F479143

General Info

Members Datasets Scaffolds Average Seq Length
751 512 1502 246

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2876808645|2876812872
Length 258
Sequence TYAILLAGALAGGFVSGLAGFGTALMALGIWLYILPPAIAVPLVLICSVSSQISTLPSMWKLLDFRLALPFVAGGLLGMPIGALLVARADPQTFKLSVGVMLLVFPAALXXXXXXXXXXXXXXXXXXXXXXXXXXGGRIADACVGFAGGILGGLAGLSGPLPTLWASIRGWTKDQRRGVFQIFNGTILGAALILQAATGFVKLNVFWLALLAMPGTLIGARLGMRTYRALNDRNFYDVVLALLFLSGLGLVWSSIAPR

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
39 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
40 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
44 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
45 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
46 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
47 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
48 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
49 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
52 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
53 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
54 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
55 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
56 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
57 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
60 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
69 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
83 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
84 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
153 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
154 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
155 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
159 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
160 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
161 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
162 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
163 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
164 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
165 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
166 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
167 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
168 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
169 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
170 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
176 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
177 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
178 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
179 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
180 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
181 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
182 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
183 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
184 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
185 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
186 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
187 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
188 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
189 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
190 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
191 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
192 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
193 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
194 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
195 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
196 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
197 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
198 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
199 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
200 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
201 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
202 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
203 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
204 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
205 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
206 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
207 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
208 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
209 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
210 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
211 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
212 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
213 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
214 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
215 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
216 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
217 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
218 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
219 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
220 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
221 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
222 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
223 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
224 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
225 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
226 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
227 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
228 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
229 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
230 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
231 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
232 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
233 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
234 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
235 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
236 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
237 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
238 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
239 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
240 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
241 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
242 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
243 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
244 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
245 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
246 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
247 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
248 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
249 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
250 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
251 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
252 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
253 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
254 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
255 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
256 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
257 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
258 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
259 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
260 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
261 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
262 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
263 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
264 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
265 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
266 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
267 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
268 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
269 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
270 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
271 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
272 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
273 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
274 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
275 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
277 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
278 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
279 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
280 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
281 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
282 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
283 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
284 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
285 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
286 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
287 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
288 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
289 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
290 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
291 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
292 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
293 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
294 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
295 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
296 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
297 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
298 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
299 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
300 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
301 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
302 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
303 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
304 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
305 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
306 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
307 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
308 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
309 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
310 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
311 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
312 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
313 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
314 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
315 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
316 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
317 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
318 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
319 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
320 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
321 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
322 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
323 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
324 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
325 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
326 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
327 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
328 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
329 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
330 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
331 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
332 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
333 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
334 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
335 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
336 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
337 2791355199
338 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
339 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
340 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
341 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
342 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
343 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
344 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
345 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
346 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
347 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
348 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
349 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
350 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
351 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
352 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
353 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
354 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
355 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
356 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
357 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
358 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
359 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
360 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
361 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
362 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
363 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
364 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
365 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
366 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
367 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
368 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
369 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
370 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
371 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
372 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
373 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
374 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
375 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
376 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
377 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
378 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
379 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
380 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
381 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
382 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
383 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
384 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
385 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
386 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
387 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
388 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
389 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
390 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
391 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
392 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
393 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
394 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
395 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
396 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
397 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
398 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
399 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
400 2904699407
401 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
402 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
403 2906610324
404 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
405 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
406 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
407 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
408 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
409 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
410 2922368715
411 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
412 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
413 2922425934
414 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
415 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
416 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
417 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
418 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
419 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
420 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
421 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
422 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
423 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
424 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
425 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
426 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
427 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
428 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
429 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
430 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
431 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
432 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
433 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
434 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
435 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
436 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
437 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
438 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
439 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
440 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
441 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
442 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
443 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
444 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
445 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
446 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
447 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
448 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
449 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
450 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
451 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
452 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
453 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
454 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
455 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
456 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
457 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
458 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
459 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
460 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
461 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
462 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
463 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
464 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
465 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
466 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
467 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
468 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
469 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
470 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
471 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
472 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
473 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
474 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
475 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
476 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
477 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
478 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
479 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
480 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
481 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
482 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
483 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
484 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
485 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
486 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
487 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
488 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
489 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
490 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
491 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
492 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
493 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
494 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
495 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
496 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
497 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
498 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
499 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
500 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
501 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
502 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
503 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
504 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
505 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
506 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
507 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
508 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
509 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
510 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
511 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
512 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 73.86
Metatranscriptomes 0.13
Isolates 26.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.79
Nodule 19.71
Rhizoplane 6.26
Rhizosphere 56.19
Stem 0
Stem Tuber 0
Unclassified 0.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10011011 3300003203 Bacteria 3979
2 JGI25153J46596_10008125 3300003215 Bacteria 5057
3 JGI25404J52841_10001223 3300003659 Bacteria 4423
4 JGI25404J52841_10014352 3300003659 Bacteria 1718
5 Ga0068869_100063079 3300005334 Bacteria 2721
6 Ga0068869_100071169 3300005334 Bacteria 2575
7 Ga0070666_10132508 3300005335 Bacteria 1732
8 Ga0070666_10140090 3300005335 Bacteria 1685
9 Ga0070680_100051072 3300005336 Bacteria 3374
10 Ga0070682_100110873 3300005337 Bacteria 1828
11 Ga0068868_100064377 3300005338 Bacteria 2910
12 Ga0068868_100104503 3300005338 Bacteria 2296
13 Ga0068868_100145571 3300005338 Bacteria 1948
14 Ga0070660_100040628 3300005339 Bacteria 3541
15 Ga0070660_100303670 3300005339 Bacteria 1309
16 Ga0070689_100298317 3300005340 Bacteria 1341
17 Ga0070661_100176906 3300005344 Bacteria 1622
18 Ga0070668_100057111 3300005347 Bacteria 3016
19 Ga0070668_100134329 3300005347 Bacteria 1988
20 Ga0070668_100265565 3300005347 Bacteria 1429
21 Ga0070668_100743835 3300005347 Bacteria 868
22 Ga0070675_100205223 3300005354 Bacteria 1712
23 Ga0070675_100501481 3300005354 Bacteria 1094
24 Ga0070671_100148845 3300005355 Bacteria 1976
25 Ga0070671_100239120 3300005355 Bacteria 1541
26 Ga0070671_100269394 3300005355 Bacteria 1447
27 Ga0070688_100120770 3300005365 Bacteria 1755
28 Ga0070709_10000460 3300005434 Bacteria 24322
29 Ga0070709_10001641 3300005434 Bacteria 12121
30 Ga0070714_100031926 3300005435 Bacteria 4396
31 Ga0070714_100123085 3300005435 Bacteria 2309
32 Ga0070713_100146316 3300005436 Bacteria 2098
33 Ga0070710_10007186 3300005437 Bacteria 5382
34 Ga0070710_10279056 3300005437 Bacteria 1083
35 Ga0070711_100001032 3300005439 Bacteria 14814
36 Ga0070711_100054383 3300005439 Bacteria 2763
37 Ga0070711_100096589 3300005439 Bacteria 2141
38 Ga0070705_100180683 3300005440 Bacteria 1429
39 Ga0070708_100134288 3300005445 Bacteria 2291
40 Ga0070663_100021088 3300005455 Bacteria 4326
41 Ga0070663_100035141 3300005455 Bacteria 3475
42 Ga0070663_100046227 3300005455 Bacteria 3079
43 Ga0070663_100141613 3300005455 Bacteria 1836
44 Ga0070663_100155020 3300005455 Bacteria 1759
45 Ga0070678_100014300 3300005456 Bacteria 5002
46 Ga0070678_100091751 3300005456 Bacteria 2332
47 Ga0070678_100179335 3300005456 Bacteria 1732
48 Ga0070678_100239403 3300005456 Bacteria 1517
49 Ga0070662_100273026 3300005457 Bacteria 1366
50 Ga0070681_10299676 3300005458 Bacteria 1518
51 Ga0068867_100127122 3300005459 Bacteria 1976
52 Ga0070685_10265354 3300005466 Bacteria 1144
53 Ga0070679_100012752 3300005530 Bacteria 8038
54 Ga0068853_100666865 3300005539 Bacteria 991
55 Ga0070686_100212366 3300005544 Bacteria 1394
56 Ga0070693_100192924 3300005547 Bacteria 1318
57 Ga0070665_100016483 3300005548 Bacteria 7409
58 Ga0070665_100087933 3300005548 Bacteria 3113
59 Ga0070665_100120014 3300005548 Bacteria 2631
60 Ga0070665_100137894 3300005548 Bacteria 2442
61 Ga0068855_100015207 3300005563 Bacteria 9266
62 Ga0068857_100042816 3300005577 Bacteria 4017
63 Ga0068857_100121140 3300005577 Bacteria 2355
64 Ga0068854_100102881 3300005578 Bacteria 2144
65 Ga0070702_100244275 3300005615 Bacteria 1213
66 Ga0068852_100352625 3300005616 Bacteria 1437
67 Ga0068852_100431165 3300005616 Bacteria 1302
68 Ga0068859_100434746 3300005617 Bacteria 1409
69 Ga0068864_100052121 3300005618 Bacteria 3526
70 Ga0068864_100078186 3300005618 Bacteria 2895
71 Ga0068866_10130837 3300005718 Bacteria 1427
72 Ga0068861_100272198 3300005719 Bacteria 1455
73 Ga0068861_100483970 3300005719 Bacteria 1115
74 Ga0068851_10193811 3300005834 Bacteria 1131
75 Ga0068870_10154803 3300005840 Bacteria 1354
76 Ga0068858_100031117 3300005842 Bacteria 4955
77 Ga0068858_100117632 3300005842 Bacteria 2484
78 Ga0068858_100170174 3300005842 Bacteria 2054
79 Ga0068860_100039656 3300005843 Bacteria 4504
80 Ga0068860_100231303 3300005843 Bacteria 1796
81 Ga0068860_100383589 3300005843 Bacteria 1388
82 Ga0068860_100481132 3300005843 Bacteria 1237
83 Ga0068862_100068555 3300005844 Bacteria 3060
84 Ga0068862_100145067 3300005844 Bacteria 2109
85 Ga0068862_100234654 3300005844 Bacteria 1665
86 Ga0068862_100328473 3300005844 Bacteria 1414
87 Ga0081455_10004153 3300005937 Bacteria 16343
88 Ga0081455_10011375 3300005937 Bacteria 8945
89 Ga0081455_10015038 3300005937 Bacteria 7537
90 Ga0081455_10032232 3300005937 Bacteria 4725
91 Ga0081540_1001150 3300005983 Bacteria 23283
92 Ga0081540_1003189 3300005983 Bacteria 13057
93 Ga0081540_1005395 3300005983 Bacteria 9552
94 Ga0081540_1008645 3300005983 Bacteria 7095
95 Ga0081540_1020690 3300005983 Bacteria 3947
96 Ga0081540_1025822 3300005983 Bacteria 3370
97 Ga0081539_10000191 3300005985 Bacteria 142387
98 Ga0081539_10075799 3300005985 Bacteria 1785
99 Ga0070717_10011853 3300006028 Bacteria 6634
100 Ga0075365_10015867 3300006038 Bacteria 4565
101 Ga0075365_10216005 3300006038 Bacteria 1345
102 Ga0075368_10100158 3300006042 Bacteria 1189
103 Ga0075363_100128067 3300006048 Bacteria 1422
104 Ga0075363_100165986 3300006048 Bacteria 1252
105 Ga0075363_100209452 3300006048 Bacteria 1115
106 Ga0075364_10148262 3300006051 Bacteria 1580
107 Ga0070715_10037477 3300006163 Bacteria 2006
108 Ga0070716_100033308 3300006173 Bacteria 2817
109 Ga0070712_100034669 3300006175 Bacteria 3422
110 Ga0075367_10020086 3300006178 Bacteria 3715
111 Ga0075367_10022374 3300006178 Bacteria 3545
112 Ga0075367_10117416 3300006178 Bacteria 1637
113 Ga0075369_10029628 3300006186 Bacteria 2300
114 Ga0075366_10141533 3300006195 Bacteria 1454
115 Ga0097621_100252162 3300006237 Bacteria 1546
116 Ga0075370_10177366 3300006353 Bacteria 1253
117 Ga0075370_10239264 3300006353 Bacteria 1075
118 Ga0068871_100311155 3300006358 Bacteria 1385
119 Ga0068871_100703464 3300006358 Bacteria 926
120 Ga0075429_100466366 3300006880 Bacteria 1106
121 Ga0068865_100111527 3300006881 Bacteria 2018
122 Ga0097620_100434755 3300006931 Bacteria 1409
123 Ga0099822_1005361 3300006943 Bacteria 16734
124 Ga0099795_10131119 3300007788 Bacteria 1011
125 Ga0105240_10017682 3300009093 Bacteria 9600
126 Ga0105240_10263313 3300009093 Bacteria 1988
127 Ga0105240_10275949 3300009093 Bacteria 1933
128 Ga0111539_10512505 3300009094 Bacteria 1397
129 Ga0105245_10043899 3300009098 Bacteria 3989
130 Ga0105245_10058260 3300009098 Bacteria 3476
131 Ga0105245_10612270 3300009098 Bacteria 1116
132 Ga0105247_10076167 3300009101 Bacteria 2106
133 Ga0105247_10126816 3300009101 Bacteria 1659
134 Ga0114129_10183736 3300009147 Bacteria 2844
135 Ga0114129_10298354 3300009147 Unclassified 2149
136 Ga0105243_10139779 3300009148 Bacteria 2065
137 Ga0105243_10650772 3300009148 Bacteria 1021
138 Ga0105241_10026901 3300009174 Bacteria 4281
139 Ga0105242_10116057 3300009176 Bacteria 2290
140 Ga0105242_10281549 3300009176 Bacteria 1510
141 Ga0105248_10145835 3300009177 Bacteria 2671
142 Ga0105248_10172485 3300009177 Bacteria 2438
143 Ga0105248_10471694 3300009177 Bacteria 1415
144 Ga0105237_10008841 3300009545 Bacteria 10858
145 Ga0105237_10055553 3300009545 Bacteria 3965
146 Ga0105237_10128902 3300009545 Bacteria 2524
147 Ga0105237_10206414 3300009545 Bacteria 1965
148 Ga0105238_10213034 3300009551 Bacteria 1908
149 Ga0105249_10092935 3300009553 Bacteria 2825
150 Ga0099796_10031983 3300010159 Bacteria 1721
151 Ga0105239_10036720 3300010375 Bacteria 5376
152 Ga0105239_10042168 3300010375 Bacteria 5000
153 Ga0105239_10099041 3300010375 Bacteria 3223
154 Ga0105239_10140754 3300010375 Bacteria 2688
155 Ga0105239_10375808 3300010375 Bacteria 1606
156 Ga0105239_10474999 3300010375 Bacteria 1420
157 Ga0105239_11038688 3300010375 Bacteria 943
158 Ga0105246_10079283 3300011119 Bacteria 2335
159 Ga0105246_10094817 3300011119 Bacteria 2159
160 Ga0105246_10342623 3300011119 Bacteria 1222
161 Ga0105246_10443856 3300011119 Bacteria 1089
162 Ga0157370_10152019 3300013104 Bacteria 2154
163 Ga0157370_10649995 3300013104 Bacteria 964
164 Ga0157369_10024826 3300013105 Bacteria 6659
165 Ga0157369_10782579 3300013105 Bacteria 981
166 Ga0157378_10005423 3300013297 Bacteria 11182
167 Ga0157378_10137622 3300013297 Bacteria 2265
168 Ga0163162_10135380 3300013306 Bacteria 2574
169 Ga0163162_10583134 3300013306 Bacteria 1245
170 Ga0157375_10341171 3300013308 Bacteria 1664
171 Ga0157375_10417626 3300013308 Bacteria 1508
172 Ga0157375_10678196 3300013308 Bacteria 1185
173 Ga0163163_10006059 3300014325 Bacteria 10519
174 Ga0163163_10019806 3300014325 Bacteria 6327
175 Ga0163163_10154833 3300014325 Bacteria 2336
176 Ga0157380_10035354 3300014326 Bacteria 3859
177 Ga0157380_10123700 3300014326 Bacteria 2195
178 Ga0157380_10800188 3300014326 Bacteria 960
179 Ga0157377_10022417 3300014745 Bacteria 3334
180 Ga0157377_10052819 3300014745 Bacteria 2296
181 Ga0157379_10070141 3300014968 Bacteria 3135
182 Ga0157379_10090916 3300014968 Bacteria 2738
183 Ga0157376_10034063 3300014969 Bacteria 4109
184 Ga0157376_10064544 3300014969 Bacteria 3089
185 Ga0157376_10141705 3300014969 Bacteria 2157
186 Ga0157376_10624118 3300014969 Bacteria 1075
187 Ga0163161_10214384 3300017792 Bacteria 1489
188 Ga0163161_10529003 3300017792 Bacteria 964
189 Ga0213876_10001984 3300021384 Bacteria 12236
190 Ga0209758_1006755 3300025297 Bacteria 8067
191 Ga0209758_1010099 3300025297 Bacteria 5717
192 Ga0207697_10081079 3300025315 Bacteria 1367
193 Ga0207656_10037266 3300025321 Bacteria 2045
194 Ga0207692_10004800 3300025898 Bacteria 5374
195 Ga0207692_10148652 3300025898 Bacteria 1339
196 Ga0207710_10018018 3300025900 Bacteria 3000
197 Ga0207688_10020494 3300025901 Bacteria 3610
198 Ga0207680_10211163 3300025903 Bacteria 1327
199 Ga0207680_10531372 3300025903 Bacteria 839
200 Ga0207647_10119972 3300025904 Bacteria 1551
201 Ga0207685_10022399 3300025905 Bacteria 2135
202 Ga0207685_10064832 3300025905 Bacteria 1460
203 Ga0207699_10000688 3300025906 Bacteria 16229
204 Ga0207699_10011578 3300025906 Bacteria 4461
205 Ga0207645_10248901 3300025907 Bacteria 1175
206 Ga0207705_10336351 3300025909 Bacteria 1162
207 Ga0207654_10010168 3300025911 Bacteria 4787
208 Ga0207707_10121054 3300025912 Bacteria 2288
209 Ga0207707_10161832 3300025912 Bacteria 1957
210 Ga0207671_10048387 3300025914 Bacteria 3147
211 Ga0207671_10126492 3300025914 Bacteria 1958
212 Ga0207671_10330177 3300025914 Bacteria 1208
213 Ga0207693_10059248 3300025915 Bacteria 2999
214 Ga0207663_10002234 3300025916 Bacteria 9271
215 Ga0207663_10002582 3300025916 Bacteria 8712
216 Ga0207663_10078186 3300025916 Bacteria 2156
217 Ga0207662_10101489 3300025918 Bacteria 1783
218 Ga0207657_10009166 3300025919 Bacteria 9982
219 Ga0207657_10308195 3300025919 Bacteria 1253
220 Ga0207649_10118394 3300025920 Bacteria 1782
221 Ga0207649_10136738 3300025920 Bacteria 1672
222 Ga0207649_10221335 3300025920 Bacteria 1348
223 Ga0207652_10029039 3300025921 Bacteria 4619
224 Ga0207659_10133104 3300025926 Bacteria 1922
225 Ga0207687_10007804 3300025927 Bacteria 7017
226 Ga0207700_10102671 3300025928 Bacteria 2284
227 Ga0207664_10086692 3300025929 Bacteria 2558
228 Ga0207644_10076757 3300025931 Bacteria 2459
229 Ga0207644_10100699 3300025931 Bacteria 2170
230 Ga0207644_10116848 3300025931 Bacteria 2025
231 Ga0207706_10102146 3300025933 Bacteria 2523
232 Ga0207706_10470822 3300025933 Bacteria 1086
233 Ga0207686_10225064 3300025934 Bacteria 1357
234 Ga0207709_10041971 3300025935 Bacteria 2749
235 Ga0207670_10269830 3300025936 Bacteria 1322
236 Ga0207669_10011996 3300025937 Bacteria 4242
237 Ga0207704_10137855 3300025938 Bacteria 1701
238 Ga0207704_10333558 3300025938 Bacteria 1175
239 Ga0207665_10001255 3300025939 Bacteria 17109
240 Ga0207691_10163465 3300025940 Bacteria 1952
241 Ga0207711_10120698 3300025941 Bacteria 2340
242 Ga0207711_10176484 3300025941 Bacteria 1941
243 Ga0207711_10223679 3300025941 Bacteria 1722
244 Ga0207711_10320311 3300025941 Bacteria 1433
245 Ga0207689_10114692 3300025942 Bacteria 2215
246 Ga0207689_10320734 3300025942 Bacteria 1286
247 Ga0207679_10846243 3300025945 Bacteria 835
248 Ga0207667_10101947 3300025949 Bacteria 2961
249 Ga0207667_10925682 3300025949 Bacteria 862
250 Ga0207651_10296201 3300025960 Bacteria 1343
251 Ga0207712_10214056 3300025961 Bacteria 1537
252 Ga0207668_10052473 3300025972 Bacteria 2821
253 Ga0207668_10114936 3300025972 Bacteria 2026
254 Ga0207668_10139791 3300025972 Bacteria 1860
255 Ga0207668_10253138 3300025972 Bacteria 1431
256 Ga0207668_10288713 3300025972 Bacteria 1348
257 Ga0207658_10136656 3300025986 Bacteria 1978
258 Ga0207677_10062927 3300026023 Bacteria 2577
259 Ga0207677_10127542 3300026023 Bacteria 1925
260 Ga0207677_10176601 3300026023 Bacteria 1676
261 Ga0207677_10192904 3300026023 Bacteria 1613
262 Ga0207677_10588484 3300026023 Bacteria 975
263 Ga0207703_10015860 3300026035 Bacteria 5878
264 Ga0207703_10093440 3300026035 Bacteria 2533
265 Ga0207703_10398923 3300026035 Bacteria 1276
266 Ga0207639_10035496 3300026041 Bacteria 3690
267 Ga0207678_10014430 3300026067 Bacteria 6947
268 Ga0207678_10022470 3300026067 Bacteria 5523
269 Ga0207678_10045603 3300026067 Bacteria 3791
270 Ga0207678_10074546 3300026067 Bacteria 2908
271 Ga0207678_10160046 3300026067 Bacteria 1923
272 Ga0207678_10216591 3300026067 Bacteria 1639
273 Ga0207678_10662763 3300026067 Bacteria 917
274 Ga0207708_10149111 3300026075 Bacteria 1840
275 Ga0207702_10000041 3300026078 Bacteria 150754
276 Ga0207641_10226417 3300026088 Bacteria 1736
277 Ga0207648_10093234 3300026089 Bacteria 2634
278 Ga0207676_10017385 3300026095 Bacteria 5211
279 Ga0207676_10069647 3300026095 Bacteria 2818
280 Ga0207676_10378784 3300026095 Bacteria 1316
281 Ga0207674_10037125 3300026116 Bacteria 5070
282 Ga0207674_10058401 3300026116 Bacteria 3908
283 Ga0207675_100151405 3300026118 Bacteria 2208
284 Ga0207675_100208564 3300026118 Bacteria 1878
285 Ga0207675_100558627 3300026118 Bacteria 1144
286 Ga0207683_10016123 3300026121 Bacteria 6359
287 Ga0207683_10033235 3300026121 Bacteria 4480
288 Ga0207683_10083473 3300026121 Bacteria 2839
289 Ga0207683_10118492 3300026121 Bacteria 2375
290 Ga0207683_10280471 3300026121 Bacteria 1523
291 Ga0207698_10529827 3300026142 Bacteria 1151
292 Ga0209589_1000006 3300027357 Bacteria 436292
293 Ga0209489_100007 3300027361 Bacteria 436292
294 Ga0209700_100008 3300027363 Bacteria 436292
295 Ga0268266_10008686 3300028379 Bacteria 9011
296 Ga0268266_10025542 3300028379 Bacteria 5024
297 Ga0268266_10051560 3300028379 Bacteria 3532
298 Ga0268266_10056802 3300028379 Bacteria 3367
299 Ga0268266_10225635 3300028379 Bacteria 1723
300 Ga0268265_10074519 3300028380 Bacteria 2655
301 Ga0268264_10280999 3300028381 Bacteria 1559
302 Ga0268264_10715716 3300028381 Bacteria 995
303 Ga0307517_10006667 3300028786 Bacteria 17002
304 Ga0307517_10256996 3300028786 Bacteria 1018
305 Ga0307515_10130615 3300028794 Bacteria 2770
306 Ga0307513_10148930 3300031456 Bacteria 2253
307 Ga0307513_10184946 3300031456 Bacteria 1942
308 Ga0307513_10404868 3300031456 Bacteria 1098
309 Ga0307509_10291215 3300031507 Bacteria 1387
310 Ga0265314_10015985 3300031711 Bacteria 5942
311 Ga0265342_10015017 3300031712 Bacteria 5113
312 Ga0307516_10027196 3300031730 Bacteria 5801
313 Ga0307516_10027291 3300031730 Bacteria 5789
314 Ga0307516_10031145 3300031730 Bacteria 5378
315 Ga0307405_10173875 3300031731 Bacteria 1539
316 Ga0307405_10385297 3300031731 Bacteria 1093
317 Ga0307413_10050900 3300031824 Bacteria 2492
318 Ga0307410_10344027 3300031852 Bacteria 1189
319 Ga0307407_10202080 3300031903 Bacteria 1332
320 Ga0307412_10065884 3300031911 Bacteria 2453
321 Ga0307412_10326559 3300031911 Bacteria 1223
322 Ga0307409_100406781 3300031995 Bacteria 1301
323 Ga0307411_10099788 3300032005 Bacteria 2050
324 Ga0307411_10262119 3300032005 Bacteria 1365
325 Ga0307415_100473556 3300032126 Bacteria 1088
326 Ga0307510_10038416 3300033180 Bacteria 5293
327 Ga0307510_10080335 3300033180 Bacteria 3172
328 Ga0307510_10276056 3300033180 Bacteria 1154
329 Ga0373938_0043560 3300034957 Bacteria 1005
330 Ga0373941_0155655 3300035115 Bacteria 842
331 Ga0373954_0046999 3300035118 Bacteria 2019
332 Ga0373943_0022382 3300035170 Bacteria 2928
333 Ga0373946_0016462 3300035171 Bacteria 2817
334 Ga0373924_0019256 3300035410 Bacteria 2643
335 Ga0373924_0019272 3300035410 Bacteria 2641
336 Ga0373935_0000721 3300035692 Bacteria 17592
337 Ga0373927_0002522 3300035695 Bacteria 13350
338 Ga0373927_0451920 3300035695 Bacteria 849
339 Ga0373933_0221319 3300035724 Bacteria 1214
340 Ga0373947_0002227 3300035725 Bacteria 11735
341 Ga0373937_0021676 3300036401 Bacteria 5768
342 Ga0373937_0442746 3300036401 Bacteria 1233
343 Ga0372808_005582 3300036459 Bacteria 1663
344 Ga0373925_0003792 3300037068 Bacteria 11621
345 Ga0373925_0490161 3300037068 Bacteria 1009
346 Ga0395898_0071991 3300037466 Bacteria 3340
347 Ga0395905_0072277 3300037471 Bacteria 3234
348 Ga0436365_0097773 3300039437 Bacteria 28049
349 Ga0439465_0112900 3300041413 Bacteria 947
350 Ga0451791_0132173 3300041451 Bacteria 800
351 Ga0451793_1622438 3300041452 Bacteria 956
352 Ga0451797_1480024 3300041453 Bacteria 1167
353 Ga0439458_0069020 3300042157 Bacteria 891
354 Ga0495592_0002465 3300046454 Bacteria 13065
355 Ga0495592_0007454 3300046454 Bacteria 8198
356 Ga0495603_0003102 3300046455 Bacteria 9873
357 Ga0495603_0062936 3300046455 Bacteria 2189
358 Ga0495629_0000341 3300046459 Bacteria 39851
359 Ga0495629_0013836 3300046459 Bacteria 5822
360 Ga0495638_0346522 3300046460 Bacteria 786
361 Ga0495641_0018699 3300046461 Bacteria 3568
362 Ga0495651_0164773 3300046462 Bacteria 1584
363 Ga0495651_0181635 3300046462 Bacteria 1488
364 Ga0495650_0023787 3300046471 Bacteria 2908
365 Ga0495580_0009717 3300046472 Bacteria 7546
366 Ga0495582_0000245 3300046473 Bacteria 30263
367 Ga0495582_0097262 3300046473 Bacteria 1646
368 Ga0495605_0215245 3300046474 Bacteria 832
369 Ga0495639_0000275 3300046475 Bacteria 25388
370 Ga0495639_0019730 3300046475 Bacteria 2942
371 Ga0495639_0201798 3300046475 Bacteria 974
372 Ga0495664_0100858 3300046477 Bacteria 1739
373 Ga0495664_0111462 3300046477 Bacteria 1651
374 Ga0495664_0249349 3300046477 Bacteria 1074
375 Ga0495585_0031449 3300046492 Bacteria 3012
376 Ga0495585_0086751 3300046492 Bacteria 1690
377 Ga0495594_0000325 3300046499 Bacteria 23654
378 Ga0495594_0037847 3300046499 Bacteria 2633
379 Ga0495596_0078222 3300046500 Bacteria 1284
380 Ga0495608_0017797 3300046511 Bacteria 4912
381 Ga0495618_0029417 3300046514 Bacteria 3428
382 Ga0495618_0134021 3300046514 Bacteria 1585
383 Ga0495620_0033870 3300046515 Bacteria 2314
384 Ga0495630_0007197 3300046517 Bacteria 7932
385 Ga0495630_0294564 3300046517 Bacteria 1240
386 Ga0495631_0214144 3300046518 Bacteria 823
387 Ga0495632_0208409 3300046519 Bacteria 887
388 Ga0495632_0212994 3300046519 Bacteria 876
389 Ga0495663_0127577 3300046525 Bacteria 856
390 Ga0495652_0037467 3300046529 Bacteria 4207
391 Ga0495652_0049019 3300046529 Bacteria 3617
392 Ga0495652_0469837 3300046529 Bacteria 877
393 Ga0495665_0000042 3300046531 Bacteria 49467
394 Ga0495640_0011585 3300046533 Bacteria 6776
395 Ga0495586_0060289 3300046535 Bacteria 2063
396 Ga0495587_0032793 3300046536 Bacteria 3137
397 Ga0495587_0202902 3300046536 Bacteria 1121
398 Ga0495598_0000868 3300046537 Bacteria 5820
399 Ga0495609_0162994 3300046538 Bacteria 944
400 Ga0495621_0028934 3300046539 Bacteria 1886
401 Ga0495645_0190657 3300046543 Bacteria 1397
402 Ga0495645_0271591 3300046543 Bacteria 1119
403 Ga0495633_0029960 3300046558 Bacteria 2645
404 Ga0495667_0026609 3300046559 Bacteria 3898
405 Ga0495667_0160490 3300046559 Bacteria 1446
406 Ga0495656_0008123 3300046615 Bacteria 3735
407 Ga0495656_0153566 3300046615 Bacteria 1113
408 Ga0495668_0085171 3300046616 Bacteria 1733
409 Ga0495668_0178231 3300046616 Bacteria 1164
410 Ga0495668_0249588 3300046616 Bacteria 972
411 Ga0495634_0000249 3300046642 Bacteria 50835
412 Ga0495634_0225889 3300046642 Bacteria 1153
413 Ga0495635_0000239 3300046663 Bacteria 34889
414 Ga0495635_0289718 3300046663 Bacteria 1099
415 Ga0495659_0014021 3300046664 Bacteria 2617
416 Ga0495661_0131524 3300046665 Bacteria 1371
417 Ga0495588_0002963 3300046674 Bacteria 7335
418 Ga0495588_0083803 3300046674 Bacteria 1665
419 Ga0495647_0012717 3300046681 Bacteria 2903
420 Ga0495647_0215078 3300046681 Bacteria 847
421 Ga0495658_0001216 3300046683 Bacteria 13515
422 Ga0495658_0138064 3300046683 Bacteria 1489
423 Ga0495669_0010105 3300046684 Bacteria 3986
424 Ga0495669_0069942 3300046684 Bacteria 1598
425 Ga0495669_0162724 3300046684 Bacteria 1059
426 Ga0495613_0001536 3300046689 Bacteria 17570
427 Ga0495624_0000538 3300046690 Bacteria 29656
428 Ga0495670_0032476 3300046691 Bacteria 2596
429 Ga0495600_0126462 3300046809 Bacteria 1662
430 Ga0495581_0001718 3300047315 Bacteria 12206
431 Ga0495581_0125683 3300047315 Bacteria 1493
432 Ga0495604_0045939 3300047317 Bacteria 3406
433 Ga0495674_0012555 3300047319 Bacteria 7980
434 Ga0495674_0168496 3300047319 Bacteria 1829
435 Ga0495672_0013735 3300047320 Bacteria 5572
436 Ga0495672_0026999 3300047320 Bacteria 3655
437 Ga0495676_0019517 3300047321 Bacteria 5961
438 Ga0495680_0067198 3300047322 Bacteria 2741
439 Ga0495675_0012647 3300047444 Bacteria 5311
440 Ga0495673_0099984 3300047469 Bacteria 1174
441 Ga0495684_0114165 3300047471 Bacteria 2036
442 Ga0495684_0365246 3300047471 Bacteria 1021
443 Ga0495593_0000034 3300047673 Bacteria 57993
444 Ga0495602_0139007 3300048088 Bacteria 1925
445 Ga0495614_0032839 3300048089 Bacteria 2233
446 Ga0496100_0025362 3300048903 Bacteria 3626
447 Ga0496100_0614665 3300048903 Bacteria 845
448 Ga0496101_0033494 3300048904 Bacteria 3624
449 Ga0496102_0037481 3300048905 Bacteria 4374
450 Ga0496102_0039924 3300048905 Bacteria 4243
451 Ga0496102_0378174 3300048905 Bacteria 1333
452 Ga0496103_0040491 3300048906 Bacteria 2863
453 Ga0496103_0316040 3300048906 Bacteria 1005
454 Ga0496104_0068285 3300048907 Bacteria 3378
455 Ga0496104_0160963 3300048907 Bacteria 2153
456 Ga0496105_0012930 3300048908 Bacteria 6615
457 Ga0496105_0029563 3300048908 Bacteria 4485
458 Ga0496105_0222297 3300048908 Bacteria 1537
459 Ga0496105_0287781 3300048908 Bacteria 1323
460 Ga0496105_0320280 3300048908 Bacteria 1243
461 Ga0496106_0019401 3300048909 Bacteria 5043
462 Ga0496106_0026557 3300048909 Bacteria 4312
463 Ga0496106_0033715 3300048909 Bacteria 3821
464 Ga0496106_0079091 3300048909 Bacteria 2524
465 Ga0496107_0045554 3300048910 Bacteria 3155
466 Ga0496107_0108039 3300048910 Bacteria 2043
467 Ga0496107_0299142 3300048910 Bacteria 1197
468 Ga0496108_0005880 3300048911 Bacteria 9945
469 Ga0496108_0033423 3300048911 Bacteria 4273
470 Ga0496108_0060720 3300048911 Bacteria 3181
471 Ga0496108_0174968 3300048911 Bacteria 1858
472 Ga0496109_0021013 3300048912 Bacteria 5771
473 Ga0496109_0129722 3300048912 Bacteria 2352
474 Ga0496109_0245952 3300048912 Bacteria 1684
475 Ga0496110_0003498 3300048913 Bacteria 12052
476 Ga0496110_0026100 3300048913 Bacteria 4995
477 Ga0496110_0153500 3300048913 Bacteria 2085
478 Ga0496110_0197788 3300048913 Bacteria 1826
479 Ga0496110_0391811 3300048913 Bacteria 1266
480 Ga0496112_0009086 3300048915 Bacteria 8930
481 Ga0496112_0019550 3300048915 Bacteria 6395
482 Ga0496112_0064771 3300048915 Bacteria 3607
483 Ga0496112_0307472 3300048915 Bacteria 1530
484 Ga0496113_0057662 3300048916 Bacteria 2919
485 Ga0496114_0016332 3300048917 Bacteria 5979
486 Ga0496114_0807875 3300048917 Bacteria 817
487 Ga0496115_0020747 3300048918 Bacteria 5069
488 Ga0496115_0032257 3300048918 Bacteria 4132
489 Ga0496115_0191323 3300048918 Bacteria 1691
490 Ga0496117_0272152 3300048920 Bacteria 912
491 Ga0496119_0125241 3300048922 Bacteria 1407
492 Ga0496121_0044216 3300048924 Bacteria 3846
493 Ga0496121_0099990 3300048924 Bacteria 2240
494 Ga0496121_0149172 3300048924 Bacteria 1723
495 Ga0496121_0168261 3300048924 Bacteria 1595
496 Ga0496121_0271446 3300048924 Bacteria 1165
497 Ga0496121_0363623 3300048924 Bacteria 960
498 Ga0496124_0057513 3300048927 Bacteria 3276
499 Ga0496126_0010229 3300048929 Bacteria 9862
500 Ga0496126_0041397 3300048929 Bacteria 4263
501 Ga0496126_0349182 3300048929 Bacteria 1210
502 Ga0496126_0657690 3300048929 Bacteria 819
503 Ga0495678_077871 3300049459 Bacteria 1198
504 Ga0501040_0198643 3300049576 Bacteria 1424
505 Ga0501069_0188216 3300049585 Bacteria 1194
506 Ga0501071_0591922 3300049587 Bacteria 853
507 nmdc:mga03n38_172825_c1 3300050490 Bacteria 1102
508 nmdc:mga00v17_201486_c1 3300050491 Bacteria 1287
509 nmdc:mga0yw44_235809_c1 3300050492 Bacteria 1215
510 nmdc:mga0yw44_268237_c1 3300050492 Bacteria 1139
511 nmdc:mga0k408_48518_c1 3300050493 Bacteria 2457
512 nmdc:mga0k408_63935_c1 3300050493 Bacteria 2141
513 nmdc:mga06z11_130501_c1 3300050494 Bacteria 1411
514 nmdc:mga07m45_33037_c1 3300050496 Bacteria 2872
515 nmdc:mga05p37_281121_c1 3300050507 Bacteria 1985
516 nmdc:mga05p37_418064_c1 3300050507 Bacteria 1561
517 nmdc:mga09592_372269_c1 3300050508 Bacteria 1236
518 nmdc:mga0qj67_560884_c1 3300050509 Bacteria 915
519 nmdc:mga08y16_182104_c1 3300050511 Bacteria 2181
520 nmdc:mga0sz30_148824_c1 3300050516 Bacteria 1035
521 nmdc:mga0sz30_239402_c1 3300050516 Bacteria 808
522 Ga0495601_0097314 3300053077 Bacteria 1898
523 Ga0495601_0163070 3300053077 Bacteria 1457
524 Ga0495612_0061799 3300053078 Bacteria 1552
525 Ga0495612_0088901 3300053078 Bacteria 1305
526 Ga0500635_0000526 3300053080 Bacteria 10473
527 Ga0495595_0066448 3300053084 Bacteria 1698
528 Ga0495619_0128216 3300053085 Bacteria 1742
529 Ga0500644_0055448 3300053088 Bacteria 1376
530 Ga0500566_0004386 3300053094 Bacteria 8423
531 Ga0500554_003283 3300053102 Bacteria 3292
532 Ga0500572_000497 3300053111 Bacteria 13512
533 Ga0500595_000331 3300053119 Bacteria 31133
534 Ga0500595_071080 3300053119 Bacteria 1032
535 Ga0500658_0017410 3300053134 Bacteria 2684
536 Ga0500559_0000640 3300053136 Bacteria 23656
537 Ga0500568_0030284 3300053139 Bacteria 2242
538 Ga0500589_042574 3300053147 Bacteria 2117
539 Ga0500603_000076 3300053150 Bacteria 22738
540 Ga0500603_006898 3300053150 Bacteria 2478
541 Ga0500627_0129979 3300053158 Bacteria 1137
542 Ga0500638_054764 3300053162 Bacteria 1923
543 Ga0500639_084367 3300053163 Bacteria 1594
544 Ga0500636_0089197 3300053177 Bacteria 1768
545 Ga0500637_0018086 3300053178 Bacteria 3781
546 Ga0500637_0037740 3300053178 Bacteria 2717
547 Ga0500637_0287001 3300053178 Bacteria 903
548 Ga0500576_004552 3300053725 Bacteria 5629
549 Ga0500645_011997 3300053730 Bacteria 2810
550 Ga0500596_002077 3300053735 Bacteria 3988
551 Ga0500661_000233 3300055283 Bacteria 9910
552 Ga0530510_0421968 3300061734 Bacteria 1007
553 2876812872 2876808645 Bacteria 8824342
554 2508544850 2508501009 Bacteria 7784016
555 2508696921 2508501042 Bacteria 8719808
556 2511396086 2511231028 Bacteria 8046582
557 2513623502 2513237092 Bacteria 8341956
558 2513637452 2513237094 Bacteria 8789602
559 2513649699 2513237095 Bacteria 8976980
560 2513697454 2513237101 Bacteria 7952346
561 2513706324 2513237102 Bacteria 7703324
562 2513861068 2513237137 Bacteria 9558895
563 2513874668 2513237139 Bacteria 8737671
564 2513892100 2513237141 Bacteria 8496279
565 2513915928 2513237145 Bacteria 8979722
566 2514010615 2513237161 Bacteria 8871253
567 2515625419 2515154112 Bacteria 8294334
568 2517894768 2517572143 Bacteria 9484767
569 2528855914 2528768022 Bacteria 10457665
570 2617350793 2617270735 Bacteria 9163226
571 2617373162 2617270741 Bacteria 8201522
572 2723843054 2721755755 Bacteria 8322773
573 2728747580 2728368998 Bacteria 8720350
574 2745076950 2744054633 Bacteria 8678936
575 2793064682 2791355196 Bacteria 7323613
576 2793079536
577 2805916665 2802429603 Bacteria 8777136
578 2818238170 2816332527 Bacteria 8933356
579 2824607748 2824600985 Bacteria 8488197
580 2824617114 2824609381 Bacteria 8672835
581 2824624279 2824617872 Bacteria 8814715
582 2824633039 2824626560 Bacteria 8813858
583 2824641037 2824635225 Bacteria 8785348
584 2824650510 2824644064 Bacteria 8743947
585 2824668284 2824661429 Bacteria 9877870
586 2824676196 2824671348 Bacteria 8369588
587 2824682868 2824679649 Bacteria 8248951
588 2824692346 2824687955 Bacteria 8360029
589 2824702284 2824696289 Bacteria 8335049
590 2824711500 2824704595 Bacteria 9667483
591 2824720360 2824714736 Bacteria 8717648
592 2824729275 2824723954 Bacteria 8758240
593 2824738465 2824732956 Bacteria 7810675
594 2824751556 2824746037 Bacteria 7911610
595 2824761242 2824753945 Bacteria 9787441
596 2824771833 2824763712 Bacteria 9792355
597 2824780525 2824773399 Bacteria 8360218
598 2838127912 2838122688 Bacteria 8803140
599 2841943206 2841941048 Bacteria 8688029
600 2841954063 2841949485 Bacteria 8680857
601 2841960202 2841957949 Bacteria 8652217
602 2841968154 2841966195 Bacteria 8673214
603 2841976637 2841974524 Bacteria 8931498
604 2841988009 2841983080 Bacteria 8395090
605 2842042688 2842038055 Bacteria 8002051
606 2842050731 2842045827 Bacteria 8006841
607 2844316895 2844315083 Bacteria 8138177
608 2847938579 2847930680 Bacteria 9342022
609 2847944221 2847939898 Bacteria 8606328
610 2849081547 2849076700 Bacteria 7039503
611 2857512207 2857509624 Bacteria 7472071
612 2874597766 2874590934 Bacteria 8299676
613 2874612613 2874604998 Bacteria 7834745
614 2874617677 2874612657 Bacteria 8252029
615 2874623418 2874620515 Bacteria 8290088
616 2874630671 2874628541 Bacteria 8630250
617 2874651295 2874645413 Bacteria 8214782
618 2876762385 2876761206 Bacteria 10111113
619 2876776366 2876771140 Bacteria 8287509
620 2876820934 2876818435 Bacteria 8274608
621 2879081771 2879074833 Bacteria 8279565
622 2879086176 2879083081 Bacteria 8587928
623 2879101330 2879099564 Bacteria 10442239
624 2879118052 2879110137 Bacteria 8907982
625 2879130486 2879127579 Bacteria 8294491
626 2879146372 2879142872 Bacteria 8267021
627 2881370699 2881364244 Bacteria 7710352
628 2881671316 2881665667 Bacteria 8175609
629 2885366917 2885366525 Bacteria 8326213
630 2885378782 2885374607 Bacteria 8927485
631 2885413415 2885409591 Bacteria 9235467
632 2888381507 2888378607 Bacteria 9652610
633 2888389131 2888388044 Bacteria 7304136
634 2888421910 2888419890 Bacteria 7857137
635 2889033645 2889033259 Bacteria 9099371
636 2903733945 2903727486 Bacteria 8281579
637 2904667351 2904666416 Bacteria 8226587
638 2904697749 2904690495 Bacteria 9412302
639 2904705901
640 2904719246 2904711408 Bacteria 9771557
641 2906604561 2906602504 Bacteria 8295279
642 2906611481
643 2906641676 2906635258 Bacteria 8601019
644 2906660778 2906660503 Bacteria 8595048
645 2908745073 2908739725 Bacteria 8628932
646 2908757155 2908756301 Bacteria 8864324
647 2908781617 2908775508 Bacteria 8092255
648 2922367007 2922361189 Bacteria 7436256
649 2922371174
650 2922390210 2922386360 Bacteria 7017218
651 2922393547 2922393267 Bacteria 8285685
652 2922427877
653 2929619559 2929615660 Bacteria 9193770
654 2929627971 2929624759 Bacteria 9339455
655 2932785887 2932784394 Bacteria 9704911
656 2932798331 2932794094 Bacteria 7915132
657 2932804127 2932801729 Bacteria 7987968
658 2932817258 2932809354 Bacteria 9135765
659 2932826855 2932818245 Bacteria 9955613
660 2932830931 2932828146 Bacteria 9745859
661 2933581479 2933577622 Bacteria 9116884
662 2935612734 2935608549 Bacteria 8203142
663 2935620997 2935616580 Bacteria 9032984
664 2935632195 2935630451 Bacteria 8169952
665 2935640072 2935638405 Bacteria 10015038
666 2935667089 2935665750 Bacteria 9571747
667 2935680269 2935675223 Bacteria 9928132
668 2935690220 2935684952 Bacteria 9590419
669 2935699693 2935694250 Bacteria 9291695
670 2935704845 2935703347 Bacteria 10242284
671 2935718083 2935713505 Bacteria 9608509
672 2935726767 2935722832 Bacteria 9608746
673 2935735536 2935732158 Bacteria 9706831
674 2935745193 2935741537 Bacteria 9707219
675 2935755231 2935750917 Bacteria 9590372
676 2935762251 2935760218 Bacteria 9817913
677 2935773641 2935769743 Bacteria 7878163
678 2935780195 2935777560 Bacteria 8077691
679 2935788454 2935785616 Bacteria 7962367
680 2935796610 2935793552 Bacteria 8012592
681 2935803753 2935801545 Bacteria 9301974
682 2935811669 2935810662 Bacteria 9401221
683 2935824223 2935819856 Bacteria 8261050
684 2935829555 2935827899 Bacteria 10038562
685 2935843111 2935837841 Bacteria 9454360
686 2935852630 2935847175 Bacteria 8228321
687 2935858804 2935855204 Bacteria 9035059
688 2935866798 2935864058 Bacteria 9784707
689 2935876929 2935873716 Bacteria 9632195
690 2935884067 2935883170 Bacteria 7964738
691 2935912224 2935908558 Bacteria 8568796
692 2935924103 2935916978 Bacteria 9113783
693 2935929253 2935926038 Bacteria 8601059
694 2935935884 2935934488 Bacteria 8602579
695 2935950392 2935942939 Bacteria 8599779
696 2935957450 2935951376 Bacteria 8602333
697 2935962025 2935959822 Bacteria 7869783
698 2935968481 2935967501 Bacteria 8603075
699 2935976670 2935975950 Bacteria 8347125
700 2935990705 2935984226 Bacteria 8302647
701 2935993433 2935992306 Bacteria 9802711
702 2936004328 2936002035 Bacteria 9362176
703 2936038251 2936037263 Bacteria 9446081
704 2936058590 2936055302 Bacteria 8785755
705 2940561488 2940556831 Bacteria 9590747
706 2941508143 2941507105 Bacteria 8166816
707 2941515352 2941515067 Bacteria 8166720
708 2941524073 2941523033 Bacteria 8169134
709 2941533675 2941531003 Bacteria 7653939
710 2941544335 2941538514 Bacteria 9402094
711 3005486167 3005483717 Bacteria 7877331
712 3005507110 3005506211 Bacteria 6943378
713 3005593068 3005587118 Bacteria 7794411
714 3005596530 3005594810 Bacteria 8716512
715 3005719660 3005718088 Bacteria 8283608
716 8006933640 8006933436 Bacteria 10410654
717 8006983312 8006973647 Bacteria 10679141
718 8006989374 8006984368 Bacteria 9651211
719 8006997857 8006994254 Bacteria 8309700
720 8016516454 8016511872 Bacteria 9921665
721 8016523854 8016522445 Bacteria 8156687
722 8016537383 8016530956 Bacteria 8155261
723 8016541654 8016539877 Bacteria 8155419
724 8016551614 8016548790 Bacteria 8155074
725 8016559998 8016557553 Bacteria 8154380
726 8016567040 8016566248 Bacteria 8158151
727 8016579761 8016575299 Bacteria 8154085
728 8016589116 8016583857 Bacteria 10421953
729 8016597925 8016595262 Bacteria 8149947
730 8016604062 8016603502 Bacteria 8731218
731 8016620647 8016613128 Bacteria 8794220
732 8016629350 8016622563 Bacteria 7999408
733 8016633869 8016630954 Bacteria 9217207
734 8017060083 8017057580 Bacteria 10023680
735 8019537067 8019530166 Bacteria 8155624
736 8019542472 8019538911 Bacteria 7872763
737 8019548282 8019547302 Bacteria 7996444
738 8019579592 8019576017 Bacteria 10049540
739 8019587302 8019586578 Bacteria 10212056
740 8019604038 8019597564 Bacteria 10041141
741 8019625119 8019619141 Bacteria 9218857
742 8019637062 8019629233 Bacteria 8687553
743 8019642542 8019638758 Bacteria 9062356
744 8019650045 8019648815 Bacteria 10014479
745 8019674463 8019668869 Bacteria 8791617
746 8019681639 8019678201 Bacteria 8863603
747 8019694131 8019687851 Bacteria 8712826
748 8055749183 8055742211 Bacteria 9226248
749 8056674892 8056673599 Bacteria 7871253
750 8056695186 8056689827 Bacteria 6712655
751 8056969702 8056967851 Bacteria 9038162
752 JGI25406J46586_10011011
753 JGI25153J46596_10008125
754 JGI25404J52841_10001223
755 JGI25404J52841_10014352
756 Ga0068869_100063079
757 Ga0068869_100071169
758 Ga0070666_10132508
759 Ga0070666_10140090
760 Ga0070680_100051072
761 Ga0070682_100110873
762 Ga0068868_100064377
763 Ga0068868_100104503
764 Ga0068868_100145571
765 Ga0070660_100040628
766 Ga0070660_100303670
767 Ga0070689_100298317
768 Ga0070661_100176906
769 Ga0070668_100057111
770 Ga0070668_100134329
771 Ga0070668_100265565
772 Ga0070668_100743835
773 Ga0070675_100205223
774 Ga0070675_100501481
775 Ga0070671_100148845
776 Ga0070671_100239120
777 Ga0070671_100269394
778 Ga0070688_100120770
779 Ga0070709_10000460
780 Ga0070709_10001641
781 Ga0070714_100031926
782 Ga0070714_100123085
783 Ga0070713_100146316
784 Ga0070710_10007186
785 Ga0070710_10279056
786 Ga0070711_100001032
787 Ga0070711_100054383
788 Ga0070711_100096589
789 Ga0070705_100180683
790 Ga0070708_100134288
791 Ga0070663_100021088
792 Ga0070663_100035141
793 Ga0070663_100046227
794 Ga0070663_100141613
795 Ga0070663_100155020
796 Ga0070678_100014300
797 Ga0070678_100091751
798 Ga0070678_100179335
799 Ga0070678_100239403
800 Ga0070662_100273026
801 Ga0070681_10299676
802 Ga0068867_100127122
803 Ga0070685_10265354
804 Ga0070679_100012752
805 Ga0068853_100666865
806 Ga0070686_100212366
807 Ga0070693_100192924
808 Ga0070665_100016483
809 Ga0070665_100087933
810 Ga0070665_100120014
811 Ga0070665_100137894
812 Ga0068855_100015207
813 Ga0068857_100042816
814 Ga0068857_100121140
815 Ga0068854_100102881
816 Ga0070702_100244275
817 Ga0068852_100352625
818 Ga0068852_100431165
819 Ga0068859_100434746
820 Ga0068864_100052121
821 Ga0068864_100078186
822 Ga0068866_10130837
823 Ga0068861_100272198
824 Ga0068861_100483970
825 Ga0068851_10193811
826 Ga0068870_10154803
827 Ga0068858_100031117
828 Ga0068858_100117632
829 Ga0068858_100170174
830 Ga0068860_100039656
831 Ga0068860_100231303
832 Ga0068860_100383589
833 Ga0068860_100481132
834 Ga0068862_100068555
835 Ga0068862_100145067
836 Ga0068862_100234654
837 Ga0068862_100328473
838 Ga0081455_10004153
839 Ga0081455_10011375
840 Ga0081455_10015038
841 Ga0081455_10032232
842 Ga0081540_1001150
843 Ga0081540_1003189
844 Ga0081540_1005395
845 Ga0081540_1008645
846 Ga0081540_1020690
847 Ga0081540_1025822
848 Ga0081539_10000191
849 Ga0081539_10075799
850 Ga0070717_10011853
851 Ga0075365_10015867
852 Ga0075365_10216005
853 Ga0075368_10100158
854 Ga0075363_100128067
855 Ga0075363_100165986
856 Ga0075363_100209452
857 Ga0075364_10148262
858 Ga0070715_10037477
859 Ga0070716_100033308
860 Ga0070712_100034669
861 Ga0075367_10020086
862 Ga0075367_10022374
863 Ga0075367_10117416
864 Ga0075369_10029628
865 Ga0075366_10141533
866 Ga0097621_100252162
867 Ga0075370_10177366
868 Ga0075370_10239264
869 Ga0068871_100311155
870 Ga0068871_100703464
871 Ga0075429_100466366
872 Ga0068865_100111527
873 Ga0097620_100434755
874 Ga0099822_1005361
875 Ga0099795_10131119
876 Ga0105240_10017682
877 Ga0105240_10263313
878 Ga0105240_10275949
879 Ga0111539_10512505
880 Ga0105245_10043899
881 Ga0105245_10058260
882 Ga0105245_10612270
883 Ga0105247_10076167
884 Ga0105247_10126816
885 Ga0114129_10183736
886 Ga0114129_10298354
887 Ga0105243_10139779
888 Ga0105243_10650772
889 Ga0105241_10026901
890 Ga0105242_10116057
891 Ga0105242_10281549
892 Ga0105248_10145835
893 Ga0105248_10172485
894 Ga0105248_10471694
895 Ga0105237_10008841
896 Ga0105237_10055553
897 Ga0105237_10128902
898 Ga0105237_10206414
899 Ga0105238_10213034
900 Ga0105249_10092935
901 Ga0099796_10031983
902 Ga0105239_10036720
903 Ga0105239_10042168
904 Ga0105239_10099041
905 Ga0105239_10140754
906 Ga0105239_10375808
907 Ga0105239_10474999
908 Ga0105239_11038688
909 Ga0105246_10079283
910 Ga0105246_10094817
911 Ga0105246_10342623
912 Ga0105246_10443856
913 Ga0157370_10152019
914 Ga0157370_10649995
915 Ga0157369_10024826
916 Ga0157369_10782579
917 Ga0157378_10005423
918 Ga0157378_10137622
919 Ga0163162_10135380
920 Ga0163162_10583134
921 Ga0157375_10341171
922 Ga0157375_10417626
923 Ga0157375_10678196
924 Ga0163163_10006059
925 Ga0163163_10019806
926 Ga0163163_10154833
927 Ga0157380_10035354
928 Ga0157380_10123700
929 Ga0157380_10800188
930 Ga0157377_10022417
931 Ga0157377_10052819
932 Ga0157379_10070141
933 Ga0157379_10090916
934 Ga0157376_10034063
935 Ga0157376_10064544
936 Ga0157376_10141705
937 Ga0157376_10624118
938 Ga0163161_10214384
939 Ga0163161_10529003
940 Ga0213876_10001984
941 Ga0209758_1006755
942 Ga0209758_1010099
943 Ga0207697_10081079
944 Ga0207656_10037266
945 Ga0207692_10004800
946 Ga0207692_10148652
947 Ga0207710_10018018
948 Ga0207688_10020494
949 Ga0207680_10211163
950 Ga0207680_10531372
951 Ga0207647_10119972
952 Ga0207685_10022399
953 Ga0207685_10064832
954 Ga0207699_10000688
955 Ga0207699_10011578
956 Ga0207645_10248901
957 Ga0207705_10336351
958 Ga0207654_10010168
959 Ga0207707_10121054
960 Ga0207707_10161832
961 Ga0207671_10048387
962 Ga0207671_10126492
963 Ga0207671_10330177
964 Ga0207693_10059248
965 Ga0207663_10002234
966 Ga0207663_10002582
967 Ga0207663_10078186
968 Ga0207662_10101489
969 Ga0207657_10009166
970 Ga0207657_10308195
971 Ga0207649_10118394
972 Ga0207649_10136738
973 Ga0207649_10221335
974 Ga0207652_10029039
975 Ga0207659_10133104
976 Ga0207687_10007804
977 Ga0207700_10102671
978 Ga0207664_10086692
979 Ga0207644_10076757
980 Ga0207644_10100699
981 Ga0207644_10116848
982 Ga0207706_10102146
983 Ga0207706_10470822
984 Ga0207686_10225064
985 Ga0207709_10041971
986 Ga0207670_10269830
987 Ga0207669_10011996
988 Ga0207704_10137855
989 Ga0207704_10333558
990 Ga0207665_10001255
991 Ga0207691_10163465
992 Ga0207711_10120698
993 Ga0207711_10176484
994 Ga0207711_10223679
995 Ga0207711_10320311
996 Ga0207689_10114692
997 Ga0207689_10320734
998 Ga0207679_10846243
999 Ga0207667_10101947
1000 Ga0207667_10925682
1001 Ga0207651_10296201
1002 Ga0207712_10214056
1003 Ga0207668_10052473
1004 Ga0207668_10114936
1005 Ga0207668_10139791
1006 Ga0207668_10253138
1007 Ga0207668_10288713
1008 Ga0207658_10136656
1009 Ga0207677_10062927
1010 Ga0207677_10127542
1011 Ga0207677_10176601
1012 Ga0207677_10192904
1013 Ga0207677_10588484
1014 Ga0207703_10015860
1015 Ga0207703_10093440
1016 Ga0207703_10398923
1017 Ga0207639_10035496
1018 Ga0207678_10014430
1019 Ga0207678_10022470
1020 Ga0207678_10045603
1021 Ga0207678_10074546
1022 Ga0207678_10160046
1023 Ga0207678_10216591
1024 Ga0207678_10662763
1025 Ga0207708_10149111
1026 Ga0207702_10000041
1027 Ga0207641_10226417
1028 Ga0207648_10093234
1029 Ga0207676_10017385
1030 Ga0207676_10069647
1031 Ga0207676_10378784
1032 Ga0207674_10037125
1033 Ga0207674_10058401
1034 Ga0207675_100151405
1035 Ga0207675_100208564
1036 Ga0207675_100558627
1037 Ga0207683_10016123
1038 Ga0207683_10033235
1039 Ga0207683_10083473
1040 Ga0207683_10118492
1041 Ga0207683_10280471
1042 Ga0207698_10529827
1043 Ga0209589_1000006
1044 Ga0209489_100007
1045 Ga0209700_100008
1046 Ga0268266_10008686
1047 Ga0268266_10025542
1048 Ga0268266_10051560
1049 Ga0268266_10056802
1050 Ga0268266_10225635
1051 Ga0268265_10074519
1052 Ga0268264_10280999
1053 Ga0268264_10715716
1054 Ga0307517_10006667
1055 Ga0307517_10256996
1056 Ga0307515_10130615
1057 Ga0307513_10148930
1058 Ga0307513_10184946
1059 Ga0307513_10404868
1060 Ga0307509_10291215
1061 Ga0265314_10015985
1062 Ga0265342_10015017
1063 Ga0307516_10027196
1064 Ga0307516_10027291
1065 Ga0307516_10031145
1066 Ga0307405_10173875
1067 Ga0307405_10385297
1068 Ga0307413_10050900
1069 Ga0307410_10344027
1070 Ga0307407_10202080
1071 Ga0307412_10065884
1072 Ga0307412_10326559
1073 Ga0307409_100406781
1074 Ga0307411_10099788
1075 Ga0307411_10262119
1076 Ga0307415_100473556
1077 Ga0307510_10038416
1078 Ga0307510_10080335
1079 Ga0307510_10276056
1080 Ga0373938_0043560
1081 Ga0373941_0155655
1082 Ga0373954_0046999
1083 Ga0373943_0022382
1084 Ga0373946_0016462
1085 Ga0373924_0019256
1086 Ga0373924_0019272
1087 Ga0373935_0000721
1088 Ga0373927_0002522
1089 Ga0373927_0451920
1090 Ga0373933_0221319
1091 Ga0373947_0002227
1092 Ga0373937_0021676
1093 Ga0373937_0442746
1094 Ga0372808_005582
1095 Ga0373925_0003792
1096 Ga0373925_0490161
1097 Ga0395898_0071991
1098 Ga0395905_0072277
1099 Ga0436365_0097773
1100 Ga0439465_0112900
1101 Ga0451791_0132173
1102 Ga0451793_1622438
1103 Ga0451797_1480024
1104 Ga0439458_0069020
1105 Ga0495592_0002465
1106 Ga0495592_0007454
1107 Ga0495603_0003102
1108 Ga0495603_0062936
1109 Ga0495629_0000341
1110 Ga0495629_0013836
1111 Ga0495638_0346522
1112 Ga0495641_0018699
1113 Ga0495651_0164773
1114 Ga0495651_0181635
1115 Ga0495650_0023787
1116 Ga0495580_0009717
1117 Ga0495582_0000245
1118 Ga0495582_0097262
1119 Ga0495605_0215245
1120 Ga0495639_0000275
1121 Ga0495639_0019730
1122 Ga0495639_0201798
1123 Ga0495664_0100858
1124 Ga0495664_0111462
1125 Ga0495664_0249349
1126 Ga0495585_0031449
1127 Ga0495585_0086751
1128 Ga0495594_0000325
1129 Ga0495594_0037847
1130 Ga0495596_0078222
1131 Ga0495608_0017797
1132 Ga0495618_0029417
1133 Ga0495618_0134021
1134 Ga0495620_0033870
1135 Ga0495630_0007197
1136 Ga0495630_0294564
1137 Ga0495631_0214144
1138 Ga0495632_0208409
1139 Ga0495632_0212994
1140 Ga0495663_0127577
1141 Ga0495652_0037467
1142 Ga0495652_0049019
1143 Ga0495652_0469837
1144 Ga0495665_0000042
1145 Ga0495640_0011585
1146 Ga0495586_0060289
1147 Ga0495587_0032793
1148 Ga0495587_0202902
1149 Ga0495598_0000868
1150 Ga0495609_0162994
1151 Ga0495621_0028934
1152 Ga0495645_0190657
1153 Ga0495645_0271591
1154 Ga0495633_0029960
1155 Ga0495667_0026609
1156 Ga0495667_0160490
1157 Ga0495656_0008123
1158 Ga0495656_0153566
1159 Ga0495668_0085171
1160 Ga0495668_0178231
1161 Ga0495668_0249588
1162 Ga0495634_0000249
1163 Ga0495634_0225889
1164 Ga0495635_0000239
1165 Ga0495635_0289718
1166 Ga0495659_0014021
1167 Ga0495661_0131524
1168 Ga0495588_0002963
1169 Ga0495588_0083803
1170 Ga0495647_0012717
1171 Ga0495647_0215078
1172 Ga0495658_0001216
1173 Ga0495658_0138064
1174 Ga0495669_0010105
1175 Ga0495669_0069942
1176 Ga0495669_0162724
1177 Ga0495613_0001536
1178 Ga0495624_0000538
1179 Ga0495670_0032476
1180 Ga0495600_0126462
1181 Ga0495581_0001718
1182 Ga0495581_0125683
1183 Ga0495604_0045939
1184 Ga0495674_0012555
1185 Ga0495674_0168496
1186 Ga0495672_0013735
1187 Ga0495672_0026999
1188 Ga0495676_0019517
1189 Ga0495680_0067198
1190 Ga0495675_0012647
1191 Ga0495673_0099984
1192 Ga0495684_0114165
1193 Ga0495684_0365246
1194 Ga0495593_0000034
1195 Ga0495602_0139007
1196 Ga0495614_0032839
1197 Ga0496100_0025362
1198 Ga0496100_0614665
1199 Ga0496101_0033494
1200 Ga0496102_0037481
1201 Ga0496102_0039924
1202 Ga0496102_0378174
1203 Ga0496103_0040491
1204 Ga0496103_0316040
1205 Ga0496104_0068285
1206 Ga0496104_0160963
1207 Ga0496105_0012930
1208 Ga0496105_0029563
1209 Ga0496105_0222297
1210 Ga0496105_0287781
1211 Ga0496105_0320280
1212 Ga0496106_0019401
1213 Ga0496106_0026557
1214 Ga0496106_0033715
1215 Ga0496106_0079091
1216 Ga0496107_0045554
1217 Ga0496107_0108039
1218 Ga0496107_0299142
1219 Ga0496108_0005880
1220 Ga0496108_0033423
1221 Ga0496108_0060720
1222 Ga0496108_0174968
1223 Ga0496109_0021013
1224 Ga0496109_0129722
1225 Ga0496109_0245952
1226 Ga0496110_0003498
1227 Ga0496110_0026100
1228 Ga0496110_0153500
1229 Ga0496110_0197788
1230 Ga0496110_0391811
1231 Ga0496112_0009086
1232 Ga0496112_0019550
1233 Ga0496112_0064771
1234 Ga0496112_0307472
1235 Ga0496113_0057662
1236 Ga0496114_0016332
1237 Ga0496114_0807875
1238 Ga0496115_0020747
1239 Ga0496115_0032257
1240 Ga0496115_0191323
1241 Ga0496117_0272152
1242 Ga0496119_0125241
1243 Ga0496121_0044216
1244 Ga0496121_0099990
1245 Ga0496121_0149172
1246 Ga0496121_0168261
1247 Ga0496121_0271446
1248 Ga0496121_0363623
1249 Ga0496124_0057513
1250 Ga0496126_0010229
1251 Ga0496126_0041397
1252 Ga0496126_0349182
1253 Ga0496126_0657690
1254 Ga0495678_077871
1255 Ga0501040_0198643
1256 Ga0501069_0188216
1257 Ga0501071_0591922
1258 nmdc:mga03n38_172825_c1
1259 nmdc:mga00v17_201486_c1
1260 nmdc:mga0yw44_235809_c1
1261 nmdc:mga0yw44_268237_c1
1262 nmdc:mga0k408_48518_c1
1263 nmdc:mga0k408_63935_c1
1264 nmdc:mga06z11_130501_c1
1265 nmdc:mga07m45_33037_c1
1266 nmdc:mga05p37_281121_c1
1267 nmdc:mga05p37_418064_c1
1268 nmdc:mga09592_372269_c1
1269 nmdc:mga0qj67_560884_c1
1270 nmdc:mga08y16_182104_c1
1271 nmdc:mga0sz30_148824_c1
1272 nmdc:mga0sz30_239402_c1
1273 Ga0495601_0097314
1274 Ga0495601_0163070
1275 Ga0495612_0061799
1276 Ga0495612_0088901
1277 Ga0500635_0000526
1278 Ga0495595_0066448
1279 Ga0495619_0128216
1280 Ga0500644_0055448
1281 Ga0500566_0004386
1282 Ga0500554_003283
1283 Ga0500572_000497
1284 Ga0500595_000331
1285 Ga0500595_071080
1286 Ga0500658_0017410
1287 Ga0500559_0000640
1288 Ga0500568_0030284
1289 Ga0500589_042574
1290 Ga0500603_000076
1291 Ga0500603_006898
1292 Ga0500627_0129979
1293 Ga0500638_054764
1294 Ga0500639_084367
1295 Ga0500636_0089197
1296 Ga0500637_0018086
1297 Ga0500637_0037740
1298 Ga0500637_0287001
1299 Ga0500576_004552
1300 Ga0500645_011997
1301 Ga0500596_002077
1302 Ga0500661_000233
1303 Ga0530510_0421968
1304 2876812872
1305 2508544850
1306 2508696921
1307 2511396086
1308 2513623502
1309 2513637452
1310 2513649699
1311 2513697454
1312 2513706324
1313 2513861068
1314 2513874668
1315 2513892100
1316 2513915928
1317 2514010615
1318 2515625419
1319 2517894768
1320 2528855914
1321 2617350793
1322 2617373162
1323 2723843054
1324 2728747580
1325 2745076950
1326 2793064682
1327 2793079536
1328 2805916665
1329 2818238170
1330 2824607748
1331 2824617114
1332 2824624279
1333 2824633039
1334 2824641037
1335 2824650510
1336 2824668284
1337 2824676196
1338 2824682868
1339 2824692346
1340 2824702284
1341 2824711500
1342 2824720360
1343 2824729275
1344 2824738465
1345 2824751556
1346 2824761242
1347 2824771833
1348 2824780525
1349 2838127912
1350 2841943206
1351 2841954063
1352 2841960202
1353 2841968154
1354 2841976637
1355 2841988009
1356 2842042688
1357 2842050731
1358 2844316895
1359 2847938579
1360 2847944221
1361 2849081547
1362 2857512207
1363 2874597766
1364 2874612613
1365 2874617677
1366 2874623418
1367 2874630671
1368 2874651295
1369 2876762385
1370 2876776366
1371 2876820934
1372 2879081771
1373 2879086176
1374 2879101330
1375 2879118052
1376 2879130486
1377 2879146372
1378 2881370699
1379 2881671316
1380 2885366917
1381 2885378782
1382 2885413415
1383 2888381507
1384 2888389131
1385 2888421910
1386 2889033645
1387 2903733945
1388 2904667351
1389 2904697749
1390 2904705901
1391 2904719246
1392 2906604561
1393 2906611481
1394 2906641676
1395 2906660778
1396 2908745073
1397 2908757155
1398 2908781617
1399 2922367007
1400 2922371174
1401 2922390210
1402 2922393547
1403 2922427877
1404 2929619559
1405 2929627971
1406 2932785887
1407 2932798331
1408 2932804127
1409 2932817258
1410 2932826855
1411 2932830931
1412 2933581479
1413 2935612734
1414 2935620997
1415 2935632195
1416 2935640072
1417 2935667089
1418 2935680269
1419 2935690220
1420 2935699693
1421 2935704845
1422 2935718083
1423 2935726767
1424 2935735536
1425 2935745193
1426 2935755231
1427 2935762251
1428 2935773641
1429 2935780195
1430 2935788454
1431 2935796610
1432 2935803753
1433 2935811669
1434 2935824223
1435 2935829555
1436 2935843111
1437 2935852630
1438 2935858804
1439 2935866798
1440 2935876929
1441 2935884067
1442 2935912224
1443 2935924103
1444 2935929253
1445 2935935884
1446 2935950392
1447 2935957450
1448 2935962025
1449 2935968481
1450 2935976670
1451 2935990705
1452 2935993433
1453 2936004328
1454 2936038251
1455 2936058590
1456 2940561488
1457 2941508143
1458 2941515352
1459 2941524073
1460 2941533675
1461 2941544335
1462 3005486167
1463 3005507110
1464 3005593068
1465 3005596530
1466 3005719660
1467 8006933640
1468 8006983312
1469 8006989374
1470 8006997857
1471 8016516454
1472 8016523854
1473 8016537383
1474 8016541654
1475 8016551614
1476 8016559998
1477 8016567040
1478 8016579761
1479 8016589116
1480 8016597925
1481 8016604062
1482 8016620647
1483 8016629350
1484 8016633869
1485 8017060083
1486 8019537067
1487 8019542472
1488 8019548282
1489 8019579592
1490 8019587302
1491 8019604038
1492 8019625119
1493 8019637062
1494 8019642542
1495 8019650045
1496 8019674463
1497 8019681639
1498 8019694131
1499 8055749183
1500 8056674892
1501 8056695186
1502 8056969702

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01925

TauE

Sulfite exporter TauE/SafE

4

250

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.7042 12 242
6cb2-assembly1.cif.gz_A crystal structure of escherichia coli uppp 0.6662 12 242
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.636 12 243
6fmt-assembly1.cif.gz_A imisx-ep of hg-baca soaking sad 0.606 12 243
4lds-assembly1.cif.gz_B the inward-facing structure of the glucose transporter from staphylococcus epidermidis 0.4076 12 246
ID Description Score Start End Superfamily
af_P33026_213_392_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4602 11 246 1.20.1250.20
af_A0A4V0IJT1_312_502_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4591 8 242 1.20.1250.20
af_P41036_268_460_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4566 12 242 1.20.1250.20
af_B7YZU1_345_528_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4538 12 241 1.20.1250.20
af_P33026_213_392_1.20.1250.20 Mainly Alpha;Up-down Bundle;Growth Hormone; Chain: A;;MFS general substrate transporter like domains 0.4514 11 246 1.20.1250.20
ID Description Score Start End GO Terms
AF-A9IPR2-F1-model_v4 Probable membrane transporter protein 0.9357 1 243 GO:0005886
AF-A0A375J5C6-F1-model_v4 Probable membrane transporter protein 0.924 9 243 GO:0005886
AF-A9IPR2-F1-model_v4 Probable membrane transporter protein 0.9211 1 243 GO:0005886
AF-A0A7Z9Y8C2-F1-model_v4 Probable membrane transporter protein 0.9193 8 241 GO:0005886
AF-A0A2T0XE42-F1-model_v4 Probable membrane transporter protein 0.9166 10 244 GO:0005886

Map