F479266

General Info

Members Datasets Scaffolds Average Seq Length
754 398 1508 328

Family's Representative Sequence

Representative Sequence 3300044658|Ga0466972_0005381|Ga0466972_0005381_3165_4271
Length 368
Sequence MSMPCSSSKSDALKNVRTRDRRLANIDTADSEWTQEAPMKMLINVPETVVADALRGMAAAHPELTVDVENRVIVRRDAPVAGKVALVSGGGSGHEPLHGGFVGPGMLSAACPGEVFTSPVPDQMVRAAAAVDSGAGVLFIVKNYTGDVLNFDMAAELAEDEGIQVAKVLVNDDVAVTDSLYTAGRRGTGATLFVEKIAGAAADEGQPLERVQSIARQVNENSRSFGVALSACTTPAKGTPTFDLPPGELELGIGIHGEPGRERRPMMTAREIADFSVNAVLDDLEPRNPVLVLVNGMGATPLLELYGYNAEVQRVLSERGVPVARTLVGNYVTSLDMAGASVTLCQIDEELLRLWEAPVSTPALRWGL

Samples

Sample ID Description Type Environment
1 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
9 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
10 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
11 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
12 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
13 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
14 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
28 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
29 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
30 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
31 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
32 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
33 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
34 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
35 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
36 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
37 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
38 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
39 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
40 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
41 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
42 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
43 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
44 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
45 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
46 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
53 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
54 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
55 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
58 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
59 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
60 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
61 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
62 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
84 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
87 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
90 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
91 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
94 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
95 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
96 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
97 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
98 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
99 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
100 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
101 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
102 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
103 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
104 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
105 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
106 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
107 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
108 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
109 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
110 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
111 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
112 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
113 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
114 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
115 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
116 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
117 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
118 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
119 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
120 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
121 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
122 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
125 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
126 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
127 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
128 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
129 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
130 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
131 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
132 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
133 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
134 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
135 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
136 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
137 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
138 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
139 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
140 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
141 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
142 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
154 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
155 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
160 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
161 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
162 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
163 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
164 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
165 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
166 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
167 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
168 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
169 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
170 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
171 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
172 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
173 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
174 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
175 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
176 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
177 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
178 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
179 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
180 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
181 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
182 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
183 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
184 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
185 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
186 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
187 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
188 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
189 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
190 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
191 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
194 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
195 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
196 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
197 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
198 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
199 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
200 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
201 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
202 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
203 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
204 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
205 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
206 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
207 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
208 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
209 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
210 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
211 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
212 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
213 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
214 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
215 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
216 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
217 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
218 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
219 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
220 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
221 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
222 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
223 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
224 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
225 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
226 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
227 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
228 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
229 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
230 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
231 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
232 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
233 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
234 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
235 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
236 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
237 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
238 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
239 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
240 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
241 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
242 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
243 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
244 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
245 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
246 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
247 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
248 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
250 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
252 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
255 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
256 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
257 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
258 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
259 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
260 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
261 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
265 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
266 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
269 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
270 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
271 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
272 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
273 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
274 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
275 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
276 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
277 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
278 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
279 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
280 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
281 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
282 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
283 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
284 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
285 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
286 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
287 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
288 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
289 3300053113 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 endosphere Metagenome Endosphere
290 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
291 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
292 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
293 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
294 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
295 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
296 3300053732 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 endosphere Metagenome Endosphere
297 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
298 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
299 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
300 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
301 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
302 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
303 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
304 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
305 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
306 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
307 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
308 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
309 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
310 2643221548 Streptomyces sp. Root55 Isolate Unclassified
311 2643221578 Streptomyces sp. Root63 Isolate Unclassified
312 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
313 2643221647 Streptomyces sp. Root369 Isolate Unclassified
314 2643221670 Streptomyces sp. Root431 Isolate Unclassified
315 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
316 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
317 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
318 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
319 2643221714 Streptomyces sp. Root264 Isolate Unclassified
320 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
321 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
322 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
323 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
324 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
325 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
326 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
327 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
328 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
329 2808606448 Streptomyces sp. 193411 Isolate Unclassified
330 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
331 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
332 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
333 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
334 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
335 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
336 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
337 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
338 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
339 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
340 2862574272 Streptomyces sp. AcE210 Isolate Nodule
341 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
342 2867369537 Streptomyces sp. Z26 Isolate Unclassified
343 2867428634 Streptomyces sp. RP5T Isolate Unclassified
344 2867475112 Streptomyces sp. TM32 Isolate Unclassified
345 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
346 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
347 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
348 2884693830 Nonomuraea phyllanthi WYY166 Isolate Unclassified
349 2895427314 Nonomuraea sp. PA05 Isolate Unclassified
350 2895442618 Nonomuraea phyllanthi PA1-10 Isolate Unclassified
351 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
352 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
353 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
354 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
355 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
356 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
357 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
358 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
359 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
360 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
361 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
362 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
363 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
364 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
365 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
366 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
367 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
368 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
369 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
370 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
371 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
372 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
373 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
374 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
375 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
376 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
377 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
378 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
379 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
380 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
381 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
382 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
383 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
384 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
385 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
386 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
387 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
388 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
389 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
390 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
391 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
392 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
393 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
394 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
395 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
396 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
397 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
398 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 85.94
Metatranscriptomes 0.53
Isolates 13.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.45
Nodule 0.4
Rhizoplane 3.45
Rhizosphere 82.23
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466972_0005381 3300044658 Bacteria 6413
2 JGI24739J22299_10019885 3300001989 Bacteria 2401
3 JGI24751J29686_10008447 3300002459 Bacteria 2108
4 rootH2_10017142 3300003320 Bacteria 3103
5 rootL2_10120955 3300003322 Bacteria 2316
6 rootH1_10054926 3300003323 Bacteria 1320
7 Ga0070690_100066842 3300005330 Bacteria 2328
8 Ga0070668_100001597 3300005347 Bacteria 16399
9 Ga0070668_100107971 3300005347 Bacteria 2213
10 Ga0070709_10008130 3300005434 Bacteria 5758
11 Ga0070709_10121405 3300005434 Bacteria 1772
12 Ga0070714_100139908 3300005435 Bacteria 2171
13 Ga0070714_100211569 3300005435 Bacteria 1777
14 Ga0070714_100361247 3300005435 Bacteria 1365
15 Ga0070713_100050049 3300005436 Bacteria 3449
16 Ga0070713_100239094 3300005436 Bacteria 1653
17 Ga0070710_10031315 3300005437 Bacteria 2870
18 Ga0070710_10065557 3300005437 Bacteria 2081
19 Ga0070710_10184810 3300005437 Bacteria 1307
20 Ga0070711_100055087 3300005439 Bacteria 2746
21 Ga0070708_100001238 3300005445 Bacteria 19640
22 Ga0070708_100001603 3300005445 Bacteria 17338
23 Ga0070708_100007689 3300005445 Bacteria 8637
24 Ga0070708_100054808 3300005445 Bacteria 3543
25 Ga0070678_100216422 3300005456 Bacteria 1590
26 Ga0070681_10135224 3300005458 Bacteria 2396
27 Ga0070706_100006141 3300005467 Bacteria 11366
28 Ga0070706_100006398 3300005467 Bacteria 11131
29 Ga0070706_100011316 3300005467 Bacteria 8290
30 Ga0070706_100027442 3300005467 Bacteria 5240
31 Ga0070706_100029379 3300005467 Bacteria 5065
32 Ga0070706_100100800 3300005467 Bacteria 2684
33 Ga0070706_100533742 3300005467 Bacteria 1091
34 Ga0070707_100000041 3300005468 Bacteria 111077
35 Ga0070707_100002195 3300005468 Bacteria 18652
36 Ga0070707_100009909 3300005468 Bacteria 8870
37 Ga0070707_100154956 3300005468 Bacteria 2232
38 Ga0070707_100208189 3300005468 Bacteria 1906
39 Ga0070707_100365439 3300005468 Bacteria 1402
40 Ga0070698_100000082 3300005471 Bacteria 73573
41 Ga0070698_100002067 3300005471 Bacteria 22298
42 Ga0070698_100009295 3300005471 Bacteria 10547
43 Ga0070698_100011159 3300005471 Bacteria 9545
44 Ga0070698_100093947 3300005471 Bacteria 2978
45 Ga0070698_100133408 3300005471 Bacteria 2438
46 Ga0070698_100210811 3300005471 Bacteria 1877
47 Ga0070699_100001106 3300005518 Bacteria 25074
48 Ga0070699_100024128 3300005518 Bacteria 5241
49 Ga0070699_100072824 3300005518 Bacteria 2989
50 Ga0070699_100075968 3300005518 Bacteria 2924
51 Ga0070684_100181714 3300005535 Bacteria 1913
52 Ga0070697_100062947 3300005536 Bacteria 3029
53 Ga0070693_100048810 3300005547 Bacteria 2412
54 Ga0070665_100222284 3300005548 Bacteria 1889
55 Ga0070665_100333663 3300005548 Bacteria 1521
56 Ga0070704_100055380 3300005549 Bacteria 2811
57 Ga0068856_100088329 3300005614 Bacteria 3082
58 Ga0068856_100287295 3300005614 Bacteria 1662
59 Ga0068856_100294303 3300005614 Bacteria 1640
60 Ga0068858_100092329 3300005842 Bacteria 2818
61 Ga0068860_100137867 3300005843 Bacteria 2344
62 Ga0081539_10001782 3300005985 Bacteria 34184
63 Ga0070717_10006347 3300006028 Bacteria 8694
64 Ga0070717_10028441 3300006028 Bacteria 4476
65 Ga0070717_10029951 3300006028 Bacteria 4371
66 Ga0070717_10076633 3300006028 Bacteria 2799
67 Ga0070717_10097614 3300006028 Bacteria 2490
68 Ga0070717_10101207 3300006028 Bacteria 2447
69 Ga0070717_10148418 3300006028 Bacteria 2027
70 Ga0070717_10390760 3300006028 Bacteria 1248
71 Ga0075368_10011702 3300006042 Bacteria 3197
72 Ga0075363_100001855 3300006048 Bacteria 8322
73 Ga0075363_100098289 3300006048 Bacteria 1618
74 Ga0070715_10002235 3300006163 Bacteria 5880
75 Ga0070716_100002738 3300006173 Bacteria 8176
76 Ga0070716_100011213 3300006173 Bacteria 4512
77 Ga0070716_100053609 3300006173 Bacteria 2300
78 Ga0070712_100063767 3300006175 Bacteria 2610
79 Ga0070712_100208351 3300006175 Bacteria 1540
80 Ga0075367_10006123 3300006178 Bacteria 6049
81 Ga0068871_100109870 3300006358 Bacteria 2318
82 Ga0075428_100016560 3300006844 Bacteria 8139
83 Ga0075428_100146911 3300006844 Bacteria 2562
84 Ga0075430_100007906 3300006846 Bacteria 8993
85 Ga0075430_100077789 3300006846 Bacteria 2780
86 Ga0075431_100082224 3300006847 Bacteria 3325
87 Ga0075431_100101521 3300006847 Bacteria 2968
88 Ga0075431_100167629 3300006847 Bacteria 2257
89 Ga0075429_100003725 3300006880 Bacteria 12995
90 Ga0075429_100220402 3300006880 Bacteria 1662
91 Ga0075436_100017666 3300006914 Bacteria 4883
92 Ga0099795_10069599 3300007788 Bacteria 1325
93 Ga0105245_10027687 3300009098 Bacteria 4994
94 Ga0105245_10037190 3300009098 Bacteria 4328
95 Ga0105245_10075808 3300009098 Bacteria 3063
96 Ga0105245_10163679 3300009098 Bacteria 2112
97 Ga0105247_10069779 3300009101 Bacteria 2194
98 Ga0105247_10082874 3300009101 Bacteria 2024
99 Ga0114129_10002397 3300009147 Bacteria 26039
100 Ga0114129_10082137 3300009147 Bacteria 4478
101 Ga0114129_10089173 3300009147 Bacteria 4275
102 Ga0105243_10192118 3300009148 Bacteria 1784
103 Ga0099796_10042921 3300010159 Bacteria 1539
104 Ga0105239_10161543 3300010375 Bacteria 2503
105 Ga0105246_10047397 3300011119 Bacteria 2934
106 Ga0157369_10039018 3300013105 Bacteria 5191
107 Ga0163162_10434350 3300013306 Bacteria 1445
108 Ga0163163_10013785 3300014325 Bacteria 7411
109 Ga0182008_10011941 3300014497 Bacteria 4603
110 Ga0157379_10090919 3300014968 Bacteria 2738
111 Ga0157376_10022450 3300014969 Bacteria 4920
112 Ga0182007_10000651 3300015262 Bacteria 19925
113 Ga0183367_1003 3300015688 Bacteria 814276
114 Ga0206356_10455475 3300020070 Bacteria 1329
115 Ga0209758_1022281 3300025297 Bacteria 2913
116 Ga0207426_1001118 3300025302 Bacteria 24589
117 Ga0207426_1025321 3300025302 Bacteria 1999
118 Ga0207653_10017464 3300025885 Bacteria 2259
119 Ga0207692_10011463 3300025898 Bacteria 3774
120 Ga0207692_10012952 3300025898 Bacteria 3601
121 Ga0207699_10004947 3300025906 Bacteria 6373
122 Ga0207699_10010584 3300025906 Bacteria 4636
123 Ga0207699_10019147 3300025906 Bacteria 3643
124 Ga0207699_10035344 3300025906 Bacteria 2843
125 Ga0207684_10000339 3300025910 Bacteria 65102
126 Ga0207684_10000574 3300025910 Bacteria 44726
127 Ga0207684_10009068 3300025910 Bacteria 8810
128 Ga0207684_10013508 3300025910 Bacteria 7062
129 Ga0207684_10027890 3300025910 Bacteria 4809
130 Ga0207684_10089191 3300025910 Bacteria 2627
131 Ga0207684_10124007 3300025910 Bacteria 2216
132 Ga0207684_10135934 3300025910 Bacteria 2111
133 Ga0207707_10099845 3300025912 Bacteria 2537
134 Ga0207693_10005872 3300025915 Bacteria 10189
135 Ga0207693_10019021 3300025915 Bacteria 5467
136 Ga0207693_10039198 3300025915 Bacteria 3731
137 Ga0207663_10006086 3300025916 Bacteria 6137
138 Ga0207663_10051538 3300025916 Bacteria 2563
139 Ga0207663_10111958 3300025916 Bacteria 1853
140 Ga0207663_10319919 3300025916 Bacteria 1165
141 Ga0207662_10081946 3300025918 Bacteria 1970
142 Ga0207646_10000061 3300025922 Bacteria 151425
143 Ga0207646_10001194 3300025922 Bacteria 32687
144 Ga0207646_10004121 3300025922 Bacteria 15968
145 Ga0207646_10035076 3300025922 Bacteria 4533
146 Ga0207646_10163460 3300025922 Bacteria 2009
147 Ga0207646_10171107 3300025922 Bacteria 1961
148 Ga0207646_10287688 3300025922 Bacteria 1485
149 Ga0207687_10090388 3300025927 Bacteria 2231
150 Ga0207687_10098105 3300025927 Bacteria 2150
151 Ga0207700_10031746 3300025928 Bacteria 3756
152 Ga0207664_10007801 3300025929 Bacteria 7434
153 Ga0207664_10093413 3300025929 Bacteria 2471
154 Ga0207664_10134725 3300025929 Bacteria 2083
155 Ga0207664_10431846 3300025929 Bacteria 1174
156 Ga0207709_10132559 3300025935 Bacteria 1700
157 Ga0207665_10002854 3300025939 Bacteria 11599
158 Ga0207665_10004964 3300025939 Bacteria 8876
159 Ga0207665_10008897 3300025939 Bacteria 6594
160 Ga0207665_10027232 3300025939 Bacteria 3777
161 Ga0207679_10152735 3300025945 Bacteria 1881
162 Ga0207677_10044687 3300026023 Bacteria 2953
163 Ga0207703_10122973 3300026035 Bacteria 2230
164 Ga0207708_10078069 3300026075 Bacteria 2542
165 Ga0207702_10097459 3300026078 Bacteria 2588
166 Ga0207702_10157653 3300026078 Bacteria 2070
167 Ga0207702_10249914 3300026078 Bacteria 1665
168 Ga0207641_10189423 3300026088 Bacteria 1890
169 Ga0207675_100047003 3300026118 Bacteria 4031
170 Ga0209813_10019102 3300027866 Bacteria 1901
171 Ga0268266_10290928 3300028379 Bacteria 1521
172 Ga0268264_10120477 3300028381 Bacteria 2312
173 Ga0307517_10002021 3300028786 Bacteria 33010
174 Ga0307517_10045362 3300028786 Bacteria 4619
175 Ga0307515_10002351 3300028794 Bacteria 41291
176 Ga0307515_10099362 3300028794 Bacteria 3534
177 Ga0307511_10001434 3300030521 Bacteria 25153
178 Ga0307511_10024493 3300030521 Bacteria 5593
179 Ga0307511_10105824 3300030521 Bacteria 1819
180 Ga0307512_10007403 3300030522 Bacteria 10896
181 Ga0307513_10041460 3300031456 Bacteria 5080
182 Ga0307509_10007954 3300031507 Bacteria 13674
183 Ga0307509_10109895 3300031507 Bacteria 2764
184 Ga0307508_10005275 3300031616 Bacteria 12338
185 Ga0307508_10008175 3300031616 Bacteria 9700
186 Ga0307508_10011922 3300031616 Bacteria 7949
187 Ga0307508_10044682 3300031616 Bacteria 3961
188 Ga0307508_10068560 3300031616 Bacteria 3117
189 Ga0307508_10102587 3300031616 Bacteria 2457
190 Ga0307514_10096570 3300031649 Bacteria 2134
191 Ga0307516_10002293 3300031730 Bacteria 25803
192 Ga0307516_10347563 3300031730 Bacteria 1149
193 Ga0307518_10106282 3300031838 Bacteria 2004
194 Ga0307416_100066305 3300032002 Bacteria 2972
195 Ga0307416_100210301 3300032002 Bacteria 1855
196 Ga0307415_100484485 3300032126 Bacteria 1078
197 Ga0307507_10007349 3300033179 Bacteria 16099
198 Ga0307507_10060199 3300033179 Bacteria 3548
199 Ga0307510_10000284 3300033180 Bacteria 46683
200 Ga0307510_10216061 3300033180 Bacteria 1434
201 Ga0373928_0001836 3300035084 Bacteria 4136
202 Ga0373934_0002647 3300035086 Bacteria 6580
203 Ga0373934_0005843 3300035086 Bacteria 4554
204 Ga0373923_0033816 3300035111 Bacteria 2072
205 Ga0373936_0002455 3300035113 Bacteria 6934
206 Ga0373941_0010422 3300035115 Bacteria 2374
207 Ga0373945_0041357 3300035116 Bacteria 1666
208 Ga0373945_0074779 3300035116 Bacteria 1288
209 Ga0373954_0023482 3300035118 Bacteria 2804
210 Ga0373957_0029446 3300035120 Bacteria 2006
211 Ga0373946_0117951 3300035171 Bacteria 1209
212 Ga0373955_0019357 3300035172 Bacteria 3400
213 Ga0373942_0005770 3300035207 Bacteria 2867
214 Ga0373962_0010326 3300035242 Bacteria 2326
215 Ga0373931_0011113 3300035691 Bacteria 4341
216 Ga0373935_0216669 3300035692 Bacteria 1328
217 Ga0373933_0012423 3300035724 Bacteria 4701
218 Ga0373933_0030292 3300035724 Bacteria 3133
219 Ga0373947_0026091 3300035725 Bacteria 3411
220 Ga0373947_0038383 3300035725 Bacteria 2845
221 Ga0373937_0065903 3300036401 Bacteria 3334
222 Ga0373937_0084399 3300036401 Bacteria 2938
223 Ga0373925_0000228 3300037068 Bacteria 59957
224 Ga0373925_0110189 3300037068 Bacteria 2125
225 Ga0395900_0588473 3300037418 Bacteria 1054
226 Ga0395898_0000852 3300037466 Bacteria 50067
227 Ga0395898_0017584 3300037466 Bacteria 7296
228 Ga0395898_0107668 3300037466 Bacteria 2673
229 Ga0395905_0066264 3300037471 Bacteria 3382
230 Ga0436364_0181279 3300037853 Bacteria 9030
231 Ga0436364_0879590 3300037853 Bacteria 6418
232 Ga0395901_0037739 3300038443 Bacteria 4996
233 Ga0395901_0038889 3300038443 Bacteria 4921
234 Ga0395901_0339485 3300038443 Bacteria 1552
235 Ga0395901_0386484 3300038443 Bacteria 1440
236 Ga0436363_0716113 3300039450 Bacteria 1405
237 Ga0439436_0008290 3300041404 Bacteria 3193
238 Ga0439439_0005705 3300041406 Bacteria 2855
239 Ga0439439_0012127 3300041406 Bacteria 2081
240 Ga0451837_0376999 3300041494 Bacteria 2488
241 Ga0451853_0157145 3300041512 Bacteria 2193
242 Ga0451853_0666452 3300041512 Bacteria 1356
243 Ga0451853_1888606 3300041512 Bacteria 2665
244 Ga0451853_2162406 3300041512 Bacteria 1694
245 Ga0439433_0003032 3300041999 Bacteria 3597
246 Ga0439433_0010143 3300041999 Bacteria 2056
247 Ga0439442_015217 3300042002 Bacteria 1584
248 Ga0439448_0005473 3300042005 Bacteria 3620
249 Ga0439448_0016187 3300042005 Bacteria 2267
250 Ga0439449_0003059 3300042007 Bacteria 6516
251 Ga0439449_0006221 3300042007 Bacteria 4561
252 Ga0439449_0073549 3300042007 Bacteria 1259
253 Ga0439454_010945 3300042011 Bacteria 1203
254 Ga0439455_0001226 3300042012 Bacteria 4195
255 Ga0439455_0049116 3300042012 Bacteria 1099
256 Ga0439457_004253 3300042014 Bacteria 3769
257 Ga0439457_004833 3300042014 Bacteria 3464
258 Ga0439462_0003900 3300042015 Bacteria 3602
259 Ga0439462_0009240 3300042015 Bacteria 2493
260 Ga0450899_000047 3300042135 Bacteria 9484
261 Ga0450902_013804 3300042137 Bacteria 1303
262 Ga0450903_000086 3300042138 Bacteria 19200
263 Ga0450903_000148 3300042138 Bacteria 15291
264 Ga0450906_002950 3300042145 Bacteria 3697
265 Ga0439458_0000692 3300042157 Bacteria 8722
266 Ga0439458_0002014 3300042157 Bacteria 5050
267 Ga0439434_0041179 3300042435 Bacteria 1419
268 Ga0466969_0039523 3300044656 Bacteria 2368
269 Ga0466969_0039678 3300044656 Bacteria 2363
270 Ga0466972_0003962 3300044658 Bacteria 7388
271 Ga0466972_0017857 3300044658 Bacteria 3550
272 Ga0466965_0017123 3300044683 Bacteria 3459
273 Ga0466966_0003947 3300044684 Bacteria 9799
274 Ga0466966_0007714 3300044684 Bacteria 7125
275 Ga0466966_0027802 3300044684 Bacteria 3688
276 Ga0466966_0053032 3300044684 Bacteria 2573
277 Ga0466961_0011038 3300044693 Bacteria 5774
278 Ga0466961_0020833 3300044693 Bacteria 4220
279 Ga0466961_0131875 3300044693 Bacteria 1566
280 Ga0466963_0000275 3300044694 Bacteria 22896
281 Ga0466963_0000711 3300044694 Bacteria 16256
282 Ga0466963_0006085 3300044694 Bacteria 7117
283 Ga0466963_0007825 3300044694 Bacteria 6394
284 Ga0466963_0026207 3300044694 Bacteria 3727
285 Ga0466963_0077727 3300044694 Bacteria 2243
286 Ga0466963_0143521 3300044694 Bacteria 1655
287 Ga0466971_0013145 3300044719 Bacteria 3631
288 Ga0466971_0025132 3300044719 Bacteria 2659
289 Ga0466968_0081034 3300044735 Bacteria 1426
290 Ga0466970_0001447 3300044765 Bacteria 11492
291 Ga0466970_0003142 3300044765 Bacteria 8025
292 Ga0466957_0000049 3300044842 Bacteria 44603
293 Ga0466960_0013760 3300044901 Bacteria 3447
294 Ga0466960_0135285 3300044901 Bacteria 1305
295 Ga0466960_0176542 3300044901 Bacteria 1156
296 Ga0466959_0000275 3300045049 Bacteria 31466
297 Ga0466959_0006079 3300045049 Bacteria 8330
298 Ga0466959_0043960 3300045049 Bacteria 3291
299 Ga0466958_0000512 3300045836 Bacteria 16251
300 Ga0466958_0005272 3300045836 Bacteria 6930
301 Ga0466958_0045071 3300045836 Bacteria 2660
302 Ga0466967_0001836 3300045976 Bacteria 12769
303 Ga0466967_0015406 3300045976 Bacteria 5991
304 Ga0466967_0158606 3300045976 Bacteria 2122
305 Ga0466967_0284018 3300045976 Bacteria 1588
306 Ga0466967_0317649 3300045976 Bacteria 1501
307 Ga0495617_035370 3300046452 Bacteria 1677
308 Ga0495592_0040288 3300046454 Bacteria 3506
309 Ga0495603_0000157 3300046455 Bacteria 34309
310 Ga0495603_0012082 3300046455 Bacteria 5228
311 Ga0495629_0003774 3300046459 Bacteria 11405
312 Ga0495629_0005897 3300046459 Bacteria 9130
313 Ga0495629_0009621 3300046459 Bacteria 7060
314 Ga0495629_0015245 3300046459 Bacteria 5521
315 Ga0495629_0022583 3300046459 Bacteria 4485
316 Ga0495629_0027046 3300046459 Bacteria 4074
317 Ga0495629_0098848 3300046459 Bacteria 2036
318 Ga0495638_0024661 3300046460 Bacteria 3917
319 Ga0495638_0183038 3300046460 Bacteria 1194
320 Ga0495641_0035285 3300046461 Bacteria 2360
321 Ga0495651_0008074 3300046462 Bacteria 8071
322 Ga0495651_0040154 3300046462 Bacteria 3640
323 Ga0495651_0041023 3300046462 Bacteria 3596
324 Ga0495653_0023073 3300046463 Bacteria 5032
325 Ga0495580_0178196 3300046472 Bacteria 1468
326 Ga0495582_0048966 3300046473 Bacteria 2327
327 Ga0495605_0099417 3300046474 Bacteria 1339
328 Ga0495639_0016737 3300046475 Bacteria 3184
329 Ga0495662_0000752 3300046476 Bacteria 15578
330 Ga0495662_0003337 3300046476 Bacteria 8135
331 Ga0495662_0055442 3300046476 Bacteria 1915
332 Ga0495664_0000894 3300046477 Bacteria 15317
333 Ga0495664_0014672 3300046477 Bacteria 4443
334 Ga0495664_0063309 3300046477 Bacteria 2204
335 Ga0495664_0082492 3300046477 Bacteria 1928
336 Ga0495585_0017819 3300046492 Bacteria 4099
337 Ga0495585_0034128 3300046492 Bacteria 2876
338 Ga0495594_0001377 3300046499 Bacteria 12617
339 Ga0495594_0046614 3300046499 Bacteria 2381
340 Ga0495594_0054783 3300046499 Bacteria 2198
341 Ga0495594_0211944 3300046499 Bacteria 1104
342 Ga0495596_0131152 3300046500 Bacteria 973
343 Ga0495607_0012056 3300046501 Bacteria 5720
344 Ga0495607_0200848 3300046501 Bacteria 987
345 Ga0495583_0012953 3300046506 Bacteria 4684
346 Ga0495583_0013898 3300046506 Bacteria 4463
347 Ga0495583_0057481 3300046506 Bacteria 1749
348 Ga0495606_0044769 3300046507 Bacteria 2940
349 Ga0495608_0132940 3300046511 Bacteria 1591
350 Ga0495608_0149608 3300046511 Bacteria 1488
351 Ga0495618_0064783 3300046514 Bacteria 2322
352 Ga0495618_0076046 3300046514 Bacteria 2139
353 Ga0495618_0088913 3300046514 Bacteria 1975
354 Ga0495628_0047344 3300046516 Bacteria 3412
355 Ga0495628_0066014 3300046516 Bacteria 2829
356 Ga0495628_0107883 3300046516 Bacteria 2143
357 Ga0495648_0101967 3300046524 Bacteria 1582
358 Ga0495666_0012772 3300046526 Bacteria 4186
359 Ga0495666_0094740 3300046526 Bacteria 1408
360 Ga0495652_0034056 3300046529 Bacteria 4442
361 Ga0495652_0040184 3300046529 Bacteria 4042
362 Ga0495652_0072084 3300046529 Bacteria 2880
363 Ga0495652_0227702 3300046529 Bacteria 1396
364 Ga0495640_0055326 3300046533 Bacteria 2714
365 Ga0495640_0098608 3300046533 Bacteria 1920
366 Ga0495640_0110799 3300046533 Bacteria 1794
367 Ga0495640_0163953 3300046533 Bacteria 1422
368 Ga0495586_0037958 3300046535 Bacteria 2586
369 Ga0495586_0053853 3300046535 Bacteria 2180
370 Ga0495587_0000273 3300046536 Bacteria 36925
371 Ga0495587_0003110 3300046536 Bacteria 11099
372 Ga0495609_0111272 3300046538 Bacteria 1182
373 Ga0495597_0011946 3300046542 Bacteria 4200
374 Ga0495645_0050563 3300046543 Bacteria 3026
375 Ga0495622_0012722 3300046557 Bacteria 3902
376 Ga0495622_0014579 3300046557 Bacteria 3650
377 Ga0495622_0066159 3300046557 Bacteria 1671
378 Ga0495633_0110633 3300046558 Bacteria 1273
379 Ga0495667_0012947 3300046559 Bacteria 5655
380 Ga0495667_0095472 3300046559 Bacteria 1925
381 Ga0495656_0106920 3300046615 Bacteria 1303
382 Ga0495668_0005005 3300046616 Bacteria 9152
383 Ga0495668_0007768 3300046616 Bacteria 6803
384 Ga0495634_0009608 3300046642 Bacteria 7125
385 Ga0495634_0010573 3300046642 Bacteria 6756
386 Ga0495634_0010984 3300046642 Bacteria 6610
387 Ga0495611_0037052 3300046648 Bacteria 2167
388 Ga0495611_0075547 3300046648 Bacteria 1544
389 Ga0495625_0106347 3300046660 Bacteria 1921
390 Ga0495625_0114415 3300046660 Bacteria 1842
391 Ga0495635_0004978 3300046663 Bacteria 9251
392 Ga0495635_0042723 3300046663 Bacteria 3129
393 Ga0495661_0189729 3300046665 Bacteria 1083
394 Ga0495588_0007242 3300046674 Bacteria 5036
395 Ga0495588_0054232 3300046674 Bacteria 2068
396 Ga0495657_0000049 3300046675 Bacteria 103042
397 Ga0495657_0006566 3300046675 Bacteria 9087
398 Ga0495657_0007365 3300046675 Bacteria 8506
399 Ga0495657_0010104 3300046675 Bacteria 7112
400 Ga0495657_0015874 3300046675 Bacteria 5498
401 Ga0495657_0025086 3300046675 Bacteria 4236
402 Ga0495657_0081335 3300046675 Bacteria 2095
403 Ga0495599_0094688 3300046678 Bacteria 1863
404 Ga0495623_0152517 3300046679 Bacteria 1365
405 Ga0495646_0021018 3300046680 Bacteria 4126
406 Ga0495646_0061720 3300046680 Bacteria 2231
407 Ga0495669_0036377 3300046684 Bacteria 2176
408 Ga0495613_0002706 3300046689 Bacteria 13302
409 Ga0495613_0005232 3300046689 Bacteria 9745
410 Ga0495613_0009424 3300046689 Bacteria 7242
411 Ga0495613_0035121 3300046689 Bacteria 3721
412 Ga0495613_0109505 3300046689 Bacteria 1991
413 Ga0495613_0275654 3300046689 Bacteria 1169
414 Ga0495624_0037703 3300046690 Bacteria 3108
415 Ga0495671_0010196 3300046692 Bacteria 5219
416 Ga0495649_0069336 3300046694 Bacteria 1891
417 Ga0495589_0035800 3300046794 Bacteria 2488
418 Ga0495589_0056258 3300046794 Bacteria 1936
419 Ga0495589_0056698 3300046794 Bacteria 1928
420 Ga0495600_0061829 3300046809 Bacteria 2446
421 Ga0495600_0193450 3300046809 Bacteria 1307
422 Ga0495660_0004050 3300046810 Bacteria 8950
423 Ga0495660_0027879 3300046810 Bacteria 3194
424 Ga0495581_0001468 3300047315 Bacteria 13105
425 Ga0495604_0003659 3300047317 Bacteria 12253
426 Ga0495604_0021890 3300047317 Bacteria 5103
427 Ga0495604_0041408 3300047317 Bacteria 3613
428 Ga0495604_0068137 3300047317 Bacteria 2702
429 Ga0495604_0078295 3300047317 Bacteria 2481
430 Ga0495604_0111833 3300047317 Bacteria 1990
431 Ga0495604_0164736 3300047317 Bacteria 1564
432 Ga0495636_0003376 3300047318 Bacteria 6192
433 Ga0495636_0006119 3300047318 Bacteria 4727
434 Ga0495636_0035485 3300047318 Bacteria 2054
435 Ga0495636_0051179 3300047318 Bacteria 1731
436 Ga0495674_0176019 3300047319 Bacteria 1783
437 Ga0495674_0213526 3300047319 Bacteria 1597
438 Ga0495676_0001217 3300047321 Bacteria 22055
439 Ga0495676_0006574 3300047321 Bacteria 10715
440 Ga0495676_0010176 3300047321 Bacteria 8543
441 Ga0495676_0019178 3300047321 Bacteria 6018
442 Ga0495676_0023405 3300047321 Bacteria 5362
443 Ga0495676_0039025 3300047321 Bacteria 3938
444 Ga0495676_0067065 3300047321 Bacteria 2778
445 Ga0495680_0006312 3300047322 Bacteria 11034
446 Ga0495680_0015996 3300047322 Bacteria 6453
447 Ga0495680_0028167 3300047322 Bacteria 4608
448 Ga0495680_0071898 3300047322 Bacteria 2632
449 Ga0495683_0086807 3300047323 Bacteria 1520
450 Ga0495687_000825 3300047443 Bacteria 33158
451 Ga0495687_020501 3300047443 Bacteria 3218
452 Ga0495687_041344 3300047443 Bacteria 2023
453 Ga0495675_0046460 3300047444 Bacteria 2764
454 Ga0495675_0078692 3300047444 Bacteria 2076
455 Ga0495675_0101560 3300047444 Bacteria 1799
456 Ga0495685_000959 3300047447 Bacteria 8735
457 Ga0495685_003140 3300047447 Bacteria 5238
458 Ga0495685_009416 3300047447 Bacteria 3261
459 Ga0495685_025470 3300047447 Bacteria 2035
460 Ga0495681_0003781 3300047470 Bacteria 10497
461 Ga0495681_0016345 3300047470 Bacteria 4162
462 Ga0495681_0031479 3300047470 Bacteria 2684
463 Ga0495684_0029594 3300047471 Bacteria 4203
464 Ga0495684_0065883 3300047471 Bacteria 2754
465 Ga0495684_0123164 3300047471 Bacteria 1951
466 Ga0495684_0210223 3300047471 Bacteria 1431
467 Ga0495686_0081389 3300047472 Bacteria 1978
468 Ga0495686_0193921 3300047472 Bacteria 1169
469 Ga0495593_0010985 3300047673 Bacteria 5212
470 Ga0495593_0024695 3300047673 Bacteria 3328
471 Ga0495602_0003730 3300048088 Bacteria 15821
472 Ga0495602_0017605 3300048088 Bacteria 7160
473 Ga0495602_0026584 3300048088 Bacteria 5579
474 Ga0495614_0000100 3300048089 Bacteria 29215
475 Ga0495614_0016273 3300048089 Bacteria 3238
476 Ga0495614_0022403 3300048089 Bacteria 2726
477 Ga0495614_0075702 3300048089 Bacteria 1454
478 Ga0495626_0016585 3300048091 Bacteria 3739
479 Ga0496102_0074114 3300048905 Bacteria 3129
480 Ga0496102_0089781 3300048905 Bacteria 2843
481 Ga0496102_0114799 3300048905 Bacteria 2512
482 Ga0496102_0136116 3300048905 Bacteria 2302
483 Ga0496103_0088193 3300048906 Bacteria 1956
484 Ga0496103_0132060 3300048906 Bacteria 1595
485 Ga0496104_0029401 3300048907 Bacteria 5097
486 Ga0496104_0122704 3300048907 Bacteria 2494
487 Ga0496105_0044743 3300048908 Bacteria 3652
488 Ga0496106_0094004 3300048909 Bacteria 2317
489 Ga0496108_0067294 3300048911 Bacteria 3021
490 Ga0496108_0082603 3300048911 Bacteria 2724
491 Ga0496109_0119562 3300048912 Bacteria 2453
492 Ga0496109_0321124 3300048912 Bacteria 1461
493 Ga0496109_0334832 3300048912 Bacteria 1429
494 Ga0496110_0048242 3300048913 Bacteria 3733
495 Ga0496111_0052440 3300048914 Bacteria 2945
496 Ga0496111_0070102 3300048914 Bacteria 2549
497 Ga0496112_0009016 3300048915 Bacteria 8958
498 Ga0496112_0065046 3300048915 Bacteria 3599
499 Ga0496112_0084631 3300048915 Bacteria 3137
500 Ga0496113_0009989 3300048916 Bacteria 6257
501 Ga0496113_0013158 3300048916 Bacteria 5591
502 Ga0496113_0218962 3300048916 Bacteria 1517
503 Ga0496115_0118693 3300048918 Bacteria 2175
504 Ga0501031_0002554 3300049568 Bacteria 11598
505 Ga0501031_0007113 3300049568 Bacteria 7302
506 Ga0501031_0111330 3300049568 Bacteria 1788
507 Ga0501032_0005207 3300049569 Bacteria 9680
508 Ga0501032_0008122 3300049569 Bacteria 7651
509 Ga0501032_0036693 3300049569 Bacteria 3345
510 Ga0501032_0040376 3300049569 Bacteria 3172
511 Ga0501032_0041774 3300049569 Bacteria 3113
512 Ga0501032_0084323 3300049569 Bacteria 2112
513 Ga0501032_0104728 3300049569 Bacteria 1874
514 Ga0501033_0009248 3300049570 Bacteria 7588
515 Ga0501033_0018237 3300049570 Bacteria 5302
516 Ga0501033_0076224 3300049570 Bacteria 2461
517 Ga0501033_0116892 3300049570 Bacteria 1937
518 Ga0501034_0008974 3300049571 Bacteria 10503
519 Ga0501034_0044166 3300049571 Bacteria 4507
520 Ga0501034_0045827 3300049571 Bacteria 4417
521 Ga0501034_0056777 3300049571 Bacteria 3938
522 Ga0501034_0172664 3300049571 Bacteria 2128
523 Ga0501036_0000708 3300049572 Bacteria 24642
524 Ga0501036_0010485 3300049572 Bacteria 7655
525 Ga0501036_0017843 3300049572 Bacteria 5941
526 Ga0501036_0019366 3300049572 Bacteria 5712
527 Ga0501036_0039257 3300049572 Bacteria 4006
528 Ga0501036_0046363 3300049572 Bacteria 3681
529 Ga0501036_0088166 3300049572 Bacteria 2622
530 Ga0501036_0217296 3300049572 Bacteria 1605
531 Ga0501037_0002174 3300049573 Bacteria 14185
532 Ga0501037_0012944 3300049573 Bacteria 6149
533 Ga0501037_0028794 3300049573 Bacteria 4104
534 Ga0501037_0066246 3300049573 Bacteria 2631
535 Ga0501037_0139147 3300049573 Bacteria 1738
536 Ga0501038_0006729 3300049574 Bacteria 10620
537 Ga0501038_0035589 3300049574 Bacteria 4371
538 Ga0501038_0042919 3300049574 Bacteria 3936
539 Ga0501038_0052424 3300049574 Bacteria 3517
540 Ga0501038_0120392 3300049574 Bacteria 2165
541 Ga0501038_0122948 3300049574 Bacteria 2138
542 Ga0501039_0015458 3300049575 Bacteria 5843
543 Ga0501039_0052205 3300049575 Bacteria 3163
544 Ga0501039_0195296 3300049575 Bacteria 1591
545 Ga0501040_0001445 3300049576 Bacteria 15042
546 Ga0501041_0024673 3300049577 Bacteria 3609
547 Ga0501042_0011296 3300049578 Bacteria 6021
548 Ga0501042_0022777 3300049578 Bacteria 4377
549 Ga0501042_0161686 3300049578 Bacteria 1616
550 Ga0501043_0004336 3300049579 Bacteria 11546
551 Ga0501043_0007163 3300049579 Bacteria 8865
552 Ga0501043_0009359 3300049579 Bacteria 7694
553 Ga0501043_0010698 3300049579 Bacteria 7188
554 Ga0501043_0021683 3300049579 Bacteria 5036
555 Ga0501043_0041318 3300049579 Bacteria 3623
556 Ga0501043_0081138 3300049579 Bacteria 2548
557 Ga0501046_0006788 3300049580 Bacteria 10100
558 Ga0501046_0047639 3300049580 Bacteria 3397
559 Ga0501046_0107107 3300049580 Bacteria 2139
560 Ga0501046_0113934 3300049580 Bacteria 2063
561 Ga0501047_0000103 3300049581 Bacteria 104053
562 Ga0501047_0000353 3300049581 Bacteria 52010
563 Ga0501047_0009882 3300049581 Bacteria 9019
564 Ga0501047_0012213 3300049581 Bacteria 8131
565 Ga0501047_0029789 3300049581 Bacteria 5260
566 Ga0501047_0044687 3300049581 Bacteria 4281
567 Ga0501047_0052148 3300049581 Bacteria 3953
568 Ga0501047_0200931 3300049581 Bacteria 1854
569 Ga0501048_0028202 3300049582 Bacteria 4075
570 Ga0501048_0062619 3300049582 Bacteria 2632
571 Ga0501067_0003009 3300049583 Bacteria 9307
572 Ga0501068_0000656 3300049584 Bacteria 17781
573 Ga0501069_0001559 3300049585 Bacteria 11326
574 Ga0501070_0025530 3300049586 Bacteria 4956
575 Ga0501070_0150724 3300049586 Bacteria 1918
576 Ga0501070_0294409 3300049586 Bacteria 1323
577 Ga0501071_0000349 3300049587 Bacteria 22503
578 Ga0501071_0055976 3300049587 Bacteria 2848
579 Ga0501072_0002398 3300049588 Bacteria 14046
580 Ga0501073_0064576 3300049589 Bacteria 2553
581 Ga0501073_0090558 3300049589 Bacteria 2125
582 Ga0501074_0000866 3300049590 Bacteria 19298
583 Ga0501074_0003063 3300049590 Bacteria 11786
584 Ga0501074_0009494 3300049590 Bacteria 7064
585 Ga0501075_0106263 3300049591 Bacteria 2133
586 Ga0501075_0291351 3300049591 Bacteria 1243
587 Ga0501076_0056888 3300049592 Bacteria 3104
588 Ga0501076_0249859 3300049592 Bacteria 1451
589 Ga0501080_0063380 3300049742 Bacteria 3441
590 Ga0501080_0241783 3300049742 Bacteria 1647
591 Ga0501083_0008989 3300049744 Bacteria 7051
592 Ga0501035_0002009 3300049822 Bacteria 20313
593 Ga0501035_0005523 3300049822 Bacteria 11948
594 Ga0501035_0023285 3300049822 Bacteria 5680
595 Ga0501035_0032516 3300049822 Bacteria 4745
596 Ga0501035_0042517 3300049822 Bacteria 4098
597 Ga0501035_0071330 3300049822 Bacteria 3076
598 Ga0501035_0126150 3300049822 Bacteria 2234
599 Ga0501035_0134994 3300049822 Bacteria 2149
600 Ga0501035_0148260 3300049822 Bacteria 2037
601 Ga0501044_0001895 3300049823 Bacteria 24214
602 Ga0501044_0001963 3300049823 Bacteria 23798
603 Ga0501044_0018743 3300049823 Bacteria 7412
604 Ga0501044_0021222 3300049823 Bacteria 6933
605 Ga0501044_0024024 3300049823 Bacteria 6475
606 Ga0501044_0052638 3300049823 Bacteria 4193
607 Ga0501044_0064164 3300049823 Bacteria 3750
608 Ga0501044_0066117 3300049823 Bacteria 3687
609 Ga0501044_0192925 3300049823 Bacteria 1998
610 Ga0501044_0195659 3300049823 Bacteria 1982
611 Ga0501044_0321198 3300049823 Bacteria 1472
612 Ga0501045_0360987 3300049824 Bacteria 1081
613 nmdc:mga03n38_56910_c1 3300050490 Bacteria 1766
614 nmdc:mga0yw44_13731_c1 3300050492 Bacteria 4275
615 nmdc:mga06z11_31385_c1 3300050494 Bacteria 2581
616 nmdc:mga04h51_22801_c1 3300050495 Bacteria 1899
617 nmdc:mga05p37_2963_c1 3300050507 Bacteria 19704
618 nmdc:mga05p37_820_c1 3300050507 Bacteria 34830
619 nmdc:mga09592_5182_c1 3300050508 Bacteria 10594
620 nmdc:mga0qj67_14923_c1 3300050509 Bacteria 5875
621 nmdc:mga0qj67_531_c1 3300050509 Bacteria 25967
622 nmdc:mga06r32_56752_c1 3300050510 Bacteria 3760
623 nmdc:mga06r32_60464_c1 3300050510 Bacteria 3646
624 nmdc:mga0rr50_106212_c1 3300050513 Bacteria 2215
625 nmdc:mga08x19_147381_c1 3300050514 Bacteria 1592
626 nmdc:mga0a205_24398_c1 3300050515 Bacteria 5750
627 Ga0495612_0019408 3300053078 Bacteria 2722
628 Ga0495655_0029301 3300053083 Bacteria 1322
629 Ga0495595_0028600 3300053084 Bacteria 2490
630 Ga0495619_0038670 3300053085 Bacteria 3113
631 Ga0500644_0021558 3300053088 Bacteria 1932
632 Ga0500640_029375 3300053095 Bacteria 2403
633 Ga0500556_0058397 3300053104 Bacteria 1415
634 Ga0500560_000753 3300053107 Bacteria 4912
635 Ga0500560_017345 3300053107 Bacteria 1985
636 Ga0500572_015599 3300053111 Bacteria 1919
637 Ga0500580_085925 3300053113 Bacteria 1266
638 Ga0500594_0025002 3300053118 Bacteria 1527
639 Ga0500621_039959 3300053126 Bacteria 1891
640 Ga0500628_039880 3300053129 Bacteria 1067
641 Ga0500561_0003140 3300053137 Bacteria 2856
642 Ga0500633_0007523 3300053160 Bacteria 2749
643 Ga0500634_0060929 3300053161 Bacteria 2002
644 Ga0500656_007804 3300053732 Bacteria 1121
645 Ga0501084_0015209 3300054114 Bacteria 6381
646 Ga0587093_004061 3300059478 Bacteria 1472
647 Ga0587078_003215 3300059646 Bacteria 1640
648 Ga0587111_0003527 3300060346 Bacteria 2235
649 Ga0501082_0040583 3300060353 Bacteria 4013
650 Ga0466962_0000081 3300061719 Bacteria 38408
651 Ga0466962_0007836 3300061719 Bacteria 5122
652 Ga0466962_0018367 3300061719 Bacteria 3363
653 2547408771 2547132111 Bacteria 8013147
654 2554260117 2554235005 Bacteria 6457341
655 2585299512 2582581312 Bacteria 7308206
656 2585305819 2582581313 Bacteria 10042643
657 2585305909 2582581313 Bacteria 10042643
658 2585315149 2582581314 Bacteria 11452267
659 2616693550 2616644814 Bacteria 11555299
660 2616900994 2616644941 Bacteria 8510691
661 2643760477 2643221548 Bacteria 8053412
662 2643898835 2643221578 Bacteria 9213798
663 2643947247 2643221587 Bacteria 7586415
664 2644270190 2643221647 Bacteria 10741251
665 2644386393 2643221670 Bacteria 6497041
666 2644403604 2643221673 Bacteria 9196637
667 2644433282 2643221677 Bacteria 7584031
668 2644441901 2643221678 Bacteria 9540101
669 2644459560 2643221682 Bacteria 6743283
670 2644630670 2643221714 Bacteria 9015452
671 2676487727 2675903060 Bacteria 10051191
672 2768643785 2767802112 Bacteria 6465194
673 2784586208 2784132148 Bacteria 8627943
674 2785346688 2784746763 Bacteria 9783172
675 2785366322 2784746768 Bacteria 10036182
676 2785366439 2784746768 Bacteria 10036182
677 2786667303 2786546132 Bacteria 10419719
678 2786675858 2786546132 Bacteria 10419719
679 2793976982 2791355406 Bacteria 11364898
680 2808846952 2808606359 Bacteria 9866990
681 2808917669 2808606375 Bacteria 9466072
682 2809229604 2808606448 Bacteria 8656184
683 2811846535 2808606982 Bacteria 7791042
684 2812361375 2811994879 Bacteria 9313447
685 2812477305 2811994917 Bacteria 7761064
686 2819699939 2818991463 Bacteria 7948711
687 2852642625 2852635781 Bacteria 8251373
688 2862180981 2862178590 Bacteria 8583590
689 2862282471 2862281513 Bacteria 9621493
690 2862293570 2862290372 Bacteria 7471434
691 2862387028 2862382967 Bacteria 10317375
692 2862513738 2862507626 Bacteria 9425308
693 2862580580 2862574272 Bacteria 10567477
694 2867346752 2867346516 Bacteria 7608576
695 2867375194 2867369537 Bacteria 6501581
696 2867436882 2867428634 Bacteria 9590268
697 2867478162 2867475112 Bacteria 6909112
698 2873158005 2873151551 Bacteria 8625867
699 2875392167 2875391855 Bacteria 7600475
700 2877684096 2877676314 Bacteria 9512378
701 2877684196 2877676314 Bacteria 9512378
702 2884697734 2884693830 Bacteria 11273186
703 2895431856 2895427314 Bacteria 13147766
704 2895444836 2895442618 Bacteria 11027144
705 2912723498 2912715099 Bacteria 9460473
706 2912726735 2912723979 Bacteria 8557534
707 2912758329 2912757875 Bacteria 7940295
708 2918501918 2918501144 Bacteria 8668083
709 2919470150 2919468124 Bacteria 9133025
710 2935391450 2935390628 Bacteria 7043367
711 2935393119 2935390628 Bacteria 7043367
712 2946052732 2946045630 Bacteria 8527308
713 2946064709 2946064051 Bacteria 8957905
714 2946073084 2946072368 Bacteria 8999607
715 2947224675 2947224130 Bacteria 9938529
716 2954008300 2954002825 Bacteria 9173742
717 2954389511 2954380949 Bacteria 10050426
718 2954682391 2954673503 Bacteria 9685905
719 2954690533 2954682443 Bacteria 9862841
720 2954691300 2954682443 Bacteria 9862841
721 2954700288 2954691527 Bacteria 10720516
722 2954701941 2954701450 Bacteria 10834262
723 2954719050 2954711539 Bacteria 10867210
724 2954729020 2954721474 Bacteria 10456478
725 2954732791 2954731030 Bacteria 10243860
726 2954747919 2954740390 Bacteria 10229294
727 2954751669 2954749733 Bacteria 10366972
728 2954767045 2954759201 Bacteria 9358192
729 2966605028 2966598605 Bacteria 7676064
730 2990061829 2990059506 Bacteria 9321252
731 2990093415 2990088156 Bacteria 6657676
732 2997453834 2997451912 Bacteria 8492419
733 2997605913 2997600082 Bacteria 9896405
734 3006327773 3006321560 Bacteria 8247479
735 3006394725 3006393351 Bacteria 6615579
736 3006428239 3006425503 Bacteria 6491253
737 3006488145 3006486233 Bacteria 8157040
738 3006498358 3006493962 Bacteria 8825450
739 8008560464 8008558824 Bacteria 10610750
740 8008581340 8008574985 Bacteria 7815457
741 8023629922 8023623736 Bacteria 8593882
742 8025486146 8025478263 Bacteria 8209203
743 8025536304 8025530807 Bacteria 8495698
744 8033690380 8033684223 Bacteria 6906479
745 8047901125 8047893842 Bacteria 11723082
746 8048134188 8048127548 Bacteria 11053136
747 8048357776 8048356638 Bacteria 11044339
748 8048378064 8048369669 Bacteria 11666822
749 8048387162 8048379754 Bacteria 11877923
750 8048413590 8048406513 Bacteria 8936924
751 8054161960 8054160619 Bacteria 7783213
752 8056451310 8056447290 Bacteria 7680491
753 8056669957 8056667051 Bacteria 6953971
754 8056830921 8056829672 Bacteria 9045328
755 Ga0466972_0005381
756 JGI24739J22299_10019885
757 JGI24751J29686_10008447
758 rootH2_10017142
759 rootL2_10120955
760 rootH1_10054926
761 Ga0070690_100066842
762 Ga0070668_100001597
763 Ga0070668_100107971
764 Ga0070709_10008130
765 Ga0070709_10121405
766 Ga0070714_100139908
767 Ga0070714_100211569
768 Ga0070714_100361247
769 Ga0070713_100050049
770 Ga0070713_100239094
771 Ga0070710_10031315
772 Ga0070710_10065557
773 Ga0070710_10184810
774 Ga0070711_100055087
775 Ga0070708_100001238
776 Ga0070708_100001603
777 Ga0070708_100007689
778 Ga0070708_100054808
779 Ga0070678_100216422
780 Ga0070681_10135224
781 Ga0070706_100006141
782 Ga0070706_100006398
783 Ga0070706_100011316
784 Ga0070706_100027442
785 Ga0070706_100029379
786 Ga0070706_100100800
787 Ga0070706_100533742
788 Ga0070707_100000041
789 Ga0070707_100002195
790 Ga0070707_100009909
791 Ga0070707_100154956
792 Ga0070707_100208189
793 Ga0070707_100365439
794 Ga0070698_100000082
795 Ga0070698_100002067
796 Ga0070698_100009295
797 Ga0070698_100011159
798 Ga0070698_100093947
799 Ga0070698_100133408
800 Ga0070698_100210811
801 Ga0070699_100001106
802 Ga0070699_100024128
803 Ga0070699_100072824
804 Ga0070699_100075968
805 Ga0070684_100181714
806 Ga0070697_100062947
807 Ga0070693_100048810
808 Ga0070665_100222284
809 Ga0070665_100333663
810 Ga0070704_100055380
811 Ga0068856_100088329
812 Ga0068856_100287295
813 Ga0068856_100294303
814 Ga0068858_100092329
815 Ga0068860_100137867
816 Ga0081539_10001782
817 Ga0070717_10006347
818 Ga0070717_10028441
819 Ga0070717_10029951
820 Ga0070717_10076633
821 Ga0070717_10097614
822 Ga0070717_10101207
823 Ga0070717_10148418
824 Ga0070717_10390760
825 Ga0075368_10011702
826 Ga0075363_100001855
827 Ga0075363_100098289
828 Ga0070715_10002235
829 Ga0070716_100002738
830 Ga0070716_100011213
831 Ga0070716_100053609
832 Ga0070712_100063767
833 Ga0070712_100208351
834 Ga0075367_10006123
835 Ga0068871_100109870
836 Ga0075428_100016560
837 Ga0075428_100146911
838 Ga0075430_100007906
839 Ga0075430_100077789
840 Ga0075431_100082224
841 Ga0075431_100101521
842 Ga0075431_100167629
843 Ga0075429_100003725
844 Ga0075429_100220402
845 Ga0075436_100017666
846 Ga0099795_10069599
847 Ga0105245_10027687
848 Ga0105245_10037190
849 Ga0105245_10075808
850 Ga0105245_10163679
851 Ga0105247_10069779
852 Ga0105247_10082874
853 Ga0114129_10002397
854 Ga0114129_10082137
855 Ga0114129_10089173
856 Ga0105243_10192118
857 Ga0099796_10042921
858 Ga0105239_10161543
859 Ga0105246_10047397
860 Ga0157369_10039018
861 Ga0163162_10434350
862 Ga0163163_10013785
863 Ga0182008_10011941
864 Ga0157379_10090919
865 Ga0157376_10022450
866 Ga0182007_10000651
867 Ga0183367_1003
868 Ga0206356_10455475
869 Ga0209758_1022281
870 Ga0207426_1001118
871 Ga0207426_1025321
872 Ga0207653_10017464
873 Ga0207692_10011463
874 Ga0207692_10012952
875 Ga0207699_10004947
876 Ga0207699_10010584
877 Ga0207699_10019147
878 Ga0207699_10035344
879 Ga0207684_10000339
880 Ga0207684_10000574
881 Ga0207684_10009068
882 Ga0207684_10013508
883 Ga0207684_10027890
884 Ga0207684_10089191
885 Ga0207684_10124007
886 Ga0207684_10135934
887 Ga0207707_10099845
888 Ga0207693_10005872
889 Ga0207693_10019021
890 Ga0207693_10039198
891 Ga0207663_10006086
892 Ga0207663_10051538
893 Ga0207663_10111958
894 Ga0207663_10319919
895 Ga0207662_10081946
896 Ga0207646_10000061
897 Ga0207646_10001194
898 Ga0207646_10004121
899 Ga0207646_10035076
900 Ga0207646_10163460
901 Ga0207646_10171107
902 Ga0207646_10287688
903 Ga0207687_10090388
904 Ga0207687_10098105
905 Ga0207700_10031746
906 Ga0207664_10007801
907 Ga0207664_10093413
908 Ga0207664_10134725
909 Ga0207664_10431846
910 Ga0207709_10132559
911 Ga0207665_10002854
912 Ga0207665_10004964
913 Ga0207665_10008897
914 Ga0207665_10027232
915 Ga0207679_10152735
916 Ga0207677_10044687
917 Ga0207703_10122973
918 Ga0207708_10078069
919 Ga0207702_10097459
920 Ga0207702_10157653
921 Ga0207702_10249914
922 Ga0207641_10189423
923 Ga0207675_100047003
924 Ga0209813_10019102
925 Ga0268266_10290928
926 Ga0268264_10120477
927 Ga0307517_10002021
928 Ga0307517_10045362
929 Ga0307515_10002351
930 Ga0307515_10099362
931 Ga0307511_10001434
932 Ga0307511_10024493
933 Ga0307511_10105824
934 Ga0307512_10007403
935 Ga0307513_10041460
936 Ga0307509_10007954
937 Ga0307509_10109895
938 Ga0307508_10005275
939 Ga0307508_10008175
940 Ga0307508_10011922
941 Ga0307508_10044682
942 Ga0307508_10068560
943 Ga0307508_10102587
944 Ga0307514_10096570
945 Ga0307516_10002293
946 Ga0307516_10347563
947 Ga0307518_10106282
948 Ga0307416_100066305
949 Ga0307416_100210301
950 Ga0307415_100484485
951 Ga0307507_10007349
952 Ga0307507_10060199
953 Ga0307510_10000284
954 Ga0307510_10216061
955 Ga0373928_0001836
956 Ga0373934_0002647
957 Ga0373934_0005843
958 Ga0373923_0033816
959 Ga0373936_0002455
960 Ga0373941_0010422
961 Ga0373945_0041357
962 Ga0373945_0074779
963 Ga0373954_0023482
964 Ga0373957_0029446
965 Ga0373946_0117951
966 Ga0373955_0019357
967 Ga0373942_0005770
968 Ga0373962_0010326
969 Ga0373931_0011113
970 Ga0373935_0216669
971 Ga0373933_0012423
972 Ga0373933_0030292
973 Ga0373947_0026091
974 Ga0373947_0038383
975 Ga0373937_0065903
976 Ga0373937_0084399
977 Ga0373925_0000228
978 Ga0373925_0110189
979 Ga0395900_0588473
980 Ga0395898_0000852
981 Ga0395898_0017584
982 Ga0395898_0107668
983 Ga0395905_0066264
984 Ga0436364_0181279
985 Ga0436364_0879590
986 Ga0395901_0037739
987 Ga0395901_0038889
988 Ga0395901_0339485
989 Ga0395901_0386484
990 Ga0436363_0716113
991 Ga0439436_0008290
992 Ga0439439_0005705
993 Ga0439439_0012127
994 Ga0451837_0376999
995 Ga0451853_0157145
996 Ga0451853_0666452
997 Ga0451853_1888606
998 Ga0451853_2162406
999 Ga0439433_0003032
1000 Ga0439433_0010143
1001 Ga0439442_015217
1002 Ga0439448_0005473
1003 Ga0439448_0016187
1004 Ga0439449_0003059
1005 Ga0439449_0006221
1006 Ga0439449_0073549
1007 Ga0439454_010945
1008 Ga0439455_0001226
1009 Ga0439455_0049116
1010 Ga0439457_004253
1011 Ga0439457_004833
1012 Ga0439462_0003900
1013 Ga0439462_0009240
1014 Ga0450899_000047
1015 Ga0450902_013804
1016 Ga0450903_000086
1017 Ga0450903_000148
1018 Ga0450906_002950
1019 Ga0439458_0000692
1020 Ga0439458_0002014
1021 Ga0439434_0041179
1022 Ga0466969_0039523
1023 Ga0466969_0039678
1024 Ga0466972_0003962
1025 Ga0466972_0017857
1026 Ga0466965_0017123
1027 Ga0466966_0003947
1028 Ga0466966_0007714
1029 Ga0466966_0027802
1030 Ga0466966_0053032
1031 Ga0466961_0011038
1032 Ga0466961_0020833
1033 Ga0466961_0131875
1034 Ga0466963_0000275
1035 Ga0466963_0000711
1036 Ga0466963_0006085
1037 Ga0466963_0007825
1038 Ga0466963_0026207
1039 Ga0466963_0077727
1040 Ga0466963_0143521
1041 Ga0466971_0013145
1042 Ga0466971_0025132
1043 Ga0466968_0081034
1044 Ga0466970_0001447
1045 Ga0466970_0003142
1046 Ga0466957_0000049
1047 Ga0466960_0013760
1048 Ga0466960_0135285
1049 Ga0466960_0176542
1050 Ga0466959_0000275
1051 Ga0466959_0006079
1052 Ga0466959_0043960
1053 Ga0466958_0000512
1054 Ga0466958_0005272
1055 Ga0466958_0045071
1056 Ga0466967_0001836
1057 Ga0466967_0015406
1058 Ga0466967_0158606
1059 Ga0466967_0284018
1060 Ga0466967_0317649
1061 Ga0495617_035370
1062 Ga0495592_0040288
1063 Ga0495603_0000157
1064 Ga0495603_0012082
1065 Ga0495629_0003774
1066 Ga0495629_0005897
1067 Ga0495629_0009621
1068 Ga0495629_0015245
1069 Ga0495629_0022583
1070 Ga0495629_0027046
1071 Ga0495629_0098848
1072 Ga0495638_0024661
1073 Ga0495638_0183038
1074 Ga0495641_0035285
1075 Ga0495651_0008074
1076 Ga0495651_0040154
1077 Ga0495651_0041023
1078 Ga0495653_0023073
1079 Ga0495580_0178196
1080 Ga0495582_0048966
1081 Ga0495605_0099417
1082 Ga0495639_0016737
1083 Ga0495662_0000752
1084 Ga0495662_0003337
1085 Ga0495662_0055442
1086 Ga0495664_0000894
1087 Ga0495664_0014672
1088 Ga0495664_0063309
1089 Ga0495664_0082492
1090 Ga0495585_0017819
1091 Ga0495585_0034128
1092 Ga0495594_0001377
1093 Ga0495594_0046614
1094 Ga0495594_0054783
1095 Ga0495594_0211944
1096 Ga0495596_0131152
1097 Ga0495607_0012056
1098 Ga0495607_0200848
1099 Ga0495583_0012953
1100 Ga0495583_0013898
1101 Ga0495583_0057481
1102 Ga0495606_0044769
1103 Ga0495608_0132940
1104 Ga0495608_0149608
1105 Ga0495618_0064783
1106 Ga0495618_0076046
1107 Ga0495618_0088913
1108 Ga0495628_0047344
1109 Ga0495628_0066014
1110 Ga0495628_0107883
1111 Ga0495648_0101967
1112 Ga0495666_0012772
1113 Ga0495666_0094740
1114 Ga0495652_0034056
1115 Ga0495652_0040184
1116 Ga0495652_0072084
1117 Ga0495652_0227702
1118 Ga0495640_0055326
1119 Ga0495640_0098608
1120 Ga0495640_0110799
1121 Ga0495640_0163953
1122 Ga0495586_0037958
1123 Ga0495586_0053853
1124 Ga0495587_0000273
1125 Ga0495587_0003110
1126 Ga0495609_0111272
1127 Ga0495597_0011946
1128 Ga0495645_0050563
1129 Ga0495622_0012722
1130 Ga0495622_0014579
1131 Ga0495622_0066159
1132 Ga0495633_0110633
1133 Ga0495667_0012947
1134 Ga0495667_0095472
1135 Ga0495656_0106920
1136 Ga0495668_0005005
1137 Ga0495668_0007768
1138 Ga0495634_0009608
1139 Ga0495634_0010573
1140 Ga0495634_0010984
1141 Ga0495611_0037052
1142 Ga0495611_0075547
1143 Ga0495625_0106347
1144 Ga0495625_0114415
1145 Ga0495635_0004978
1146 Ga0495635_0042723
1147 Ga0495661_0189729
1148 Ga0495588_0007242
1149 Ga0495588_0054232
1150 Ga0495657_0000049
1151 Ga0495657_0006566
1152 Ga0495657_0007365
1153 Ga0495657_0010104
1154 Ga0495657_0015874
1155 Ga0495657_0025086
1156 Ga0495657_0081335
1157 Ga0495599_0094688
1158 Ga0495623_0152517
1159 Ga0495646_0021018
1160 Ga0495646_0061720
1161 Ga0495669_0036377
1162 Ga0495613_0002706
1163 Ga0495613_0005232
1164 Ga0495613_0009424
1165 Ga0495613_0035121
1166 Ga0495613_0109505
1167 Ga0495613_0275654
1168 Ga0495624_0037703
1169 Ga0495671_0010196
1170 Ga0495649_0069336
1171 Ga0495589_0035800
1172 Ga0495589_0056258
1173 Ga0495589_0056698
1174 Ga0495600_0061829
1175 Ga0495600_0193450
1176 Ga0495660_0004050
1177 Ga0495660_0027879
1178 Ga0495581_0001468
1179 Ga0495604_0003659
1180 Ga0495604_0021890
1181 Ga0495604_0041408
1182 Ga0495604_0068137
1183 Ga0495604_0078295
1184 Ga0495604_0111833
1185 Ga0495604_0164736
1186 Ga0495636_0003376
1187 Ga0495636_0006119
1188 Ga0495636_0035485
1189 Ga0495636_0051179
1190 Ga0495674_0176019
1191 Ga0495674_0213526
1192 Ga0495676_0001217
1193 Ga0495676_0006574
1194 Ga0495676_0010176
1195 Ga0495676_0019178
1196 Ga0495676_0023405
1197 Ga0495676_0039025
1198 Ga0495676_0067065
1199 Ga0495680_0006312
1200 Ga0495680_0015996
1201 Ga0495680_0028167
1202 Ga0495680_0071898
1203 Ga0495683_0086807
1204 Ga0495687_000825
1205 Ga0495687_020501
1206 Ga0495687_041344
1207 Ga0495675_0046460
1208 Ga0495675_0078692
1209 Ga0495675_0101560
1210 Ga0495685_000959
1211 Ga0495685_003140
1212 Ga0495685_009416
1213 Ga0495685_025470
1214 Ga0495681_0003781
1215 Ga0495681_0016345
1216 Ga0495681_0031479
1217 Ga0495684_0029594
1218 Ga0495684_0065883
1219 Ga0495684_0123164
1220 Ga0495684_0210223
1221 Ga0495686_0081389
1222 Ga0495686_0193921
1223 Ga0495593_0010985
1224 Ga0495593_0024695
1225 Ga0495602_0003730
1226 Ga0495602_0017605
1227 Ga0495602_0026584
1228 Ga0495614_0000100
1229 Ga0495614_0016273
1230 Ga0495614_0022403
1231 Ga0495614_0075702
1232 Ga0495626_0016585
1233 Ga0496102_0074114
1234 Ga0496102_0089781
1235 Ga0496102_0114799
1236 Ga0496102_0136116
1237 Ga0496103_0088193
1238 Ga0496103_0132060
1239 Ga0496104_0029401
1240 Ga0496104_0122704
1241 Ga0496105_0044743
1242 Ga0496106_0094004
1243 Ga0496108_0067294
1244 Ga0496108_0082603
1245 Ga0496109_0119562
1246 Ga0496109_0321124
1247 Ga0496109_0334832
1248 Ga0496110_0048242
1249 Ga0496111_0052440
1250 Ga0496111_0070102
1251 Ga0496112_0009016
1252 Ga0496112_0065046
1253 Ga0496112_0084631
1254 Ga0496113_0009989
1255 Ga0496113_0013158
1256 Ga0496113_0218962
1257 Ga0496115_0118693
1258 Ga0501031_0002554
1259 Ga0501031_0007113
1260 Ga0501031_0111330
1261 Ga0501032_0005207
1262 Ga0501032_0008122
1263 Ga0501032_0036693
1264 Ga0501032_0040376
1265 Ga0501032_0041774
1266 Ga0501032_0084323
1267 Ga0501032_0104728
1268 Ga0501033_0009248
1269 Ga0501033_0018237
1270 Ga0501033_0076224
1271 Ga0501033_0116892
1272 Ga0501034_0008974
1273 Ga0501034_0044166
1274 Ga0501034_0045827
1275 Ga0501034_0056777
1276 Ga0501034_0172664
1277 Ga0501036_0000708
1278 Ga0501036_0010485
1279 Ga0501036_0017843
1280 Ga0501036_0019366
1281 Ga0501036_0039257
1282 Ga0501036_0046363
1283 Ga0501036_0088166
1284 Ga0501036_0217296
1285 Ga0501037_0002174
1286 Ga0501037_0012944
1287 Ga0501037_0028794
1288 Ga0501037_0066246
1289 Ga0501037_0139147
1290 Ga0501038_0006729
1291 Ga0501038_0035589
1292 Ga0501038_0042919
1293 Ga0501038_0052424
1294 Ga0501038_0120392
1295 Ga0501038_0122948
1296 Ga0501039_0015458
1297 Ga0501039_0052205
1298 Ga0501039_0195296
1299 Ga0501040_0001445
1300 Ga0501041_0024673
1301 Ga0501042_0011296
1302 Ga0501042_0022777
1303 Ga0501042_0161686
1304 Ga0501043_0004336
1305 Ga0501043_0007163
1306 Ga0501043_0009359
1307 Ga0501043_0010698
1308 Ga0501043_0021683
1309 Ga0501043_0041318
1310 Ga0501043_0081138
1311 Ga0501046_0006788
1312 Ga0501046_0047639
1313 Ga0501046_0107107
1314 Ga0501046_0113934
1315 Ga0501047_0000103
1316 Ga0501047_0000353
1317 Ga0501047_0009882
1318 Ga0501047_0012213
1319 Ga0501047_0029789
1320 Ga0501047_0044687
1321 Ga0501047_0052148
1322 Ga0501047_0200931
1323 Ga0501048_0028202
1324 Ga0501048_0062619
1325 Ga0501067_0003009
1326 Ga0501068_0000656
1327 Ga0501069_0001559
1328 Ga0501070_0025530
1329 Ga0501070_0150724
1330 Ga0501070_0294409
1331 Ga0501071_0000349
1332 Ga0501071_0055976
1333 Ga0501072_0002398
1334 Ga0501073_0064576
1335 Ga0501073_0090558
1336 Ga0501074_0000866
1337 Ga0501074_0003063
1338 Ga0501074_0009494
1339 Ga0501075_0106263
1340 Ga0501075_0291351
1341 Ga0501076_0056888
1342 Ga0501076_0249859
1343 Ga0501080_0063380
1344 Ga0501080_0241783
1345 Ga0501083_0008989
1346 Ga0501035_0002009
1347 Ga0501035_0005523
1348 Ga0501035_0023285
1349 Ga0501035_0032516
1350 Ga0501035_0042517
1351 Ga0501035_0071330
1352 Ga0501035_0126150
1353 Ga0501035_0134994
1354 Ga0501035_0148260
1355 Ga0501044_0001895
1356 Ga0501044_0001963
1357 Ga0501044_0018743
1358 Ga0501044_0021222
1359 Ga0501044_0024024
1360 Ga0501044_0052638
1361 Ga0501044_0064164
1362 Ga0501044_0066117
1363 Ga0501044_0192925
1364 Ga0501044_0195659
1365 Ga0501044_0321198
1366 Ga0501045_0360987
1367 nmdc:mga03n38_56910_c1
1368 nmdc:mga0yw44_13731_c1
1369 nmdc:mga06z11_31385_c1
1370 nmdc:mga04h51_22801_c1
1371 nmdc:mga05p37_2963_c1
1372 nmdc:mga05p37_820_c1
1373 nmdc:mga09592_5182_c1
1374 nmdc:mga0qj67_14923_c1
1375 nmdc:mga0qj67_531_c1
1376 nmdc:mga06r32_56752_c1
1377 nmdc:mga06r32_60464_c1
1378 nmdc:mga0rr50_106212_c1
1379 nmdc:mga08x19_147381_c1
1380 nmdc:mga0a205_24398_c1
1381 Ga0495612_0019408
1382 Ga0495655_0029301
1383 Ga0495595_0028600
1384 Ga0495619_0038670
1385 Ga0500644_0021558
1386 Ga0500640_029375
1387 Ga0500556_0058397
1388 Ga0500560_000753
1389 Ga0500560_017345
1390 Ga0500572_015599
1391 Ga0500580_085925
1392 Ga0500594_0025002
1393 Ga0500621_039959
1394 Ga0500628_039880
1395 Ga0500561_0003140
1396 Ga0500633_0007523
1397 Ga0500634_0060929
1398 Ga0500656_007804
1399 Ga0501084_0015209
1400 Ga0587093_004061
1401 Ga0587078_003215
1402 Ga0587111_0003527
1403 Ga0501082_0040583
1404 Ga0466962_0000081
1405 Ga0466962_0007836
1406 Ga0466962_0018367
1407 2547408771
1408 2554260117
1409 2585299512
1410 2585305819
1411 2585305909
1412 2585315149
1413 2616693550
1414 2616900994
1415 2643760477
1416 2643898835
1417 2643947247
1418 2644270190
1419 2644386393
1420 2644403604
1421 2644433282
1422 2644441901
1423 2644459560
1424 2644630670
1425 2676487727
1426 2768643785
1427 2784586208
1428 2785346688
1429 2785366322
1430 2785366439
1431 2786667303
1432 2786675858
1433 2793976982
1434 2808846952
1435 2808917669
1436 2809229604
1437 2811846535
1438 2812361375
1439 2812477305
1440 2819699939
1441 2852642625
1442 2862180981
1443 2862282471
1444 2862293570
1445 2862387028
1446 2862513738
1447 2862580580
1448 2867346752
1449 2867375194
1450 2867436882
1451 2867478162
1452 2873158005
1453 2875392167
1454 2877684096
1455 2877684196
1456 2884697734
1457 2895431856
1458 2895444836
1459 2912723498
1460 2912726735
1461 2912758329
1462 2918501918
1463 2919470150
1464 2935391450
1465 2935393119
1466 2946052732
1467 2946064709
1468 2946073084
1469 2947224675
1470 2954008300
1471 2954389511
1472 2954682391
1473 2954690533
1474 2954691300
1475 2954700288
1476 2954701941
1477 2954719050
1478 2954729020
1479 2954732791
1480 2954747919
1481 2954751669
1482 2954767045
1483 2966605028
1484 2990061829
1485 2990093415
1486 2997453834
1487 2997605913
1488 3006327773
1489 3006394725
1490 3006428239
1491 3006488145
1492 3006498358
1493 8008560464
1494 8008581340
1495 8023629922
1496 8025486146
1497 8025536304
1498 8033690380
1499 8047901125
1500 8048134188
1501 8048357776
1502 8048378064
1503 8048387162
1504 8048413590
1505 8054161960
1506 8056451310
1507 8056669957
1508 8056830921

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02733

Dak1

Dak1 domain

55

363

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4lry-assembly1.cif.gz_B crystal structure of the e.coli dhar(n)-dhak(t79l) complex 0.972 1 329
4lry-assembly1.cif.gz_B crystal structure of the e.coli dhar(n)-dhak(t79l) complex 0.9691 1 329
3pnk-assembly1.cif.gz_B crystal structure of e.coli dha kinase dhak 0.9593 2 328
3pnk-assembly1.cif.gz_B crystal structure of e.coli dha kinase dhak 0.9508 2 328
3ct4-assembly1.cif.gz_A structure of dha-kinase subunit dhak from l. lactis 0.9499 2 325
ID Description Score Start End Superfamily
af_P76015_11_183_3.40.50.10440 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 0.9809 11 182 3.40.50.10440
af_P76015_11_183_3.40.50.10440 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 0.9698 11 182 3.40.50.10440
af_Q2G1Z0_14_178_3.40.50.10440 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 0.9496 14 181 3.40.50.10440
af_Q2G1Z0_180_322_3.30.1180.20 Alpha Beta;2-Layer Sandwich;Hypothetical Protein Tm841; Chain: A;domain 3;Dihydroxyacetone kinase; domain 2 0.9387 185 319 3.30.1180.20
af_Q9N5C4_13_185_3.40.50.10440 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Dihydroxyacetone kinase; domain 1 0.935 12 182 3.40.50.10440
ID Description Score Start End GO Terms
AF-A0A6B3GB48-F1-model_v4 Dihydroxyacetone kinase subunit DhaK 0.9903 1 211 GO:0004371
GO:0005829
GO:0019563
AF-A0A7K2FDW1-F1-model_v4 Dihydroxyacetone kinase subunit DhaK (EC 2.7.1.121) 0.9872 1 329 GO:0004371
GO:0005829
GO:0019563
GO:0047324
AF-A0A6A0ANJ3-F1-model_v4 Dihydroxyacetone kinase subunit DhaK 0.9872 3 329 GO:0004371
GO:0005829
GO:0019563
AF-A0A1R0M6I1-F1-model_v4 Dihydroxyacetone kinase subunit DhaK 0.9869 1 329 GO:0004371
GO:0005829
GO:0019563
AF-A0A0U3TKS4-F1-model_v4 Dihydroxyacetone kinase 0.9868 2 329 GO:0004371
GO:0005829
GO:0019563

Map