F479266
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 754 | 398 | 1508 | 328 |
Family's Representative Sequence
| Representative Sequence | 3300044658|Ga0466972_0005381|Ga0466972_0005381_3165_4271 |
| Length | 368 |
| Sequence | MSMPCSSSKSDALKNVRTRDRRLANIDTADSEWTQEAPMKMLINVPETVVADALRGMAAAHPELTVDVENRVIVRRDAPVAGKVALVSGGGSGHEPLHGGFVGPGMLSAACPGEVFTSPVPDQMVRAAAAVDSGAGVLFIVKNYTGDVLNFDMAAELAEDEGIQVAKVLVNDDVAVTDSLYTAGRRGTGATLFVEKIAGAAADEGQPLERVQSIARQVNENSRSFGVALSACTTPAKGTPTFDLPPGELELGIGIHGEPGRERRPMMTAREIADFSVNAVLDDLEPRNPVLVLVNGMGATPLLELYGYNAEVQRVLSERGVPVARTLVGNYVTSLDMAGASVTLCQIDEELLRLWEAPVSTPALRWGL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 8 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 10 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 12 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 27 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 28 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 29 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 30 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 32 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 33 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 37 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 38 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 39 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 40 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 41 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 42 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 43 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 44 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 45 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 47 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 49 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 55 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 58 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 59 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 60 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 63 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 64 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 67 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 84 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 87 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 88 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 89 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 90 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 91 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 92 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 93 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 94 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 95 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 96 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 97 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 98 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 99 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 100 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 101 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 102 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 103 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 104 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 105 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 106 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 107 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 108 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 109 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 110 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 112 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 113 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 114 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 115 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 116 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 117 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 118 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 119 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 120 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 121 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 122 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 123 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 124 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 125 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 126 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 127 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 128 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 129 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 130 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 131 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 132 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 133 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 134 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 135 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 136 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 137 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 138 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 139 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 140 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 141 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 142 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 143 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 144 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 145 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 146 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 147 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 148 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 149 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 150 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 151 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 152 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 153 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 154 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 155 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 228 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 229 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 230 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 231 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 232 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 233 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 234 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 235 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 236 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 237 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 238 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 239 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 240 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 241 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 242 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 243 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 244 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 247 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 248 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 250 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 252 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 262 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 266 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 268 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 270 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 271 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 272 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 273 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 274 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 275 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 276 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 277 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 285 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 286 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 287 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 288 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 289 | 3300053113 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere | Metagenome | Endosphere |
| 290 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 291 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 292 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 293 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 294 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 295 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 296 | 3300053732 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere | Metagenome | Endosphere |
| 297 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300059478 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 299 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 300 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 301 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 303 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 304 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 305 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 306 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 307 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 308 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 309 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 310 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 311 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 312 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 313 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 314 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 315 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 316 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 317 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 318 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 319 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 320 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 321 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 322 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 323 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 324 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 325 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 326 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 327 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 328 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 329 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 330 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 331 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 332 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 333 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 334 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 335 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 336 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 337 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 338 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 339 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 340 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 341 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 342 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 343 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 344 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 345 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 346 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 347 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 348 | 2884693830 | Nonomuraea phyllanthi WYY166 | Isolate | Unclassified |
| 349 | 2895427314 | Nonomuraea sp. PA05 | Isolate | Unclassified |
| 350 | 2895442618 | Nonomuraea phyllanthi PA1-10 | Isolate | Unclassified |
| 351 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 352 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 353 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 354 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 355 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 356 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 357 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 358 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 359 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 360 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 361 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 362 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 363 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 364 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 365 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 366 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 367 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 368 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 369 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 370 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 371 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 372 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 373 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 374 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 375 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 376 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 377 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 378 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 379 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 380 | 3006425503 | Streptomyces zingiberis PLAI1-29 | Isolate | Unclassified |
| 381 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 382 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 383 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 384 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 385 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 386 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 387 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 388 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 389 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 390 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 391 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 392 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 393 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 394 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 395 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 396 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 397 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 398 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 85.94 |
| Metatranscriptomes | 0.53 |
| Isolates | 13.53 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.45 |
| Nodule | 0.4 |
| Rhizoplane | 3.45 |
| Rhizosphere | 82.23 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466972_0005381 | 3300044658 | Bacteria | 6413 |
| 2 | JGI24739J22299_10019885 | 3300001989 | Bacteria | 2401 |
| 3 | JGI24751J29686_10008447 | 3300002459 | Bacteria | 2108 |
| 4 | rootH2_10017142 | 3300003320 | Bacteria | 3103 |
| 5 | rootL2_10120955 | 3300003322 | Bacteria | 2316 |
| 6 | rootH1_10054926 | 3300003323 | Bacteria | 1320 |
| 7 | Ga0070690_100066842 | 3300005330 | Bacteria | 2328 |
| 8 | Ga0070668_100001597 | 3300005347 | Bacteria | 16399 |
| 9 | Ga0070668_100107971 | 3300005347 | Bacteria | 2213 |
| 10 | Ga0070709_10008130 | 3300005434 | Bacteria | 5758 |
| 11 | Ga0070709_10121405 | 3300005434 | Bacteria | 1772 |
| 12 | Ga0070714_100139908 | 3300005435 | Bacteria | 2171 |
| 13 | Ga0070714_100211569 | 3300005435 | Bacteria | 1777 |
| 14 | Ga0070714_100361247 | 3300005435 | Bacteria | 1365 |
| 15 | Ga0070713_100050049 | 3300005436 | Bacteria | 3449 |
| 16 | Ga0070713_100239094 | 3300005436 | Bacteria | 1653 |
| 17 | Ga0070710_10031315 | 3300005437 | Bacteria | 2870 |
| 18 | Ga0070710_10065557 | 3300005437 | Bacteria | 2081 |
| 19 | Ga0070710_10184810 | 3300005437 | Bacteria | 1307 |
| 20 | Ga0070711_100055087 | 3300005439 | Bacteria | 2746 |
| 21 | Ga0070708_100001238 | 3300005445 | Bacteria | 19640 |
| 22 | Ga0070708_100001603 | 3300005445 | Bacteria | 17338 |
| 23 | Ga0070708_100007689 | 3300005445 | Bacteria | 8637 |
| 24 | Ga0070708_100054808 | 3300005445 | Bacteria | 3543 |
| 25 | Ga0070678_100216422 | 3300005456 | Bacteria | 1590 |
| 26 | Ga0070681_10135224 | 3300005458 | Bacteria | 2396 |
| 27 | Ga0070706_100006141 | 3300005467 | Bacteria | 11366 |
| 28 | Ga0070706_100006398 | 3300005467 | Bacteria | 11131 |
| 29 | Ga0070706_100011316 | 3300005467 | Bacteria | 8290 |
| 30 | Ga0070706_100027442 | 3300005467 | Bacteria | 5240 |
| 31 | Ga0070706_100029379 | 3300005467 | Bacteria | 5065 |
| 32 | Ga0070706_100100800 | 3300005467 | Bacteria | 2684 |
| 33 | Ga0070706_100533742 | 3300005467 | Bacteria | 1091 |
| 34 | Ga0070707_100000041 | 3300005468 | Bacteria | 111077 |
| 35 | Ga0070707_100002195 | 3300005468 | Bacteria | 18652 |
| 36 | Ga0070707_100009909 | 3300005468 | Bacteria | 8870 |
| 37 | Ga0070707_100154956 | 3300005468 | Bacteria | 2232 |
| 38 | Ga0070707_100208189 | 3300005468 | Bacteria | 1906 |
| 39 | Ga0070707_100365439 | 3300005468 | Bacteria | 1402 |
| 40 | Ga0070698_100000082 | 3300005471 | Bacteria | 73573 |
| 41 | Ga0070698_100002067 | 3300005471 | Bacteria | 22298 |
| 42 | Ga0070698_100009295 | 3300005471 | Bacteria | 10547 |
| 43 | Ga0070698_100011159 | 3300005471 | Bacteria | 9545 |
| 44 | Ga0070698_100093947 | 3300005471 | Bacteria | 2978 |
| 45 | Ga0070698_100133408 | 3300005471 | Bacteria | 2438 |
| 46 | Ga0070698_100210811 | 3300005471 | Bacteria | 1877 |
| 47 | Ga0070699_100001106 | 3300005518 | Bacteria | 25074 |
| 48 | Ga0070699_100024128 | 3300005518 | Bacteria | 5241 |
| 49 | Ga0070699_100072824 | 3300005518 | Bacteria | 2989 |
| 50 | Ga0070699_100075968 | 3300005518 | Bacteria | 2924 |
| 51 | Ga0070684_100181714 | 3300005535 | Bacteria | 1913 |
| 52 | Ga0070697_100062947 | 3300005536 | Bacteria | 3029 |
| 53 | Ga0070693_100048810 | 3300005547 | Bacteria | 2412 |
| 54 | Ga0070665_100222284 | 3300005548 | Bacteria | 1889 |
| 55 | Ga0070665_100333663 | 3300005548 | Bacteria | 1521 |
| 56 | Ga0070704_100055380 | 3300005549 | Bacteria | 2811 |
| 57 | Ga0068856_100088329 | 3300005614 | Bacteria | 3082 |
| 58 | Ga0068856_100287295 | 3300005614 | Bacteria | 1662 |
| 59 | Ga0068856_100294303 | 3300005614 | Bacteria | 1640 |
| 60 | Ga0068858_100092329 | 3300005842 | Bacteria | 2818 |
| 61 | Ga0068860_100137867 | 3300005843 | Bacteria | 2344 |
| 62 | Ga0081539_10001782 | 3300005985 | Bacteria | 34184 |
| 63 | Ga0070717_10006347 | 3300006028 | Bacteria | 8694 |
| 64 | Ga0070717_10028441 | 3300006028 | Bacteria | 4476 |
| 65 | Ga0070717_10029951 | 3300006028 | Bacteria | 4371 |
| 66 | Ga0070717_10076633 | 3300006028 | Bacteria | 2799 |
| 67 | Ga0070717_10097614 | 3300006028 | Bacteria | 2490 |
| 68 | Ga0070717_10101207 | 3300006028 | Bacteria | 2447 |
| 69 | Ga0070717_10148418 | 3300006028 | Bacteria | 2027 |
| 70 | Ga0070717_10390760 | 3300006028 | Bacteria | 1248 |
| 71 | Ga0075368_10011702 | 3300006042 | Bacteria | 3197 |
| 72 | Ga0075363_100001855 | 3300006048 | Bacteria | 8322 |
| 73 | Ga0075363_100098289 | 3300006048 | Bacteria | 1618 |
| 74 | Ga0070715_10002235 | 3300006163 | Bacteria | 5880 |
| 75 | Ga0070716_100002738 | 3300006173 | Bacteria | 8176 |
| 76 | Ga0070716_100011213 | 3300006173 | Bacteria | 4512 |
| 77 | Ga0070716_100053609 | 3300006173 | Bacteria | 2300 |
| 78 | Ga0070712_100063767 | 3300006175 | Bacteria | 2610 |
| 79 | Ga0070712_100208351 | 3300006175 | Bacteria | 1540 |
| 80 | Ga0075367_10006123 | 3300006178 | Bacteria | 6049 |
| 81 | Ga0068871_100109870 | 3300006358 | Bacteria | 2318 |
| 82 | Ga0075428_100016560 | 3300006844 | Bacteria | 8139 |
| 83 | Ga0075428_100146911 | 3300006844 | Bacteria | 2562 |
| 84 | Ga0075430_100007906 | 3300006846 | Bacteria | 8993 |
| 85 | Ga0075430_100077789 | 3300006846 | Bacteria | 2780 |
| 86 | Ga0075431_100082224 | 3300006847 | Bacteria | 3325 |
| 87 | Ga0075431_100101521 | 3300006847 | Bacteria | 2968 |
| 88 | Ga0075431_100167629 | 3300006847 | Bacteria | 2257 |
| 89 | Ga0075429_100003725 | 3300006880 | Bacteria | 12995 |
| 90 | Ga0075429_100220402 | 3300006880 | Bacteria | 1662 |
| 91 | Ga0075436_100017666 | 3300006914 | Bacteria | 4883 |
| 92 | Ga0099795_10069599 | 3300007788 | Bacteria | 1325 |
| 93 | Ga0105245_10027687 | 3300009098 | Bacteria | 4994 |
| 94 | Ga0105245_10037190 | 3300009098 | Bacteria | 4328 |
| 95 | Ga0105245_10075808 | 3300009098 | Bacteria | 3063 |
| 96 | Ga0105245_10163679 | 3300009098 | Bacteria | 2112 |
| 97 | Ga0105247_10069779 | 3300009101 | Bacteria | 2194 |
| 98 | Ga0105247_10082874 | 3300009101 | Bacteria | 2024 |
| 99 | Ga0114129_10002397 | 3300009147 | Bacteria | 26039 |
| 100 | Ga0114129_10082137 | 3300009147 | Bacteria | 4478 |
| 101 | Ga0114129_10089173 | 3300009147 | Bacteria | 4275 |
| 102 | Ga0105243_10192118 | 3300009148 | Bacteria | 1784 |
| 103 | Ga0099796_10042921 | 3300010159 | Bacteria | 1539 |
| 104 | Ga0105239_10161543 | 3300010375 | Bacteria | 2503 |
| 105 | Ga0105246_10047397 | 3300011119 | Bacteria | 2934 |
| 106 | Ga0157369_10039018 | 3300013105 | Bacteria | 5191 |
| 107 | Ga0163162_10434350 | 3300013306 | Bacteria | 1445 |
| 108 | Ga0163163_10013785 | 3300014325 | Bacteria | 7411 |
| 109 | Ga0182008_10011941 | 3300014497 | Bacteria | 4603 |
| 110 | Ga0157379_10090919 | 3300014968 | Bacteria | 2738 |
| 111 | Ga0157376_10022450 | 3300014969 | Bacteria | 4920 |
| 112 | Ga0182007_10000651 | 3300015262 | Bacteria | 19925 |
| 113 | Ga0183367_1003 | 3300015688 | Bacteria | 814276 |
| 114 | Ga0206356_10455475 | 3300020070 | Bacteria | 1329 |
| 115 | Ga0209758_1022281 | 3300025297 | Bacteria | 2913 |
| 116 | Ga0207426_1001118 | 3300025302 | Bacteria | 24589 |
| 117 | Ga0207426_1025321 | 3300025302 | Bacteria | 1999 |
| 118 | Ga0207653_10017464 | 3300025885 | Bacteria | 2259 |
| 119 | Ga0207692_10011463 | 3300025898 | Bacteria | 3774 |
| 120 | Ga0207692_10012952 | 3300025898 | Bacteria | 3601 |
| 121 | Ga0207699_10004947 | 3300025906 | Bacteria | 6373 |
| 122 | Ga0207699_10010584 | 3300025906 | Bacteria | 4636 |
| 123 | Ga0207699_10019147 | 3300025906 | Bacteria | 3643 |
| 124 | Ga0207699_10035344 | 3300025906 | Bacteria | 2843 |
| 125 | Ga0207684_10000339 | 3300025910 | Bacteria | 65102 |
| 126 | Ga0207684_10000574 | 3300025910 | Bacteria | 44726 |
| 127 | Ga0207684_10009068 | 3300025910 | Bacteria | 8810 |
| 128 | Ga0207684_10013508 | 3300025910 | Bacteria | 7062 |
| 129 | Ga0207684_10027890 | 3300025910 | Bacteria | 4809 |
| 130 | Ga0207684_10089191 | 3300025910 | Bacteria | 2627 |
| 131 | Ga0207684_10124007 | 3300025910 | Bacteria | 2216 |
| 132 | Ga0207684_10135934 | 3300025910 | Bacteria | 2111 |
| 133 | Ga0207707_10099845 | 3300025912 | Bacteria | 2537 |
| 134 | Ga0207693_10005872 | 3300025915 | Bacteria | 10189 |
| 135 | Ga0207693_10019021 | 3300025915 | Bacteria | 5467 |
| 136 | Ga0207693_10039198 | 3300025915 | Bacteria | 3731 |
| 137 | Ga0207663_10006086 | 3300025916 | Bacteria | 6137 |
| 138 | Ga0207663_10051538 | 3300025916 | Bacteria | 2563 |
| 139 | Ga0207663_10111958 | 3300025916 | Bacteria | 1853 |
| 140 | Ga0207663_10319919 | 3300025916 | Bacteria | 1165 |
| 141 | Ga0207662_10081946 | 3300025918 | Bacteria | 1970 |
| 142 | Ga0207646_10000061 | 3300025922 | Bacteria | 151425 |
| 143 | Ga0207646_10001194 | 3300025922 | Bacteria | 32687 |
| 144 | Ga0207646_10004121 | 3300025922 | Bacteria | 15968 |
| 145 | Ga0207646_10035076 | 3300025922 | Bacteria | 4533 |
| 146 | Ga0207646_10163460 | 3300025922 | Bacteria | 2009 |
| 147 | Ga0207646_10171107 | 3300025922 | Bacteria | 1961 |
| 148 | Ga0207646_10287688 | 3300025922 | Bacteria | 1485 |
| 149 | Ga0207687_10090388 | 3300025927 | Bacteria | 2231 |
| 150 | Ga0207687_10098105 | 3300025927 | Bacteria | 2150 |
| 151 | Ga0207700_10031746 | 3300025928 | Bacteria | 3756 |
| 152 | Ga0207664_10007801 | 3300025929 | Bacteria | 7434 |
| 153 | Ga0207664_10093413 | 3300025929 | Bacteria | 2471 |
| 154 | Ga0207664_10134725 | 3300025929 | Bacteria | 2083 |
| 155 | Ga0207664_10431846 | 3300025929 | Bacteria | 1174 |
| 156 | Ga0207709_10132559 | 3300025935 | Bacteria | 1700 |
| 157 | Ga0207665_10002854 | 3300025939 | Bacteria | 11599 |
| 158 | Ga0207665_10004964 | 3300025939 | Bacteria | 8876 |
| 159 | Ga0207665_10008897 | 3300025939 | Bacteria | 6594 |
| 160 | Ga0207665_10027232 | 3300025939 | Bacteria | 3777 |
| 161 | Ga0207679_10152735 | 3300025945 | Bacteria | 1881 |
| 162 | Ga0207677_10044687 | 3300026023 | Bacteria | 2953 |
| 163 | Ga0207703_10122973 | 3300026035 | Bacteria | 2230 |
| 164 | Ga0207708_10078069 | 3300026075 | Bacteria | 2542 |
| 165 | Ga0207702_10097459 | 3300026078 | Bacteria | 2588 |
| 166 | Ga0207702_10157653 | 3300026078 | Bacteria | 2070 |
| 167 | Ga0207702_10249914 | 3300026078 | Bacteria | 1665 |
| 168 | Ga0207641_10189423 | 3300026088 | Bacteria | 1890 |
| 169 | Ga0207675_100047003 | 3300026118 | Bacteria | 4031 |
| 170 | Ga0209813_10019102 | 3300027866 | Bacteria | 1901 |
| 171 | Ga0268266_10290928 | 3300028379 | Bacteria | 1521 |
| 172 | Ga0268264_10120477 | 3300028381 | Bacteria | 2312 |
| 173 | Ga0307517_10002021 | 3300028786 | Bacteria | 33010 |
| 174 | Ga0307517_10045362 | 3300028786 | Bacteria | 4619 |
| 175 | Ga0307515_10002351 | 3300028794 | Bacteria | 41291 |
| 176 | Ga0307515_10099362 | 3300028794 | Bacteria | 3534 |
| 177 | Ga0307511_10001434 | 3300030521 | Bacteria | 25153 |
| 178 | Ga0307511_10024493 | 3300030521 | Bacteria | 5593 |
| 179 | Ga0307511_10105824 | 3300030521 | Bacteria | 1819 |
| 180 | Ga0307512_10007403 | 3300030522 | Bacteria | 10896 |
| 181 | Ga0307513_10041460 | 3300031456 | Bacteria | 5080 |
| 182 | Ga0307509_10007954 | 3300031507 | Bacteria | 13674 |
| 183 | Ga0307509_10109895 | 3300031507 | Bacteria | 2764 |
| 184 | Ga0307508_10005275 | 3300031616 | Bacteria | 12338 |
| 185 | Ga0307508_10008175 | 3300031616 | Bacteria | 9700 |
| 186 | Ga0307508_10011922 | 3300031616 | Bacteria | 7949 |
| 187 | Ga0307508_10044682 | 3300031616 | Bacteria | 3961 |
| 188 | Ga0307508_10068560 | 3300031616 | Bacteria | 3117 |
| 189 | Ga0307508_10102587 | 3300031616 | Bacteria | 2457 |
| 190 | Ga0307514_10096570 | 3300031649 | Bacteria | 2134 |
| 191 | Ga0307516_10002293 | 3300031730 | Bacteria | 25803 |
| 192 | Ga0307516_10347563 | 3300031730 | Bacteria | 1149 |
| 193 | Ga0307518_10106282 | 3300031838 | Bacteria | 2004 |
| 194 | Ga0307416_100066305 | 3300032002 | Bacteria | 2972 |
| 195 | Ga0307416_100210301 | 3300032002 | Bacteria | 1855 |
| 196 | Ga0307415_100484485 | 3300032126 | Bacteria | 1078 |
| 197 | Ga0307507_10007349 | 3300033179 | Bacteria | 16099 |
| 198 | Ga0307507_10060199 | 3300033179 | Bacteria | 3548 |
| 199 | Ga0307510_10000284 | 3300033180 | Bacteria | 46683 |
| 200 | Ga0307510_10216061 | 3300033180 | Bacteria | 1434 |
| 201 | Ga0373928_0001836 | 3300035084 | Bacteria | 4136 |
| 202 | Ga0373934_0002647 | 3300035086 | Bacteria | 6580 |
| 203 | Ga0373934_0005843 | 3300035086 | Bacteria | 4554 |
| 204 | Ga0373923_0033816 | 3300035111 | Bacteria | 2072 |
| 205 | Ga0373936_0002455 | 3300035113 | Bacteria | 6934 |
| 206 | Ga0373941_0010422 | 3300035115 | Bacteria | 2374 |
| 207 | Ga0373945_0041357 | 3300035116 | Bacteria | 1666 |
| 208 | Ga0373945_0074779 | 3300035116 | Bacteria | 1288 |
| 209 | Ga0373954_0023482 | 3300035118 | Bacteria | 2804 |
| 210 | Ga0373957_0029446 | 3300035120 | Bacteria | 2006 |
| 211 | Ga0373946_0117951 | 3300035171 | Bacteria | 1209 |
| 212 | Ga0373955_0019357 | 3300035172 | Bacteria | 3400 |
| 213 | Ga0373942_0005770 | 3300035207 | Bacteria | 2867 |
| 214 | Ga0373962_0010326 | 3300035242 | Bacteria | 2326 |
| 215 | Ga0373931_0011113 | 3300035691 | Bacteria | 4341 |
| 216 | Ga0373935_0216669 | 3300035692 | Bacteria | 1328 |
| 217 | Ga0373933_0012423 | 3300035724 | Bacteria | 4701 |
| 218 | Ga0373933_0030292 | 3300035724 | Bacteria | 3133 |
| 219 | Ga0373947_0026091 | 3300035725 | Bacteria | 3411 |
| 220 | Ga0373947_0038383 | 3300035725 | Bacteria | 2845 |
| 221 | Ga0373937_0065903 | 3300036401 | Bacteria | 3334 |
| 222 | Ga0373937_0084399 | 3300036401 | Bacteria | 2938 |
| 223 | Ga0373925_0000228 | 3300037068 | Bacteria | 59957 |
| 224 | Ga0373925_0110189 | 3300037068 | Bacteria | 2125 |
| 225 | Ga0395900_0588473 | 3300037418 | Bacteria | 1054 |
| 226 | Ga0395898_0000852 | 3300037466 | Bacteria | 50067 |
| 227 | Ga0395898_0017584 | 3300037466 | Bacteria | 7296 |
| 228 | Ga0395898_0107668 | 3300037466 | Bacteria | 2673 |
| 229 | Ga0395905_0066264 | 3300037471 | Bacteria | 3382 |
| 230 | Ga0436364_0181279 | 3300037853 | Bacteria | 9030 |
| 231 | Ga0436364_0879590 | 3300037853 | Bacteria | 6418 |
| 232 | Ga0395901_0037739 | 3300038443 | Bacteria | 4996 |
| 233 | Ga0395901_0038889 | 3300038443 | Bacteria | 4921 |
| 234 | Ga0395901_0339485 | 3300038443 | Bacteria | 1552 |
| 235 | Ga0395901_0386484 | 3300038443 | Bacteria | 1440 |
| 236 | Ga0436363_0716113 | 3300039450 | Bacteria | 1405 |
| 237 | Ga0439436_0008290 | 3300041404 | Bacteria | 3193 |
| 238 | Ga0439439_0005705 | 3300041406 | Bacteria | 2855 |
| 239 | Ga0439439_0012127 | 3300041406 | Bacteria | 2081 |
| 240 | Ga0451837_0376999 | 3300041494 | Bacteria | 2488 |
| 241 | Ga0451853_0157145 | 3300041512 | Bacteria | 2193 |
| 242 | Ga0451853_0666452 | 3300041512 | Bacteria | 1356 |
| 243 | Ga0451853_1888606 | 3300041512 | Bacteria | 2665 |
| 244 | Ga0451853_2162406 | 3300041512 | Bacteria | 1694 |
| 245 | Ga0439433_0003032 | 3300041999 | Bacteria | 3597 |
| 246 | Ga0439433_0010143 | 3300041999 | Bacteria | 2056 |
| 247 | Ga0439442_015217 | 3300042002 | Bacteria | 1584 |
| 248 | Ga0439448_0005473 | 3300042005 | Bacteria | 3620 |
| 249 | Ga0439448_0016187 | 3300042005 | Bacteria | 2267 |
| 250 | Ga0439449_0003059 | 3300042007 | Bacteria | 6516 |
| 251 | Ga0439449_0006221 | 3300042007 | Bacteria | 4561 |
| 252 | Ga0439449_0073549 | 3300042007 | Bacteria | 1259 |
| 253 | Ga0439454_010945 | 3300042011 | Bacteria | 1203 |
| 254 | Ga0439455_0001226 | 3300042012 | Bacteria | 4195 |
| 255 | Ga0439455_0049116 | 3300042012 | Bacteria | 1099 |
| 256 | Ga0439457_004253 | 3300042014 | Bacteria | 3769 |
| 257 | Ga0439457_004833 | 3300042014 | Bacteria | 3464 |
| 258 | Ga0439462_0003900 | 3300042015 | Bacteria | 3602 |
| 259 | Ga0439462_0009240 | 3300042015 | Bacteria | 2493 |
| 260 | Ga0450899_000047 | 3300042135 | Bacteria | 9484 |
| 261 | Ga0450902_013804 | 3300042137 | Bacteria | 1303 |
| 262 | Ga0450903_000086 | 3300042138 | Bacteria | 19200 |
| 263 | Ga0450903_000148 | 3300042138 | Bacteria | 15291 |
| 264 | Ga0450906_002950 | 3300042145 | Bacteria | 3697 |
| 265 | Ga0439458_0000692 | 3300042157 | Bacteria | 8722 |
| 266 | Ga0439458_0002014 | 3300042157 | Bacteria | 5050 |
| 267 | Ga0439434_0041179 | 3300042435 | Bacteria | 1419 |
| 268 | Ga0466969_0039523 | 3300044656 | Bacteria | 2368 |
| 269 | Ga0466969_0039678 | 3300044656 | Bacteria | 2363 |
| 270 | Ga0466972_0003962 | 3300044658 | Bacteria | 7388 |
| 271 | Ga0466972_0017857 | 3300044658 | Bacteria | 3550 |
| 272 | Ga0466965_0017123 | 3300044683 | Bacteria | 3459 |
| 273 | Ga0466966_0003947 | 3300044684 | Bacteria | 9799 |
| 274 | Ga0466966_0007714 | 3300044684 | Bacteria | 7125 |
| 275 | Ga0466966_0027802 | 3300044684 | Bacteria | 3688 |
| 276 | Ga0466966_0053032 | 3300044684 | Bacteria | 2573 |
| 277 | Ga0466961_0011038 | 3300044693 | Bacteria | 5774 |
| 278 | Ga0466961_0020833 | 3300044693 | Bacteria | 4220 |
| 279 | Ga0466961_0131875 | 3300044693 | Bacteria | 1566 |
| 280 | Ga0466963_0000275 | 3300044694 | Bacteria | 22896 |
| 281 | Ga0466963_0000711 | 3300044694 | Bacteria | 16256 |
| 282 | Ga0466963_0006085 | 3300044694 | Bacteria | 7117 |
| 283 | Ga0466963_0007825 | 3300044694 | Bacteria | 6394 |
| 284 | Ga0466963_0026207 | 3300044694 | Bacteria | 3727 |
| 285 | Ga0466963_0077727 | 3300044694 | Bacteria | 2243 |
| 286 | Ga0466963_0143521 | 3300044694 | Bacteria | 1655 |
| 287 | Ga0466971_0013145 | 3300044719 | Bacteria | 3631 |
| 288 | Ga0466971_0025132 | 3300044719 | Bacteria | 2659 |
| 289 | Ga0466968_0081034 | 3300044735 | Bacteria | 1426 |
| 290 | Ga0466970_0001447 | 3300044765 | Bacteria | 11492 |
| 291 | Ga0466970_0003142 | 3300044765 | Bacteria | 8025 |
| 292 | Ga0466957_0000049 | 3300044842 | Bacteria | 44603 |
| 293 | Ga0466960_0013760 | 3300044901 | Bacteria | 3447 |
| 294 | Ga0466960_0135285 | 3300044901 | Bacteria | 1305 |
| 295 | Ga0466960_0176542 | 3300044901 | Bacteria | 1156 |
| 296 | Ga0466959_0000275 | 3300045049 | Bacteria | 31466 |
| 297 | Ga0466959_0006079 | 3300045049 | Bacteria | 8330 |
| 298 | Ga0466959_0043960 | 3300045049 | Bacteria | 3291 |
| 299 | Ga0466958_0000512 | 3300045836 | Bacteria | 16251 |
| 300 | Ga0466958_0005272 | 3300045836 | Bacteria | 6930 |
| 301 | Ga0466958_0045071 | 3300045836 | Bacteria | 2660 |
| 302 | Ga0466967_0001836 | 3300045976 | Bacteria | 12769 |
| 303 | Ga0466967_0015406 | 3300045976 | Bacteria | 5991 |
| 304 | Ga0466967_0158606 | 3300045976 | Bacteria | 2122 |
| 305 | Ga0466967_0284018 | 3300045976 | Bacteria | 1588 |
| 306 | Ga0466967_0317649 | 3300045976 | Bacteria | 1501 |
| 307 | Ga0495617_035370 | 3300046452 | Bacteria | 1677 |
| 308 | Ga0495592_0040288 | 3300046454 | Bacteria | 3506 |
| 309 | Ga0495603_0000157 | 3300046455 | Bacteria | 34309 |
| 310 | Ga0495603_0012082 | 3300046455 | Bacteria | 5228 |
| 311 | Ga0495629_0003774 | 3300046459 | Bacteria | 11405 |
| 312 | Ga0495629_0005897 | 3300046459 | Bacteria | 9130 |
| 313 | Ga0495629_0009621 | 3300046459 | Bacteria | 7060 |
| 314 | Ga0495629_0015245 | 3300046459 | Bacteria | 5521 |
| 315 | Ga0495629_0022583 | 3300046459 | Bacteria | 4485 |
| 316 | Ga0495629_0027046 | 3300046459 | Bacteria | 4074 |
| 317 | Ga0495629_0098848 | 3300046459 | Bacteria | 2036 |
| 318 | Ga0495638_0024661 | 3300046460 | Bacteria | 3917 |
| 319 | Ga0495638_0183038 | 3300046460 | Bacteria | 1194 |
| 320 | Ga0495641_0035285 | 3300046461 | Bacteria | 2360 |
| 321 | Ga0495651_0008074 | 3300046462 | Bacteria | 8071 |
| 322 | Ga0495651_0040154 | 3300046462 | Bacteria | 3640 |
| 323 | Ga0495651_0041023 | 3300046462 | Bacteria | 3596 |
| 324 | Ga0495653_0023073 | 3300046463 | Bacteria | 5032 |
| 325 | Ga0495580_0178196 | 3300046472 | Bacteria | 1468 |
| 326 | Ga0495582_0048966 | 3300046473 | Bacteria | 2327 |
| 327 | Ga0495605_0099417 | 3300046474 | Bacteria | 1339 |
| 328 | Ga0495639_0016737 | 3300046475 | Bacteria | 3184 |
| 329 | Ga0495662_0000752 | 3300046476 | Bacteria | 15578 |
| 330 | Ga0495662_0003337 | 3300046476 | Bacteria | 8135 |
| 331 | Ga0495662_0055442 | 3300046476 | Bacteria | 1915 |
| 332 | Ga0495664_0000894 | 3300046477 | Bacteria | 15317 |
| 333 | Ga0495664_0014672 | 3300046477 | Bacteria | 4443 |
| 334 | Ga0495664_0063309 | 3300046477 | Bacteria | 2204 |
| 335 | Ga0495664_0082492 | 3300046477 | Bacteria | 1928 |
| 336 | Ga0495585_0017819 | 3300046492 | Bacteria | 4099 |
| 337 | Ga0495585_0034128 | 3300046492 | Bacteria | 2876 |
| 338 | Ga0495594_0001377 | 3300046499 | Bacteria | 12617 |
| 339 | Ga0495594_0046614 | 3300046499 | Bacteria | 2381 |
| 340 | Ga0495594_0054783 | 3300046499 | Bacteria | 2198 |
| 341 | Ga0495594_0211944 | 3300046499 | Bacteria | 1104 |
| 342 | Ga0495596_0131152 | 3300046500 | Bacteria | 973 |
| 343 | Ga0495607_0012056 | 3300046501 | Bacteria | 5720 |
| 344 | Ga0495607_0200848 | 3300046501 | Bacteria | 987 |
| 345 | Ga0495583_0012953 | 3300046506 | Bacteria | 4684 |
| 346 | Ga0495583_0013898 | 3300046506 | Bacteria | 4463 |
| 347 | Ga0495583_0057481 | 3300046506 | Bacteria | 1749 |
| 348 | Ga0495606_0044769 | 3300046507 | Bacteria | 2940 |
| 349 | Ga0495608_0132940 | 3300046511 | Bacteria | 1591 |
| 350 | Ga0495608_0149608 | 3300046511 | Bacteria | 1488 |
| 351 | Ga0495618_0064783 | 3300046514 | Bacteria | 2322 |
| 352 | Ga0495618_0076046 | 3300046514 | Bacteria | 2139 |
| 353 | Ga0495618_0088913 | 3300046514 | Bacteria | 1975 |
| 354 | Ga0495628_0047344 | 3300046516 | Bacteria | 3412 |
| 355 | Ga0495628_0066014 | 3300046516 | Bacteria | 2829 |
| 356 | Ga0495628_0107883 | 3300046516 | Bacteria | 2143 |
| 357 | Ga0495648_0101967 | 3300046524 | Bacteria | 1582 |
| 358 | Ga0495666_0012772 | 3300046526 | Bacteria | 4186 |
| 359 | Ga0495666_0094740 | 3300046526 | Bacteria | 1408 |
| 360 | Ga0495652_0034056 | 3300046529 | Bacteria | 4442 |
| 361 | Ga0495652_0040184 | 3300046529 | Bacteria | 4042 |
| 362 | Ga0495652_0072084 | 3300046529 | Bacteria | 2880 |
| 363 | Ga0495652_0227702 | 3300046529 | Bacteria | 1396 |
| 364 | Ga0495640_0055326 | 3300046533 | Bacteria | 2714 |
| 365 | Ga0495640_0098608 | 3300046533 | Bacteria | 1920 |
| 366 | Ga0495640_0110799 | 3300046533 | Bacteria | 1794 |
| 367 | Ga0495640_0163953 | 3300046533 | Bacteria | 1422 |
| 368 | Ga0495586_0037958 | 3300046535 | Bacteria | 2586 |
| 369 | Ga0495586_0053853 | 3300046535 | Bacteria | 2180 |
| 370 | Ga0495587_0000273 | 3300046536 | Bacteria | 36925 |
| 371 | Ga0495587_0003110 | 3300046536 | Bacteria | 11099 |
| 372 | Ga0495609_0111272 | 3300046538 | Bacteria | 1182 |
| 373 | Ga0495597_0011946 | 3300046542 | Bacteria | 4200 |
| 374 | Ga0495645_0050563 | 3300046543 | Bacteria | 3026 |
| 375 | Ga0495622_0012722 | 3300046557 | Bacteria | 3902 |
| 376 | Ga0495622_0014579 | 3300046557 | Bacteria | 3650 |
| 377 | Ga0495622_0066159 | 3300046557 | Bacteria | 1671 |
| 378 | Ga0495633_0110633 | 3300046558 | Bacteria | 1273 |
| 379 | Ga0495667_0012947 | 3300046559 | Bacteria | 5655 |
| 380 | Ga0495667_0095472 | 3300046559 | Bacteria | 1925 |
| 381 | Ga0495656_0106920 | 3300046615 | Bacteria | 1303 |
| 382 | Ga0495668_0005005 | 3300046616 | Bacteria | 9152 |
| 383 | Ga0495668_0007768 | 3300046616 | Bacteria | 6803 |
| 384 | Ga0495634_0009608 | 3300046642 | Bacteria | 7125 |
| 385 | Ga0495634_0010573 | 3300046642 | Bacteria | 6756 |
| 386 | Ga0495634_0010984 | 3300046642 | Bacteria | 6610 |
| 387 | Ga0495611_0037052 | 3300046648 | Bacteria | 2167 |
| 388 | Ga0495611_0075547 | 3300046648 | Bacteria | 1544 |
| 389 | Ga0495625_0106347 | 3300046660 | Bacteria | 1921 |
| 390 | Ga0495625_0114415 | 3300046660 | Bacteria | 1842 |
| 391 | Ga0495635_0004978 | 3300046663 | Bacteria | 9251 |
| 392 | Ga0495635_0042723 | 3300046663 | Bacteria | 3129 |
| 393 | Ga0495661_0189729 | 3300046665 | Bacteria | 1083 |
| 394 | Ga0495588_0007242 | 3300046674 | Bacteria | 5036 |
| 395 | Ga0495588_0054232 | 3300046674 | Bacteria | 2068 |
| 396 | Ga0495657_0000049 | 3300046675 | Bacteria | 103042 |
| 397 | Ga0495657_0006566 | 3300046675 | Bacteria | 9087 |
| 398 | Ga0495657_0007365 | 3300046675 | Bacteria | 8506 |
| 399 | Ga0495657_0010104 | 3300046675 | Bacteria | 7112 |
| 400 | Ga0495657_0015874 | 3300046675 | Bacteria | 5498 |
| 401 | Ga0495657_0025086 | 3300046675 | Bacteria | 4236 |
| 402 | Ga0495657_0081335 | 3300046675 | Bacteria | 2095 |
| 403 | Ga0495599_0094688 | 3300046678 | Bacteria | 1863 |
| 404 | Ga0495623_0152517 | 3300046679 | Bacteria | 1365 |
| 405 | Ga0495646_0021018 | 3300046680 | Bacteria | 4126 |
| 406 | Ga0495646_0061720 | 3300046680 | Bacteria | 2231 |
| 407 | Ga0495669_0036377 | 3300046684 | Bacteria | 2176 |
| 408 | Ga0495613_0002706 | 3300046689 | Bacteria | 13302 |
| 409 | Ga0495613_0005232 | 3300046689 | Bacteria | 9745 |
| 410 | Ga0495613_0009424 | 3300046689 | Bacteria | 7242 |
| 411 | Ga0495613_0035121 | 3300046689 | Bacteria | 3721 |
| 412 | Ga0495613_0109505 | 3300046689 | Bacteria | 1991 |
| 413 | Ga0495613_0275654 | 3300046689 | Bacteria | 1169 |
| 414 | Ga0495624_0037703 | 3300046690 | Bacteria | 3108 |
| 415 | Ga0495671_0010196 | 3300046692 | Bacteria | 5219 |
| 416 | Ga0495649_0069336 | 3300046694 | Bacteria | 1891 |
| 417 | Ga0495589_0035800 | 3300046794 | Bacteria | 2488 |
| 418 | Ga0495589_0056258 | 3300046794 | Bacteria | 1936 |
| 419 | Ga0495589_0056698 | 3300046794 | Bacteria | 1928 |
| 420 | Ga0495600_0061829 | 3300046809 | Bacteria | 2446 |
| 421 | Ga0495600_0193450 | 3300046809 | Bacteria | 1307 |
| 422 | Ga0495660_0004050 | 3300046810 | Bacteria | 8950 |
| 423 | Ga0495660_0027879 | 3300046810 | Bacteria | 3194 |
| 424 | Ga0495581_0001468 | 3300047315 | Bacteria | 13105 |
| 425 | Ga0495604_0003659 | 3300047317 | Bacteria | 12253 |
| 426 | Ga0495604_0021890 | 3300047317 | Bacteria | 5103 |
| 427 | Ga0495604_0041408 | 3300047317 | Bacteria | 3613 |
| 428 | Ga0495604_0068137 | 3300047317 | Bacteria | 2702 |
| 429 | Ga0495604_0078295 | 3300047317 | Bacteria | 2481 |
| 430 | Ga0495604_0111833 | 3300047317 | Bacteria | 1990 |
| 431 | Ga0495604_0164736 | 3300047317 | Bacteria | 1564 |
| 432 | Ga0495636_0003376 | 3300047318 | Bacteria | 6192 |
| 433 | Ga0495636_0006119 | 3300047318 | Bacteria | 4727 |
| 434 | Ga0495636_0035485 | 3300047318 | Bacteria | 2054 |
| 435 | Ga0495636_0051179 | 3300047318 | Bacteria | 1731 |
| 436 | Ga0495674_0176019 | 3300047319 | Bacteria | 1783 |
| 437 | Ga0495674_0213526 | 3300047319 | Bacteria | 1597 |
| 438 | Ga0495676_0001217 | 3300047321 | Bacteria | 22055 |
| 439 | Ga0495676_0006574 | 3300047321 | Bacteria | 10715 |
| 440 | Ga0495676_0010176 | 3300047321 | Bacteria | 8543 |
| 441 | Ga0495676_0019178 | 3300047321 | Bacteria | 6018 |
| 442 | Ga0495676_0023405 | 3300047321 | Bacteria | 5362 |
| 443 | Ga0495676_0039025 | 3300047321 | Bacteria | 3938 |
| 444 | Ga0495676_0067065 | 3300047321 | Bacteria | 2778 |
| 445 | Ga0495680_0006312 | 3300047322 | Bacteria | 11034 |
| 446 | Ga0495680_0015996 | 3300047322 | Bacteria | 6453 |
| 447 | Ga0495680_0028167 | 3300047322 | Bacteria | 4608 |
| 448 | Ga0495680_0071898 | 3300047322 | Bacteria | 2632 |
| 449 | Ga0495683_0086807 | 3300047323 | Bacteria | 1520 |
| 450 | Ga0495687_000825 | 3300047443 | Bacteria | 33158 |
| 451 | Ga0495687_020501 | 3300047443 | Bacteria | 3218 |
| 452 | Ga0495687_041344 | 3300047443 | Bacteria | 2023 |
| 453 | Ga0495675_0046460 | 3300047444 | Bacteria | 2764 |
| 454 | Ga0495675_0078692 | 3300047444 | Bacteria | 2076 |
| 455 | Ga0495675_0101560 | 3300047444 | Bacteria | 1799 |
| 456 | Ga0495685_000959 | 3300047447 | Bacteria | 8735 |
| 457 | Ga0495685_003140 | 3300047447 | Bacteria | 5238 |
| 458 | Ga0495685_009416 | 3300047447 | Bacteria | 3261 |
| 459 | Ga0495685_025470 | 3300047447 | Bacteria | 2035 |
| 460 | Ga0495681_0003781 | 3300047470 | Bacteria | 10497 |
| 461 | Ga0495681_0016345 | 3300047470 | Bacteria | 4162 |
| 462 | Ga0495681_0031479 | 3300047470 | Bacteria | 2684 |
| 463 | Ga0495684_0029594 | 3300047471 | Bacteria | 4203 |
| 464 | Ga0495684_0065883 | 3300047471 | Bacteria | 2754 |
| 465 | Ga0495684_0123164 | 3300047471 | Bacteria | 1951 |
| 466 | Ga0495684_0210223 | 3300047471 | Bacteria | 1431 |
| 467 | Ga0495686_0081389 | 3300047472 | Bacteria | 1978 |
| 468 | Ga0495686_0193921 | 3300047472 | Bacteria | 1169 |
| 469 | Ga0495593_0010985 | 3300047673 | Bacteria | 5212 |
| 470 | Ga0495593_0024695 | 3300047673 | Bacteria | 3328 |
| 471 | Ga0495602_0003730 | 3300048088 | Bacteria | 15821 |
| 472 | Ga0495602_0017605 | 3300048088 | Bacteria | 7160 |
| 473 | Ga0495602_0026584 | 3300048088 | Bacteria | 5579 |
| 474 | Ga0495614_0000100 | 3300048089 | Bacteria | 29215 |
| 475 | Ga0495614_0016273 | 3300048089 | Bacteria | 3238 |
| 476 | Ga0495614_0022403 | 3300048089 | Bacteria | 2726 |
| 477 | Ga0495614_0075702 | 3300048089 | Bacteria | 1454 |
| 478 | Ga0495626_0016585 | 3300048091 | Bacteria | 3739 |
| 479 | Ga0496102_0074114 | 3300048905 | Bacteria | 3129 |
| 480 | Ga0496102_0089781 | 3300048905 | Bacteria | 2843 |
| 481 | Ga0496102_0114799 | 3300048905 | Bacteria | 2512 |
| 482 | Ga0496102_0136116 | 3300048905 | Bacteria | 2302 |
| 483 | Ga0496103_0088193 | 3300048906 | Bacteria | 1956 |
| 484 | Ga0496103_0132060 | 3300048906 | Bacteria | 1595 |
| 485 | Ga0496104_0029401 | 3300048907 | Bacteria | 5097 |
| 486 | Ga0496104_0122704 | 3300048907 | Bacteria | 2494 |
| 487 | Ga0496105_0044743 | 3300048908 | Bacteria | 3652 |
| 488 | Ga0496106_0094004 | 3300048909 | Bacteria | 2317 |
| 489 | Ga0496108_0067294 | 3300048911 | Bacteria | 3021 |
| 490 | Ga0496108_0082603 | 3300048911 | Bacteria | 2724 |
| 491 | Ga0496109_0119562 | 3300048912 | Bacteria | 2453 |
| 492 | Ga0496109_0321124 | 3300048912 | Bacteria | 1461 |
| 493 | Ga0496109_0334832 | 3300048912 | Bacteria | 1429 |
| 494 | Ga0496110_0048242 | 3300048913 | Bacteria | 3733 |
| 495 | Ga0496111_0052440 | 3300048914 | Bacteria | 2945 |
| 496 | Ga0496111_0070102 | 3300048914 | Bacteria | 2549 |
| 497 | Ga0496112_0009016 | 3300048915 | Bacteria | 8958 |
| 498 | Ga0496112_0065046 | 3300048915 | Bacteria | 3599 |
| 499 | Ga0496112_0084631 | 3300048915 | Bacteria | 3137 |
| 500 | Ga0496113_0009989 | 3300048916 | Bacteria | 6257 |
| 501 | Ga0496113_0013158 | 3300048916 | Bacteria | 5591 |
| 502 | Ga0496113_0218962 | 3300048916 | Bacteria | 1517 |
| 503 | Ga0496115_0118693 | 3300048918 | Bacteria | 2175 |
| 504 | Ga0501031_0002554 | 3300049568 | Bacteria | 11598 |
| 505 | Ga0501031_0007113 | 3300049568 | Bacteria | 7302 |
| 506 | Ga0501031_0111330 | 3300049568 | Bacteria | 1788 |
| 507 | Ga0501032_0005207 | 3300049569 | Bacteria | 9680 |
| 508 | Ga0501032_0008122 | 3300049569 | Bacteria | 7651 |
| 509 | Ga0501032_0036693 | 3300049569 | Bacteria | 3345 |
| 510 | Ga0501032_0040376 | 3300049569 | Bacteria | 3172 |
| 511 | Ga0501032_0041774 | 3300049569 | Bacteria | 3113 |
| 512 | Ga0501032_0084323 | 3300049569 | Bacteria | 2112 |
| 513 | Ga0501032_0104728 | 3300049569 | Bacteria | 1874 |
| 514 | Ga0501033_0009248 | 3300049570 | Bacteria | 7588 |
| 515 | Ga0501033_0018237 | 3300049570 | Bacteria | 5302 |
| 516 | Ga0501033_0076224 | 3300049570 | Bacteria | 2461 |
| 517 | Ga0501033_0116892 | 3300049570 | Bacteria | 1937 |
| 518 | Ga0501034_0008974 | 3300049571 | Bacteria | 10503 |
| 519 | Ga0501034_0044166 | 3300049571 | Bacteria | 4507 |
| 520 | Ga0501034_0045827 | 3300049571 | Bacteria | 4417 |
| 521 | Ga0501034_0056777 | 3300049571 | Bacteria | 3938 |
| 522 | Ga0501034_0172664 | 3300049571 | Bacteria | 2128 |
| 523 | Ga0501036_0000708 | 3300049572 | Bacteria | 24642 |
| 524 | Ga0501036_0010485 | 3300049572 | Bacteria | 7655 |
| 525 | Ga0501036_0017843 | 3300049572 | Bacteria | 5941 |
| 526 | Ga0501036_0019366 | 3300049572 | Bacteria | 5712 |
| 527 | Ga0501036_0039257 | 3300049572 | Bacteria | 4006 |
| 528 | Ga0501036_0046363 | 3300049572 | Bacteria | 3681 |
| 529 | Ga0501036_0088166 | 3300049572 | Bacteria | 2622 |
| 530 | Ga0501036_0217296 | 3300049572 | Bacteria | 1605 |
| 531 | Ga0501037_0002174 | 3300049573 | Bacteria | 14185 |
| 532 | Ga0501037_0012944 | 3300049573 | Bacteria | 6149 |
| 533 | Ga0501037_0028794 | 3300049573 | Bacteria | 4104 |
| 534 | Ga0501037_0066246 | 3300049573 | Bacteria | 2631 |
| 535 | Ga0501037_0139147 | 3300049573 | Bacteria | 1738 |
| 536 | Ga0501038_0006729 | 3300049574 | Bacteria | 10620 |
| 537 | Ga0501038_0035589 | 3300049574 | Bacteria | 4371 |
| 538 | Ga0501038_0042919 | 3300049574 | Bacteria | 3936 |
| 539 | Ga0501038_0052424 | 3300049574 | Bacteria | 3517 |
| 540 | Ga0501038_0120392 | 3300049574 | Bacteria | 2165 |
| 541 | Ga0501038_0122948 | 3300049574 | Bacteria | 2138 |
| 542 | Ga0501039_0015458 | 3300049575 | Bacteria | 5843 |
| 543 | Ga0501039_0052205 | 3300049575 | Bacteria | 3163 |
| 544 | Ga0501039_0195296 | 3300049575 | Bacteria | 1591 |
| 545 | Ga0501040_0001445 | 3300049576 | Bacteria | 15042 |
| 546 | Ga0501041_0024673 | 3300049577 | Bacteria | 3609 |
| 547 | Ga0501042_0011296 | 3300049578 | Bacteria | 6021 |
| 548 | Ga0501042_0022777 | 3300049578 | Bacteria | 4377 |
| 549 | Ga0501042_0161686 | 3300049578 | Bacteria | 1616 |
| 550 | Ga0501043_0004336 | 3300049579 | Bacteria | 11546 |
| 551 | Ga0501043_0007163 | 3300049579 | Bacteria | 8865 |
| 552 | Ga0501043_0009359 | 3300049579 | Bacteria | 7694 |
| 553 | Ga0501043_0010698 | 3300049579 | Bacteria | 7188 |
| 554 | Ga0501043_0021683 | 3300049579 | Bacteria | 5036 |
| 555 | Ga0501043_0041318 | 3300049579 | Bacteria | 3623 |
| 556 | Ga0501043_0081138 | 3300049579 | Bacteria | 2548 |
| 557 | Ga0501046_0006788 | 3300049580 | Bacteria | 10100 |
| 558 | Ga0501046_0047639 | 3300049580 | Bacteria | 3397 |
| 559 | Ga0501046_0107107 | 3300049580 | Bacteria | 2139 |
| 560 | Ga0501046_0113934 | 3300049580 | Bacteria | 2063 |
| 561 | Ga0501047_0000103 | 3300049581 | Bacteria | 104053 |
| 562 | Ga0501047_0000353 | 3300049581 | Bacteria | 52010 |
| 563 | Ga0501047_0009882 | 3300049581 | Bacteria | 9019 |
| 564 | Ga0501047_0012213 | 3300049581 | Bacteria | 8131 |
| 565 | Ga0501047_0029789 | 3300049581 | Bacteria | 5260 |
| 566 | Ga0501047_0044687 | 3300049581 | Bacteria | 4281 |
| 567 | Ga0501047_0052148 | 3300049581 | Bacteria | 3953 |
| 568 | Ga0501047_0200931 | 3300049581 | Bacteria | 1854 |
| 569 | Ga0501048_0028202 | 3300049582 | Bacteria | 4075 |
| 570 | Ga0501048_0062619 | 3300049582 | Bacteria | 2632 |
| 571 | Ga0501067_0003009 | 3300049583 | Bacteria | 9307 |
| 572 | Ga0501068_0000656 | 3300049584 | Bacteria | 17781 |
| 573 | Ga0501069_0001559 | 3300049585 | Bacteria | 11326 |
| 574 | Ga0501070_0025530 | 3300049586 | Bacteria | 4956 |
| 575 | Ga0501070_0150724 | 3300049586 | Bacteria | 1918 |
| 576 | Ga0501070_0294409 | 3300049586 | Bacteria | 1323 |
| 577 | Ga0501071_0000349 | 3300049587 | Bacteria | 22503 |
| 578 | Ga0501071_0055976 | 3300049587 | Bacteria | 2848 |
| 579 | Ga0501072_0002398 | 3300049588 | Bacteria | 14046 |
| 580 | Ga0501073_0064576 | 3300049589 | Bacteria | 2553 |
| 581 | Ga0501073_0090558 | 3300049589 | Bacteria | 2125 |
| 582 | Ga0501074_0000866 | 3300049590 | Bacteria | 19298 |
| 583 | Ga0501074_0003063 | 3300049590 | Bacteria | 11786 |
| 584 | Ga0501074_0009494 | 3300049590 | Bacteria | 7064 |
| 585 | Ga0501075_0106263 | 3300049591 | Bacteria | 2133 |
| 586 | Ga0501075_0291351 | 3300049591 | Bacteria | 1243 |
| 587 | Ga0501076_0056888 | 3300049592 | Bacteria | 3104 |
| 588 | Ga0501076_0249859 | 3300049592 | Bacteria | 1451 |
| 589 | Ga0501080_0063380 | 3300049742 | Bacteria | 3441 |
| 590 | Ga0501080_0241783 | 3300049742 | Bacteria | 1647 |
| 591 | Ga0501083_0008989 | 3300049744 | Bacteria | 7051 |
| 592 | Ga0501035_0002009 | 3300049822 | Bacteria | 20313 |
| 593 | Ga0501035_0005523 | 3300049822 | Bacteria | 11948 |
| 594 | Ga0501035_0023285 | 3300049822 | Bacteria | 5680 |
| 595 | Ga0501035_0032516 | 3300049822 | Bacteria | 4745 |
| 596 | Ga0501035_0042517 | 3300049822 | Bacteria | 4098 |
| 597 | Ga0501035_0071330 | 3300049822 | Bacteria | 3076 |
| 598 | Ga0501035_0126150 | 3300049822 | Bacteria | 2234 |
| 599 | Ga0501035_0134994 | 3300049822 | Bacteria | 2149 |
| 600 | Ga0501035_0148260 | 3300049822 | Bacteria | 2037 |
| 601 | Ga0501044_0001895 | 3300049823 | Bacteria | 24214 |
| 602 | Ga0501044_0001963 | 3300049823 | Bacteria | 23798 |
| 603 | Ga0501044_0018743 | 3300049823 | Bacteria | 7412 |
| 604 | Ga0501044_0021222 | 3300049823 | Bacteria | 6933 |
| 605 | Ga0501044_0024024 | 3300049823 | Bacteria | 6475 |
| 606 | Ga0501044_0052638 | 3300049823 | Bacteria | 4193 |
| 607 | Ga0501044_0064164 | 3300049823 | Bacteria | 3750 |
| 608 | Ga0501044_0066117 | 3300049823 | Bacteria | 3687 |
| 609 | Ga0501044_0192925 | 3300049823 | Bacteria | 1998 |
| 610 | Ga0501044_0195659 | 3300049823 | Bacteria | 1982 |
| 611 | Ga0501044_0321198 | 3300049823 | Bacteria | 1472 |
| 612 | Ga0501045_0360987 | 3300049824 | Bacteria | 1081 |
| 613 | nmdc:mga03n38_56910_c1 | 3300050490 | Bacteria | 1766 |
| 614 | nmdc:mga0yw44_13731_c1 | 3300050492 | Bacteria | 4275 |
| 615 | nmdc:mga06z11_31385_c1 | 3300050494 | Bacteria | 2581 |
| 616 | nmdc:mga04h51_22801_c1 | 3300050495 | Bacteria | 1899 |
| 617 | nmdc:mga05p37_2963_c1 | 3300050507 | Bacteria | 19704 |
| 618 | nmdc:mga05p37_820_c1 | 3300050507 | Bacteria | 34830 |
| 619 | nmdc:mga09592_5182_c1 | 3300050508 | Bacteria | 10594 |
| 620 | nmdc:mga0qj67_14923_c1 | 3300050509 | Bacteria | 5875 |
| 621 | nmdc:mga0qj67_531_c1 | 3300050509 | Bacteria | 25967 |
| 622 | nmdc:mga06r32_56752_c1 | 3300050510 | Bacteria | 3760 |
| 623 | nmdc:mga06r32_60464_c1 | 3300050510 | Bacteria | 3646 |
| 624 | nmdc:mga0rr50_106212_c1 | 3300050513 | Bacteria | 2215 |
| 625 | nmdc:mga08x19_147381_c1 | 3300050514 | Bacteria | 1592 |
| 626 | nmdc:mga0a205_24398_c1 | 3300050515 | Bacteria | 5750 |
| 627 | Ga0495612_0019408 | 3300053078 | Bacteria | 2722 |
| 628 | Ga0495655_0029301 | 3300053083 | Bacteria | 1322 |
| 629 | Ga0495595_0028600 | 3300053084 | Bacteria | 2490 |
| 630 | Ga0495619_0038670 | 3300053085 | Bacteria | 3113 |
| 631 | Ga0500644_0021558 | 3300053088 | Bacteria | 1932 |
| 632 | Ga0500640_029375 | 3300053095 | Bacteria | 2403 |
| 633 | Ga0500556_0058397 | 3300053104 | Bacteria | 1415 |
| 634 | Ga0500560_000753 | 3300053107 | Bacteria | 4912 |
| 635 | Ga0500560_017345 | 3300053107 | Bacteria | 1985 |
| 636 | Ga0500572_015599 | 3300053111 | Bacteria | 1919 |
| 637 | Ga0500580_085925 | 3300053113 | Bacteria | 1266 |
| 638 | Ga0500594_0025002 | 3300053118 | Bacteria | 1527 |
| 639 | Ga0500621_039959 | 3300053126 | Bacteria | 1891 |
| 640 | Ga0500628_039880 | 3300053129 | Bacteria | 1067 |
| 641 | Ga0500561_0003140 | 3300053137 | Bacteria | 2856 |
| 642 | Ga0500633_0007523 | 3300053160 | Bacteria | 2749 |
| 643 | Ga0500634_0060929 | 3300053161 | Bacteria | 2002 |
| 644 | Ga0500656_007804 | 3300053732 | Bacteria | 1121 |
| 645 | Ga0501084_0015209 | 3300054114 | Bacteria | 6381 |
| 646 | Ga0587093_004061 | 3300059478 | Bacteria | 1472 |
| 647 | Ga0587078_003215 | 3300059646 | Bacteria | 1640 |
| 648 | Ga0587111_0003527 | 3300060346 | Bacteria | 2235 |
| 649 | Ga0501082_0040583 | 3300060353 | Bacteria | 4013 |
| 650 | Ga0466962_0000081 | 3300061719 | Bacteria | 38408 |
| 651 | Ga0466962_0007836 | 3300061719 | Bacteria | 5122 |
| 652 | Ga0466962_0018367 | 3300061719 | Bacteria | 3363 |
| 653 | 2547408771 | 2547132111 | Bacteria | 8013147 |
| 654 | 2554260117 | 2554235005 | Bacteria | 6457341 |
| 655 | 2585299512 | 2582581312 | Bacteria | 7308206 |
| 656 | 2585305819 | 2582581313 | Bacteria | 10042643 |
| 657 | 2585305909 | 2582581313 | Bacteria | 10042643 |
| 658 | 2585315149 | 2582581314 | Bacteria | 11452267 |
| 659 | 2616693550 | 2616644814 | Bacteria | 11555299 |
| 660 | 2616900994 | 2616644941 | Bacteria | 8510691 |
| 661 | 2643760477 | 2643221548 | Bacteria | 8053412 |
| 662 | 2643898835 | 2643221578 | Bacteria | 9213798 |
| 663 | 2643947247 | 2643221587 | Bacteria | 7586415 |
| 664 | 2644270190 | 2643221647 | Bacteria | 10741251 |
| 665 | 2644386393 | 2643221670 | Bacteria | 6497041 |
| 666 | 2644403604 | 2643221673 | Bacteria | 9196637 |
| 667 | 2644433282 | 2643221677 | Bacteria | 7584031 |
| 668 | 2644441901 | 2643221678 | Bacteria | 9540101 |
| 669 | 2644459560 | 2643221682 | Bacteria | 6743283 |
| 670 | 2644630670 | 2643221714 | Bacteria | 9015452 |
| 671 | 2676487727 | 2675903060 | Bacteria | 10051191 |
| 672 | 2768643785 | 2767802112 | Bacteria | 6465194 |
| 673 | 2784586208 | 2784132148 | Bacteria | 8627943 |
| 674 | 2785346688 | 2784746763 | Bacteria | 9783172 |
| 675 | 2785366322 | 2784746768 | Bacteria | 10036182 |
| 676 | 2785366439 | 2784746768 | Bacteria | 10036182 |
| 677 | 2786667303 | 2786546132 | Bacteria | 10419719 |
| 678 | 2786675858 | 2786546132 | Bacteria | 10419719 |
| 679 | 2793976982 | 2791355406 | Bacteria | 11364898 |
| 680 | 2808846952 | 2808606359 | Bacteria | 9866990 |
| 681 | 2808917669 | 2808606375 | Bacteria | 9466072 |
| 682 | 2809229604 | 2808606448 | Bacteria | 8656184 |
| 683 | 2811846535 | 2808606982 | Bacteria | 7791042 |
| 684 | 2812361375 | 2811994879 | Bacteria | 9313447 |
| 685 | 2812477305 | 2811994917 | Bacteria | 7761064 |
| 686 | 2819699939 | 2818991463 | Bacteria | 7948711 |
| 687 | 2852642625 | 2852635781 | Bacteria | 8251373 |
| 688 | 2862180981 | 2862178590 | Bacteria | 8583590 |
| 689 | 2862282471 | 2862281513 | Bacteria | 9621493 |
| 690 | 2862293570 | 2862290372 | Bacteria | 7471434 |
| 691 | 2862387028 | 2862382967 | Bacteria | 10317375 |
| 692 | 2862513738 | 2862507626 | Bacteria | 9425308 |
| 693 | 2862580580 | 2862574272 | Bacteria | 10567477 |
| 694 | 2867346752 | 2867346516 | Bacteria | 7608576 |
| 695 | 2867375194 | 2867369537 | Bacteria | 6501581 |
| 696 | 2867436882 | 2867428634 | Bacteria | 9590268 |
| 697 | 2867478162 | 2867475112 | Bacteria | 6909112 |
| 698 | 2873158005 | 2873151551 | Bacteria | 8625867 |
| 699 | 2875392167 | 2875391855 | Bacteria | 7600475 |
| 700 | 2877684096 | 2877676314 | Bacteria | 9512378 |
| 701 | 2877684196 | 2877676314 | Bacteria | 9512378 |
| 702 | 2884697734 | 2884693830 | Bacteria | 11273186 |
| 703 | 2895431856 | 2895427314 | Bacteria | 13147766 |
| 704 | 2895444836 | 2895442618 | Bacteria | 11027144 |
| 705 | 2912723498 | 2912715099 | Bacteria | 9460473 |
| 706 | 2912726735 | 2912723979 | Bacteria | 8557534 |
| 707 | 2912758329 | 2912757875 | Bacteria | 7940295 |
| 708 | 2918501918 | 2918501144 | Bacteria | 8668083 |
| 709 | 2919470150 | 2919468124 | Bacteria | 9133025 |
| 710 | 2935391450 | 2935390628 | Bacteria | 7043367 |
| 711 | 2935393119 | 2935390628 | Bacteria | 7043367 |
| 712 | 2946052732 | 2946045630 | Bacteria | 8527308 |
| 713 | 2946064709 | 2946064051 | Bacteria | 8957905 |
| 714 | 2946073084 | 2946072368 | Bacteria | 8999607 |
| 715 | 2947224675 | 2947224130 | Bacteria | 9938529 |
| 716 | 2954008300 | 2954002825 | Bacteria | 9173742 |
| 717 | 2954389511 | 2954380949 | Bacteria | 10050426 |
| 718 | 2954682391 | 2954673503 | Bacteria | 9685905 |
| 719 | 2954690533 | 2954682443 | Bacteria | 9862841 |
| 720 | 2954691300 | 2954682443 | Bacteria | 9862841 |
| 721 | 2954700288 | 2954691527 | Bacteria | 10720516 |
| 722 | 2954701941 | 2954701450 | Bacteria | 10834262 |
| 723 | 2954719050 | 2954711539 | Bacteria | 10867210 |
| 724 | 2954729020 | 2954721474 | Bacteria | 10456478 |
| 725 | 2954732791 | 2954731030 | Bacteria | 10243860 |
| 726 | 2954747919 | 2954740390 | Bacteria | 10229294 |
| 727 | 2954751669 | 2954749733 | Bacteria | 10366972 |
| 728 | 2954767045 | 2954759201 | Bacteria | 9358192 |
| 729 | 2966605028 | 2966598605 | Bacteria | 7676064 |
| 730 | 2990061829 | 2990059506 | Bacteria | 9321252 |
| 731 | 2990093415 | 2990088156 | Bacteria | 6657676 |
| 732 | 2997453834 | 2997451912 | Bacteria | 8492419 |
| 733 | 2997605913 | 2997600082 | Bacteria | 9896405 |
| 734 | 3006327773 | 3006321560 | Bacteria | 8247479 |
| 735 | 3006394725 | 3006393351 | Bacteria | 6615579 |
| 736 | 3006428239 | 3006425503 | Bacteria | 6491253 |
| 737 | 3006488145 | 3006486233 | Bacteria | 8157040 |
| 738 | 3006498358 | 3006493962 | Bacteria | 8825450 |
| 739 | 8008560464 | 8008558824 | Bacteria | 10610750 |
| 740 | 8008581340 | 8008574985 | Bacteria | 7815457 |
| 741 | 8023629922 | 8023623736 | Bacteria | 8593882 |
| 742 | 8025486146 | 8025478263 | Bacteria | 8209203 |
| 743 | 8025536304 | 8025530807 | Bacteria | 8495698 |
| 744 | 8033690380 | 8033684223 | Bacteria | 6906479 |
| 745 | 8047901125 | 8047893842 | Bacteria | 11723082 |
| 746 | 8048134188 | 8048127548 | Bacteria | 11053136 |
| 747 | 8048357776 | 8048356638 | Bacteria | 11044339 |
| 748 | 8048378064 | 8048369669 | Bacteria | 11666822 |
| 749 | 8048387162 | 8048379754 | Bacteria | 11877923 |
| 750 | 8048413590 | 8048406513 | Bacteria | 8936924 |
| 751 | 8054161960 | 8054160619 | Bacteria | 7783213 |
| 752 | 8056451310 | 8056447290 | Bacteria | 7680491 |
| 753 | 8056669957 | 8056667051 | Bacteria | 6953971 |
| 754 | 8056830921 | 8056829672 | Bacteria | 9045328 |
| 755 | Ga0466972_0005381 | |||
| 756 | JGI24739J22299_10019885 | |||
| 757 | JGI24751J29686_10008447 | |||
| 758 | rootH2_10017142 | |||
| 759 | rootL2_10120955 | |||
| 760 | rootH1_10054926 | |||
| 761 | Ga0070690_100066842 | |||
| 762 | Ga0070668_100001597 | |||
| 763 | Ga0070668_100107971 | |||
| 764 | Ga0070709_10008130 | |||
| 765 | Ga0070709_10121405 | |||
| 766 | Ga0070714_100139908 | |||
| 767 | Ga0070714_100211569 | |||
| 768 | Ga0070714_100361247 | |||
| 769 | Ga0070713_100050049 | |||
| 770 | Ga0070713_100239094 | |||
| 771 | Ga0070710_10031315 | |||
| 772 | Ga0070710_10065557 | |||
| 773 | Ga0070710_10184810 | |||
| 774 | Ga0070711_100055087 | |||
| 775 | Ga0070708_100001238 | |||
| 776 | Ga0070708_100001603 | |||
| 777 | Ga0070708_100007689 | |||
| 778 | Ga0070708_100054808 | |||
| 779 | Ga0070678_100216422 | |||
| 780 | Ga0070681_10135224 | |||
| 781 | Ga0070706_100006141 | |||
| 782 | Ga0070706_100006398 | |||
| 783 | Ga0070706_100011316 | |||
| 784 | Ga0070706_100027442 | |||
| 785 | Ga0070706_100029379 | |||
| 786 | Ga0070706_100100800 | |||
| 787 | Ga0070706_100533742 | |||
| 788 | Ga0070707_100000041 | |||
| 789 | Ga0070707_100002195 | |||
| 790 | Ga0070707_100009909 | |||
| 791 | Ga0070707_100154956 | |||
| 792 | Ga0070707_100208189 | |||
| 793 | Ga0070707_100365439 | |||
| 794 | Ga0070698_100000082 | |||
| 795 | Ga0070698_100002067 | |||
| 796 | Ga0070698_100009295 | |||
| 797 | Ga0070698_100011159 | |||
| 798 | Ga0070698_100093947 | |||
| 799 | Ga0070698_100133408 | |||
| 800 | Ga0070698_100210811 | |||
| 801 | Ga0070699_100001106 | |||
| 802 | Ga0070699_100024128 | |||
| 803 | Ga0070699_100072824 | |||
| 804 | Ga0070699_100075968 | |||
| 805 | Ga0070684_100181714 | |||
| 806 | Ga0070697_100062947 | |||
| 807 | Ga0070693_100048810 | |||
| 808 | Ga0070665_100222284 | |||
| 809 | Ga0070665_100333663 | |||
| 810 | Ga0070704_100055380 | |||
| 811 | Ga0068856_100088329 | |||
| 812 | Ga0068856_100287295 | |||
| 813 | Ga0068856_100294303 | |||
| 814 | Ga0068858_100092329 | |||
| 815 | Ga0068860_100137867 | |||
| 816 | Ga0081539_10001782 | |||
| 817 | Ga0070717_10006347 | |||
| 818 | Ga0070717_10028441 | |||
| 819 | Ga0070717_10029951 | |||
| 820 | Ga0070717_10076633 | |||
| 821 | Ga0070717_10097614 | |||
| 822 | Ga0070717_10101207 | |||
| 823 | Ga0070717_10148418 | |||
| 824 | Ga0070717_10390760 | |||
| 825 | Ga0075368_10011702 | |||
| 826 | Ga0075363_100001855 | |||
| 827 | Ga0075363_100098289 | |||
| 828 | Ga0070715_10002235 | |||
| 829 | Ga0070716_100002738 | |||
| 830 | Ga0070716_100011213 | |||
| 831 | Ga0070716_100053609 | |||
| 832 | Ga0070712_100063767 | |||
| 833 | Ga0070712_100208351 | |||
| 834 | Ga0075367_10006123 | |||
| 835 | Ga0068871_100109870 | |||
| 836 | Ga0075428_100016560 | |||
| 837 | Ga0075428_100146911 | |||
| 838 | Ga0075430_100007906 | |||
| 839 | Ga0075430_100077789 | |||
| 840 | Ga0075431_100082224 | |||
| 841 | Ga0075431_100101521 | |||
| 842 | Ga0075431_100167629 | |||
| 843 | Ga0075429_100003725 | |||
| 844 | Ga0075429_100220402 | |||
| 845 | Ga0075436_100017666 | |||
| 846 | Ga0099795_10069599 | |||
| 847 | Ga0105245_10027687 | |||
| 848 | Ga0105245_10037190 | |||
| 849 | Ga0105245_10075808 | |||
| 850 | Ga0105245_10163679 | |||
| 851 | Ga0105247_10069779 | |||
| 852 | Ga0105247_10082874 | |||
| 853 | Ga0114129_10002397 | |||
| 854 | Ga0114129_10082137 | |||
| 855 | Ga0114129_10089173 | |||
| 856 | Ga0105243_10192118 | |||
| 857 | Ga0099796_10042921 | |||
| 858 | Ga0105239_10161543 | |||
| 859 | Ga0105246_10047397 | |||
| 860 | Ga0157369_10039018 | |||
| 861 | Ga0163162_10434350 | |||
| 862 | Ga0163163_10013785 | |||
| 863 | Ga0182008_10011941 | |||
| 864 | Ga0157379_10090919 | |||
| 865 | Ga0157376_10022450 | |||
| 866 | Ga0182007_10000651 | |||
| 867 | Ga0183367_1003 | |||
| 868 | Ga0206356_10455475 | |||
| 869 | Ga0209758_1022281 | |||
| 870 | Ga0207426_1001118 | |||
| 871 | Ga0207426_1025321 | |||
| 872 | Ga0207653_10017464 | |||
| 873 | Ga0207692_10011463 | |||
| 874 | Ga0207692_10012952 | |||
| 875 | Ga0207699_10004947 | |||
| 876 | Ga0207699_10010584 | |||
| 877 | Ga0207699_10019147 | |||
| 878 | Ga0207699_10035344 | |||
| 879 | Ga0207684_10000339 | |||
| 880 | Ga0207684_10000574 | |||
| 881 | Ga0207684_10009068 | |||
| 882 | Ga0207684_10013508 | |||
| 883 | Ga0207684_10027890 | |||
| 884 | Ga0207684_10089191 | |||
| 885 | Ga0207684_10124007 | |||
| 886 | Ga0207684_10135934 | |||
| 887 | Ga0207707_10099845 | |||
| 888 | Ga0207693_10005872 | |||
| 889 | Ga0207693_10019021 | |||
| 890 | Ga0207693_10039198 | |||
| 891 | Ga0207663_10006086 | |||
| 892 | Ga0207663_10051538 | |||
| 893 | Ga0207663_10111958 | |||
| 894 | Ga0207663_10319919 | |||
| 895 | Ga0207662_10081946 | |||
| 896 | Ga0207646_10000061 | |||
| 897 | Ga0207646_10001194 | |||
| 898 | Ga0207646_10004121 | |||
| 899 | Ga0207646_10035076 | |||
| 900 | Ga0207646_10163460 | |||
| 901 | Ga0207646_10171107 | |||
| 902 | Ga0207646_10287688 | |||
| 903 | Ga0207687_10090388 | |||
| 904 | Ga0207687_10098105 | |||
| 905 | Ga0207700_10031746 | |||
| 906 | Ga0207664_10007801 | |||
| 907 | Ga0207664_10093413 | |||
| 908 | Ga0207664_10134725 | |||
| 909 | Ga0207664_10431846 | |||
| 910 | Ga0207709_10132559 | |||
| 911 | Ga0207665_10002854 | |||
| 912 | Ga0207665_10004964 | |||
| 913 | Ga0207665_10008897 | |||
| 914 | Ga0207665_10027232 | |||
| 915 | Ga0207679_10152735 | |||
| 916 | Ga0207677_10044687 | |||
| 917 | Ga0207703_10122973 | |||
| 918 | Ga0207708_10078069 | |||
| 919 | Ga0207702_10097459 | |||
| 920 | Ga0207702_10157653 | |||
| 921 | Ga0207702_10249914 | |||
| 922 | Ga0207641_10189423 | |||
| 923 | Ga0207675_100047003 | |||
| 924 | Ga0209813_10019102 | |||
| 925 | Ga0268266_10290928 | |||
| 926 | Ga0268264_10120477 | |||
| 927 | Ga0307517_10002021 | |||
| 928 | Ga0307517_10045362 | |||
| 929 | Ga0307515_10002351 | |||
| 930 | Ga0307515_10099362 | |||
| 931 | Ga0307511_10001434 | |||
| 932 | Ga0307511_10024493 | |||
| 933 | Ga0307511_10105824 | |||
| 934 | Ga0307512_10007403 | |||
| 935 | Ga0307513_10041460 | |||
| 936 | Ga0307509_10007954 | |||
| 937 | Ga0307509_10109895 | |||
| 938 | Ga0307508_10005275 | |||
| 939 | Ga0307508_10008175 | |||
| 940 | Ga0307508_10011922 | |||
| 941 | Ga0307508_10044682 | |||
| 942 | Ga0307508_10068560 | |||
| 943 | Ga0307508_10102587 | |||
| 944 | Ga0307514_10096570 | |||
| 945 | Ga0307516_10002293 | |||
| 946 | Ga0307516_10347563 | |||
| 947 | Ga0307518_10106282 | |||
| 948 | Ga0307416_100066305 | |||
| 949 | Ga0307416_100210301 | |||
| 950 | Ga0307415_100484485 | |||
| 951 | Ga0307507_10007349 | |||
| 952 | Ga0307507_10060199 | |||
| 953 | Ga0307510_10000284 | |||
| 954 | Ga0307510_10216061 | |||
| 955 | Ga0373928_0001836 | |||
| 956 | Ga0373934_0002647 | |||
| 957 | Ga0373934_0005843 | |||
| 958 | Ga0373923_0033816 | |||
| 959 | Ga0373936_0002455 | |||
| 960 | Ga0373941_0010422 | |||
| 961 | Ga0373945_0041357 | |||
| 962 | Ga0373945_0074779 | |||
| 963 | Ga0373954_0023482 | |||
| 964 | Ga0373957_0029446 | |||
| 965 | Ga0373946_0117951 | |||
| 966 | Ga0373955_0019357 | |||
| 967 | Ga0373942_0005770 | |||
| 968 | Ga0373962_0010326 | |||
| 969 | Ga0373931_0011113 | |||
| 970 | Ga0373935_0216669 | |||
| 971 | Ga0373933_0012423 | |||
| 972 | Ga0373933_0030292 | |||
| 973 | Ga0373947_0026091 | |||
| 974 | Ga0373947_0038383 | |||
| 975 | Ga0373937_0065903 | |||
| 976 | Ga0373937_0084399 | |||
| 977 | Ga0373925_0000228 | |||
| 978 | Ga0373925_0110189 | |||
| 979 | Ga0395900_0588473 | |||
| 980 | Ga0395898_0000852 | |||
| 981 | Ga0395898_0017584 | |||
| 982 | Ga0395898_0107668 | |||
| 983 | Ga0395905_0066264 | |||
| 984 | Ga0436364_0181279 | |||
| 985 | Ga0436364_0879590 | |||
| 986 | Ga0395901_0037739 | |||
| 987 | Ga0395901_0038889 | |||
| 988 | Ga0395901_0339485 | |||
| 989 | Ga0395901_0386484 | |||
| 990 | Ga0436363_0716113 | |||
| 991 | Ga0439436_0008290 | |||
| 992 | Ga0439439_0005705 | |||
| 993 | Ga0439439_0012127 | |||
| 994 | Ga0451837_0376999 | |||
| 995 | Ga0451853_0157145 | |||
| 996 | Ga0451853_0666452 | |||
| 997 | Ga0451853_1888606 | |||
| 998 | Ga0451853_2162406 | |||
| 999 | Ga0439433_0003032 | |||
| 1000 | Ga0439433_0010143 | |||
| 1001 | Ga0439442_015217 | |||
| 1002 | Ga0439448_0005473 | |||
| 1003 | Ga0439448_0016187 | |||
| 1004 | Ga0439449_0003059 | |||
| 1005 | Ga0439449_0006221 | |||
| 1006 | Ga0439449_0073549 | |||
| 1007 | Ga0439454_010945 | |||
| 1008 | Ga0439455_0001226 | |||
| 1009 | Ga0439455_0049116 | |||
| 1010 | Ga0439457_004253 | |||
| 1011 | Ga0439457_004833 | |||
| 1012 | Ga0439462_0003900 | |||
| 1013 | Ga0439462_0009240 | |||
| 1014 | Ga0450899_000047 | |||
| 1015 | Ga0450902_013804 | |||
| 1016 | Ga0450903_000086 | |||
| 1017 | Ga0450903_000148 | |||
| 1018 | Ga0450906_002950 | |||
| 1019 | Ga0439458_0000692 | |||
| 1020 | Ga0439458_0002014 | |||
| 1021 | Ga0439434_0041179 | |||
| 1022 | Ga0466969_0039523 | |||
| 1023 | Ga0466969_0039678 | |||
| 1024 | Ga0466972_0003962 | |||
| 1025 | Ga0466972_0017857 | |||
| 1026 | Ga0466965_0017123 | |||
| 1027 | Ga0466966_0003947 | |||
| 1028 | Ga0466966_0007714 | |||
| 1029 | Ga0466966_0027802 | |||
| 1030 | Ga0466966_0053032 | |||
| 1031 | Ga0466961_0011038 | |||
| 1032 | Ga0466961_0020833 | |||
| 1033 | Ga0466961_0131875 | |||
| 1034 | Ga0466963_0000275 | |||
| 1035 | Ga0466963_0000711 | |||
| 1036 | Ga0466963_0006085 | |||
| 1037 | Ga0466963_0007825 | |||
| 1038 | Ga0466963_0026207 | |||
| 1039 | Ga0466963_0077727 | |||
| 1040 | Ga0466963_0143521 | |||
| 1041 | Ga0466971_0013145 | |||
| 1042 | Ga0466971_0025132 | |||
| 1043 | Ga0466968_0081034 | |||
| 1044 | Ga0466970_0001447 | |||
| 1045 | Ga0466970_0003142 | |||
| 1046 | Ga0466957_0000049 | |||
| 1047 | Ga0466960_0013760 | |||
| 1048 | Ga0466960_0135285 | |||
| 1049 | Ga0466960_0176542 | |||
| 1050 | Ga0466959_0000275 | |||
| 1051 | Ga0466959_0006079 | |||
| 1052 | Ga0466959_0043960 | |||
| 1053 | Ga0466958_0000512 | |||
| 1054 | Ga0466958_0005272 | |||
| 1055 | Ga0466958_0045071 | |||
| 1056 | Ga0466967_0001836 | |||
| 1057 | Ga0466967_0015406 | |||
| 1058 | Ga0466967_0158606 | |||
| 1059 | Ga0466967_0284018 | |||
| 1060 | Ga0466967_0317649 | |||
| 1061 | Ga0495617_035370 | |||
| 1062 | Ga0495592_0040288 | |||
| 1063 | Ga0495603_0000157 | |||
| 1064 | Ga0495603_0012082 | |||
| 1065 | Ga0495629_0003774 | |||
| 1066 | Ga0495629_0005897 | |||
| 1067 | Ga0495629_0009621 | |||
| 1068 | Ga0495629_0015245 | |||
| 1069 | Ga0495629_0022583 | |||
| 1070 | Ga0495629_0027046 | |||
| 1071 | Ga0495629_0098848 | |||
| 1072 | Ga0495638_0024661 | |||
| 1073 | Ga0495638_0183038 | |||
| 1074 | Ga0495641_0035285 | |||
| 1075 | Ga0495651_0008074 | |||
| 1076 | Ga0495651_0040154 | |||
| 1077 | Ga0495651_0041023 | |||
| 1078 | Ga0495653_0023073 | |||
| 1079 | Ga0495580_0178196 | |||
| 1080 | Ga0495582_0048966 | |||
| 1081 | Ga0495605_0099417 | |||
| 1082 | Ga0495639_0016737 | |||
| 1083 | Ga0495662_0000752 | |||
| 1084 | Ga0495662_0003337 | |||
| 1085 | Ga0495662_0055442 | |||
| 1086 | Ga0495664_0000894 | |||
| 1087 | Ga0495664_0014672 | |||
| 1088 | Ga0495664_0063309 | |||
| 1089 | Ga0495664_0082492 | |||
| 1090 | Ga0495585_0017819 | |||
| 1091 | Ga0495585_0034128 | |||
| 1092 | Ga0495594_0001377 | |||
| 1093 | Ga0495594_0046614 | |||
| 1094 | Ga0495594_0054783 | |||
| 1095 | Ga0495594_0211944 | |||
| 1096 | Ga0495596_0131152 | |||
| 1097 | Ga0495607_0012056 | |||
| 1098 | Ga0495607_0200848 | |||
| 1099 | Ga0495583_0012953 | |||
| 1100 | Ga0495583_0013898 | |||
| 1101 | Ga0495583_0057481 | |||
| 1102 | Ga0495606_0044769 | |||
| 1103 | Ga0495608_0132940 | |||
| 1104 | Ga0495608_0149608 | |||
| 1105 | Ga0495618_0064783 | |||
| 1106 | Ga0495618_0076046 | |||
| 1107 | Ga0495618_0088913 | |||
| 1108 | Ga0495628_0047344 | |||
| 1109 | Ga0495628_0066014 | |||
| 1110 | Ga0495628_0107883 | |||
| 1111 | Ga0495648_0101967 | |||
| 1112 | Ga0495666_0012772 | |||
| 1113 | Ga0495666_0094740 | |||
| 1114 | Ga0495652_0034056 | |||
| 1115 | Ga0495652_0040184 | |||
| 1116 | Ga0495652_0072084 | |||
| 1117 | Ga0495652_0227702 | |||
| 1118 | Ga0495640_0055326 | |||
| 1119 | Ga0495640_0098608 | |||
| 1120 | Ga0495640_0110799 | |||
| 1121 | Ga0495640_0163953 | |||
| 1122 | Ga0495586_0037958 | |||
| 1123 | Ga0495586_0053853 | |||
| 1124 | Ga0495587_0000273 | |||
| 1125 | Ga0495587_0003110 | |||
| 1126 | Ga0495609_0111272 | |||
| 1127 | Ga0495597_0011946 | |||
| 1128 | Ga0495645_0050563 | |||
| 1129 | Ga0495622_0012722 | |||
| 1130 | Ga0495622_0014579 | |||
| 1131 | Ga0495622_0066159 | |||
| 1132 | Ga0495633_0110633 | |||
| 1133 | Ga0495667_0012947 | |||
| 1134 | Ga0495667_0095472 | |||
| 1135 | Ga0495656_0106920 | |||
| 1136 | Ga0495668_0005005 | |||
| 1137 | Ga0495668_0007768 | |||
| 1138 | Ga0495634_0009608 | |||
| 1139 | Ga0495634_0010573 | |||
| 1140 | Ga0495634_0010984 | |||
| 1141 | Ga0495611_0037052 | |||
| 1142 | Ga0495611_0075547 | |||
| 1143 | Ga0495625_0106347 | |||
| 1144 | Ga0495625_0114415 | |||
| 1145 | Ga0495635_0004978 | |||
| 1146 | Ga0495635_0042723 | |||
| 1147 | Ga0495661_0189729 | |||
| 1148 | Ga0495588_0007242 | |||
| 1149 | Ga0495588_0054232 | |||
| 1150 | Ga0495657_0000049 | |||
| 1151 | Ga0495657_0006566 | |||
| 1152 | Ga0495657_0007365 | |||
| 1153 | Ga0495657_0010104 | |||
| 1154 | Ga0495657_0015874 | |||
| 1155 | Ga0495657_0025086 | |||
| 1156 | Ga0495657_0081335 | |||
| 1157 | Ga0495599_0094688 | |||
| 1158 | Ga0495623_0152517 | |||
| 1159 | Ga0495646_0021018 | |||
| 1160 | Ga0495646_0061720 | |||
| 1161 | Ga0495669_0036377 | |||
| 1162 | Ga0495613_0002706 | |||
| 1163 | Ga0495613_0005232 | |||
| 1164 | Ga0495613_0009424 | |||
| 1165 | Ga0495613_0035121 | |||
| 1166 | Ga0495613_0109505 | |||
| 1167 | Ga0495613_0275654 | |||
| 1168 | Ga0495624_0037703 | |||
| 1169 | Ga0495671_0010196 | |||
| 1170 | Ga0495649_0069336 | |||
| 1171 | Ga0495589_0035800 | |||
| 1172 | Ga0495589_0056258 | |||
| 1173 | Ga0495589_0056698 | |||
| 1174 | Ga0495600_0061829 | |||
| 1175 | Ga0495600_0193450 | |||
| 1176 | Ga0495660_0004050 | |||
| 1177 | Ga0495660_0027879 | |||
| 1178 | Ga0495581_0001468 | |||
| 1179 | Ga0495604_0003659 | |||
| 1180 | Ga0495604_0021890 | |||
| 1181 | Ga0495604_0041408 | |||
| 1182 | Ga0495604_0068137 | |||
| 1183 | Ga0495604_0078295 | |||
| 1184 | Ga0495604_0111833 | |||
| 1185 | Ga0495604_0164736 | |||
| 1186 | Ga0495636_0003376 | |||
| 1187 | Ga0495636_0006119 | |||
| 1188 | Ga0495636_0035485 | |||
| 1189 | Ga0495636_0051179 | |||
| 1190 | Ga0495674_0176019 | |||
| 1191 | Ga0495674_0213526 | |||
| 1192 | Ga0495676_0001217 | |||
| 1193 | Ga0495676_0006574 | |||
| 1194 | Ga0495676_0010176 | |||
| 1195 | Ga0495676_0019178 | |||
| 1196 | Ga0495676_0023405 | |||
| 1197 | Ga0495676_0039025 | |||
| 1198 | Ga0495676_0067065 | |||
| 1199 | Ga0495680_0006312 | |||
| 1200 | Ga0495680_0015996 | |||
| 1201 | Ga0495680_0028167 | |||
| 1202 | Ga0495680_0071898 | |||
| 1203 | Ga0495683_0086807 | |||
| 1204 | Ga0495687_000825 | |||
| 1205 | Ga0495687_020501 | |||
| 1206 | Ga0495687_041344 | |||
| 1207 | Ga0495675_0046460 | |||
| 1208 | Ga0495675_0078692 | |||
| 1209 | Ga0495675_0101560 | |||
| 1210 | Ga0495685_000959 | |||
| 1211 | Ga0495685_003140 | |||
| 1212 | Ga0495685_009416 | |||
| 1213 | Ga0495685_025470 | |||
| 1214 | Ga0495681_0003781 | |||
| 1215 | Ga0495681_0016345 | |||
| 1216 | Ga0495681_0031479 | |||
| 1217 | Ga0495684_0029594 | |||
| 1218 | Ga0495684_0065883 | |||
| 1219 | Ga0495684_0123164 | |||
| 1220 | Ga0495684_0210223 | |||
| 1221 | Ga0495686_0081389 | |||
| 1222 | Ga0495686_0193921 | |||
| 1223 | Ga0495593_0010985 | |||
| 1224 | Ga0495593_0024695 | |||
| 1225 | Ga0495602_0003730 | |||
| 1226 | Ga0495602_0017605 | |||
| 1227 | Ga0495602_0026584 | |||
| 1228 | Ga0495614_0000100 | |||
| 1229 | Ga0495614_0016273 | |||
| 1230 | Ga0495614_0022403 | |||
| 1231 | Ga0495614_0075702 | |||
| 1232 | Ga0495626_0016585 | |||
| 1233 | Ga0496102_0074114 | |||
| 1234 | Ga0496102_0089781 | |||
| 1235 | Ga0496102_0114799 | |||
| 1236 | Ga0496102_0136116 | |||
| 1237 | Ga0496103_0088193 | |||
| 1238 | Ga0496103_0132060 | |||
| 1239 | Ga0496104_0029401 | |||
| 1240 | Ga0496104_0122704 | |||
| 1241 | Ga0496105_0044743 | |||
| 1242 | Ga0496106_0094004 | |||
| 1243 | Ga0496108_0067294 | |||
| 1244 | Ga0496108_0082603 | |||
| 1245 | Ga0496109_0119562 | |||
| 1246 | Ga0496109_0321124 | |||
| 1247 | Ga0496109_0334832 | |||
| 1248 | Ga0496110_0048242 | |||
| 1249 | Ga0496111_0052440 | |||
| 1250 | Ga0496111_0070102 | |||
| 1251 | Ga0496112_0009016 | |||
| 1252 | Ga0496112_0065046 | |||
| 1253 | Ga0496112_0084631 | |||
| 1254 | Ga0496113_0009989 | |||
| 1255 | Ga0496113_0013158 | |||
| 1256 | Ga0496113_0218962 | |||
| 1257 | Ga0496115_0118693 | |||
| 1258 | Ga0501031_0002554 | |||
| 1259 | Ga0501031_0007113 | |||
| 1260 | Ga0501031_0111330 | |||
| 1261 | Ga0501032_0005207 | |||
| 1262 | Ga0501032_0008122 | |||
| 1263 | Ga0501032_0036693 | |||
| 1264 | Ga0501032_0040376 | |||
| 1265 | Ga0501032_0041774 | |||
| 1266 | Ga0501032_0084323 | |||
| 1267 | Ga0501032_0104728 | |||
| 1268 | Ga0501033_0009248 | |||
| 1269 | Ga0501033_0018237 | |||
| 1270 | Ga0501033_0076224 | |||
| 1271 | Ga0501033_0116892 | |||
| 1272 | Ga0501034_0008974 | |||
| 1273 | Ga0501034_0044166 | |||
| 1274 | Ga0501034_0045827 | |||
| 1275 | Ga0501034_0056777 | |||
| 1276 | Ga0501034_0172664 | |||
| 1277 | Ga0501036_0000708 | |||
| 1278 | Ga0501036_0010485 | |||
| 1279 | Ga0501036_0017843 | |||
| 1280 | Ga0501036_0019366 | |||
| 1281 | Ga0501036_0039257 | |||
| 1282 | Ga0501036_0046363 | |||
| 1283 | Ga0501036_0088166 | |||
| 1284 | Ga0501036_0217296 | |||
| 1285 | Ga0501037_0002174 | |||
| 1286 | Ga0501037_0012944 | |||
| 1287 | Ga0501037_0028794 | |||
| 1288 | Ga0501037_0066246 | |||
| 1289 | Ga0501037_0139147 | |||
| 1290 | Ga0501038_0006729 | |||
| 1291 | Ga0501038_0035589 | |||
| 1292 | Ga0501038_0042919 | |||
| 1293 | Ga0501038_0052424 | |||
| 1294 | Ga0501038_0120392 | |||
| 1295 | Ga0501038_0122948 | |||
| 1296 | Ga0501039_0015458 | |||
| 1297 | Ga0501039_0052205 | |||
| 1298 | Ga0501039_0195296 | |||
| 1299 | Ga0501040_0001445 | |||
| 1300 | Ga0501041_0024673 | |||
| 1301 | Ga0501042_0011296 | |||
| 1302 | Ga0501042_0022777 | |||
| 1303 | Ga0501042_0161686 | |||
| 1304 | Ga0501043_0004336 | |||
| 1305 | Ga0501043_0007163 | |||
| 1306 | Ga0501043_0009359 | |||
| 1307 | Ga0501043_0010698 | |||
| 1308 | Ga0501043_0021683 | |||
| 1309 | Ga0501043_0041318 | |||
| 1310 | Ga0501043_0081138 | |||
| 1311 | Ga0501046_0006788 | |||
| 1312 | Ga0501046_0047639 | |||
| 1313 | Ga0501046_0107107 | |||
| 1314 | Ga0501046_0113934 | |||
| 1315 | Ga0501047_0000103 | |||
| 1316 | Ga0501047_0000353 | |||
| 1317 | Ga0501047_0009882 | |||
| 1318 | Ga0501047_0012213 | |||
| 1319 | Ga0501047_0029789 | |||
| 1320 | Ga0501047_0044687 | |||
| 1321 | Ga0501047_0052148 | |||
| 1322 | Ga0501047_0200931 | |||
| 1323 | Ga0501048_0028202 | |||
| 1324 | Ga0501048_0062619 | |||
| 1325 | Ga0501067_0003009 | |||
| 1326 | Ga0501068_0000656 | |||
| 1327 | Ga0501069_0001559 | |||
| 1328 | Ga0501070_0025530 | |||
| 1329 | Ga0501070_0150724 | |||
| 1330 | Ga0501070_0294409 | |||
| 1331 | Ga0501071_0000349 | |||
| 1332 | Ga0501071_0055976 | |||
| 1333 | Ga0501072_0002398 | |||
| 1334 | Ga0501073_0064576 | |||
| 1335 | Ga0501073_0090558 | |||
| 1336 | Ga0501074_0000866 | |||
| 1337 | Ga0501074_0003063 | |||
| 1338 | Ga0501074_0009494 | |||
| 1339 | Ga0501075_0106263 | |||
| 1340 | Ga0501075_0291351 | |||
| 1341 | Ga0501076_0056888 | |||
| 1342 | Ga0501076_0249859 | |||
| 1343 | Ga0501080_0063380 | |||
| 1344 | Ga0501080_0241783 | |||
| 1345 | Ga0501083_0008989 | |||
| 1346 | Ga0501035_0002009 | |||
| 1347 | Ga0501035_0005523 | |||
| 1348 | Ga0501035_0023285 | |||
| 1349 | Ga0501035_0032516 | |||
| 1350 | Ga0501035_0042517 | |||
| 1351 | Ga0501035_0071330 | |||
| 1352 | Ga0501035_0126150 | |||
| 1353 | Ga0501035_0134994 | |||
| 1354 | Ga0501035_0148260 | |||
| 1355 | Ga0501044_0001895 | |||
| 1356 | Ga0501044_0001963 | |||
| 1357 | Ga0501044_0018743 | |||
| 1358 | Ga0501044_0021222 | |||
| 1359 | Ga0501044_0024024 | |||
| 1360 | Ga0501044_0052638 | |||
| 1361 | Ga0501044_0064164 | |||
| 1362 | Ga0501044_0066117 | |||
| 1363 | Ga0501044_0192925 | |||
| 1364 | Ga0501044_0195659 | |||
| 1365 | Ga0501044_0321198 | |||
| 1366 | Ga0501045_0360987 | |||
| 1367 | nmdc:mga03n38_56910_c1 | |||
| 1368 | nmdc:mga0yw44_13731_c1 | |||
| 1369 | nmdc:mga06z11_31385_c1 | |||
| 1370 | nmdc:mga04h51_22801_c1 | |||
| 1371 | nmdc:mga05p37_2963_c1 | |||
| 1372 | nmdc:mga05p37_820_c1 | |||
| 1373 | nmdc:mga09592_5182_c1 | |||
| 1374 | nmdc:mga0qj67_14923_c1 | |||
| 1375 | nmdc:mga0qj67_531_c1 | |||
| 1376 | nmdc:mga06r32_56752_c1 | |||
| 1377 | nmdc:mga06r32_60464_c1 | |||
| 1378 | nmdc:mga0rr50_106212_c1 | |||
| 1379 | nmdc:mga08x19_147381_c1 | |||
| 1380 | nmdc:mga0a205_24398_c1 | |||
| 1381 | Ga0495612_0019408 | |||
| 1382 | Ga0495655_0029301 | |||
| 1383 | Ga0495595_0028600 | |||
| 1384 | Ga0495619_0038670 | |||
| 1385 | Ga0500644_0021558 | |||
| 1386 | Ga0500640_029375 | |||
| 1387 | Ga0500556_0058397 | |||
| 1388 | Ga0500560_000753 | |||
| 1389 | Ga0500560_017345 | |||
| 1390 | Ga0500572_015599 | |||
| 1391 | Ga0500580_085925 | |||
| 1392 | Ga0500594_0025002 | |||
| 1393 | Ga0500621_039959 | |||
| 1394 | Ga0500628_039880 | |||
| 1395 | Ga0500561_0003140 | |||
| 1396 | Ga0500633_0007523 | |||
| 1397 | Ga0500634_0060929 | |||
| 1398 | Ga0500656_007804 | |||
| 1399 | Ga0501084_0015209 | |||
| 1400 | Ga0587093_004061 | |||
| 1401 | Ga0587078_003215 | |||
| 1402 | Ga0587111_0003527 | |||
| 1403 | Ga0501082_0040583 | |||
| 1404 | Ga0466962_0000081 | |||
| 1405 | Ga0466962_0007836 | |||
| 1406 | Ga0466962_0018367 | |||
| 1407 | 2547408771 | |||
| 1408 | 2554260117 | |||
| 1409 | 2585299512 | |||
| 1410 | 2585305819 | |||
| 1411 | 2585305909 | |||
| 1412 | 2585315149 | |||
| 1413 | 2616693550 | |||
| 1414 | 2616900994 | |||
| 1415 | 2643760477 | |||
| 1416 | 2643898835 | |||
| 1417 | 2643947247 | |||
| 1418 | 2644270190 | |||
| 1419 | 2644386393 | |||
| 1420 | 2644403604 | |||
| 1421 | 2644433282 | |||
| 1422 | 2644441901 | |||
| 1423 | 2644459560 | |||
| 1424 | 2644630670 | |||
| 1425 | 2676487727 | |||
| 1426 | 2768643785 | |||
| 1427 | 2784586208 | |||
| 1428 | 2785346688 | |||
| 1429 | 2785366322 | |||
| 1430 | 2785366439 | |||
| 1431 | 2786667303 | |||
| 1432 | 2786675858 | |||
| 1433 | 2793976982 | |||
| 1434 | 2808846952 | |||
| 1435 | 2808917669 | |||
| 1436 | 2809229604 | |||
| 1437 | 2811846535 | |||
| 1438 | 2812361375 | |||
| 1439 | 2812477305 | |||
| 1440 | 2819699939 | |||
| 1441 | 2852642625 | |||
| 1442 | 2862180981 | |||
| 1443 | 2862282471 | |||
| 1444 | 2862293570 | |||
| 1445 | 2862387028 | |||
| 1446 | 2862513738 | |||
| 1447 | 2862580580 | |||
| 1448 | 2867346752 | |||
| 1449 | 2867375194 | |||
| 1450 | 2867436882 | |||
| 1451 | 2867478162 | |||
| 1452 | 2873158005 | |||
| 1453 | 2875392167 | |||
| 1454 | 2877684096 | |||
| 1455 | 2877684196 | |||
| 1456 | 2884697734 | |||
| 1457 | 2895431856 | |||
| 1458 | 2895444836 | |||
| 1459 | 2912723498 | |||
| 1460 | 2912726735 | |||
| 1461 | 2912758329 | |||
| 1462 | 2918501918 | |||
| 1463 | 2919470150 | |||
| 1464 | 2935391450 | |||
| 1465 | 2935393119 | |||
| 1466 | 2946052732 | |||
| 1467 | 2946064709 | |||
| 1468 | 2946073084 | |||
| 1469 | 2947224675 | |||
| 1470 | 2954008300 | |||
| 1471 | 2954389511 | |||
| 1472 | 2954682391 | |||
| 1473 | 2954690533 | |||
| 1474 | 2954691300 | |||
| 1475 | 2954700288 | |||
| 1476 | 2954701941 | |||
| 1477 | 2954719050 | |||
| 1478 | 2954729020 | |||
| 1479 | 2954732791 | |||
| 1480 | 2954747919 | |||
| 1481 | 2954751669 | |||
| 1482 | 2954767045 | |||
| 1483 | 2966605028 | |||
| 1484 | 2990061829 | |||
| 1485 | 2990093415 | |||
| 1486 | 2997453834 | |||
| 1487 | 2997605913 | |||
| 1488 | 3006327773 | |||
| 1489 | 3006394725 | |||
| 1490 | 3006428239 | |||
| 1491 | 3006488145 | |||
| 1492 | 3006498358 | |||
| 1493 | 8008560464 | |||
| 1494 | 8008581340 | |||
| 1495 | 8023629922 | |||
| 1496 | 8025486146 | |||
| 1497 | 8025536304 | |||
| 1498 | 8033690380 | |||
| 1499 | 8047901125 | |||
| 1500 | 8048134188 | |||
| 1501 | 8048357776 | |||
| 1502 | 8048378064 | |||
| 1503 | 8048387162 | |||
| 1504 | 8048413590 | |||
| 1505 | 8054161960 | |||
| 1506 | 8056451310 | |||
| 1507 | 8056669957 | |||
| 1508 | 8056830921 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lry-assembly1.cif.gz_B | crystal structure of the e.coli dhar(n)-dhak(t79l) complex | 0.972 | 1 | 329 |
| 4lry-assembly1.cif.gz_B | crystal structure of the e.coli dhar(n)-dhak(t79l) complex | 0.9691 | 1 | 329 |
| 3pnk-assembly1.cif.gz_B | crystal structure of e.coli dha kinase dhak | 0.9593 | 2 | 328 |
| 3pnk-assembly1.cif.gz_B | crystal structure of e.coli dha kinase dhak | 0.9508 | 2 | 328 |
| 3ct4-assembly1.cif.gz_A | structure of dha-kinase subunit dhak from l. lactis | 0.9499 | 2 | 325 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P76015_11_183_3.40.50.10440 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 | 0.9809 | 11 | 182 | 3.40.50.10440 |
| af_P76015_11_183_3.40.50.10440 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 | 0.9698 | 11 | 182 | 3.40.50.10440 |
| af_Q2G1Z0_14_178_3.40.50.10440 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 | 0.9496 | 14 | 181 | 3.40.50.10440 |
| af_Q2G1Z0_180_322_3.30.1180.20 | Alpha Beta;2-Layer Sandwich;Hypothetical Protein Tm841; Chain: A;domain 3;Dihydroxyacetone kinase; domain 2 | 0.9387 | 185 | 319 | 3.30.1180.20 |
| af_Q9N5C4_13_185_3.40.50.10440 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 | 0.935 | 12 | 182 | 3.40.50.10440 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6B3GB48-F1-model_v4 | Dihydroxyacetone kinase subunit DhaK | 0.9903 | 1 | 211 |
GO:0004371
GO:0005829 GO:0019563 |
| AF-A0A7K2FDW1-F1-model_v4 | Dihydroxyacetone kinase subunit DhaK (EC 2.7.1.121) | 0.9872 | 1 | 329 |
GO:0004371
GO:0005829 GO:0019563 GO:0047324 |
| AF-A0A6A0ANJ3-F1-model_v4 | Dihydroxyacetone kinase subunit DhaK | 0.9872 | 3 | 329 |
GO:0004371
GO:0005829 GO:0019563 |
| AF-A0A1R0M6I1-F1-model_v4 | Dihydroxyacetone kinase subunit DhaK | 0.9869 | 1 | 329 |
GO:0004371
GO:0005829 GO:0019563 |
| AF-A0A0U3TKS4-F1-model_v4 | Dihydroxyacetone kinase | 0.9868 | 2 | 329 |
GO:0004371
GO:0005829 GO:0019563 |