ga0373937_0000940 3300036401 Bacteria 24739
531 Ga0373937_0103020 3300036401 Bacteria 2650
532 Ga0373937_0144432 3300036401 Bacteria 2227
533 Ga0373937_0351583 3300036401 Bacteria 1396
534 Ga0316584_0077066 3300036712 Bacteria 2498
535 Ga0373925_0010251 3300037068 Bacteria 6799
536 Ga0395900_0043396 3300037418 Bacteria 4635
537 Ga0395905_0002051 3300037471 Bacteria 22993
538 Ga0395905_0172631 3300037471 Bacteria 2031
539 Ga0436364_0302973 3300037853 Bacteria 187060
540 Ga0436364_1228372 3300037853 Bacteria 25658
541 Ga0436365_1832854 3300039437 Bacteria 1619
542 Ga0451802_0881020 3300041460 Bacteria 2521
543 Ga0451802_1847778 3300041460 Bacteria 1946
544 Ga0450908_000989 3300042184 Bacteria 5501
545 Ga0450918_010308 3300042531 Bacteria 1633
546 Ga0451577_0003642 3300042876 Bacteria 16927
547 Ga0466963_0030991 3300044694 Bacteria 3454
548 Ga0453684_0064993 3300044712 Bacteria 4655
549 Ga0453684_0219144 3300044712 Bacteria 2206
550 Ga0451576_0013633 3300045051 Bacteria 9085
551 Ga0451576_0022133 3300045051 Bacteria 6897
552 Ga0451576_0023079 3300045051 Bacteria 6741
553 Ga0451576_0032546 3300045051 Bacteria 5550
554 Ga0451576_0074772 3300045051 Bacteria 3525
555 Ga0451576_0168255 3300045051 Bacteria 2287
556 Ga0451576_0177401 3300045051 Bacteria 2225
557 Ga0495592_0009397 3300046454 Bacteria 7354
558 Ga0495629_0041826 3300046459 Bacteria 3222
559 Ga0495653_0039719 3300046463 Bacteria 3685
560 Ga0495580_0004499 3300046472 Bacteria 11707
561 Ga0495639_0043044 3300046475 Bacteria 2039
562 Ga0495639_0055779 3300046475 Unclassified 1803
563 Ga0495584_0029448 3300046491 Bacteria 2782
564 Ga0495594_0025797 3300046499 Bacteria 3159
565 Ga0495608_0002154 3300046511 Bacteria 14199
566 Ga0495618_0001809 3300046514 Bacteria 14152
567 Ga0495628_0005733 3300046516 Bacteria 10878
568 Ga0495628_0105948 3300046516 Bacteria 2166
569 Ga0495628_0112744 3300046516 Bacteria 2090
570 Ga0495642_0011729 3300046528 Bacteria 3374
571 Ga0495586_0011877 3300046535 Bacteria 4628
572 Ga0495586_0045746 3300046535 Bacteria 2359
573 Ga0495587_0003920 3300046536 Bacteria 9876
574 Ga0495598_0008134 3300046537 Bacteria 2432
575 Ga0495609_0049110 3300046538 Bacteria 1884
576 Ga0495621_0025942 3300046539 Bacteria 1973
577 Ga0495634_0002995 3300046642 Bacteria 13760
578 Ga0495634_0099741 3300046642 Bacteria 1878
579 Ga0495659_0006274 3300046664 Bacteria 3757
580 Ga0495659_0039751 3300046664 Bacteria 1673
581 Ga0495599_0053136 3300046678 Bacteria 2538
582 Ga0495599_0066224 3300046678 Bacteria 2257
583 Ga0495658_0006238 3300046683 Bacteria 5858
584 Ga0495658_0046072 3300046683 Bacteria 2450
585 Ga0495658_0122064 3300046683 Bacteria 1577
586 Ga0495669_0007780 3300046684 Bacteria 4499
587 Ga0495670_0035240 3300046691 Bacteria 2494
588 Ga0495636_0005852 3300047318 Bacteria 4823
589 Ga0495636_0060920 3300047318 Bacteria 1595
590 Ga0495674_0003540 3300047319 Bacteria 15198
591 Ga0495680_0185783 3300047322 Bacteria 1497
592 Ga0495684_0162899 3300047471 Bacteria 1663
593 Ga0495684_0206329 3300047471 Bacteria 1447
594 Ga0496100_0064832 3300048903 Bacteria 2419
595 Ga0496101_0002467 3300048904 Bacteria 11361
596 Ga0496102_0007729 3300048905 Bacteria 9186
597 Ga0496104_0041137 3300048907 Bacteria 4332
598 Ga0496105_0154839 3300048908 Bacteria 1883
599 Ga0496106_0004490 3300048909 Bacteria 10347
600 Ga0496107_0100273 3300048910 Bacteria 2123
601 Ga0496108_0036334 3300048911 Bacteria 4099
602 Ga0496109_0012647 3300048912 Bacteria 7290
603 Ga0496109_0310856 3300048912 Unclassified 1487
604 Ga0496111_0001145 3300048914 Bacteria 14715
605 Ga0496112_0009020 3300048915 Bacteria 8956
606 Ga0496112_0050813 3300048915 Bacteria 4066
607 Ga0496113_0069692 3300048916 Bacteria 2671
608 Ga0496114_0000001 3300048917 Bacteria 893286
609 Ga0496114_0002936 3300048917 Bacteria 13074
610 Ga0496114_0009778 3300048917 Bacteria 7618
611 Ga0496114_0019959 3300048917 Bacteria 5437
612 Ga0496115_0003856 3300048918 Bacteria 10812
613 Ga0496115_0049582 3300048918 Unclassified 3361
614 Ga0496116_0002908 3300048919 Bacteria 17496
615 Ga0496117_0000140 3300048920 Bacteria 158390
616 Ga0496118_0000102 3300048921 Bacteria 158228
617 Ga0496121_0084690 3300048924 Unclassified 2498
618 Ga0496125_0035666 3300048928 Bacteria 4357
619 Ga0496126_0044577 3300048929 Bacteria 4083
620 Ga0501031_0055898 3300049568 Bacteria 2572
621 Ga0501032_0127235 3300049569 Bacteria 1682
622 Ga0501033_0013229 3300049570 Bacteria 6288
623 Ga0501034_0000025 3300049571 Bacteria 262496
624 Ga0501036_0002221 3300049572 Bacteria 15170
625 Ga0501036_0005057 3300049572 Bacteria 10676
626 Ga0501036_0024333 3300049572 Bacteria 5105
627 Ga0501036_0074186 3300049572 Bacteria 2877
628 Ga0501037_0046548 3300049573 Bacteria 3181
629 Ga0501038_0100861 3300049574 Bacteria 2404
630 Ga0501038_0139954 3300049574 Bacteria 1980
631 Ga0501039_0000810 3300049575 Bacteria 22551
632 Ga0501040_0004684 3300049576 Bacteria 8875
633 Ga0501040_0010830 3300049576 Bacteria 5961
634 Ga0501040_0058598 3300049576 Bacteria 2645
635 Ga0501041_0000218 3300049577 Bacteria 26770
636 Ga0501041_0085940 3300049577 Bacteria 1940
637 Ga0501042_0009188 3300049578 Bacteria 6575
638 Ga0501043_0192086 3300049579 Bacteria 1587
639 Ga0501046_0003342 3300049580 Bacteria 14738
640 Ga0501046_0032270 3300049580 Bacteria 4241
641 Ga0501046_0055562 3300049580 Bacteria 3110
642 Ga0501047_0000011 3300049581 Bacteria 409778
643 Ga0501047_0000583 3300049581 Bacteria 38792
644 Ga0501048_0004448 3300049582 Bacteria 10674
645 Ga0501067_0001265 3300049583 Bacteria 13739
646 Ga0501067_0017113 3300049583 Bacteria 4005
647 Ga0501067_0031230 3300049583 Bacteria 2955
648 Ga0501068_0004183 3300049584 Bacteria 7828
649 Ga0501068_0016213 3300049584 Bacteria 4294
650 Ga0501068_0052130 3300049584 Bacteria 2475
651 Ga0501069_0010962 3300049585 Bacteria 4806
652 Ga0501069_0031209 3300049585 Bacteria 2929
653 Ga0501070_0000022 3300049586 Bacteria 165335
654 Ga0501070_0053175 3300049586 Bacteria 3360
655 Ga0501070_0099645 3300049586 Bacteria 2404
656 Ga0501070_0120125 3300049586 Bacteria 2172
657 Ga0501071_0017929 3300049587 Bacteria 4895
658 Ga0501071_0018123 3300049587 Bacteria 4869
659 Ga0501071_0029622 3300049587 Bacteria 3865
660 Ga0501072_0000031 3300049588 Bacteria 128377
661 Ga0501072_0000055 3300049588 Bacteria 83678
662 Ga0501072_0000330 3300049588 Bacteria 33764
663 Ga0501073_0000074 3300049589 Bacteria 62368
664 Ga0501073_0000642 3300049589 Bacteria 24540
665 Ga0501073_0001482 3300049589 Bacteria 17394
666 Ga0501073_0003808 3300049589 Bacteria 11327
667 Ga0501073_0008399 3300049589 Bacteria 7661
668 Ga0501073_0014783 3300049589 Bacteria 5668
669 Ga0501073_0030354 3300049589 Bacteria 3859
670 Ga0501073_0049424 3300049589 Bacteria 2949
671 Ga0501074_0001544 3300049590 Bacteria 15560
672 Ga0501074_0007873 3300049590 Bacteria 7719
673 Ga0501074_0016903 3300049590 Bacteria 5293
674 Ga0501074_0051924 3300049590 Bacteria 2959
675 Ga0501075_0001127 3300049591 Bacteria 17220
676 Ga0501076_0009540 3300049592 Bacteria 7164
677 Ga0501076_0058390 3300049592 Bacteria 3066
678 Ga0501076_0075723 3300049592 Bacteria 2698
679 Ga0501077_0000047 3300049593 Bacteria 62227
680 Ga0501077_0000920 3300049593 Bacteria 17688
681 Ga0501077_0009278 3300049593 Bacteria 6109
682 Ga0501077_0069025 3300049593 Bacteria 2240
683 Ga0501079_0000469 3300049741 Bacteria 26625
684 Ga0501079_0000621 3300049741 Bacteria 23559
685 Ga0501079_0001246 3300049741 Bacteria 17853
686 Ga0501079_0036603 3300049741 Bacteria 3781
687 Ga0501080_0001908 3300049742 Bacteria 17967
688 Ga0501080_0006598 3300049742 Bacteria 10428
689 Ga0501080_0009121 3300049742 Bacteria 9031
690 Ga0501080_0011771 3300049742 Bacteria 8019
691 Ga0501080_0012753 3300049742 Bacteria 7709
692 Ga0501081_0160653 3300049743 Bacteria 1619
693 Ga0501083_0000271 3300049744 Bacteria 33188
694 Ga0501083_0003685 3300049744 Bacteria 10762
695 Ga0501083_0006104 3300049744 Bacteria 8539
696 Ga0501083_0031993 3300049744 Bacteria 3609
697 Ga0501083_0046139 3300049744 Bacteria 2947
698 Ga0501272_000363 3300049769 Bacteria 3991
699 Ga0501035_0006537 3300049822 Bacteria 10941
700 Ga0501035_0097951 3300049822 Bacteria 2575
701 Ga0501044_0005594 3300049823 Bacteria 13951
702 Ga0501045_0000097 3300049824 Bacteria 42924
703 Ga0501045_0019438 3300049824 Bacteria 4843
704 nmdc:mga03n38_60726_c1 3300050490 Bacteria 1719
705 nmdc:mga0k408_3149_c1 3300050493 Bacteria 8746
706 nmdc:mga0k408_47510_c1 3300050493 Bacteria 2481
707 nmdc:mga0k408_70873_c1 3300050493 Unclassified 2034
708 nmdc:mga07m45_53203_c1 3300050496 Bacteria 2287
709 nmdc:mga05p37_112227_c1 3300050507 Bacteria 3352
710 nmdc:mga05p37_120406_c1 3300050507 Bacteria 3225
711 nmdc:mga05p37_63876_c1 3300050507 Bacteria 4531
712 nmdc:mga05p37_6678_c1 3300050507 Bacteria 13605
713 nmdc:mga05p37_72929_c1 3300050507 Bacteria 4225
714 nmdc:mga05p37_7655_c1 3300050507 Bacteria 12743
715 nmdc:mga09592_143054_c1 3300050508 Bacteria 2062
716 nmdc:mga09592_30561_c1 3300050508 Bacteria 4483
717 nmdc:mga09592_39831_c1 3300050508 Bacteria 3947
718 nmdc:mga09592_4066_c1 3300050508 Bacteria 11819
719 nmdc:mga0qj67_8957_c1 3300050509 Bacteria 7423
720 nmdc:mga06r32_2141_c1 3300050510 Bacteria 17647
721 nmdc:mga08y16_12696_c1 3300050511 Bacteria 8863
722 nmdc:mga08y16_2_c1 3300050511 Bacteria 983367
723 nmdc:mga08y16_33119_c1 3300050511 Bacteria 5428
724 nmdc:mga08y16_7830_c1 3300050511 Bacteria 11191
725 nmdc:mga0n895_135584_c1 3300050512 Unclassified 2488
726 nmdc:mga0n895_148157_c1 3300050512 Bacteria 2376
727 nmdc:mga0n895_174881_c1 3300050512 Bacteria 2178
728 nmdc:mga0n895_1915_c1 3300050512 Bacteria 15950
729 nmdc:mga0n895_26169_c1 3300050512 Bacteria 5521
730 nmdc:mga0rr50_143357_c1 3300050513 Bacteria 1924
731 nmdc:mga0rr50_197212_c1 3300050513 Bacteria 1653
732 nmdc:mga0rr50_47621_c1 3300050513 Bacteria 3164
733 nmdc:mga08x19_2167_c1 3300050514 Bacteria 12003
734 nmdc:mga08x19_89365_c1 3300050514 Bacteria 2031
735 nmdc:mga0a205_2094_c2 3300050515 Unclassified 3907
736 Ga0495601_0085150 3300053077 Bacteria 2031
737 Ga0495619_0054765 3300053085 Bacteria 2641
738 Ga0500641_0000690 3300053096 Bacteria 12210
739 Ga0500555_000387 3300053103 Bacteria 18508
740 Ga0500637_0081194 3300053178 Bacteria 1873
741 Ga0500645_000365 3300053730 Bacteria 32071
742 Ga0501084_0000050 3300054114 Bacteria 92878
743 Ga0501084_0000070 3300054114 Bacteria 77654
744 Ga0501084_0005147 3300054114 Bacteria 10703
745 Ga0501084_0017200 3300054114 Bacteria 6007
746 Ga0501082_0000238 3300060353 Bacteria 48210
747 Ga0501082_0001812 3300060353 Bacteria 18813
748 Ga0501082_0005418 3300060353 Bacteria 11074
749 Ga0501082_0009363 3300060353 Bacteria 8441
750 Ga0501082_0013228 3300060353 Bacteria 7097
751 Ga0501082_0020203 3300060353 Bacteria 5739
752 Ga0501082_0043214 3300060353 Bacteria 3885
753 Ga0501082_0066985 3300060353 Unclassified 3092
754 Ga0530510_0043942 3300061734 Bacteria 3228
755 Ga0530510_0084539 3300061734 Bacteria 2311
756 Ga0500616_0000204
757 rootH1_10050541
758 Ga0065704_10002507
759 Ga0065715_10015077
760 Ga0065707_10002498
761 Ga0070658_10001502
762 Ga0070658_10008043
763 Ga0070658_10014962
764 Ga0070658_10178888
765 Ga0070676_10002848
766 Ga0070676_10017606
767 Ga0070676_10119406
768 Ga0070676_10124977
769 Ga0070683_100051531
770 Ga0070683_100061279
771 Ga0070683_100089296
772 Ga0070690_100003119
773 Ga0070690_100010799
774 Ga0070690_100018746
775 Ga0070690_100019068
776 Ga0070690_100078788
777 Ga0070670_100017844
778 Ga0070670_100137269
779 Ga0070670_100238016
780 Ga0070666_10015159
781 Ga0070666_10040910
782 Ga0070666_10061440
783 Ga0070666_10120327
784 Ga0070680_100002053
785 Ga0070680_100004832
786 Ga0070680_100088046
787 Ga0070680_100164773
788 Ga0068868_100006472
789 Ga0068868_100023884
790 Ga0068868_100078592
791 Ga0068868_100180540
792 Ga0070660_100201291
793 Ga0070689_100000015
794 Ga0070689_100005560
795 Ga0070689_100009154
796 Ga0070689_100014571
797 Ga0070689_100023875
798 Ga0070689_100063574
799 Ga0070689_100134666
800 Ga0070687_100003229
801 Ga0070661_100040619
802 Ga0070668_100046936
803 Ga0070669_100003184
804 Ga0070669_100006943
805 Ga0070669_100080876
806 Ga0070675_100008559
807 Ga0070675_100027213
808 Ga0070675_100155904
809 Ga0070671_100006515
810 Ga0070671_100048055
811 Ga0070671_100061608
812 Ga0070671_100109618
813 Ga0070674_100013787
814 Ga0070674_100071158
815 Ga0070673_100003963
816 Ga0070673_100029461
817 Ga0070688_100002244
818 Ga0070688_100101776
819 Ga0070688_100108970
820 Ga0070659_100053100
821 Ga0070667_100005556
822 Ga0070667_100044370
823 Ga0070709_10000047
824 Ga0070714_100086100
825 Ga0070713_100006106
826 Ga0070701_10006307
827 Ga0070701_10017361
828 Ga0070711_100015495
829 Ga0070705_100005687
830 Ga0070700_100013087
831 Ga0070694_100003107
832 Ga0070694_100010145
833 Ga0070678_100001136
834 Ga0070678_100103496
835 Ga0070662_100054340
836 Ga0070662_100059486
837 Ga0070681_10002868
838 Ga0070681_10002897
839 Ga0070681_10032836
840 Ga0068867_100027784
841 Ga0070685_10002729
842 Ga0070685_10030664
843 Ga0070707_100028306
844 Ga0070707_100175792
845 Ga0070698_100002282
846 Ga0070698_100006038
847 Ga0070698_100134573
848 Ga0070698_100140555
849 Ga0070699_100000763
850 Ga0070699_100004119
851 Ga0070699_100031167
852 Ga0070699_100080099
853 Ga0070679_100004061
854 Ga0070679_100005972
855 Ga0070679_100024463
856 Ga0070679_100055976
857 Ga0070679_100074372
858 Ga0070679_100101842
859 Ga0070684_100024485
860 Ga0070684_100164958
861 Ga0070697_100050865
862 Ga0070697_100087387
863 Ga0068853_100001470
864 Ga0068853_100002336
865 Ga0068853_100002532
866 Ga0068853_100159670
867 Ga0070672_100000669
868 Ga0070672_100005776
869 Ga0070672_100017690
870 Ga0070672_100018021
871 Ga0070672_100024131
872 Ga0070686_100009848
873 Ga0070686_100110991
874 Ga0070695_100000165
875 Ga0070695_100042891
876 Ga0070696_100000299
877 Ga0070696_100002781
878 Ga0070696_100026257
879 Ga0070696_100054744
880 Ga0070693_100084563
881 Ga0070665_100000260
882 Ga0070665_100008165
883 Ga0070665_100023755
884 Ga0070665_100071031
885 Ga0070665_100080522
886 Ga0070704_100002093
887 Ga0070704_100012601
888 Ga0070704_100034592
889 Ga0068855_100001126
890 Ga0068855_100001559
891 Ga0068855_100006115
892 Ga0068855_100008548
893 Ga0068855_100020637
894 Ga0068855_100037427
895 Ga0068855_100038866
896 Ga0068855_100050061
897 Ga0068855_100084644
898 Ga0068855_100136545
899 Ga0070664_100005673
900 Ga0070664_100043922
901 Ga0070664_100071377
902 Ga0070664_100123647
903 Ga0068857_100018996
904 Ga0068856_100007009
905 Ga0068856_100021956
906 Ga0068856_100057710
907 Ga0068856_100085709
908 Ga0068856_100242413
909 Ga0070702_100015598
910 Ga0070702_100056815
911 Ga0068852_100091856
912 Ga0068852_100125197
913 Ga0068859_100000351
914 Ga0068859_100000928
915 Ga0068859_100003334
916 Ga0068859_100051668
917 Ga0068859_100056860
918 Ga0068859_100111494
919 Ga0068864_100043398
920 Ga0068864_100067834
921 Ga0068861_100054566
922 Ga0068863_100001670
923 Ga0068863_100012408
924 Ga0068863_100016086
925 Ga0068863_100039185
926 Ga0068863_100082719
927 Ga0068863_100347531
928 Ga0068858_100006466
929 Ga0068858_100010999
930 Ga0068858_100029932
931 Ga0068858_100039437
932 Ga0068858_100117982
933 Ga0068860_100000731
934 Ga0068860_100007945
935 Ga0068860_100040768
936 Ga0068860_100062100
937 Ga0068860_100140801
938 Ga0068860_100160122
939 Ga0068860_100194698
940 Ga0068860_100221245
941 Ga0068862_100004001
942 Ga0068862_100006668
943 Ga0068862_100058576
944 Ga0068862_100066020
945 Ga0070717_10075487
946 Ga0070715_10000168
947 Ga0070715_10016575
948 Ga0070715_10034067
949 Ga0070716_100008972
950 Ga0070712_100001910
951 Ga0075367_10012764
952 Ga0075366_10006277
953 Ga0097621_100036189
954 Ga0097621_100188098
955 Ga0068871_100068257
956 Ga0068871_100076048
957 Ga0075428_100000115
958 Ga0075433_10020643
959 Ga0075434_100006213
960 Ga0075434_100015024
961 Ga0075434_100027595
962 Ga0075434_100051931
963 Ga0075434_100082272
964 Ga0075434_100131017
965 Ga0075429_100000186
966 Ga0075429_100039240
967 Ga0075429_100046293
968 Ga0068865_100015529
969 Ga0068865_100030682
970 Ga0068865_100145630
971 Ga0075436_100015596
972 Ga0075436_100021475
973 Ga0075436_100080867
974 Ga0097620_100000351
975 Ga0097620_100000928
976 Ga0097620_100003334
977 Ga0097620_100051674
978 Ga0097620_100056861
979 Ga0097620_100111494
980 Ga0075435_100040210
981 Ga0075435_100199134
982 Ga0105240_10000995
983 Ga0105240_10001314
984 Ga0105240_10009806
985 Ga0105240_10013816
986 Ga0105240_10030890
987 Ga0105240_10112299
988 Ga0105240_10113191
989 Ga0105240_10200164
990 Ga0111539_10000002
991 Ga0111539_10015870
992 Ga0111539_10048997
993 Ga0105245_10018862
994 Ga0105247_10000150
995 Ga0105247_10001687
996 Ga0105247_10012121
997 Ga0114129_10000063
998 Ga0114129_10011672
999 Ga0114129_10019451
1000 Ga0114129_10192637
1001 Ga0114129_10293168
1002 Ga0114129_10346072
1003 Ga0105241_10039913
1004 Ga0105241_10088657
1005 Ga0105242_10000384
1006 Ga0105242_10024301
1007 Ga0105242_10066736
1008 Ga0105242_10114816
1009 Ga0105248_10018313
1010 Ga0105248_10021309
1011 Ga0105248_10096736
1012 Ga0105248_10219800
1013 Ga0105237_10000013
1014 Ga0105237_10000044
1015 Ga0105237_10002450
1016 Ga0105237_10027347
1017 Ga0105237_10206671
1018 Ga0105238_10005655
1019 Ga0105238_10011421
1020 Ga0105238_10018450
1021 Ga0105238_10018672
1022 Ga0105238_10105531
1023 Ga0105238_10148350
1024 Ga0105238_10176834
1025 Ga0105249_10030921
1026 Ga0105249_10030956
1027 Ga0105249_10101968
1028 Ga0099796_10000823
1029 Ga0105239_10052790
1030 Ga0105239_10229965
1031 Ga0105239_10328620
1032 Ga0157373_10051729
1033 Ga0157370_10005646
1034 Ga0157370_10137974
1035 Ga0157369_10214503
1036 Ga0157374_10008063
1037 Ga0157374_10015813
1038 Ga0157374_10047894
1039 Ga0157374_10141451
1040 Ga0157378_10002033
1041 Ga0157378_10016795
1042 Ga0157378_10067266
1043 Ga0163162_10015937
1044 Ga0163162_10080932
1045 Ga0157372_10077038
1046 Ga0157375_10014390
1047 Ga0157375_10018374
1048 Ga0157375_10027917
1049 Ga0157375_10107621
1050 Ga0157375_10160521
1051 Ga0157375_10278670
1052 Ga0163163_10016495
1053 Ga0163163_10052370
1054 Ga0163163_10063626
1055 Ga0163163_10067808
1056 Ga0157380_10015453
1057 Ga0157380_10033912
1058 Ga0157380_10065110
1059 Ga0157379_10032573
1060 Ga0157379_10050280
1061 Ga0157376_10039662
1062 Ga0157376_10052165
1063 Ga0157376_10141394
1064 Ga0163161_10028574
1065 Ga0163161_10092792
1066 Ga0213875_10000028
1067 Ga0213875_10004151
1068 Ga0207692_10014851
1069 Ga0207710_10000181
1070 Ga0207710_10005863
1071 Ga0207710_10019776
1072 Ga0207680_10007549
1073 Ga0207680_10008459
1074 Ga0207680_10030688
1075 Ga0207685_10000708
1076 Ga0207699_10000056
1077 Ga0207699_10003768
1078 Ga0207645_10001962
1079 Ga0207645_10023944
1080 Ga0207645_10067345
1081 Ga0207645_10102409
1082 Ga0207643_10010972
1083 Ga0207705_10002257
1084 Ga0207705_10006510
1085 Ga0207705_10006777
1086 Ga0207707_10002766
1087 Ga0207707_10003382
1088 Ga0207707_10003871
1089 Ga0207695_10006740
1090 Ga0207695_10011497
1091 Ga0207695_10020399
1092 Ga0207695_10027837
1093 Ga0207695_10080228
1094 Ga0207695_10081333
1095 Ga0207671_10000004
1096 Ga0207671_10000024
1097 Ga0207671_10000819
1098 Ga0207671_10061364
1099 Ga0207693_10000385
1100 Ga0207663_10055592
1101 Ga0207663_10099267
1102 Ga0207660_10027312
1103 Ga0207660_10047569
1104 Ga0207662_10003819
1105 Ga0207662_10044681
1106 Ga0207649_10012234
1107 Ga0207652_10025697
1108 Ga0207652_10037343
1109 Ga0207652_10085502
1110 Ga0207646_10067871
1111 Ga0207646_10083960
1112 Ga0207681_10004945
1113 Ga0207681_10042660
1114 Ga0207694_10012501
1115 Ga0207694_10027566
1116 Ga0207694_10088248
1117 Ga0207694_10097497
1118 Ga0207694_10165116
1119 Ga0207694_10194253
1120 Ga0207650_10132453
1121 Ga0207659_10003748
1122 Ga0207659_10081066
1123 Ga0207659_10118434
1124 Ga0207659_10284857
1125 Ga0207700_10000880
1126 Ga0207664_10085109
1127 Ga0207644_10011875
1128 Ga0207690_10047003
1129 Ga0207690_10048286
1130 Ga0207706_10070381
1131 Ga0207670_10000008
1132 Ga0207670_10000116
1133 Ga0207670_10001594
1134 Ga0207670_10019256
1135 Ga0207670_10040474
1136 Ga0207670_10050826
1137 Ga0207670_10063066
1138 Ga0207670_10100089
1139 Ga0207704_10005027
1140 Ga0207704_10041618
1141 Ga0207704_10044082
1142 Ga0207665_10046912
1143 Ga0207691_10001300
1144 Ga0207691_10005325
1145 Ga0207691_10020171
1146 Ga0207691_10027375
1147 Ga0207691_10033701
1148 Ga0207691_10057135
1149 Ga0207691_10066241
1150 Ga0207711_10023614
1151 Ga0207661_10029288
1152 Ga0207661_10141664
1153 Ga0207661_10260705
1154 Ga0207679_10046596
1155 Ga0207667_10008172
1156 Ga0207667_10052633
1157 Ga0207667_10059829
1158 Ga0207667_10120503
1159 Ga0207667_10167494
1160 Ga0207651_10000563
1161 Ga0207651_10045531
1162 Ga0207712_10026466
1163 Ga0207668_10021824
1164 Ga0207658_10018140
1165 Ga0207658_10029385
1166 Ga0207658_10109191
1167 Ga0207658_10171140
1168 Ga0207677_10119258
1169 Ga0207703_10001369
1170 Ga0207703_10069415
1171 Ga0207639_10001254
1172 Ga0207639_10008284
1173 Ga0207639_10186678
1174 Ga0207678_10072496
1175 Ga0207708_10001158
1176 Ga0207708_10024076
1177 Ga0207708_10032461
1178 Ga0207708_10155118
1179 Ga0207702_10023308
1180 Ga0207641_10004304
1181 Ga0207641_10005080
1182 Ga0207641_10020076
1183 Ga0207641_10081795
1184 Ga0207641_10097037
1185 Ga0207641_10138077
1186 Ga0207648_10006109
1187 Ga0207648_10075705
1188 Ga0207676_10008791
1189 Ga0207676_10011343
1190 Ga0207676_10035512
1191 Ga0207676_10075547
1192 Ga0207674_10011030
1193 Ga0207674_10076534
1194 Ga0207674_10130534
1195 Ga0207675_100004447
1196 Ga0207675_100019540
1197 Ga0207675_100020653
1198 Ga0207675_100066235
1199 Ga0207675_100073431
1200 Ga0207675_100116003
1201 Ga0207675_100300512
1202 Ga0207683_10005289
1203 Ga0207683_10018751
1204 Ga0207683_10027464
1205 Ga0207698_10136682
1206 Ga0207428_10000004
1207 Ga0207428_10000918
1208 Ga0268266_10000524
1209 Ga0268266_10004397
1210 Ga0268266_10035411
1211 Ga0268265_10011774
1212 Ga0268265_10055381
1213 Ga0268264_10006697
1214 Ga0268264_10008827
1215 Ga0268264_10012411
1216 Ga0268264_10051426
1217 Ga0268264_10086895
1218 Ga0268264_10148356
1219 Ga0265319_1028733
1220 Ga0265334_10024405
1221 Ga0265318_10000085
1222 Ga0265318_10000119
1223 Ga0265336_10002471
1224 Ga0307515_10000005
1225 Ga0307515_10198752
1226 Ga0265338_10016615
1227 Ga0265338_10068245
1228 Ga0307511_10000310
1229 Ga0265330_10000058
1230 Ga0265330_10000610
1231 Ga0265332_10000105
1232 Ga0265332_10013465
1233 Ga0265328_10000179
1234 Ga0265328_10000560
1235 Ga0265320_10000025
1236 Ga0265320_10000538
1237 Ga0265320_10002141
1238 Ga0265320_10030797
1239 Ga0265325_10041473
1240 Ga0265329_10000203
1241 Ga0265329_10010576
1242 Ga0265340_10061271
1243 Ga0265339_10002553
1244 Ga0265339_10013709
1245 Ga0265339_10022112
1246 Ga0265331_10000063
1247 Ga0265331_10000531
1248 Ga0265331_10002531
1249 Ga0265316_10001697
1250 Ga0265316_10147148
1251 Ga0307513_10067024
1252 Ga0307509_10000017
1253 Ga0307408_100256556
1254 Ga0265313_10000085
1255 Ga0265313_10008445
1256 Ga0307508_10187525
1257 Ga0265314_10000057
1258 Ga0265314_10001585
1259 Ga0265314_10003605
1260 Ga0265342_10000165
1261 Ga0265342_10001074
1262 Ga0265342_10002331
1263 Ga0265342_10007332
1264 Ga0316576_10001484
1265 Ga0307405_10001448
1266 Ga0307405_10017538
1267 Ga0307407_10041050
1268 Ga0307412_10006752
1269 Ga0307412_10038406
1270 Ga0307510_10000002
1271 Ga0307510_10066594
1272 Ga0373950_0000001
1273 Ga0373950_0000052
1274 Ga0373936_0012241
1275 Ga0373936_0050415
1276 Ga0373956_0020807
1277 Ga0373942_0016965
1278 Ga0373961_0000214
1279 Ga0316574_0000061
1280 Ga0373935_0002307
1281 Ga0373927_0006569
1282 Ga0373933_0000343
1283 Ga0373947_0144572
1284 Ga0373937_0000940
1285 Ga0373937_0103020
1286 Ga0373937_0144432
1287 Ga0373937_0351583
1288 Ga0316584_0077066
1289 Ga0373925_0010251
1290 Ga0395900_0043396
1291 Ga0395905_0002051
1292 Ga0395905_0172631
1293 Ga0436364_0302973
1294 Ga0436364_1228372
1295 Ga0436365_1832854
1296 Ga0451802_0881020
1297 Ga0451802_1847778
1298 Ga0450908_000989
1299 Ga0450918_010308
1300 Ga0451577_0003642
1301 Ga0466963_0030991
1302 Ga0453684_0064993
1303 Ga0453684_0219144
1304 Ga0451576_0013633
1305 Ga0451576_0022133
1306 Ga0451576_0023079
1307 Ga0451576_0032546
1308 Ga0451576_0074772
1309 Ga0451576_0168255
1310 Ga0451576_0177401
1311 Ga0495592_0009397
1312 Ga0495629_0041826
1313 Ga0495653_0039719
1314 Ga0495580_0004499
1315 Ga0495639_0043044
1316 Ga0495639_0055779
1317 Ga0495584_0029448
1318 Ga0495594_0025797
1319 Ga0495608_0002154
1320 Ga0495618_0001809
1321 Ga0495628_0005733
1322 Ga0495628_0105948
1323 Ga0495628_0112744
1324 Ga0495642_0011729
1325 Ga0495586_0011877
1326 Ga0495586_0045746
1327 Ga0495587_0003920
1328 Ga0495598_0008134
1329 Ga0495609_0049110
1330 Ga0495621_0025942
1331 Ga0495634_0002995
1332 Ga0495634_0099741
1333 Ga0495659_0006274
1334 Ga0495659_0039751
1335 Ga0495599_0053136
1336 Ga0495599_0066224
1337 Ga0495658_0006238
1338 Ga0495658_0046072
1339 Ga0495658_0122064
1340 Ga0495669_0007780
1341 Ga0495670_0035240
1342 Ga0495636_0005852
1343 Ga0495636_0060920
1344 Ga0495674_0003540
1345 Ga0495680_0185783
1346 Ga0495684_0162899
1347 Ga0495684_0206329
1348 Ga0496100_0064832
1349 Ga0496101_0002467
1350 Ga0496102_0007729
1351 Ga0496104_0041137
1352 Ga0496105_0154839
1353 Ga0496106_0004490
1354 Ga0496107_0100273
1355 Ga0496108_0036334
1356 Ga0496109_0012647
1357 Ga0496109_0310856
1358 Ga0496111_0001145
1359 Ga0496112_0009020
1360 Ga0496112_0050813
1361 Ga0496113_0069692
1362 Ga0496114_0000001
1363 Ga0496114_0002936
1364 Ga0496114_0009778
1365 Ga0496114_0019959
1366 Ga0496115_0003856
1367 Ga0496115_0049582
1368 Ga0496116_0002908
1369 Ga0496117_0000140
1370 Ga0496118_0000102
1371 Ga0496121_0084690
1372 Ga0496125_0035666
1373 Ga0496126_0044577
1374 Ga0501031_0055898
1375 Ga0501032_0127235
1376 Ga0501033_0013229
1377 Ga0501034_0000025
1378 Ga0501036_0002221
1379 Ga0501036_0005057
1380 Ga0501036_0024333
1381 Ga0501036_0074186
1382 Ga0501037_0046548
1383 Ga0501038_0100861
1384 Ga0501038_0139954
1385 Ga0501039_0000810
1386 Ga0501040_0004684
1387 Ga0501040_0010830
1388 Ga0501040_0058598
1389 Ga0501041_0000218
1390 Ga0501041_0085940
1391 Ga0501042_0009188
1392 Ga0501043_0192086
1393 Ga0501046_0003342
1394 Ga0501046_0032270
1395 Ga0501046_0055562
1396 Ga0501047_0000011
1397 Ga0501047_0000583
1398 Ga0501048_0004448
1399 Ga0501067_0001265
1400 Ga0501067_0017113
1401 Ga0501067_0031230
1402 Ga0501068_0004183
1403 Ga0501068_0016213
1404 Ga0501068_0052130
1405 Ga0501069_0010962
1406 Ga0501069_0031209
1407 Ga0501070_0000022
1408 Ga0501070_0053175
1409 Ga0501070_0099645
1410 Ga0501070_0120125
1411 Ga0501071_0017929
1412 Ga0501071_0018123
1413 Ga0501071_0029622
1414 Ga0501072_0000031
1415 Ga0501072_0000055
1416 Ga0501072_0000330
1417 Ga0501073_0000074
1418 Ga0501073_0000642
1419 Ga0501073_0001482
1420 Ga0501073_0003808
1421 Ga0501073_0008399
1422 Ga0501073_0014783
1423 Ga0501073_0030354
1424 Ga0501073_0049424
1425 Ga0501074_0001544
1426 Ga0501074_0007873
1427 Ga0501074_0016903
1428 Ga0501074_0051924
1429 Ga0501075_0001127
1430 Ga0501076_0009540
1431 Ga0501076_0058390
1432 Ga0501076_0075723
1433 Ga0501077_0000047
1434 Ga0501077_0000920
1435 Ga0501077_0009278
1436 Ga0501077_0069025
1437 Ga0501079_0000469
1438 Ga0501079_0000621
1439 Ga0501079_0001246
1440 Ga0501079_0036603
1441 Ga0501080_0001908
1442 Ga0501080_0006598
1443 Ga0501080_0009121
1444 Ga0501080_0011771
1445 Ga0501080_0012753
1446 Ga0501081_0160653
1447 Ga0501083_0000271
1448 Ga0501083_0003685
1449 Ga0501083_0006104
1450 Ga0501083_0031993
1451 Ga0501083_0046139
1452 Ga0501272_000363
1453 Ga0501035_0006537
1454 Ga0501035_0097951
1455 Ga0501044_0005594
1456 Ga0501045_0000097
1457 Ga0501045_0019438
1458 nmdc:mga03n38_60726_c1
1459 nmdc:mga0k408_3149_c1
1460 nmdc:mga0k408_47510_c1
1461 nmdc:mga0k408_70873_c1
1462 nmdc:mga07m45_53203_c1
1463 nmdc:mga05p37_112227_c1
1464 nmdc:mga05p37_120406_c1
1465 nmdc:mga05p37_63876_c1
1466 nmdc:mga05p37_6678_c1
1467 nmdc:mga05p37_72929_c1
1468 nmdc:mga05p37_7655_c1
1469 nmdc:mga09592_143054_c1
1470 nmdc:mga09592_30561_c1
1471 nmdc:mga09592_39831_c1
1472 nmdc:mga09592_4066_c1
1473 nmdc:mga0qj67_8957_c1
1474 nmdc:mga06r32_2141_c1
1475 nmdc:mga08y16_12696_c1
1476 nmdc:mga08y16_2_c1
1477 nmdc:mga08y16_33119_c1
1478 nmdc:mga08y16_7830_c1
1479 nmdc:mga0n895_135584_c1
1480 nmdc:mga0n895_148157_c1
1481 nmdc:mga0n895_174881_c1
1482 nmdc:mga0n895_1915_c1
1483 nmdc:mga0n895_26169_c1
1484 nmdc:mga0rr50_143357_c1
1485 nmdc:mga0rr50_197212_c1
1486 nmdc:mga0rr50_47621_c1
1487 nmdc:mga08x19_2167_c1
1488 nmdc:mga08x19_89365_c1
1489 nmdc:mga0a205_2094_c2
1490 Ga0495601_0085150
1491 Ga0495619_0054765
1492 Ga0500641_0000690
1493 Ga0500555_000387
1494 Ga0500637_0081194
1495 Ga0500645_000365
1496 Ga0501084_0000050
1497 Ga0501084_0000070
1498 Ga0501084_0005147
1499 Ga0501084_0017200
1500 Ga0501082_0000238
1501 Ga0501082_0001812
1502 Ga0501082_0005418
1503 Ga0501082_0009363
1504 Ga0501082_0013228
1505 Ga0501082_0020203
1506 Ga0501082_0043214
1507 Ga0501082_0066985
1508 Ga0530510_0043942
1509 Ga0530510_0084539

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00083

Sugar_tr

Sugar (and other) transporter

91

279

0.94

PF07690

MFS_1

Major Facilitator Superfamily

72

451

0.86

Structural Annotation

Top 5 Hits

ID Description Score Start End
6lyy-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. 0.8669 5 411
7ckr-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate bay-8002 in the outward-open conformation. 0.8558 5 411
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8499 9 414
6zgr-assembly2.cif.gz_B crystal structure of a mfs transporter with bound 1-hydroxynaphthalene-2-carboxylic acid at 2.67 angstroem resolution 0.8478 9 414
6lyy-assembly1.cif.gz_A cryo-em structure of the human mct1/basigin-2 complex in the presence of anti-cancer drug candidate azd3965 in the outward-open conformation. 0.8417 5 411
ID Description Score Start End Superfamily
af_P25744_10_204_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9027 8 215 1.20.1250.20
af_A0A1L1SUI3_3_201_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.9006 7 207 1.20.1250.20
af_Q2G1N0_6_195_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.891 8 212 1.20.1250.20
af_O43081_53_265_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8869 6 207 1.20.1250.20
af_P39352_7_395_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.8864 4 412 1.20.1250.20
ID Description Score Start End GO Terms
AF-A0A7V8YB93-F1-model_v4 MFS transporter 0.9568 103 417 GO:0005886
GO:0046943
AF-A0A838VIZ1-F1-model_v4 MFS transporter 0.9407 1 418 GO:0005886
GO:0046943
AF-A0A534N1Q1-F1-model_v4 MFS transporter 0.9263 3 418 GO:0005886
GO:0046943
AF-A0A7Y0KFW7-F1-model_v4 MFS transporter 0.9253 1 418 GO:0005886
GO:0046943
AF-L8HCU0-F1-model_v4 Transporter, major facilitator subfamily protein 0.9214 7 426 GO:0005886
GO:0046943

Map