F479213
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 753 | 295 | 1506 | 287 |
Family's Representative Sequence
| Representative Sequence | 3300025922|Ga0207646_10240458|Ga0207646_102404581 |
| Length | 329 |
| Sequence | MPGGRPRGLEHTVDEGGRGPRPLDGAEQRDRCPEAIELAPAVGALRQVGVDLCPLLDLQGVSELFPISSLGHSVILPRLVGWHIHQNDKFFITFLVATHLATAIVLLLFFRHDWWRILKGLGRSLRDRGIAPDDADAKLGWLLVVGTIPAGILGLLLENKLRSVFASAQSASIFLCLNGLLLYGAELLRRRAPQTAEDDDTRIARQVSFPQSFFVGAAQALALVPGLSRSGATMGGGLLVGLSHKDAARFAFLLATPIIGAAAALKLPELAGKEGNGVRGPAAVGALCAAVTAYFAVRFLMRYFETQTLTPFAIYCAAAGAAAAIYFAL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 5 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 6 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 29 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 33 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 34 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 35 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 40 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 42 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 44 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 52 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 54 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 55 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 58 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 68 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 95 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 99 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 100 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 145 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 146 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 147 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 149 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 150 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 151 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 152 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 153 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 154 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 155 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 156 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 157 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 158 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 159 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 160 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 161 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 162 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 163 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 164 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 165 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 166 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 168 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 169 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 170 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 171 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 172 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 173 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 174 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 175 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 176 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 177 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 178 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 179 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 180 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 181 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 182 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 183 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 184 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 185 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 186 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 187 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 188 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 189 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 190 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 192 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 193 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 194 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 195 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 196 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 197 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 198 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 199 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 200 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 201 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 202 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 203 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 204 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 205 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 206 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 207 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 208 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 209 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 210 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 211 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 260 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 261 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 262 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 263 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 264 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 265 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 267 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 268 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 269 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 270 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 271 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 272 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 273 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 281 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 294 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 295 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.6 |
| Metatranscriptomes | 0.27 |
| Isolates | 0.13 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 15.54 |
| Rhizosphere | 84.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0207646_10240458 | 3300025922 | Bacteria | 1636 |
| 2 | JGI24744J21845_10000048 | 3300002077 | Bacteria | 13865 |
| 3 | JGI25406J46586_10043029 | 3300003203 | Bacteria | 1576 |
| 4 | Ga0070683_100264211 | 3300005329 | Bacteria | 1637 |
| 5 | Ga0068869_100324823 | 3300005334 | Bacteria | 1249 |
| 6 | Ga0070666_10042304 | 3300005335 | Bacteria | 3048 |
| 7 | Ga0070680_100118483 | 3300005336 | Bacteria | 2208 |
| 8 | Ga0070682_100002740 | 3300005337 | Bacteria | 9760 |
| 9 | Ga0068868_100021086 | 3300005338 | Bacteria | 4905 |
| 10 | Ga0068868_100021337 | 3300005338 | Bacteria | 4877 |
| 11 | Ga0070660_100212528 | 3300005339 | Unclassified | 1571 |
| 12 | Ga0070689_100012819 | 3300005340 | Bacteria | 6054 |
| 13 | Ga0070692_10055696 | 3300005345 | Bacteria | 2068 |
| 14 | Ga0070668_100263230 | 3300005347 | Bacteria | 1435 |
| 15 | Ga0070669_100065484 | 3300005353 | Bacteria | 2677 |
| 16 | Ga0070669_100497170 | 3300005353 | Bacteria | 1011 |
| 17 | Ga0070671_100006577 | 3300005355 | Bacteria | 9289 |
| 18 | Ga0070674_100002377 | 3300005356 | Bacteria | 10399 |
| 19 | Ga0070673_100022916 | 3300005364 | Bacteria | 4556 |
| 20 | Ga0070673_100344563 | 3300005364 | Bacteria | 1321 |
| 21 | Ga0070688_100003284 | 3300005365 | Bacteria | 8295 |
| 22 | Ga0070659_100065631 | 3300005366 | Bacteria | 2875 |
| 23 | Ga0070703_10033832 | 3300005406 | Bacteria | 1557 |
| 24 | Ga0070703_10045519 | 3300005406 | Bacteria | 1384 |
| 25 | Ga0070709_10002232 | 3300005434 | Bacteria | 10500 |
| 26 | Ga0070709_10123517 | 3300005434 | Bacteria | 1758 |
| 27 | Ga0070709_10140564 | 3300005434 | Bacteria | 1658 |
| 28 | Ga0070714_100032813 | 3300005435 | Bacteria | 4336 |
| 29 | Ga0070714_100041494 | 3300005435 | Bacteria | 3883 |
| 30 | Ga0070714_100058967 | 3300005435 | Bacteria | 3290 |
| 31 | Ga0070714_100068626 | 3300005435 | Bacteria | 3059 |
| 32 | Ga0070714_100124502 | 3300005435 | Bacteria | 2296 |
| 33 | Ga0070714_100240895 | 3300005435 | Bacteria | 1669 |
| 34 | Ga0070713_100039142 | 3300005436 | Bacteria | 3846 |
| 35 | Ga0070713_100045215 | 3300005436 | Bacteria | 3607 |
| 36 | Ga0070713_100062979 | 3300005436 | Unclassified | 3107 |
| 37 | Ga0070713_100081255 | 3300005436 | Bacteria | 2765 |
| 38 | Ga0070713_100167035 | 3300005436 | Bacteria | 1968 |
| 39 | Ga0070713_100320250 | 3300005436 | Bacteria | 1432 |
| 40 | Ga0070713_100446737 | 3300005436 | Bacteria | 1214 |
| 41 | Ga0070710_10042740 | 3300005437 | Bacteria | 2507 |
| 42 | Ga0070710_10043599 | 3300005437 | Bacteria | 2485 |
| 43 | Ga0070710_10046845 | 3300005437 | Bacteria | 2409 |
| 44 | Ga0070710_10062629 | 3300005437 | Bacteria | 2122 |
| 45 | Ga0070710_10161198 | 3300005437 | Bacteria | 1391 |
| 46 | Ga0070710_10167049 | 3300005437 | Bacteria | 1368 |
| 47 | Ga0070701_10001647 | 3300005438 | Bacteria | 8353 |
| 48 | Ga0070711_100007901 | 3300005439 | Bacteria | 6485 |
| 49 | Ga0070711_100161386 | 3300005439 | Bacteria | 1699 |
| 50 | Ga0070711_100171955 | 3300005439 | Bacteria | 1652 |
| 51 | Ga0070705_100013222 | 3300005440 | Bacteria | 4216 |
| 52 | Ga0070705_100124313 | 3300005440 | Bacteria | 1671 |
| 53 | Ga0070705_100353999 | 3300005440 | Bacteria | 1071 |
| 54 | Ga0070700_100013116 | 3300005441 | Bacteria | 4649 |
| 55 | Ga0070694_100077844 | 3300005444 | Bacteria | 2298 |
| 56 | Ga0070694_100149709 | 3300005444 | Bacteria | 1703 |
| 57 | Ga0070708_100222033 | 3300005445 | Bacteria | 1772 |
| 58 | Ga0070708_100293980 | 3300005445 | Bacteria | 1529 |
| 59 | Ga0070708_100458271 | 3300005445 | Bacteria | 1203 |
| 60 | Ga0070678_100033694 | 3300005456 | Bacteria | 3559 |
| 61 | Ga0070681_10257196 | 3300005458 | Bacteria | 1658 |
| 62 | Ga0070681_10302997 | 3300005458 | Bacteria | 1507 |
| 63 | Ga0068867_100007309 | 3300005459 | Bacteria | 7817 |
| 64 | Ga0070685_10000713 | 3300005466 | Bacteria | 18043 |
| 65 | Ga0070706_100009295 | 3300005467 | Bacteria | 9160 |
| 66 | Ga0070706_100228418 | 3300005467 | Bacteria | 1737 |
| 67 | Ga0070707_100000908 | 3300005468 | Bacteria | 29349 |
| 68 | Ga0070707_100009704 | 3300005468 | Bacteria | 8946 |
| 69 | Ga0070707_100082652 | 3300005468 | Bacteria | 3102 |
| 70 | Ga0070707_100190093 | 3300005468 | Bacteria | 2002 |
| 71 | Ga0070707_100583020 | 3300005468 | Bacteria | 1081 |
| 72 | Ga0070698_100012522 | 3300005471 | Bacteria | 8981 |
| 73 | Ga0070698_100033115 | 3300005471 | Bacteria | 5353 |
| 74 | Ga0070698_100079742 | 3300005471 | Bacteria | 3270 |
| 75 | Ga0070698_100116827 | 3300005471 | Bacteria | 2630 |
| 76 | Ga0070698_100187068 | 3300005471 | Bacteria | 2009 |
| 77 | Ga0070698_100233293 | 3300005471 | Bacteria | 1773 |
| 78 | Ga0070698_100271375 | 3300005471 | Bacteria | 1628 |
| 79 | Ga0070698_100300786 | 3300005471 | Bacteria | 1535 |
| 80 | Ga0070699_100080090 | 3300005518 | Bacteria | 2846 |
| 81 | Ga0070679_100163879 | 3300005530 | Bacteria | 2197 |
| 82 | Ga0070697_100046669 | 3300005536 | Bacteria | 3511 |
| 83 | Ga0070697_100242135 | 3300005536 | Bacteria | 1541 |
| 84 | Ga0070697_100289087 | 3300005536 | Bacteria | 1408 |
| 85 | Ga0068853_100000599 | 3300005539 | Bacteria | 24755 |
| 86 | Ga0068853_100383646 | 3300005539 | Bacteria | 1313 |
| 87 | Ga0070672_100000982 | 3300005543 | Bacteria | 17248 |
| 88 | Ga0070686_100003945 | 3300005544 | Bacteria | 8158 |
| 89 | Ga0070695_100048809 | 3300005545 | Bacteria | 2708 |
| 90 | Ga0070696_100024382 | 3300005546 | Bacteria | 4111 |
| 91 | Ga0070696_100157879 | 3300005546 | Bacteria | 1669 |
| 92 | Ga0070696_100167131 | 3300005546 | Bacteria | 1624 |
| 93 | Ga0070665_100073592 | 3300005548 | Bacteria | 3422 |
| 94 | Ga0070704_100042599 | 3300005549 | Bacteria | 3141 |
| 95 | Ga0068855_100007768 | 3300005563 | Bacteria | 12954 |
| 96 | Ga0068855_100108365 | 3300005563 | Bacteria | 3190 |
| 97 | Ga0068855_100150383 | 3300005563 | Bacteria | 2647 |
| 98 | Ga0068855_100211553 | 3300005563 | Bacteria | 2179 |
| 99 | Ga0070664_100637067 | 3300005564 | Bacteria | 990 |
| 100 | Ga0068857_100261695 | 3300005577 | Bacteria | 1588 |
| 101 | Ga0068856_100001488 | 3300005614 | Bacteria | 24505 |
| 102 | Ga0068856_100152139 | 3300005614 | Bacteria | 2323 |
| 103 | Ga0068856_100195775 | 3300005614 | Bacteria | 2035 |
| 104 | Ga0068856_100254576 | 3300005614 | Unclassified | 1771 |
| 105 | Ga0068856_100318154 | 3300005614 | Bacteria | 1573 |
| 106 | Ga0070702_100033386 | 3300005615 | Bacteria | 2829 |
| 107 | Ga0068852_100354504 | 3300005616 | Bacteria | 1433 |
| 108 | Ga0068866_10000288 | 3300005718 | Bacteria | 24073 |
| 109 | Ga0068861_100071161 | 3300005719 | Bacteria | 2695 |
| 110 | Ga0068861_100098734 | 3300005719 | Bacteria | 2318 |
| 111 | Ga0068863_100116749 | 3300005841 | Bacteria | 2543 |
| 112 | Ga0068860_100062444 | 3300005843 | Bacteria | 3540 |
| 113 | Ga0068860_100207764 | 3300005843 | Bacteria | 1899 |
| 114 | Ga0068862_100187048 | 3300005844 | Bacteria | 1862 |
| 115 | Ga0081539_10001691 | 3300005985 | Bacteria | 35581 |
| 116 | Ga0081539_10002541 | 3300005985 | Bacteria | 25355 |
| 117 | Ga0070717_10010490 | 3300006028 | Bacteria | 6999 |
| 118 | Ga0070717_10023883 | 3300006028 | Bacteria | 4850 |
| 119 | Ga0070717_10134792 | 3300006028 | Bacteria | 2126 |
| 120 | Ga0070717_10190175 | 3300006028 | Bacteria | 1793 |
| 121 | Ga0070717_10272827 | 3300006028 | Bacteria | 1498 |
| 122 | Ga0070715_10000741 | 3300006163 | Bacteria | 8796 |
| 123 | Ga0070715_10032783 | 3300006163 | Bacteria | 2118 |
| 124 | Ga0070715_10083561 | 3300006163 | Bacteria | 1454 |
| 125 | Ga0070715_10139699 | 3300006163 | Bacteria | 1175 |
| 126 | Ga0070716_100034129 | 3300006173 | Bacteria | 2787 |
| 127 | Ga0070716_100085079 | 3300006173 | Bacteria | 1898 |
| 128 | Ga0070716_100214476 | 3300006173 | Bacteria | 1289 |
| 129 | Ga0070716_100237945 | 3300006173 | Bacteria | 1233 |
| 130 | Ga0070712_100002294 | 3300006175 | Bacteria | 11782 |
| 131 | Ga0070712_100020138 | 3300006175 | Bacteria | 4362 |
| 132 | Ga0070712_100024038 | 3300006175 | Bacteria | 4032 |
| 133 | Ga0070712_100024189 | 3300006175 | Bacteria | 4021 |
| 134 | Ga0070712_100144724 | 3300006175 | Bacteria | 1818 |
| 135 | Ga0070712_100221003 | 3300006175 | Bacteria | 1500 |
| 136 | Ga0070712_100250431 | 3300006175 | Bacteria | 1415 |
| 137 | Ga0070712_100514915 | 3300006175 | Unclassified | 1004 |
| 138 | Ga0097621_100020690 | 3300006237 | Bacteria | 5074 |
| 139 | Ga0068871_100002551 | 3300006358 | Bacteria | 12432 |
| 140 | Ga0068871_100178840 | 3300006358 | Bacteria | 1822 |
| 141 | Ga0075428_100081858 | 3300006844 | Bacteria | 3523 |
| 142 | Ga0075433_10003161 | 3300006852 | Bacteria | 12683 |
| 143 | Ga0075433_10004549 | 3300006852 | Bacteria | 10816 |
| 144 | Ga0075433_10039097 | 3300006852 | Bacteria | 4100 |
| 145 | Ga0075433_10117966 | 3300006852 | Bacteria | 2355 |
| 146 | Ga0075433_10122223 | 3300006852 | Bacteria | 2312 |
| 147 | Ga0075434_100001540 | 3300006871 | Bacteria | 19518 |
| 148 | Ga0075434_100012783 | 3300006871 | Bacteria | 7968 |
| 149 | Ga0075434_100031404 | 3300006871 | Bacteria | 5236 |
| 150 | Ga0075434_100099396 | 3300006871 | Bacteria | 2915 |
| 151 | Ga0075434_100206706 | 3300006871 | Bacteria | 1984 |
| 152 | Ga0075434_100308273 | 3300006871 | Unclassified | 1603 |
| 153 | Ga0068865_100383580 | 3300006881 | Bacteria | 1147 |
| 154 | Ga0075436_100000947 | 3300006914 | Bacteria | 19413 |
| 155 | Ga0075436_100007807 | 3300006914 | Bacteria | 7318 |
| 156 | Ga0075436_100008576 | 3300006914 | Bacteria | 6985 |
| 157 | Ga0075436_100009593 | 3300006914 | Bacteria | 6626 |
| 158 | Ga0075436_100083531 | 3300006914 | Bacteria | 2216 |
| 159 | Ga0075436_100211479 | 3300006914 | Unclassified | 1375 |
| 160 | Ga0075435_100006557 | 3300007076 | Bacteria | 8233 |
| 161 | Ga0075435_100013944 | 3300007076 | Bacteria | 5994 |
| 162 | Ga0075435_100023558 | 3300007076 | Bacteria | 4763 |
| 163 | Ga0075435_100026919 | 3300007076 | Bacteria | 4492 |
| 164 | Ga0075435_100031553 | 3300007076 | Bacteria | 4175 |
| 165 | Ga0105240_10000920 | 3300009093 | Bacteria | 52419 |
| 166 | Ga0105240_10035548 | 3300009093 | Bacteria | 6419 |
| 167 | Ga0105240_10184799 | 3300009093 | Bacteria | 2456 |
| 168 | Ga0105240_10491964 | 3300009093 | Bacteria | 1365 |
| 169 | Ga0111539_10430739 | 3300009094 | Bacteria | 1536 |
| 170 | Ga0111539_10483696 | 3300009094 | Bacteria | 1442 |
| 171 | Ga0111539_10547098 | 3300009094 | Bacteria | 1349 |
| 172 | Ga0105245_10001880 | 3300009098 | Bacteria | 19055 |
| 173 | Ga0105245_10087806 | 3300009098 | Bacteria | 2855 |
| 174 | Ga0105245_10217268 | 3300009098 | Bacteria | 1843 |
| 175 | Ga0105245_10343650 | 3300009098 | Bacteria | 1476 |
| 176 | Ga0105245_10476968 | 3300009098 | Bacteria | 1260 |
| 177 | Ga0105245_10535793 | 3300009098 | Bacteria | 1191 |
| 178 | Ga0105245_10611719 | 3300009098 | Bacteria | 1117 |
| 179 | Ga0105247_10002585 | 3300009101 | Bacteria | 12254 |
| 180 | Ga0114129_10009708 | 3300009147 | Bacteria | 13732 |
| 181 | Ga0114129_10020152 | 3300009147 | Bacteria | 9492 |
| 182 | Ga0114129_10306578 | 3300009147 | Bacteria | 2115 |
| 183 | Ga0105243_10029470 | 3300009148 | Bacteria | 4221 |
| 184 | Ga0105243_10059732 | 3300009148 | Bacteria | 3044 |
| 185 | Ga0105243_10266688 | 3300009148 | Bacteria | 1536 |
| 186 | Ga0105241_10116033 | 3300009174 | Unclassified | 2150 |
| 187 | Ga0105242_10079714 | 3300009176 | Bacteria | 2735 |
| 188 | Ga0105242_10167219 | 3300009176 | Bacteria | 1930 |
| 189 | Ga0105242_10226303 | 3300009176 | Bacteria | 1674 |
| 190 | Ga0105242_10350387 | 3300009176 | Bacteria | 1363 |
| 191 | Ga0105248_10005061 | 3300009177 | Bacteria | 14557 |
| 192 | Ga0105237_10295953 | 3300009545 | Bacteria | 1621 |
| 193 | Ga0105238_10126857 | 3300009551 | Bacteria | 2530 |
| 194 | Ga0105238_10258321 | 3300009551 | Bacteria | 1721 |
| 195 | Ga0105249_10002244 | 3300009553 | Bacteria | 16771 |
| 196 | Ga0105239_10000975 | 3300010375 | Bacteria | 40184 |
| 197 | Ga0105239_10159139 | 3300010375 | Bacteria | 2522 |
| 198 | Ga0157373_10044365 | 3300013100 | Bacteria | 3174 |
| 199 | Ga0157370_10018152 | 3300013104 | Bacteria | 7080 |
| 200 | Ga0157370_10099457 | 3300013104 | Bacteria | 2726 |
| 201 | Ga0157370_10131812 | 3300013104 | Bacteria | 2331 |
| 202 | Ga0157369_10177145 | 3300013105 | Bacteria | 2244 |
| 203 | Ga0157369_10374104 | 3300013105 | Bacteria | 1479 |
| 204 | Ga0157374_10005744 | 3300013296 | Bacteria | 10470 |
| 205 | Ga0157374_10081369 | 3300013296 | Bacteria | 3073 |
| 206 | Ga0157374_10222864 | 3300013296 | Bacteria | 1851 |
| 207 | Ga0157374_10328005 | 3300013296 | Bacteria | 1518 |
| 208 | Ga0157378_10002591 | 3300013297 | Bacteria | 16094 |
| 209 | Ga0163162_10004951 | 3300013306 | Bacteria | 12835 |
| 210 | Ga0163162_10138488 | 3300013306 | Bacteria | 2545 |
| 211 | Ga0163162_10164380 | 3300013306 | Bacteria | 2343 |
| 212 | Ga0157372_10040045 | 3300013307 | Bacteria | 5175 |
| 213 | Ga0157372_10193854 | 3300013307 | Bacteria | 2353 |
| 214 | Ga0157372_10229489 | 3300013307 | Unclassified | 2152 |
| 215 | Ga0157375_10001218 | 3300013308 | Bacteria | 22180 |
| 216 | Ga0157375_11088169 | 3300013308 | Unclassified | 935 |
| 217 | Ga0157380_10020626 | 3300014326 | Bacteria | 4928 |
| 218 | Ga0182008_10095274 | 3300014497 | Bacteria | 1469 |
| 219 | Ga0157377_10001116 | 3300014745 | Bacteria | 11364 |
| 220 | Ga0157379_10322703 | 3300014968 | Bacteria | 1410 |
| 221 | Ga0157376_10006361 | 3300014969 | Bacteria | 8341 |
| 222 | Ga0157376_10041000 | 3300014969 | Bacteria | 3788 |
| 223 | Ga0206353_11262601 | 3300020082 | Bacteria | 1705 |
| 224 | Ga0206353_11495463 | 3300020082 | Bacteria | 1845 |
| 225 | Ga0213871_10005597 | 3300021441 | Bacteria | 2603 |
| 226 | Ga0207653_10007984 | 3300025885 | Bacteria | 3299 |
| 227 | Ga0207653_10044209 | 3300025885 | Bacteria | 1468 |
| 228 | Ga0207692_10012609 | 3300025898 | Bacteria | 3635 |
| 229 | Ga0207692_10045051 | 3300025898 | Unclassified | 2204 |
| 230 | Ga0207642_10001625 | 3300025899 | Bacteria | 6917 |
| 231 | Ga0207688_10091542 | 3300025901 | Bacteria | 1747 |
| 232 | Ga0207680_10029293 | 3300025903 | Bacteria | 3091 |
| 233 | Ga0207647_10044556 | 3300025904 | Bacteria | 2771 |
| 234 | Ga0207685_10008490 | 3300025905 | Bacteria | 2928 |
| 235 | Ga0207685_10014067 | 3300025905 | Bacteria | 2495 |
| 236 | Ga0207699_10023229 | 3300025906 | Bacteria | 3372 |
| 237 | Ga0207699_10141020 | 3300025906 | Bacteria | 1584 |
| 238 | Ga0207684_10038097 | 3300025910 | Bacteria | 4080 |
| 239 | Ga0207684_10069873 | 3300025910 | Bacteria | 2984 |
| 240 | Ga0207684_10238053 | 3300025910 | Bacteria | 1570 |
| 241 | Ga0207684_10305031 | 3300025910 | Unclassified | 1373 |
| 242 | Ga0207695_10000785 | 3300025913 | Bacteria | 59941 |
| 243 | Ga0207695_10089307 | 3300025913 | Bacteria | 3099 |
| 244 | Ga0207695_10107047 | 3300025913 | Bacteria | 2781 |
| 245 | Ga0207695_10243533 | 3300025913 | Bacteria | 1699 |
| 246 | Ga0207693_10000190 | 3300025915 | Bacteria | 56234 |
| 247 | Ga0207693_10000745 | 3300025915 | Bacteria | 29290 |
| 248 | Ga0207693_10023385 | 3300025915 | Bacteria | 4907 |
| 249 | Ga0207693_10036427 | 3300025915 | Bacteria | 3879 |
| 250 | Ga0207693_10052762 | 3300025915 | Bacteria | 3189 |
| 251 | Ga0207693_10062641 | 3300025915 | Bacteria | 2914 |
| 252 | Ga0207693_10089732 | 3300025915 | Bacteria | 2409 |
| 253 | Ga0207693_10093160 | 3300025915 | Bacteria | 2361 |
| 254 | Ga0207693_10177149 | 3300025915 | Bacteria | 1678 |
| 255 | Ga0207693_10270871 | 3300025915 | Bacteria | 1330 |
| 256 | Ga0207663_10001144 | 3300025916 | Bacteria | 12231 |
| 257 | Ga0207663_10023118 | 3300025916 | Bacteria | 3563 |
| 258 | Ga0207663_10049294 | 3300025916 | Unclassified | 2611 |
| 259 | Ga0207663_10196469 | 3300025916 | Bacteria | 1452 |
| 260 | Ga0207657_10260642 | 3300025919 | Bacteria | 1380 |
| 261 | Ga0207646_10000785 | 3300025922 | Bacteria | 41163 |
| 262 | Ga0207646_10013954 | 3300025922 | Bacteria | 7657 |
| 263 | Ga0207646_10049089 | 3300025922 | Bacteria | 3781 |
| 264 | Ga0207646_10121285 | 3300025922 | Bacteria | 2349 |
| 265 | Ga0207646_10378607 | 3300025922 | Bacteria | 1279 |
| 266 | Ga0207694_10039153 | 3300025924 | Bacteria | 3647 |
| 267 | Ga0207694_10114559 | 3300025924 | Bacteria | 2147 |
| 268 | Ga0207687_10035096 | 3300025927 | Bacteria | 3410 |
| 269 | Ga0207687_10138099 | 3300025927 | Bacteria | 1846 |
| 270 | Ga0207687_10159425 | 3300025927 | Bacteria | 1730 |
| 271 | Ga0207700_10000012 | 3300025928 | Bacteria | 231712 |
| 272 | Ga0207700_10026889 | 3300025928 | Bacteria | 4019 |
| 273 | Ga0207700_10046445 | 3300025928 | Bacteria | 3211 |
| 274 | Ga0207664_10008805 | 3300025929 | Bacteria | 7059 |
| 275 | Ga0207664_10047056 | 3300025929 | Bacteria | 3387 |
| 276 | Ga0207664_10231573 | 3300025929 | Bacteria | 1606 |
| 277 | Ga0207664_10304761 | 3300025929 | Bacteria | 1402 |
| 278 | Ga0207664_10464443 | 3300025929 | Bacteria | 1131 |
| 279 | Ga0207644_10026202 | 3300025931 | Bacteria | 4015 |
| 280 | Ga0207706_10129094 | 3300025933 | Unclassified | 2223 |
| 281 | Ga0207686_10016986 | 3300025934 | Bacteria | 4091 |
| 282 | Ga0207686_10312109 | 3300025934 | Bacteria | 1172 |
| 283 | Ga0207709_10000714 | 3300025935 | Bacteria | 26694 |
| 284 | Ga0207709_10042357 | 3300025935 | Unclassified | 2738 |
| 285 | Ga0207669_10044850 | 3300025937 | Bacteria | 2601 |
| 286 | Ga0207669_10266441 | 3300025937 | Bacteria | 1284 |
| 287 | Ga0207704_10016861 | 3300025938 | Bacteria | 3768 |
| 288 | Ga0207704_10424223 | 3300025938 | Bacteria | 1055 |
| 289 | Ga0207704_10483116 | 3300025938 | Bacteria | 995 |
| 290 | Ga0207665_10025991 | 3300025939 | Bacteria | 3862 |
| 291 | Ga0207665_10034672 | 3300025939 | Bacteria | 3348 |
| 292 | Ga0207665_10085519 | 3300025939 | Bacteria | 2177 |
| 293 | Ga0207665_10141228 | 3300025939 | Bacteria | 1717 |
| 294 | Ga0207665_10146714 | 3300025939 | Bacteria | 1686 |
| 295 | Ga0207665_10251156 | 3300025939 | Bacteria | 1307 |
| 296 | Ga0207691_10010717 | 3300025940 | Bacteria | 8801 |
| 297 | Ga0207711_10020314 | 3300025941 | Bacteria | 5536 |
| 298 | Ga0207689_10252742 | 3300025942 | Bacteria | 1458 |
| 299 | Ga0207689_10257854 | 3300025942 | Bacteria | 1442 |
| 300 | Ga0207679_10086360 | 3300025945 | Bacteria | 2413 |
| 301 | Ga0207667_10023399 | 3300025949 | Bacteria | 6803 |
| 302 | Ga0207667_10093464 | 3300025949 | Bacteria | 3106 |
| 303 | Ga0207667_10181741 | 3300025949 | Bacteria | 2159 |
| 304 | Ga0207667_10246052 | 3300025949 | Bacteria | 1830 |
| 305 | Ga0207667_10337275 | 3300025949 | Unclassified | 1539 |
| 306 | Ga0207712_10022858 | 3300025961 | Bacteria | 4122 |
| 307 | Ga0207668_10090194 | 3300025972 | Bacteria | 2249 |
| 308 | Ga0207668_10230845 | 3300025972 | Bacteria | 1492 |
| 309 | Ga0207640_10042006 | 3300025981 | Bacteria | 2912 |
| 310 | Ga0207677_10006995 | 3300026023 | Bacteria | 6206 |
| 311 | Ga0207677_10137137 | 3300026023 | Bacteria | 1867 |
| 312 | Ga0207639_10005567 | 3300026041 | Bacteria | 8518 |
| 313 | Ga0207639_10638881 | 3300026041 | Bacteria | 984 |
| 314 | Ga0207708_10000111 | 3300026075 | Bacteria | 62791 |
| 315 | Ga0207708_10196732 | 3300026075 | Bacteria | 1607 |
| 316 | Ga0207708_10285318 | 3300026075 | Bacteria | 1339 |
| 317 | Ga0207702_10046130 | 3300026078 | Bacteria | 3667 |
| 318 | Ga0207702_10066927 | 3300026078 | Bacteria | 3081 |
| 319 | Ga0207702_10088749 | 3300026078 | Bacteria | 2702 |
| 320 | Ga0207702_10099571 | 3300026078 | Bacteria | 2563 |
| 321 | Ga0207702_10278816 | 3300026078 | Bacteria | 1579 |
| 322 | Ga0207648_10000136 | 3300026089 | Bacteria | 73368 |
| 323 | Ga0207674_10160034 | 3300026116 | Bacteria | 2206 |
| 324 | Ga0207675_100008182 | 3300026118 | Bacteria | 9857 |
| 325 | Ga0207675_100010108 | 3300026118 | Bacteria | 8844 |
| 326 | Ga0207683_10001232 | 3300026121 | Bacteria | 23246 |
| 327 | Ga0207683_10051435 | 3300026121 | Bacteria | 3609 |
| 328 | Ga0207428_10008369 | 3300027907 | Bacteria | 9344 |
| 329 | Ga0268266_10156907 | 3300028379 | Unclassified | 2056 |
| 330 | Ga0268265_10040263 | 3300028380 | Bacteria | 3451 |
| 331 | Ga0268264_10043105 | 3300028381 | Bacteria | 3738 |
| 332 | Ga0265337_1012446 | 3300028556 | Unclassified | 2891 |
| 333 | Ga0265326_10006384 | 3300028558 | Unclassified | 3669 |
| 334 | Ga0265319_1000985 | 3300028563 | Bacteria | 17873 |
| 335 | Ga0265319_1003201 | 3300028563 | Bacteria | 8615 |
| 336 | Ga0265319_1004016 | 3300028563 | Bacteria | 7453 |
| 337 | Ga0265319_1014116 | 3300028563 | Unclassified | 3144 |
| 338 | Ga0265319_1014749 | 3300028563 | Bacteria | 3054 |
| 339 | Ga0265319_1021126 | 3300028563 | Bacteria | 2396 |
| 340 | Ga0265319_1030357 | 3300028563 | Bacteria | 1891 |
| 341 | Ga0265319_1044366 | 3300028563 | Bacteria | 1490 |
| 342 | Ga0265334_10000652 | 3300028573 | Bacteria | 17431 |
| 343 | Ga0265334_10078128 | 3300028573 | Bacteria | 1223 |
| 344 | Ga0265318_10000633 | 3300028577 | Bacteria | 24181 |
| 345 | Ga0265318_10002263 | 3300028577 | Bacteria | 10355 |
| 346 | Ga0265318_10011388 | 3300028577 | Unclassified | 3830 |
| 347 | Ga0265318_10017055 | 3300028577 | Bacteria | 2988 |
| 348 | Ga0265318_10040276 | 3300028577 | Bacteria | 1779 |
| 349 | Ga0265318_10083719 | 3300028577 | Bacteria | 1177 |
| 350 | Ga0265323_10000944 | 3300028653 | Bacteria | 15268 |
| 351 | Ga0265336_10006303 | 3300028666 | Unclassified | 4289 |
| 352 | Ga0265338_10000811 | 3300028800 | Bacteria | 52712 |
| 353 | Ga0265338_10008319 | 3300028800 | Bacteria | 12622 |
| 354 | Ga0265338_10011482 | 3300028800 | Bacteria | 10226 |
| 355 | Ga0265338_10015816 | 3300028800 | Bacteria | 8262 |
| 356 | Ga0265338_10019714 | 3300028800 | Bacteria | 7136 |
| 357 | Ga0265338_10022710 | 3300028800 | Bacteria | 6480 |
| 358 | Ga0265338_10030617 | 3300028800 | Bacteria | 5295 |
| 359 | Ga0265338_10070756 | 3300028800 | Bacteria | 2988 |
| 360 | Ga0265338_10101547 | 3300028800 | Bacteria | 2342 |
| 361 | Ga0265338_10173546 | 3300028800 | Bacteria | 1650 |
| 362 | Ga0265324_10008364 | 3300029957 | Unclassified | 4113 |
| 363 | Ga0265330_10002570 | 3300031235 | Bacteria | 9854 |
| 364 | Ga0265330_10011228 | 3300031235 | Bacteria | 4205 |
| 365 | Ga0265330_10040230 | 3300031235 | Bacteria | 2077 |
| 366 | Ga0265330_10098216 | 3300031235 | Bacteria | 1254 |
| 367 | Ga0265330_10113426 | 3300031235 | Bacteria | 1156 |
| 368 | Ga0265332_10010937 | 3300031238 | Bacteria | 4030 |
| 369 | Ga0265332_10016372 | 3300031238 | Unclassified | 3271 |
| 370 | Ga0265328_10017165 | 3300031239 | Unclassified | 2806 |
| 371 | Ga0265320_10006515 | 3300031240 | Bacteria | 7357 |
| 372 | Ga0265320_10016238 | 3300031240 | Bacteria | 4179 |
| 373 | Ga0265320_10101645 | 3300031240 | Bacteria | 1323 |
| 374 | Ga0265320_10129500 | 3300031240 | Bacteria | 1147 |
| 375 | Ga0265325_10005716 | 3300031241 | Bacteria | 7644 |
| 376 | Ga0265325_10016909 | 3300031241 | Unclassified | 4066 |
| 377 | Ga0265325_10020991 | 3300031241 | Bacteria | 3594 |
| 378 | Ga0265329_10007774 | 3300031242 | Unclassified | 4115 |
| 379 | Ga0265340_10011248 | 3300031247 | Bacteria | 4764 |
| 380 | Ga0265340_10074734 | 3300031247 | Bacteria | 1602 |
| 381 | Ga0265339_10012547 | 3300031249 | Bacteria | 5170 |
| 382 | Ga0265339_10039634 | 3300031249 | Bacteria | 2622 |
| 383 | Ga0265339_10054202 | 3300031249 | Bacteria | 2179 |
| 384 | Ga0265331_10056796 | 3300031250 | Unclassified | 1857 |
| 385 | Ga0265331_10132301 | 3300031250 | Bacteria | 1137 |
| 386 | Ga0265327_10001778 | 3300031251 | Bacteria | 25403 |
| 387 | Ga0265327_10023376 | 3300031251 | Bacteria | 3662 |
| 388 | Ga0265327_10023524 | 3300031251 | Unclassified | 3647 |
| 389 | Ga0265327_10045276 | 3300031251 | Bacteria | 2340 |
| 390 | Ga0265327_10047312 | 3300031251 | Bacteria | 2270 |
| 391 | Ga0265316_10003315 | 3300031344 | Bacteria | 16319 |
| 392 | Ga0265316_10004519 | 3300031344 | Bacteria | 13826 |
| 393 | Ga0265316_10034615 | 3300031344 | Bacteria | 4101 |
| 394 | Ga0265316_10280763 | 3300031344 | Bacteria | 1217 |
| 395 | Ga0265313_10007170 | 3300031595 | Bacteria | 7677 |
| 396 | Ga0265313_10012054 | 3300031595 | Bacteria | 5324 |
| 397 | Ga0265313_10018830 | 3300031595 | Unclassified | 3864 |
| 398 | Ga0265313_10050590 | 3300031595 | Bacteria | 1992 |
| 399 | Ga0316575_10012590 | 3300031665 | Bacteria | 3149 |
| 400 | Ga0265314_10010692 | 3300031711 | Bacteria | 7636 |
| 401 | Ga0265314_10017184 | 3300031711 | Bacteria | 5684 |
| 402 | Ga0265314_10027406 | 3300031711 | Bacteria | 4266 |
| 403 | Ga0265314_10073771 | 3300031711 | Unclassified | 2274 |
| 404 | Ga0265314_10099763 | 3300031711 | Bacteria | 1869 |
| 405 | Ga0265342_10005802 | 3300031712 | Bacteria | 9322 |
| 406 | Ga0265342_10015125 | 3300031712 | Bacteria | 5089 |
| 407 | Ga0265342_10091518 | 3300031712 | Bacteria | 1743 |
| 408 | Ga0265342_10100789 | 3300031712 | Bacteria | 1645 |
| 409 | Ga0265342_10123565 | 3300031712 | Bacteria | 1455 |
| 410 | Ga0373948_0001379 | 3300034817 | Bacteria | 3347 |
| 411 | Ga0373928_0008443 | 3300035084 | Bacteria | 2000 |
| 412 | Ga0373929_0004709 | 3300035085 | Bacteria | 2447 |
| 413 | Ga0373934_0140037 | 3300035086 | Bacteria | 989 |
| 414 | Ga0373944_0000856 | 3300035089 | Bacteria | 7475 |
| 415 | Ga0373951_0001162 | 3300035091 | Bacteria | 6963 |
| 416 | Ga0373932_0019758 | 3300035112 | Bacteria | 1759 |
| 417 | Ga0373939_0008595 | 3300035114 | Bacteria | 2507 |
| 418 | Ga0373945_0001140 | 3300035116 | Bacteria | 8041 |
| 419 | Ga0373953_0084374 | 3300035117 | Bacteria | 1324 |
| 420 | Ga0373960_0000483 | 3300035121 | Bacteria | 7887 |
| 421 | Ga0373943_0000321 | 3300035170 | Bacteria | 20135 |
| 422 | Ga0373943_0195411 | 3300035170 | Bacteria | 1118 |
| 423 | Ga0373946_0001951 | 3300035171 | Bacteria | 7215 |
| 424 | Ga0373955_0030039 | 3300035172 | Bacteria | 2833 |
| 425 | Ga0373962_0005556 | 3300035242 | Bacteria | 3047 |
| 426 | Ga0373962_0031072 | 3300035242 | Bacteria | 1464 |
| 427 | Ga0373924_0118414 | 3300035410 | Bacteria | 1148 |
| 428 | Ga0373931_0064734 | 3300035691 | Bacteria | 1979 |
| 429 | Ga0373931_0106017 | 3300035691 | Bacteria | 1588 |
| 430 | Ga0373935_0012490 | 3300035692 | Bacteria | 5107 |
| 431 | Ga0373927_0048682 | 3300035695 | Bacteria | 2742 |
| 432 | Ga0373933_0020996 | 3300035724 | Bacteria | 3705 |
| 433 | Ga0373947_0008667 | 3300035725 | Bacteria | 5851 |
| 434 | Ga0373937_0005253 | 3300036401 | Bacteria | 11057 |
| 435 | Ga0373937_0219269 | 3300036401 | Bacteria | 1791 |
| 436 | Ga0373937_0223879 | 3300036401 | Bacteria | 1771 |
| 437 | Ga0373937_0405404 | 3300036401 | Bacteria | 1294 |
| 438 | Ga0373925_0013028 | 3300037068 | Bacteria | 6021 |
| 439 | Ga0395899_0051801 | 3300037312 | Bacteria | 3045 |
| 440 | Ga0395899_0059819 | 3300037312 | Bacteria | 2808 |
| 441 | Ga0395899_0192341 | 3300037312 | Bacteria | 1427 |
| 442 | Ga0395900_0029133 | 3300037418 | Bacteria | 5663 |
| 443 | Ga0395900_0199010 | 3300037418 | Bacteria | 2028 |
| 444 | Ga0395898_0006039 | 3300037466 | Bacteria | 13002 |
| 445 | Ga0395898_0006272 | 3300037466 | Bacteria | 12714 |
| 446 | Ga0395898_0092822 | 3300037466 | Bacteria | 2902 |
| 447 | Ga0395905_0005942 | 3300037471 | Bacteria | 12368 |
| 448 | Ga0395905_0114441 | 3300037471 | Bacteria | 2534 |
| 449 | Ga0395905_0186060 | 3300037471 | Bacteria | 1949 |
| 450 | Ga0395905_0441976 | 3300037471 | Bacteria | 1198 |
| 451 | Ga0395901_0017535 | 3300038443 | Bacteria | 7309 |
| 452 | Ga0395901_0085055 | 3300038443 | Bacteria | 3306 |
| 453 | Ga0395901_0104233 | 3300038443 | Bacteria | 2976 |
| 454 | Ga0395901_0131348 | 3300038443 | Bacteria | 2631 |
| 455 | Ga0395901_0256352 | 3300038443 | Bacteria | 1821 |
| 456 | Ga0242420_010112 | 3300038996 | Bacteria | 1561 |
| 457 | Ga0436360_0731594 | 3300039438 | Bacteria | 15643 |
| 458 | Ga0451853_0159322 | 3300041512 | Bacteria | 4026 |
| 459 | Ga0466969_0176349 | 3300044656 | Bacteria | 979 |
| 460 | Ga0466965_0070508 | 3300044683 | Bacteria | 1757 |
| 461 | Ga0466963_0018073 | 3300044694 | Bacteria | 4401 |
| 462 | Ga0466963_0032903 | 3300044694 | Bacteria | 3361 |
| 463 | Ga0466963_0033057 | 3300044694 | Bacteria | 3354 |
| 464 | Ga0466963_0221361 | 3300044694 | Bacteria | 1325 |
| 465 | Ga0466964_0000564 | 3300044706 | Bacteria | 11641 |
| 466 | Ga0453684_0850194 | 3300044712 | Unclassified | 981 |
| 467 | Ga0466971_0011983 | 3300044719 | Bacteria | 3799 |
| 468 | Ga0466968_0039255 | 3300044735 | Bacteria | 1992 |
| 469 | Ga0466957_0189859 | 3300044842 | Bacteria | 1345 |
| 470 | Ga0466957_0320082 | 3300044842 | Bacteria | 1046 |
| 471 | Ga0466960_0005010 | 3300044901 | Bacteria | 5225 |
| 472 | Ga0466959_0030241 | 3300045049 | Bacteria | 4011 |
| 473 | Ga0466959_0079500 | 3300045049 | Bacteria | 2364 |
| 474 | Ga0466958_0004163 | 3300045836 | Bacteria | 7601 |
| 475 | Ga0466967_0004980 | 3300045976 | Bacteria | 9093 |
| 476 | Ga0466967_0004987 | 3300045976 | Bacteria | 9087 |
| 477 | Ga0466967_0014168 | 3300045976 | Bacteria | 6197 |
| 478 | Ga0466967_0023980 | 3300045976 | Bacteria | 5009 |
| 479 | Ga0466967_0244300 | 3300045976 | Bacteria | 1713 |
| 480 | Ga0495592_0046011 | 3300046454 | Bacteria | 3253 |
| 481 | Ga0495592_0143385 | 3300046454 | Bacteria | 1659 |
| 482 | Ga0495603_0006085 | 3300046455 | Bacteria | 7214 |
| 483 | Ga0495629_0039028 | 3300046459 | Bacteria | 3344 |
| 484 | Ga0495629_0059698 | 3300046459 | Bacteria | 2666 |
| 485 | Ga0495629_0171277 | 3300046459 | Bacteria | 1506 |
| 486 | Ga0495641_0013109 | 3300046461 | Bacteria | 4581 |
| 487 | Ga0495641_0036248 | 3300046461 | Bacteria | 2319 |
| 488 | Ga0495641_0040878 | 3300046461 | Bacteria | 2155 |
| 489 | Ga0495641_0100412 | 3300046461 | Bacteria | 1291 |
| 490 | Ga0495651_0141080 | 3300046462 | Bacteria | 1747 |
| 491 | Ga0495651_0285436 | 3300046462 | Bacteria | 1113 |
| 492 | Ga0495653_0008519 | 3300046463 | Bacteria | 8410 |
| 493 | Ga0495653_0020365 | 3300046463 | Bacteria | 5379 |
| 494 | Ga0495653_0046439 | 3300046463 | Bacteria | 3363 |
| 495 | Ga0495653_0052168 | 3300046463 | Bacteria | 3136 |
| 496 | Ga0495653_0069147 | 3300046463 | Bacteria | 2646 |
| 497 | Ga0495580_0046658 | 3300046472 | Bacteria | 3073 |
| 498 | Ga0495582_0017354 | 3300046473 | Unclassified | 3939 |
| 499 | Ga0495582_0036089 | 3300046473 | Bacteria | 2719 |
| 500 | Ga0495582_0070849 | 3300046473 | Bacteria | 1929 |
| 501 | Ga0495582_0106512 | 3300046473 | Bacteria | 1573 |
| 502 | Ga0495605_0136558 | 3300046474 | Unclassified | 1102 |
| 503 | Ga0495639_0004011 | 3300046475 | Bacteria | 6310 |
| 504 | Ga0495639_0047056 | 3300046475 | Bacteria | 1954 |
| 505 | Ga0495639_0115171 | 3300046475 | Bacteria | 1278 |
| 506 | Ga0495662_0012564 | 3300046476 | Bacteria | 4130 |
| 507 | Ga0495662_0055112 | 3300046476 | Bacteria | 1921 |
| 508 | Ga0495664_0074548 | 3300046477 | Bacteria | 2030 |
| 509 | Ga0495664_0132045 | 3300046477 | Bacteria | 1512 |
| 510 | Ga0495584_0110604 | 3300046491 | Bacteria | 1390 |
| 511 | Ga0495594_0028273 | 3300046499 | Bacteria | 3025 |
| 512 | Ga0495594_0100824 | 3300046499 | Bacteria | 1624 |
| 513 | Ga0495608_0040727 | 3300046511 | Bacteria | 3111 |
| 514 | Ga0495608_0075450 | 3300046511 | Bacteria | 2197 |
| 515 | Ga0495608_0104673 | 3300046511 | Bacteria | 1822 |
| 516 | Ga0495618_0087476 | 3300046514 | Bacteria | 1993 |
| 517 | Ga0495628_0118677 | 3300046516 | Bacteria | 2030 |
| 518 | Ga0495630_0030426 | 3300046517 | Bacteria | 4016 |
| 519 | Ga0495666_0048480 | 3300046526 | Bacteria | 2046 |
| 520 | Ga0495666_0051091 | 3300046526 | Bacteria | 1987 |
| 521 | Ga0495652_0045452 | 3300046529 | Bacteria | 3774 |
| 522 | Ga0495652_0045682 | 3300046529 | Bacteria | 3763 |
| 523 | Ga0495665_0001770 | 3300046531 | Bacteria | 11634 |
| 524 | Ga0495665_0054675 | 3300046531 | Unclassified | 2109 |
| 525 | Ga0495640_0013752 | 3300046533 | Bacteria | 6150 |
| 526 | Ga0495640_0239940 | 3300046533 | Unclassified | 1138 |
| 527 | Ga0495640_0281035 | 3300046533 | Bacteria | 1036 |
| 528 | Ga0495586_0010916 | 3300046535 | Bacteria | 4826 |
| 529 | Ga0495586_0073240 | 3300046535 | Bacteria | 1874 |
| 530 | Ga0495586_0208245 | 3300046535 | Bacteria | 1109 |
| 531 | Ga0495587_0108048 | 3300046536 | Bacteria | 1600 |
| 532 | Ga0495645_0080221 | 3300046543 | Bacteria | 2343 |
| 533 | Ga0495645_0109787 | 3300046543 | Bacteria | 1953 |
| 534 | Ga0495667_0004579 | 3300046559 | Bacteria | 9345 |
| 535 | Ga0495667_0005571 | 3300046559 | Bacteria | 8518 |
| 536 | Ga0495667_0076972 | 3300046559 | Bacteria | 2170 |
| 537 | Ga0495667_0192445 | 3300046559 | Bacteria | 1307 |
| 538 | Ga0495634_0032875 | 3300046642 | Bacteria | 3565 |
| 539 | Ga0495635_0025912 | 3300046663 | Bacteria | 4084 |
| 540 | Ga0495635_0081298 | 3300046663 | Bacteria | 2217 |
| 541 | Ga0495635_0091521 | 3300046663 | Bacteria | 2080 |
| 542 | Ga0495635_0204671 | 3300046663 | Bacteria | 1338 |
| 543 | Ga0495659_0127250 | 3300046664 | Unclassified | 1008 |
| 544 | Ga0495588_0172640 | 3300046674 | Bacteria | 1143 |
| 545 | Ga0495657_0009096 | 3300046675 | Bacteria | 7550 |
| 546 | Ga0495657_0029198 | 3300046675 | Bacteria | 3870 |
| 547 | Ga0495657_0043191 | 3300046675 | Bacteria | 3075 |
| 548 | Ga0495657_0050841 | 3300046675 | Bacteria | 2786 |
| 549 | Ga0495657_0109007 | 3300046675 | Bacteria | 1756 |
| 550 | Ga0495599_0113675 | 3300046678 | Bacteria | 1685 |
| 551 | Ga0495599_0179924 | 3300046678 | Bacteria | 1304 |
| 552 | Ga0495647_0033904 | 3300046681 | Bacteria | 1910 |
| 553 | Ga0495647_0036453 | 3300046681 | Bacteria | 1851 |
| 554 | Ga0495647_0047626 | 3300046681 | Unclassified | 1655 |
| 555 | Ga0495658_0000020 | 3300046683 | Bacteria | 87200 |
| 556 | Ga0495658_0123965 | 3300046683 | Unclassified | 1566 |
| 557 | Ga0495613_0048288 | 3300046689 | Bacteria | 3143 |
| 558 | Ga0495613_0065782 | 3300046689 | Bacteria | 2649 |
| 559 | Ga0495613_0189583 | 3300046689 | Bacteria | 1454 |
| 560 | Ga0495600_0176171 | 3300046809 | Bacteria | 1379 |
| 561 | Ga0495581_0001628 | 3300047315 | Bacteria | 12521 |
| 562 | Ga0495581_0005202 | 3300047315 | Bacteria | 7527 |
| 563 | Ga0495581_0013028 | 3300047315 | Bacteria | 4820 |
| 564 | Ga0495581_0015799 | 3300047315 | Bacteria | 4384 |
| 565 | Ga0495581_0053902 | 3300047315 | Bacteria | 2322 |
| 566 | Ga0495581_0173266 | 3300047315 | Bacteria | 1262 |
| 567 | Ga0495604_0047878 | 3300047317 | Bacteria | 3328 |
| 568 | Ga0495674_0024968 | 3300047319 | Bacteria | 5485 |
| 569 | Ga0495674_0099236 | 3300047319 | Bacteria | 2479 |
| 570 | Ga0495674_0231445 | 3300047319 | Bacteria | 1525 |
| 571 | Ga0495676_0000726 | 3300047321 | Bacteria | 27488 |
| 572 | Ga0495676_0133831 | 3300047321 | Bacteria | 1786 |
| 573 | Ga0495680_0009305 | 3300047322 | Bacteria | 8851 |
| 574 | Ga0495680_0042692 | 3300047322 | Bacteria | 3596 |
| 575 | Ga0495680_0058236 | 3300047322 | Bacteria | 2986 |
| 576 | Ga0495680_0094101 | 3300047322 | Bacteria | 2242 |
| 577 | Ga0495680_0121409 | 3300047322 | Bacteria | 1929 |
| 578 | Ga0495677_0123338 | 3300047445 | Bacteria | 989 |
| 579 | Ga0495684_0005051 | 3300047471 | Bacteria | 10300 |
| 580 | Ga0495684_0005288 | 3300047471 | Bacteria | 10056 |
| 581 | Ga0495684_0121511 | 3300047471 | Bacteria | 1967 |
| 582 | Ga0495593_0026453 | 3300047673 | Bacteria | 3203 |
| 583 | Ga0495602_0061800 | 3300048088 | Bacteria | 3254 |
| 584 | Ga0495602_0221292 | 3300048088 | Bacteria | 1429 |
| 585 | Ga0495614_0016489 | 3300048089 | Bacteria | 3215 |
| 586 | Ga0496100_0003843 | 3300048903 | Bacteria | 7876 |
| 587 | Ga0496100_0007036 | 3300048903 | Bacteria | 6171 |
| 588 | Ga0496100_0009279 | 3300048903 | Bacteria | 5525 |
| 589 | Ga0496100_0012294 | 3300048903 | Bacteria | 4903 |
| 590 | Ga0496100_0033900 | 3300048903 | Bacteria | 3198 |
| 591 | Ga0496100_0035025 | 3300048903 | Bacteria | 3155 |
| 592 | Ga0496100_0055010 | 3300048903 | Bacteria | 2598 |
| 593 | Ga0496100_0328052 | 3300048903 | Bacteria | 1151 |
| 594 | Ga0496101_0000413 | 3300048904 | Bacteria | 27636 |
| 595 | Ga0496101_0031836 | 3300048904 | Bacteria | 3710 |
| 596 | Ga0496101_0115697 | 3300048904 | Unclassified | 2023 |
| 597 | Ga0496101_0311345 | 3300048904 | Bacteria | 1234 |
| 598 | Ga0496102_0002031 | 3300048905 | Bacteria | 17497 |
| 599 | Ga0496102_0046694 | 3300048905 | Bacteria | 3933 |
| 600 | Ga0496102_0055367 | 3300048905 | Bacteria | 3617 |
| 601 | Ga0496102_0081412 | 3300048905 | Bacteria | 2985 |
| 602 | Ga0496102_0136737 | 3300048905 | Bacteria | 2296 |
| 603 | Ga0496102_0178722 | 3300048905 | Unclassified | 1999 |
| 604 | Ga0496102_0249074 | 3300048905 | Bacteria | 1675 |
| 605 | Ga0496102_0328214 | 3300048905 | Unclassified | 1441 |
| 606 | Ga0496103_0000619 | 3300048906 | Bacteria | 27363 |
| 607 | Ga0496104_0011933 | 3300048907 | Bacteria | 7794 |
| 608 | Ga0496104_0035667 | 3300048907 | Bacteria | 4644 |
| 609 | Ga0496104_0090350 | 3300048907 | Bacteria | 2926 |
| 610 | Ga0496104_0119764 | 3300048907 | Bacteria | 2527 |
| 611 | Ga0496104_0133142 | 3300048907 | Bacteria | 2388 |
| 612 | Ga0496104_0133476 | 3300048907 | Bacteria | 2385 |
| 613 | Ga0496104_0141354 | 3300048907 | Bacteria | 2312 |
| 614 | Ga0496104_0184055 | 3300048907 | Bacteria | 1999 |
| 615 | Ga0496104_0457544 | 3300048907 | Bacteria | 1188 |
| 616 | Ga0496104_0611007 | 3300048907 | Bacteria | 1000 |
| 617 | Ga0496105_0001789 | 3300048908 | Bacteria | 15361 |
| 618 | Ga0496105_0012441 | 3300048908 | Bacteria | 6737 |
| 619 | Ga0496105_0012877 | 3300048908 | Bacteria | 6629 |
| 620 | Ga0496105_0118780 | 3300048908 | Bacteria | 2181 |
| 621 | Ga0496105_0120679 | 3300048908 | Bacteria | 2161 |
| 622 | Ga0496105_0124999 | 3300048908 | Bacteria | 2120 |
| 623 | Ga0496105_0187273 | 3300048908 | Bacteria | 1693 |
| 624 | Ga0496105_0206067 | 3300048908 | Bacteria | 1604 |
| 625 | Ga0496105_0247515 | 3300048908 | Bacteria | 1445 |
| 626 | Ga0496105_0293960 | 3300048908 | Bacteria | 1307 |
| 627 | Ga0496106_0003490 | 3300048909 | Bacteria | 11710 |
| 628 | Ga0496106_0006812 | 3300048909 | Bacteria | 8457 |
| 629 | Ga0496106_0062406 | 3300048909 | Bacteria | 2829 |
| 630 | Ga0496106_0068432 | 3300048909 | Bacteria | 2708 |
| 631 | Ga0496106_0150498 | 3300048909 | Bacteria | 1835 |
| 632 | Ga0496106_0158182 | 3300048909 | Bacteria | 1791 |
| 633 | Ga0496106_0245894 | 3300048909 | Bacteria | 1429 |
| 634 | Ga0496107_0018463 | 3300048910 | Bacteria | 4911 |
| 635 | Ga0496107_0019828 | 3300048910 | Bacteria | 4748 |
| 636 | Ga0496107_0025854 | 3300048910 | Bacteria | 4159 |
| 637 | Ga0496107_0246206 | 3300048910 | Bacteria | 1330 |
| 638 | Ga0496108_0016266 | 3300048911 | Bacteria | 6065 |
| 639 | Ga0496108_0016309 | 3300048911 | Bacteria | 6059 |
| 640 | Ga0496108_0079463 | 3300048911 | Bacteria | 2777 |
| 641 | Ga0496108_0084842 | 3300048911 | Bacteria | 2688 |
| 642 | Ga0496108_0162851 | 3300048911 | Bacteria | 1928 |
| 643 | Ga0496108_0258443 | 3300048911 | Bacteria | 1515 |
| 644 | Ga0496108_0478145 | 3300048911 | Bacteria | 1088 |
| 645 | Ga0496109_0001859 | 3300048912 | Bacteria | 17490 |
| 646 | Ga0496109_0008579 | 3300048912 | Bacteria | 8698 |
| 647 | Ga0496109_0009759 | 3300048912 | Bacteria | 8193 |
| 648 | Ga0496109_0016423 | 3300048912 | Bacteria | 6472 |
| 649 | Ga0496109_0035222 | 3300048912 | Bacteria | 4513 |
| 650 | Ga0496109_0044361 | 3300048912 | Bacteria | 4033 |
| 651 | Ga0496109_0058369 | 3300048912 | Bacteria | 3524 |
| 652 | Ga0496109_0245287 | 3300048912 | Bacteria | 1686 |
| 653 | Ga0496109_0254259 | 3300048912 | Bacteria | 1655 |
| 654 | Ga0496110_0013623 | 3300048913 | Bacteria | 6732 |
| 655 | Ga0496110_0052967 | 3300048913 | Bacteria | 3566 |
| 656 | Ga0496110_0055467 | 3300048913 | Bacteria | 3487 |
| 657 | Ga0496110_0063101 | 3300048913 | Bacteria | 3273 |
| 658 | Ga0496110_0157987 | 3300048913 | Bacteria | 2054 |
| 659 | Ga0496110_0228705 | 3300048913 | Bacteria | 1691 |
| 660 | Ga0496110_0354355 | 3300048913 | Bacteria | 1337 |
| 661 | Ga0496110_0408277 | 3300048913 | Bacteria | 1238 |
| 662 | Ga0496111_0017947 | 3300048914 | Bacteria | 4894 |
| 663 | Ga0496111_0028704 | 3300048914 | Bacteria | 3943 |
| 664 | Ga0496111_0037796 | 3300048914 | Bacteria | 3456 |
| 665 | Ga0496111_0055121 | 3300048914 | Bacteria | 2875 |
| 666 | Ga0496111_0061169 | 3300048914 | Bacteria | 2730 |
| 667 | Ga0496111_0123692 | 3300048914 | Bacteria | 1912 |
| 668 | Ga0496111_0392852 | 3300048914 | Bacteria | 1025 |
| 669 | Ga0496111_0421245 | 3300048914 | Bacteria | 986 |
| 670 | Ga0496112_0005419 | 3300048915 | Bacteria | 11030 |
| 671 | Ga0496112_0011560 | 3300048915 | Bacteria | 8066 |
| 672 | Ga0496112_0013888 | 3300048915 | Bacteria | 7450 |
| 673 | Ga0496112_0019889 | 3300048915 | Bacteria | 6354 |
| 674 | Ga0496112_0023360 | 3300048915 | Bacteria | 5907 |
| 675 | Ga0496112_0051064 | 3300048915 | Bacteria | 4056 |
| 676 | Ga0496112_0056106 | 3300048915 | Bacteria | 3876 |
| 677 | Ga0496112_0116891 | 3300048915 | Bacteria | 2637 |
| 678 | Ga0496112_0160128 | 3300048915 | Bacteria | 2217 |
| 679 | Ga0496112_0257361 | 3300048915 | Bacteria | 1695 |
| 680 | Ga0496112_0460776 | 3300048915 | Bacteria | 1209 |
| 681 | Ga0496113_0219656 | 3300048916 | Bacteria | 1514 |
| 682 | Ga0496113_0280024 | 3300048916 | Bacteria | 1333 |
| 683 | Ga0496114_0000429 | 3300048917 | Bacteria | 31010 |
| 684 | Ga0496114_0003700 | 3300048917 | Bacteria | 11770 |
| 685 | Ga0496114_0017105 | 3300048917 | Bacteria | 5849 |
| 686 | Ga0496114_0017489 | 3300048917 | Bacteria | 5787 |
| 687 | Ga0496114_0031920 | 3300048917 | Bacteria | 4333 |
| 688 | Ga0496114_0043689 | 3300048917 | Bacteria | 3716 |
| 689 | Ga0496114_0062316 | 3300048917 | Bacteria | 3121 |
| 690 | Ga0496114_0090525 | 3300048917 | Bacteria | 2597 |
| 691 | Ga0496114_0130697 | 3300048917 | Bacteria | 2168 |
| 692 | Ga0496114_0220084 | 3300048917 | Bacteria | 1666 |
| 693 | Ga0496115_0000905 | 3300048918 | Bacteria | 21521 |
| 694 | Ga0496115_0002162 | 3300048918 | Bacteria | 14060 |
| 695 | Ga0496115_0005156 | 3300048918 | Bacteria | 9509 |
| 696 | Ga0496115_0009644 | 3300048918 | Bacteria | 7183 |
| 697 | Ga0496115_0022210 | 3300048918 | Bacteria | 4913 |
| 698 | Ga0496115_0079580 | 3300048918 | Bacteria | 2668 |
| 699 | Ga0496115_0101874 | 3300048918 | Bacteria | 2355 |
| 700 | Ga0496115_0174863 | 3300048918 | Bacteria | 1775 |
| 701 | Ga0496115_0336648 | 3300048918 | Bacteria | 1232 |
| 702 | Ga0496115_0392578 | 3300048918 | Unclassified | 1127 |
| 703 | Ga0501047_0346670 | 3300049581 | Bacteria | 1322 |
| 704 | Ga0501067_0003085 | 3300049583 | Bacteria | 9194 |
| 705 | Ga0501067_0112524 | 3300049583 | Bacteria | 1514 |
| 706 | Ga0501068_0013685 | 3300049584 | Bacteria | 4621 |
| 707 | Ga0501069_0019385 | 3300049585 | Bacteria | 3678 |
| 708 | Ga0501072_0260162 | 3300049588 | Bacteria | 1381 |
| 709 | Ga0501074_0098319 | 3300049590 | Bacteria | 2095 |
| 710 | Ga0501080_0431324 | 3300049742 | Bacteria | 1183 |
| 711 | Ga0501044_0528861 | 3300049823 | Bacteria | 1078 |
| 712 | nmdc:mga05p37_16747_c1 | 3300050507 | Bacteria | 8836 |
| 713 | nmdc:mga05p37_28859_c1 | 3300050507 | Bacteria | 6768 |
| 714 | nmdc:mga05p37_5641_c1 | 3300050507 | Bacteria | 14712 |
| 715 | nmdc:mga06r32_23173_c1 | 3300050510 | Bacteria | 5742 |
| 716 | nmdc:mga08y16_10048_c1 | 3300050511 | Bacteria | 9931 |
| 717 | nmdc:mga08y16_210155_c1 | 3300050511 | Bacteria | 2015 |
| 718 | nmdc:mga08y16_422058_c1 | 3300050511 | Bacteria | 1363 |
| 719 | nmdc:mga08y16_531452_c1 | 3300050511 | Bacteria | 1192 |
| 720 | nmdc:mga0n895_33842_c1 | 3300050512 | Bacteria | 4913 |
| 721 | nmdc:mga0n895_532671_c1 | 3300050512 | Bacteria | 1181 |
| 722 | nmdc:mga0n895_674_c1 | 3300050512 | Bacteria | 23965 |
| 723 | nmdc:mga0n895_98440_c1 | 3300050512 | Bacteria | 2932 |
| 724 | nmdc:mga0rr50_105280_c1 | 3300050513 | Bacteria | 2224 |
| 725 | nmdc:mga0rr50_23040_c1 | 3300050513 | Bacteria | 4286 |
| 726 | nmdc:mga0rr50_418218_c1 | 3300050513 | Unclassified | 1134 |
| 727 | nmdc:mga0rr50_9854_c1 | 3300050513 | Bacteria | 6036 |
| 728 | nmdc:mga08x19_109687_c1 | 3300050514 | Unclassified | 1840 |
| 729 | nmdc:mga08x19_13824_c1 | 3300050514 | Bacteria | 4890 |
| 730 | nmdc:mga08x19_22927_c1 | 3300050514 | Bacteria | 3871 |
| 731 | nmdc:mga08x19_26477_c1 | 3300050514 | Bacteria | 3619 |
| 732 | nmdc:mga08x19_46481_c1 | 3300050514 | Bacteria | 2776 |
| 733 | nmdc:mga08x19_9662_c1 | 3300050514 | Bacteria | 5775 |
| 734 | nmdc:mga0a205_12051_c1 | 3300050515 | Bacteria | 7987 |
| 735 | nmdc:mga0a205_55662_c1 | 3300050515 | Bacteria | 3820 |
| 736 | nmdc:mga0a205_6428_c1 | 3300050515 | Bacteria | 10624 |
| 737 | nmdc:mga0a205_96821_c1 | 3300050515 | Bacteria | 2850 |
| 738 | Ga0495601_0165175 | 3300053077 | Bacteria | 1447 |
| 739 | Ga0495612_0025932 | 3300053078 | Bacteria | 2355 |
| 740 | Ga0495612_0078349 | 3300053078 | Bacteria | 1386 |
| 741 | Ga0495612_0079100 | 3300053078 | Bacteria | 1380 |
| 742 | Ga0495655_0004849 | 3300053083 | Unclassified | 2335 |
| 743 | Ga0495595_0004206 | 3300053084 | Bacteria | 5791 |
| 744 | Ga0495595_0016037 | 3300053084 | Bacteria | 3200 |
| 745 | Ga0495595_0050392 | 3300053084 | Bacteria | 1928 |
| 746 | Ga0495619_0020489 | 3300053085 | Bacteria | 4212 |
| 747 | Ga0495619_0039566 | 3300053085 | Bacteria | 3079 |
| 748 | Ga0495619_0044044 | 3300053085 | Bacteria | 2928 |
| 749 | Ga0495619_0135489 | 3300053085 | Bacteria | 1694 |
| 750 | Ga0495619_0203410 | 3300053085 | Bacteria | 1371 |
| 751 | Ga0501084_0086729 | 3300054114 | Bacteria | 2628 |
| 752 | Ga0466962_0046259 | 3300061719 | Bacteria | 2079 |
| 753 | 2808895477 | 2808606371 | Bacteria | 4251511 |
| 754 | Ga0207646_10240458 | |||
| 755 | JGI24744J21845_10000048 | |||
| 756 | JGI25406J46586_10043029 | |||
| 757 | Ga0070683_100264211 | |||
| 758 | Ga0068869_100324823 | |||
| 759 | Ga0070666_10042304 | |||
| 760 | Ga0070680_100118483 | |||
| 761 | Ga0070682_100002740 | |||
| 762 | Ga0068868_100021086 | |||
| 763 | Ga0068868_100021337 | |||
| 764 | Ga0070660_100212528 | |||
| 765 | Ga0070689_100012819 | |||
| 766 | Ga0070692_10055696 | |||
| 767 | Ga0070668_100263230 | |||
| 768 | Ga0070669_100065484 | |||
| 769 | Ga0070669_100497170 | |||
| 770 | Ga0070671_100006577 | |||
| 771 | Ga0070674_100002377 | |||
| 772 | Ga0070673_100022916 | |||
| 773 | Ga0070673_100344563 | |||
| 774 | Ga0070688_100003284 | |||
| 775 | Ga0070659_100065631 | |||
| 776 | Ga0070703_10033832 | |||
| 777 | Ga0070703_10045519 | |||
| 778 | Ga0070709_10002232 | |||
| 779 | Ga0070709_10123517 | |||
| 780 | Ga0070709_10140564 | |||
| 781 | Ga0070714_100032813 | |||
| 782 | Ga0070714_100041494 | |||
| 783 | Ga0070714_100058967 | |||
| 784 | Ga0070714_100068626 | |||
| 785 | Ga0070714_100124502 | |||
| 786 | Ga0070714_100240895 | |||
| 787 | Ga0070713_100039142 | |||
| 788 | Ga0070713_100045215 | |||
| 789 | Ga0070713_100062979 | |||
| 790 | Ga0070713_100081255 | |||
| 791 | Ga0070713_100167035 | |||
| 792 | Ga0070713_100320250 | |||
| 793 | Ga0070713_100446737 | |||
| 794 | Ga0070710_10042740 | |||
| 795 | Ga0070710_10043599 | |||
| 796 | Ga0070710_10046845 | |||
| 797 | Ga0070710_10062629 | |||
| 798 | Ga0070710_10161198 | |||
| 799 | Ga0070710_10167049 | |||
| 800 | Ga0070701_10001647 | |||
| 801 | Ga0070711_100007901 | |||
| 802 | Ga0070711_100161386 | |||
| 803 | Ga0070711_100171955 | |||
| 804 | Ga0070705_100013222 | |||
| 805 | Ga0070705_100124313 | |||
| 806 | Ga0070705_100353999 | |||
| 807 | Ga0070700_100013116 | |||
| 808 | Ga0070694_100077844 | |||
| 809 | Ga0070694_100149709 | |||
| 810 | Ga0070708_100222033 | |||
| 811 | Ga0070708_100293980 | |||
| 812 | Ga0070708_100458271 | |||
| 813 | Ga0070678_100033694 | |||
| 814 | Ga0070681_10257196 | |||
| 815 | Ga0070681_10302997 | |||
| 816 | Ga0068867_100007309 | |||
| 817 | Ga0070685_10000713 | |||
| 818 | Ga0070706_100009295 | |||
| 819 | Ga0070706_100228418 | |||
| 820 | Ga0070707_100000908 | |||
| 821 | Ga0070707_100009704 | |||
| 822 | Ga0070707_100082652 | |||
| 823 | Ga0070707_100190093 | |||
| 824 | Ga0070707_100583020 | |||
| 825 | Ga0070698_100012522 | |||
| 826 | Ga0070698_100033115 | |||
| 827 | Ga0070698_100079742 | |||
| 828 | Ga0070698_100116827 | |||
| 829 | Ga0070698_100187068 | |||
| 830 | Ga0070698_100233293 | |||
| 831 | Ga0070698_100271375 | |||
| 832 | Ga0070698_100300786 | |||
| 833 | Ga0070699_100080090 | |||
| 834 | Ga0070679_100163879 | |||
| 835 | Ga0070697_100046669 | |||
| 836 | Ga0070697_100242135 | |||
| 837 | Ga0070697_100289087 | |||
| 838 | Ga0068853_100000599 | |||
| 839 | Ga0068853_100383646 | |||
| 840 | Ga0070672_100000982 | |||
| 841 | Ga0070686_100003945 | |||
| 842 | Ga0070695_100048809 | |||
| 843 | Ga0070696_100024382 | |||
| 844 | Ga0070696_100157879 | |||
| 845 | Ga0070696_100167131 | |||
| 846 | Ga0070665_100073592 | |||
| 847 | Ga0070704_100042599 | |||
| 848 | Ga0068855_100007768 | |||
| 849 | Ga0068855_100108365 | |||
| 850 | Ga0068855_100150383 | |||
| 851 | Ga0068855_100211553 | |||
| 852 | Ga0070664_100637067 | |||
| 853 | Ga0068857_100261695 | |||
| 854 | Ga0068856_100001488 | |||
| 855 | Ga0068856_100152139 | |||
| 856 | Ga0068856_100195775 | |||
| 857 | Ga0068856_100254576 | |||
| 858 | Ga0068856_100318154 | |||
| 859 | Ga0070702_100033386 | |||
| 860 | Ga0068852_100354504 | |||
| 861 | Ga0068866_10000288 | |||
| 862 | Ga0068861_100071161 | |||
| 863 | Ga0068861_100098734 | |||
| 864 | Ga0068863_100116749 | |||
| 865 | Ga0068860_100062444 | |||
| 866 | Ga0068860_100207764 | |||
| 867 | Ga0068862_100187048 | |||
| 868 | Ga0081539_10001691 | |||
| 869 | Ga0081539_10002541 | |||
| 870 | Ga0070717_10010490 | |||
| 871 | Ga0070717_10023883 | |||
| 872 | Ga0070717_10134792 | |||
| 873 | Ga0070717_10190175 | |||
| 874 | Ga0070717_10272827 | |||
| 875 | Ga0070715_10000741 | |||
| 876 | Ga0070715_10032783 | |||
| 877 | Ga0070715_10083561 | |||
| 878 | Ga0070715_10139699 | |||
| 879 | Ga0070716_100034129 | |||
| 880 | Ga0070716_100085079 | |||
| 881 | Ga0070716_100214476 | |||
| 882 | Ga0070716_100237945 | |||
| 883 | Ga0070712_100002294 | |||
| 884 | Ga0070712_100020138 | |||
| 885 | Ga0070712_100024038 | |||
| 886 | Ga0070712_100024189 | |||
| 887 | Ga0070712_100144724 | |||
| 888 | Ga0070712_100221003 | |||
| 889 | Ga0070712_100250431 | |||
| 890 | Ga0070712_100514915 | |||
| 891 | Ga0097621_100020690 | |||
| 892 | Ga0068871_100002551 | |||
| 893 | Ga0068871_100178840 | |||
| 894 | Ga0075428_100081858 | |||
| 895 | Ga0075433_10003161 | |||
| 896 | Ga0075433_10004549 | |||
| 897 | Ga0075433_10039097 | |||
| 898 | Ga0075433_10117966 | |||
| 899 | Ga0075433_10122223 | |||
| 900 | Ga0075434_100001540 | |||
| 901 | Ga0075434_100012783 | |||
| 902 | Ga0075434_100031404 | |||
| 903 | Ga0075434_100099396 | |||
| 904 | Ga0075434_100206706 | |||
| 905 | Ga0075434_100308273 | |||
| 906 | Ga0068865_100383580 | |||
| 907 | Ga0075436_100000947 | |||
| 908 | Ga0075436_100007807 | |||
| 909 | Ga0075436_100008576 | |||
| 910 | Ga0075436_100009593 | |||
| 911 | Ga0075436_100083531 | |||
| 912 | Ga0075436_100211479 | |||
| 913 | Ga0075435_100006557 | |||
| 914 | Ga0075435_100013944 | |||
| 915 | Ga0075435_100023558 | |||
| 916 | Ga0075435_100026919 | |||
| 917 | Ga0075435_100031553 | |||
| 918 | Ga0105240_10000920 | |||
| 919 | Ga0105240_10035548 | |||
| 920 | Ga0105240_10184799 | |||
| 921 | Ga0105240_10491964 | |||
| 922 | Ga0111539_10430739 | |||
| 923 | Ga0111539_10483696 | |||
| 924 | Ga0111539_10547098 | |||
| 925 | Ga0105245_10001880 | |||
| 926 | Ga0105245_10087806 | |||
| 927 | Ga0105245_10217268 | |||
| 928 | Ga0105245_10343650 | |||
| 929 | Ga0105245_10476968 | |||
| 930 | Ga0105245_10535793 | |||
| 931 | Ga0105245_10611719 | |||
| 932 | Ga0105247_10002585 | |||
| 933 | Ga0114129_10009708 | |||
| 934 | Ga0114129_10020152 | |||
| 935 | Ga0114129_10306578 | |||
| 936 | Ga0105243_10029470 | |||
| 937 | Ga0105243_10059732 | |||
| 938 | Ga0105243_10266688 | |||
| 939 | Ga0105241_10116033 | |||
| 940 | Ga0105242_10079714 | |||
| 941 | Ga0105242_10167219 | |||
| 942 | Ga0105242_10226303 | |||
| 943 | Ga0105242_10350387 | |||
| 944 | Ga0105248_10005061 | |||
| 945 | Ga0105237_10295953 | |||
| 946 | Ga0105238_10126857 | |||
| 947 | Ga0105238_10258321 | |||
| 948 | Ga0105249_10002244 | |||
| 949 | Ga0105239_10000975 | |||
| 950 | Ga0105239_10159139 | |||
| 951 | Ga0157373_10044365 | |||
| 952 | Ga0157370_10018152 | |||
| 953 | Ga0157370_10099457 | |||
| 954 | Ga0157370_10131812 | |||
| 955 | Ga0157369_10177145 | |||
| 956 | Ga0157369_10374104 | |||
| 957 | Ga0157374_10005744 | |||
| 958 | Ga0157374_10081369 | |||
| 959 | Ga0157374_10222864 | |||
| 960 | Ga0157374_10328005 | |||
| 961 | Ga0157378_10002591 | |||
| 962 | Ga0163162_10004951 | |||
| 963 | Ga0163162_10138488 | |||
| 964 | Ga0163162_10164380 | |||
| 965 | Ga0157372_10040045 | |||
| 966 | Ga0157372_10193854 | |||
| 967 | Ga0157372_10229489 | |||
| 968 | Ga0157375_10001218 | |||
| 969 | Ga0157375_11088169 | |||
| 970 | Ga0157380_10020626 | |||
| 971 | Ga0182008_10095274 | |||
| 972 | Ga0157377_10001116 | |||
| 973 | Ga0157379_10322703 | |||
| 974 | Ga0157376_10006361 | |||
| 975 | Ga0157376_10041000 | |||
| 976 | Ga0206353_11262601 | |||
| 977 | Ga0206353_11495463 | |||
| 978 | Ga0213871_10005597 | |||
| 979 | Ga0207653_10007984 | |||
| 980 | Ga0207653_10044209 | |||
| 981 | Ga0207692_10012609 | |||
| 982 | Ga0207692_10045051 | |||
| 983 | Ga0207642_10001625 | |||
| 984 | Ga0207688_10091542 | |||
| 985 | Ga0207680_10029293 | |||
| 986 | Ga0207647_10044556 | |||
| 987 | Ga0207685_10008490 | |||
| 988 | Ga0207685_10014067 | |||
| 989 | Ga0207699_10023229 | |||
| 990 | Ga0207699_10141020 | |||
| 991 | Ga0207684_10038097 | |||
| 992 | Ga0207684_10069873 | |||
| 993 | Ga0207684_10238053 | |||
| 994 | Ga0207684_10305031 | |||
| 995 | Ga0207695_10000785 | |||
| 996 | Ga0207695_10089307 | |||
| 997 | Ga0207695_10107047 | |||
| 998 | Ga0207695_10243533 | |||
| 999 | Ga0207693_10000190 | |||
| 1000 | Ga0207693_10000745 | |||
| 1001 | Ga0207693_10023385 | |||
| 1002 | Ga0207693_10036427 | |||
| 1003 | Ga0207693_10052762 | |||
| 1004 | Ga0207693_10062641 | |||
| 1005 | Ga0207693_10089732 | |||
| 1006 | Ga0207693_10093160 | |||
| 1007 | Ga0207693_10177149 | |||
| 1008 | Ga0207693_10270871 | |||
| 1009 | Ga0207663_10001144 | |||
| 1010 | Ga0207663_10023118 | |||
| 1011 | Ga0207663_10049294 | |||
| 1012 | Ga0207663_10196469 | |||
| 1013 | Ga0207657_10260642 | |||
| 1014 | Ga0207646_10000785 | |||
| 1015 | Ga0207646_10013954 | |||
| 1016 | Ga0207646_10049089 | |||
| 1017 | Ga0207646_10121285 | |||
| 1018 | Ga0207646_10378607 | |||
| 1019 | Ga0207694_10039153 | |||
| 1020 | Ga0207694_10114559 | |||
| 1021 | Ga0207687_10035096 | |||
| 1022 | Ga0207687_10138099 | |||
| 1023 | Ga0207687_10159425 | |||
| 1024 | Ga0207700_10000012 | |||
| 1025 | Ga0207700_10026889 | |||
| 1026 | Ga0207700_10046445 | |||
| 1027 | Ga0207664_10008805 | |||
| 1028 | Ga0207664_10047056 | |||
| 1029 | Ga0207664_10231573 | |||
| 1030 | Ga0207664_10304761 | |||
| 1031 | Ga0207664_10464443 | |||
| 1032 | Ga0207644_10026202 | |||
| 1033 | Ga0207706_10129094 | |||
| 1034 | Ga0207686_10016986 | |||
| 1035 | Ga0207686_10312109 | |||
| 1036 | Ga0207709_10000714 | |||
| 1037 | Ga0207709_10042357 | |||
| 1038 | Ga0207669_10044850 | |||
| 1039 | Ga0207669_10266441 | |||
| 1040 | Ga0207704_10016861 | |||
| 1041 | Ga0207704_10424223 | |||
| 1042 | Ga0207704_10483116 | |||
| 1043 | Ga0207665_10025991 | |||
| 1044 | Ga0207665_10034672 | |||
| 1045 | Ga0207665_10085519 | |||
| 1046 | Ga0207665_10141228 | |||
| 1047 | Ga0207665_10146714 | |||
| 1048 | Ga0207665_10251156 | |||
| 1049 | Ga0207691_10010717 | |||
| 1050 | Ga0207711_10020314 | |||
| 1051 | Ga0207689_10252742 | |||
| 1052 | Ga0207689_10257854 | |||
| 1053 | Ga0207679_10086360 | |||
| 1054 | Ga0207667_10023399 | |||
| 1055 | Ga0207667_10093464 | |||
| 1056 | Ga0207667_10181741 | |||
| 1057 | Ga0207667_10246052 | |||
| 1058 | Ga0207667_10337275 | |||
| 1059 | Ga0207712_10022858 | |||
| 1060 | Ga0207668_10090194 | |||
| 1061 | Ga0207668_10230845 | |||
| 1062 | Ga0207640_10042006 | |||
| 1063 | Ga0207677_10006995 | |||
| 1064 | Ga0207677_10137137 | |||
| 1065 | Ga0207639_10005567 | |||
| 1066 | Ga0207639_10638881 | |||
| 1067 | Ga0207708_10000111 | |||
| 1068 | Ga0207708_10196732 | |||
| 1069 | Ga0207708_10285318 | |||
| 1070 | Ga0207702_10046130 | |||
| 1071 | Ga0207702_10066927 | |||
| 1072 | Ga0207702_10088749 | |||
| 1073 | Ga0207702_10099571 | |||
| 1074 | Ga0207702_10278816 | |||
| 1075 | Ga0207648_10000136 | |||
| 1076 | Ga0207674_10160034 | |||
| 1077 | Ga0207675_100008182 | |||
| 1078 | Ga0207675_100010108 | |||
| 1079 | Ga0207683_10001232 | |||
| 1080 | Ga0207683_10051435 | |||
| 1081 | Ga0207428_10008369 | |||
| 1082 | Ga0268266_10156907 | |||
| 1083 | Ga0268265_10040263 | |||
| 1084 | Ga0268264_10043105 | |||
| 1085 | Ga0265337_1012446 | |||
| 1086 | Ga0265326_10006384 | |||
| 1087 | Ga0265319_1000985 | |||
| 1088 | Ga0265319_1003201 | |||
| 1089 | Ga0265319_1004016 | |||
| 1090 | Ga0265319_1014116 | |||
| 1091 | Ga0265319_1014749 | |||
| 1092 | Ga0265319_1021126 | |||
| 1093 | Ga0265319_1030357 | |||
| 1094 | Ga0265319_1044366 | |||
| 1095 | Ga0265334_10000652 | |||
| 1096 | Ga0265334_10078128 | |||
| 1097 | Ga0265318_10000633 | |||
| 1098 | Ga0265318_10002263 | |||
| 1099 | Ga0265318_10011388 | |||
| 1100 | Ga0265318_10017055 | |||
| 1101 | Ga0265318_10040276 | |||
| 1102 | Ga0265318_10083719 | |||
| 1103 | Ga0265323_10000944 | |||
| 1104 | Ga0265336_10006303 | |||
| 1105 | Ga0265338_10000811 | |||
| 1106 | Ga0265338_10008319 | |||
| 1107 | Ga0265338_10011482 | |||
| 1108 | Ga0265338_10015816 | |||
| 1109 | Ga0265338_10019714 | |||
| 1110 | Ga0265338_10022710 | |||
| 1111 | Ga0265338_10030617 | |||
| 1112 | Ga0265338_10070756 | |||
| 1113 | Ga0265338_10101547 | |||
| 1114 | Ga0265338_10173546 | |||
| 1115 | Ga0265324_10008364 | |||
| 1116 | Ga0265330_10002570 | |||
| 1117 | Ga0265330_10011228 | |||
| 1118 | Ga0265330_10040230 | |||
| 1119 | Ga0265330_10098216 | |||
| 1120 | Ga0265330_10113426 | |||
| 1121 | Ga0265332_10010937 | |||
| 1122 | Ga0265332_10016372 | |||
| 1123 | Ga0265328_10017165 | |||
| 1124 | Ga0265320_10006515 | |||
| 1125 | Ga0265320_10016238 | |||
| 1126 | Ga0265320_10101645 | |||
| 1127 | Ga0265320_10129500 | |||
| 1128 | Ga0265325_10005716 | |||
| 1129 | Ga0265325_10016909 | |||
| 1130 | Ga0265325_10020991 | |||
| 1131 | Ga0265329_10007774 | |||
| 1132 | Ga0265340_10011248 | |||
| 1133 | Ga0265340_10074734 | |||
| 1134 | Ga0265339_10012547 | |||
| 1135 | Ga0265339_10039634 | |||
| 1136 | Ga0265339_10054202 | |||
| 1137 | Ga0265331_10056796 | |||
| 1138 | Ga0265331_10132301 | |||
| 1139 | Ga0265327_10001778 | |||
| 1140 | Ga0265327_10023376 | |||
| 1141 | Ga0265327_10023524 | |||
| 1142 | Ga0265327_10045276 | |||
| 1143 | Ga0265327_10047312 | |||
| 1144 | Ga0265316_10003315 | |||
| 1145 | Ga0265316_10004519 | |||
| 1146 | Ga0265316_10034615 | |||
| 1147 | Ga0265316_10280763 | |||
| 1148 | Ga0265313_10007170 | |||
| 1149 | Ga0265313_10012054 | |||
| 1150 | Ga0265313_10018830 | |||
| 1151 | Ga0265313_10050590 | |||
| 1152 | Ga0316575_10012590 | |||
| 1153 | Ga0265314_10010692 | |||
| 1154 | Ga0265314_10017184 | |||
| 1155 | Ga0265314_10027406 | |||
| 1156 | Ga0265314_10073771 | |||
| 1157 | Ga0265314_10099763 | |||
| 1158 | Ga0265342_10005802 | |||
| 1159 | Ga0265342_10015125 | |||
| 1160 | Ga0265342_10091518 | |||
| 1161 | Ga0265342_10100789 | |||
| 1162 | Ga0265342_10123565 | |||
| 1163 | Ga0373948_0001379 | |||
| 1164 | Ga0373928_0008443 | |||
| 1165 | Ga0373929_0004709 | |||
| 1166 | Ga0373934_0140037 | |||
| 1167 | Ga0373944_0000856 | |||
| 1168 | Ga0373951_0001162 | |||
| 1169 | Ga0373932_0019758 | |||
| 1170 | Ga0373939_0008595 | |||
| 1171 | Ga0373945_0001140 | |||
| 1172 | Ga0373953_0084374 | |||
| 1173 | Ga0373960_0000483 | |||
| 1174 | Ga0373943_0000321 | |||
| 1175 | Ga0373943_0195411 | |||
| 1176 | Ga0373946_0001951 | |||
| 1177 | Ga0373955_0030039 | |||
| 1178 | Ga0373962_0005556 | |||
| 1179 | Ga0373962_0031072 | |||
| 1180 | Ga0373924_0118414 | |||
| 1181 | Ga0373931_0064734 | |||
| 1182 | Ga0373931_0106017 | |||
| 1183 | Ga0373935_0012490 | |||
| 1184 | Ga0373927_0048682 | |||
| 1185 | Ga0373933_0020996 | |||
| 1186 | Ga0373947_0008667 | |||
| 1187 | Ga0373937_0005253 | |||
| 1188 | Ga0373937_0219269 | |||
| 1189 | Ga0373937_0223879 | |||
| 1190 | Ga0373937_0405404 | |||
| 1191 | Ga0373925_0013028 | |||
| 1192 | Ga0395899_0051801 | |||
| 1193 | Ga0395899_0059819 | |||
| 1194 | Ga0395899_0192341 | |||
| 1195 | Ga0395900_0029133 | |||
| 1196 | Ga0395900_0199010 | |||
| 1197 | Ga0395898_0006039 | |||
| 1198 | Ga0395898_0006272 | |||
| 1199 | Ga0395898_0092822 | |||
| 1200 | Ga0395905_0005942 | |||
| 1201 | Ga0395905_0114441 | |||
| 1202 | Ga0395905_0186060 | |||
| 1203 | Ga0395905_0441976 | |||
| 1204 | Ga0395901_0017535 | |||
| 1205 | Ga0395901_0085055 | |||
| 1206 | Ga0395901_0104233 | |||
| 1207 | Ga0395901_0131348 | |||
| 1208 | Ga0395901_0256352 | |||
| 1209 | Ga0242420_010112 | |||
| 1210 | Ga0436360_0731594 | |||
| 1211 | Ga0451853_0159322 | |||
| 1212 | Ga0466969_0176349 | |||
| 1213 | Ga0466965_0070508 | |||
| 1214 | Ga0466963_0018073 | |||
| 1215 | Ga0466963_0032903 | |||
| 1216 | Ga0466963_0033057 | |||
| 1217 | Ga0466963_0221361 | |||
| 1218 | Ga0466964_0000564 | |||
| 1219 | Ga0453684_0850194 | |||
| 1220 | Ga0466971_0011983 | |||
| 1221 | Ga0466968_0039255 | |||
| 1222 | Ga0466957_0189859 | |||
| 1223 | Ga0466957_0320082 | |||
| 1224 | Ga0466960_0005010 | |||
| 1225 | Ga0466959_0030241 | |||
| 1226 | Ga0466959_0079500 | |||
| 1227 | Ga0466958_0004163 | |||
| 1228 | Ga0466967_0004980 | |||
| 1229 | Ga0466967_0004987 | |||
| 1230 | Ga0466967_0014168 | |||
| 1231 | Ga0466967_0023980 | |||
| 1232 | Ga0466967_0244300 | |||
| 1233 | Ga0495592_0046011 | |||
| 1234 | Ga0495592_0143385 | |||
| 1235 | Ga0495603_0006085 | |||
| 1236 | Ga0495629_0039028 | |||
| 1237 | Ga0495629_0059698 | |||
| 1238 | Ga0495629_0171277 | |||
| 1239 | Ga0495641_0013109 | |||
| 1240 | Ga0495641_0036248 | |||
| 1241 | Ga0495641_0040878 | |||
| 1242 | Ga0495641_0100412 | |||
| 1243 | Ga0495651_0141080 | |||
| 1244 | Ga0495651_0285436 | |||
| 1245 | Ga0495653_0008519 | |||
| 1246 | Ga0495653_0020365 | |||
| 1247 | Ga0495653_0046439 | |||
| 1248 | Ga0495653_0052168 | |||
| 1249 | Ga0495653_0069147 | |||
| 1250 | Ga0495580_0046658 | |||
| 1251 | Ga0495582_0017354 | |||
| 1252 | Ga0495582_0036089 | |||
| 1253 | Ga0495582_0070849 | |||
| 1254 | Ga0495582_0106512 | |||
| 1255 | Ga0495605_0136558 | |||
| 1256 | Ga0495639_0004011 | |||
| 1257 | Ga0495639_0047056 | |||
| 1258 | Ga0495639_0115171 | |||
| 1259 | Ga0495662_0012564 | |||
| 1260 | Ga0495662_0055112 | |||
| 1261 | Ga0495664_0074548 | |||
| 1262 | Ga0495664_0132045 | |||
| 1263 | Ga0495584_0110604 | |||
| 1264 | Ga0495594_0028273 | |||
| 1265 | Ga0495594_0100824 | |||
| 1266 | Ga0495608_0040727 | |||
| 1267 | Ga0495608_0075450 | |||
| 1268 | Ga0495608_0104673 | |||
| 1269 | Ga0495618_0087476 | |||
| 1270 | Ga0495628_0118677 | |||
| 1271 | Ga0495630_0030426 | |||
| 1272 | Ga0495666_0048480 | |||
| 1273 | Ga0495666_0051091 | |||
| 1274 | Ga0495652_0045452 | |||
| 1275 | Ga0495652_0045682 | |||
| 1276 | Ga0495665_0001770 | |||
| 1277 | Ga0495665_0054675 | |||
| 1278 | Ga0495640_0013752 | |||
| 1279 | Ga0495640_0239940 | |||
| 1280 | Ga0495640_0281035 | |||
| 1281 | Ga0495586_0010916 | |||
| 1282 | Ga0495586_0073240 | |||
| 1283 | Ga0495586_0208245 | |||
| 1284 | Ga0495587_0108048 | |||
| 1285 | Ga0495645_0080221 | |||
| 1286 | Ga0495645_0109787 | |||
| 1287 | Ga0495667_0004579 | |||
| 1288 | Ga0495667_0005571 | |||
| 1289 | Ga0495667_0076972 | |||
| 1290 | Ga0495667_0192445 | |||
| 1291 | Ga0495634_0032875 | |||
| 1292 | Ga0495635_0025912 | |||
| 1293 | Ga0495635_0081298 | |||
| 1294 | Ga0495635_0091521 | |||
| 1295 | Ga0495635_0204671 | |||
| 1296 | Ga0495659_0127250 | |||
| 1297 | Ga0495588_0172640 | |||
| 1298 | Ga0495657_0009096 | |||
| 1299 | Ga0495657_0029198 | |||
| 1300 | Ga0495657_0043191 | |||
| 1301 | Ga0495657_0050841 | |||
| 1302 | Ga0495657_0109007 | |||
| 1303 | Ga0495599_0113675 | |||
| 1304 | Ga0495599_0179924 | |||
| 1305 | Ga0495647_0033904 | |||
| 1306 | Ga0495647_0036453 | |||
| 1307 | Ga0495647_0047626 | |||
| 1308 | Ga0495658_0000020 | |||
| 1309 | Ga0495658_0123965 | |||
| 1310 | Ga0495613_0048288 | |||
| 1311 | Ga0495613_0065782 | |||
| 1312 | Ga0495613_0189583 | |||
| 1313 | Ga0495600_0176171 | |||
| 1314 | Ga0495581_0001628 | |||
| 1315 | Ga0495581_0005202 | |||
| 1316 | Ga0495581_0013028 | |||
| 1317 | Ga0495581_0015799 | |||
| 1318 | Ga0495581_0053902 | |||
| 1319 | Ga0495581_0173266 | |||
| 1320 | Ga0495604_0047878 | |||
| 1321 | Ga0495674_0024968 | |||
| 1322 | Ga0495674_0099236 | |||
| 1323 | Ga0495674_0231445 | |||
| 1324 | Ga0495676_0000726 | |||
| 1325 | Ga0495676_0133831 | |||
| 1326 | Ga0495680_0009305 | |||
| 1327 | Ga0495680_0042692 | |||
| 1328 | Ga0495680_0058236 | |||
| 1329 | Ga0495680_0094101 | |||
| 1330 | Ga0495680_0121409 | |||
| 1331 | Ga0495677_0123338 | |||
| 1332 | Ga0495684_0005051 | |||
| 1333 | Ga0495684_0005288 | |||
| 1334 | Ga0495684_0121511 | |||
| 1335 | Ga0495593_0026453 | |||
| 1336 | Ga0495602_0061800 | |||
| 1337 | Ga0495602_0221292 | |||
| 1338 | Ga0495614_0016489 | |||
| 1339 | Ga0496100_0003843 | |||
| 1340 | Ga0496100_0007036 | |||
| 1341 | Ga0496100_0009279 | |||
| 1342 | Ga0496100_0012294 | |||
| 1343 | Ga0496100_0033900 | |||
| 1344 | Ga0496100_0035025 | |||
| 1345 | Ga0496100_0055010 | |||
| 1346 | Ga0496100_0328052 | |||
| 1347 | Ga0496101_0000413 | |||
| 1348 | Ga0496101_0031836 | |||
| 1349 | Ga0496101_0115697 | |||
| 1350 | Ga0496101_0311345 | |||
| 1351 | Ga0496102_0002031 | |||
| 1352 | Ga0496102_0046694 | |||
| 1353 | Ga0496102_0055367 | |||
| 1354 | Ga0496102_0081412 | |||
| 1355 | Ga0496102_0136737 | |||
| 1356 | Ga0496102_0178722 | |||
| 1357 | Ga0496102_0249074 | |||
| 1358 | Ga0496102_0328214 | |||
| 1359 | Ga0496103_0000619 | |||
| 1360 | Ga0496104_0011933 | |||
| 1361 | Ga0496104_0035667 | |||
| 1362 | Ga0496104_0090350 | |||
| 1363 | Ga0496104_0119764 | |||
| 1364 | Ga0496104_0133142 | |||
| 1365 | Ga0496104_0133476 | |||
| 1366 | Ga0496104_0141354 | |||
| 1367 | Ga0496104_0184055 | |||
| 1368 | Ga0496104_0457544 | |||
| 1369 | Ga0496104_0611007 | |||
| 1370 | Ga0496105_0001789 | |||
| 1371 | Ga0496105_0012441 | |||
| 1372 | Ga0496105_0012877 | |||
| 1373 | Ga0496105_0118780 | |||
| 1374 | Ga0496105_0120679 | |||
| 1375 | Ga0496105_0124999 | |||
| 1376 | Ga0496105_0187273 | |||
| 1377 | Ga0496105_0206067 | |||
| 1378 | Ga0496105_0247515 | |||
| 1379 | Ga0496105_0293960 | |||
| 1380 | Ga0496106_0003490 | |||
| 1381 | Ga0496106_0006812 | |||
| 1382 | Ga0496106_0062406 | |||
| 1383 | Ga0496106_0068432 | |||
| 1384 | Ga0496106_0150498 | |||
| 1385 | Ga0496106_0158182 | |||
| 1386 | Ga0496106_0245894 | |||
| 1387 | Ga0496107_0018463 | |||
| 1388 | Ga0496107_0019828 | |||
| 1389 | Ga0496107_0025854 | |||
| 1390 | Ga0496107_0246206 | |||
| 1391 | Ga0496108_0016266 | |||
| 1392 | Ga0496108_0016309 | |||
| 1393 | Ga0496108_0079463 | |||
| 1394 | Ga0496108_0084842 | |||
| 1395 | Ga0496108_0162851 | |||
| 1396 | Ga0496108_0258443 | |||
| 1397 | Ga0496108_0478145 | |||
| 1398 | Ga0496109_0001859 | |||
| 1399 | Ga0496109_0008579 | |||
| 1400 | Ga0496109_0009759 | |||
| 1401 | Ga0496109_0016423 | |||
| 1402 | Ga0496109_0035222 | |||
| 1403 | Ga0496109_0044361 | |||
| 1404 | Ga0496109_0058369 | |||
| 1405 | Ga0496109_0245287 | |||
| 1406 | Ga0496109_0254259 | |||
| 1407 | Ga0496110_0013623 | |||
| 1408 | Ga0496110_0052967 | |||
| 1409 | Ga0496110_0055467 | |||
| 1410 | Ga0496110_0063101 | |||
| 1411 | Ga0496110_0157987 | |||
| 1412 | Ga0496110_0228705 | |||
| 1413 | Ga0496110_0354355 | |||
| 1414 | Ga0496110_0408277 | |||
| 1415 | Ga0496111_0017947 | |||
| 1416 | Ga0496111_0028704 | |||
| 1417 | Ga0496111_0037796 | |||
| 1418 | Ga0496111_0055121 | |||
| 1419 | Ga0496111_0061169 | |||
| 1420 | Ga0496111_0123692 | |||
| 1421 | Ga0496111_0392852 | |||
| 1422 | Ga0496111_0421245 | |||
| 1423 | Ga0496112_0005419 | |||
| 1424 | Ga0496112_0011560 | |||
| 1425 | Ga0496112_0013888 | |||
| 1426 | Ga0496112_0019889 | |||
| 1427 | Ga0496112_0023360 | |||
| 1428 | Ga0496112_0051064 | |||
| 1429 | Ga0496112_0056106 | |||
| 1430 | Ga0496112_0116891 | |||
| 1431 | Ga0496112_0160128 | |||
| 1432 | Ga0496112_0257361 | |||
| 1433 | Ga0496112_0460776 | |||
| 1434 | Ga0496113_0219656 | |||
| 1435 | Ga0496113_0280024 | |||
| 1436 | Ga0496114_0000429 | |||
| 1437 | Ga0496114_0003700 | |||
| 1438 | Ga0496114_0017105 | |||
| 1439 | Ga0496114_0017489 | |||
| 1440 | Ga0496114_0031920 | |||
| 1441 | Ga0496114_0043689 | |||
| 1442 | Ga0496114_0062316 | |||
| 1443 | Ga0496114_0090525 | |||
| 1444 | Ga0496114_0130697 | |||
| 1445 | Ga0496114_0220084 | |||
| 1446 | Ga0496115_0000905 | |||
| 1447 | Ga0496115_0002162 | |||
| 1448 | Ga0496115_0005156 | |||
| 1449 | Ga0496115_0009644 | |||
| 1450 | Ga0496115_0022210 | |||
| 1451 | Ga0496115_0079580 | |||
| 1452 | Ga0496115_0101874 | |||
| 1453 | Ga0496115_0174863 | |||
| 1454 | Ga0496115_0336648 | |||
| 1455 | Ga0496115_0392578 | |||
| 1456 | Ga0501047_0346670 | |||
| 1457 | Ga0501067_0003085 | |||
| 1458 | Ga0501067_0112524 | |||
| 1459 | Ga0501068_0013685 | |||
| 1460 | Ga0501069_0019385 | |||
| 1461 | Ga0501072_0260162 | |||
| 1462 | Ga0501074_0098319 | |||
| 1463 | Ga0501080_0431324 | |||
| 1464 | Ga0501044_0528861 | |||
| 1465 | nmdc:mga05p37_16747_c1 | |||
| 1466 | nmdc:mga05p37_28859_c1 | |||
| 1467 | nmdc:mga05p37_5641_c1 | |||
| 1468 | nmdc:mga06r32_23173_c1 | |||
| 1469 | nmdc:mga08y16_10048_c1 | |||
| 1470 | nmdc:mga08y16_210155_c1 | |||
| 1471 | nmdc:mga08y16_422058_c1 | |||
| 1472 | nmdc:mga08y16_531452_c1 | |||
| 1473 | nmdc:mga0n895_33842_c1 | |||
| 1474 | nmdc:mga0n895_532671_c1 | |||
| 1475 | nmdc:mga0n895_674_c1 | |||
| 1476 | nmdc:mga0n895_98440_c1 | |||
| 1477 | nmdc:mga0rr50_105280_c1 | |||
| 1478 | nmdc:mga0rr50_23040_c1 | |||
| 1479 | nmdc:mga0rr50_418218_c1 | |||
| 1480 | nmdc:mga0rr50_9854_c1 | |||
| 1481 | nmdc:mga08x19_109687_c1 | |||
| 1482 | nmdc:mga08x19_13824_c1 | |||
| 1483 | nmdc:mga08x19_22927_c1 | |||
| 1484 | nmdc:mga08x19_26477_c1 | |||
| 1485 | nmdc:mga08x19_46481_c1 | |||
| 1486 | nmdc:mga08x19_9662_c1 | |||
| 1487 | nmdc:mga0a205_12051_c1 | |||
| 1488 | nmdc:mga0a205_55662_c1 | |||
| 1489 | nmdc:mga0a205_6428_c1 | |||
| 1490 | nmdc:mga0a205_96821_c1 | |||
| 1491 | Ga0495601_0165175 | |||
| 1492 | Ga0495612_0025932 | |||
| 1493 | Ga0495612_0078349 | |||
| 1494 | Ga0495612_0079100 | |||
| 1495 | Ga0495655_0004849 | |||
| 1496 | Ga0495595_0004206 | |||
| 1497 | Ga0495595_0016037 | |||
| 1498 | Ga0495595_0050392 | |||
| 1499 | Ga0495619_0020489 | |||
| 1500 | Ga0495619_0039566 | |||
| 1501 | Ga0495619_0044044 | |||
| 1502 | Ga0495619_0135489 | |||
| 1503 | Ga0495619_0203410 | |||
| 1504 | Ga0501084_0086729 | |||
| 1505 | Ga0466962_0046259 | |||
| 1506 | 2808895477 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.8619 | 8 | 305 |
| 6fmt-assembly1.cif.gz_A | imisx-ep of hg-baca soaking sad | 0.8524 | 8 | 305 |
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.8279 | 8 | 305 |
| 6cb2-assembly1.cif.gz_A | crystal structure of escherichia coli uppp | 0.8194 | 8 | 305 |
| 7paf-assembly1.cif.gz_D | streptococcus pneumoniae choline importer licb in lipid nanodiscs | 0.3856 | 17 | 305 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AE16_220_412_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3988 | 58 | 306 | 1.20.1250.20 |
| af_Q4DAY3_330_514_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3936 | 56 | 304 | 1.20.1250.20 |
| af_A0A1D8PSX6_296_531_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3884 | 50 | 301 | 1.20.1250.20 |
| af_D3ZUN1_35_222_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3883 | 57 | 304 | 1.20.1250.20 |
| af_Q8BGC3_15_203_1.20.1250.20 | Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains | 0.3859 | 52 | 303 | 1.20.1250.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538G428-F1-model_v4 | Undecaprenyl-diphosphatase (EC 3.6.1.27) (Bacitracin resistance protein) (Undecaprenyl pyrophosphate phosphatase) | 0.9733 | 11 | 306 |
GO:0005886
GO:0008360 GO:0009252 GO:0046677 GO:0050380 GO:0071555 |
| AF-A0A7W1M440-F1-model_v4 | Undecaprenyl-diphosphatase (EC 3.6.1.27) (Bacitracin resistance protein) (Undecaprenyl pyrophosphate phosphatase) | 0.9609 | 9 | 306 |
GO:0005886
GO:0008360 GO:0009252 GO:0046677 GO:0050380 GO:0071555 |
| AF-A0A1M3BGM9-F1-model_v4 | Undecaprenyl-diphosphatase (EC 3.6.1.27) (Bacitracin resistance protein) (Undecaprenyl pyrophosphate phosphatase) | 0.9592 | 11 | 307 |
GO:0005886
GO:0008360 GO:0009252 GO:0046677 GO:0050380 GO:0071555 |
| AF-A0A838V1A1-F1-model_v4 | Undecaprenyl-diphosphatase (EC 3.6.1.27) (Bacitracin resistance protein) (Undecaprenyl pyrophosphate phosphatase) | 0.9583 | 9 | 307 |
GO:0005886
GO:0008360 GO:0009252 GO:0046677 GO:0050380 GO:0071555 |
| AF-A0A1M3BGM9-F1-model_v4 | Undecaprenyl-diphosphatase (EC 3.6.1.27) (Bacitracin resistance protein) (Undecaprenyl pyrophosphate phosphatase) | 0.9559 | 11 | 307 |
GO:0005886
GO:0008360 GO:0009252 GO:0046677 GO:0050380 GO:0071555 |