F479121
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 751 | 307 | 751 | 64 |
Family's Representative Sequence
| Representative Sequence | 3300031911|Ga0307412_11260357|Ga0307412_112603572 |
| Length | 74 |
| Sequence | VEAARNDRSLMKWTDTQDIAIALVEAHPDKDPKTVNFVDLYKWVLALPEFSDDPKRCGERILEAIQQSWIDEAE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 2 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 4 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 11 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 13 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 37 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 40 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 47 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 48 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 49 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 51 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 52 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 53 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 54 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 55 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 56 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 57 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 58 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 59 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 60 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 75 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300012494 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 | Metagenome | Rhizosphere |
| 85 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 86 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 98 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 159 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 160 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 161 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 162 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 163 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 164 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 165 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 166 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 167 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 168 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 169 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 170 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 171 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 172 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 173 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 174 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 175 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 176 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 177 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 178 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 179 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 180 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 181 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 182 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 183 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 184 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 185 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 186 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 187 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 188 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 189 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 190 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 191 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 192 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 193 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 194 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 195 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 197 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 198 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 199 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 200 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 201 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 202 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 203 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 204 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 205 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 206 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 207 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 208 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 209 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 210 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 211 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 212 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 213 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 214 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 215 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 216 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 217 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 218 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 219 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 220 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 221 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 222 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 223 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 248 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 249 | 3300049520 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought | Metagenome | Rhizosphere |
| 250 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 251 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 252 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 253 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 254 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 255 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 256 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 257 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 258 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 266 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 270 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 271 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 277 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 278 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 279 | 3300049670 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought | Metagenome | Rhizosphere |
| 280 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 281 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 282 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 288 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 289 | 3300049779 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought | Metagenome | Rhizosphere |
| 290 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 304 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 305 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 306 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 307 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 0.13 |
| Rhizosphere | 99.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0065704_10449634 | 3300005289 | Bacteria | 706 |
| 2 | Ga0065707_10110299 | 3300005295 | Bacteria | 2435 |
| 3 | Ga0065707_10160834 | 3300005295 | Bacteria | 1559 |
| 4 | Ga0070690_100000048 | 3300005330 | Bacteria | 57196 |
| 5 | Ga0070690_100346623 | 3300005330 | Bacteria | 1077 |
| 6 | Ga0070690_100369302 | 3300005330 | Bacteria | 1046 |
| 7 | Ga0070690_100855288 | 3300005330 | Bacteria | 709 |
| 8 | Ga0070670_102175077 | 3300005331 | Bacteria | 511 |
| 9 | Ga0070677_10637978 | 3300005333 | Bacteria | 594 |
| 10 | Ga0068869_100003924 | 3300005334 | Bacteria | 9183 |
| 11 | Ga0068869_100864874 | 3300005334 | Bacteria | 781 |
| 12 | Ga0068869_101283501 | 3300005334 | Bacteria | 645 |
| 13 | Ga0068869_101579773 | 3300005334 | Bacteria | 584 |
| 14 | Ga0070666_10070556 | 3300005335 | Bacteria | 2377 |
| 15 | Ga0070680_100002906 | 3300005336 | Bacteria | 12727 |
| 16 | Ga0070680_100057644 | 3300005336 | Bacteria | 3176 |
| 17 | Ga0070680_100144219 | 3300005336 | Bacteria | 1997 |
| 18 | Ga0070680_100521636 | 3300005336 | Bacteria | 1017 |
| 19 | Ga0070680_101675449 | 3300005336 | Bacteria | 551 |
| 20 | Ga0070682_100059435 | 3300005337 | Bacteria | 2415 |
| 21 | Ga0068868_100000169 | 3300005338 | Bacteria | 42949 |
| 22 | Ga0068868_101601021 | 3300005338 | Bacteria | 612 |
| 23 | Ga0070689_100052142 | 3300005340 | Bacteria | 3164 |
| 24 | Ga0070689_100105537 | 3300005340 | Bacteria | 2234 |
| 25 | Ga0070689_100221257 | 3300005340 | Bacteria | 1553 |
| 26 | Ga0070689_100222797 | 3300005340 | Bacteria | 1548 |
| 27 | Ga0070691_10005631 | 3300005341 | Bacteria | 5707 |
| 28 | Ga0070691_10228333 | 3300005341 | Bacteria | 989 |
| 29 | Ga0070691_10264147 | 3300005341 | Bacteria | 928 |
| 30 | Ga0070691_10769561 | 3300005341 | Bacteria | 584 |
| 31 | Ga0070687_100000112 | 3300005343 | Bacteria | 27473 |
| 32 | Ga0070687_100375502 | 3300005343 | Bacteria | 925 |
| 33 | Ga0070687_100765667 | 3300005343 | Bacteria | 681 |
| 34 | Ga0070687_101110797 | 3300005343 | Bacteria | 579 |
| 35 | Ga0070692_10000771 | 3300005345 | Bacteria | 10540 |
| 36 | Ga0070692_10004733 | 3300005345 | Bacteria | 5710 |
| 37 | Ga0070692_10077194 | 3300005345 | Bacteria | 1787 |
| 38 | Ga0070692_10119083 | 3300005345 | Bacteria | 1470 |
| 39 | Ga0070692_10574394 | 3300005345 | Bacteria | 742 |
| 40 | Ga0070692_11407243 | 3300005345 | Bacteria | 504 |
| 41 | Ga0070668_100118907 | 3300005347 | Bacteria | 2110 |
| 42 | Ga0070669_100070052 | 3300005353 | Bacteria | 2592 |
| 43 | Ga0070669_100573438 | 3300005353 | Bacteria | 943 |
| 44 | Ga0070675_100056290 | 3300005354 | Bacteria | 3240 |
| 45 | Ga0070675_100230333 | 3300005354 | Bacteria | 1616 |
| 46 | Ga0070671_100001186 | 3300005355 | Bacteria | 19510 |
| 47 | Ga0070674_100861481 | 3300005356 | Bacteria | 787 |
| 48 | Ga0070688_100129267 | 3300005365 | Unclassified | 1702 |
| 49 | Ga0070688_101754115 | 3300005365 | Bacteria | 509 |
| 50 | Ga0070709_10762205 | 3300005434 | Bacteria | 757 |
| 51 | Ga0070709_11009296 | 3300005434 | Bacteria | 662 |
| 52 | Ga0070714_100185510 | 3300005435 | Bacteria | 1895 |
| 53 | Ga0070714_101906510 | 3300005435 | Bacteria | 580 |
| 54 | Ga0070710_11336412 | 3300005437 | Bacteria | 534 |
| 55 | Ga0070701_10001982 | 3300005438 | Bacteria | 7754 |
| 56 | Ga0070701_10020823 | 3300005438 | Bacteria | 3120 |
| 57 | Ga0070701_11350862 | 3300005438 | Bacteria | 511 |
| 58 | Ga0070705_100000275 | 3300005440 | Bacteria | 31164 |
| 59 | Ga0070705_100005488 | 3300005440 | Bacteria | 6181 |
| 60 | Ga0070705_100090996 | 3300005440 | Bacteria | 1900 |
| 61 | Ga0070705_100195727 | 3300005440 | Bacteria | 1382 |
| 62 | Ga0070705_100563316 | 3300005440 | Bacteria | 876 |
| 63 | Ga0070700_100000718 | 3300005441 | Bacteria | 16353 |
| 64 | Ga0070700_100006936 | 3300005441 | Bacteria | 6083 |
| 65 | Ga0070700_100159819 | 3300005441 | Bacteria | 1550 |
| 66 | Ga0070700_100312331 | 3300005441 | Bacteria | 1152 |
| 67 | Ga0070700_100513280 | 3300005441 | Bacteria | 924 |
| 68 | Ga0070700_100602125 | 3300005441 | Bacteria | 861 |
| 69 | Ga0070700_100907483 | 3300005441 | Bacteria | 718 |
| 70 | Ga0070694_100000608 | 3300005444 | Bacteria | 19748 |
| 71 | Ga0070694_100009317 | 3300005444 | Bacteria | 6028 |
| 72 | Ga0070694_100014517 | 3300005444 | Bacteria | 4932 |
| 73 | Ga0070694_100110866 | 3300005444 | Bacteria | 1954 |
| 74 | Ga0070694_100132063 | 3300005444 | Bacteria | 1805 |
| 75 | Ga0070694_100141175 | 3300005444 | Bacteria | 1750 |
| 76 | Ga0070694_101888735 | 3300005444 | Bacteria | 510 |
| 77 | Ga0070708_101677815 | 3300005445 | Bacteria | 591 |
| 78 | Ga0070708_102242505 | 3300005445 | Bacteria | 504 |
| 79 | Ga0070678_100324300 | 3300005456 | Bacteria | 1316 |
| 80 | Ga0070662_101118929 | 3300005457 | Bacteria | 676 |
| 81 | Ga0070681_10000198 | 3300005458 | Bacteria | 47037 |
| 82 | Ga0070681_10557601 | 3300005458 | Bacteria | 1060 |
| 83 | Ga0070681_11361542 | 3300005458 | Bacteria | 633 |
| 84 | Ga0068867_100000568 | 3300005459 | Bacteria | 24458 |
| 85 | Ga0068867_100023523 | 3300005459 | Bacteria | 4410 |
| 86 | Ga0070706_100167580 | 3300005467 | Bacteria | 2051 |
| 87 | Ga0070707_101001884 | 3300005468 | Unclassified | 801 |
| 88 | Ga0070699_100095806 | 3300005518 | Bacteria | 2599 |
| 89 | Ga0070699_100204649 | 3300005518 | Bacteria | 1756 |
| 90 | Ga0070699_100258097 | 3300005518 | Bacteria | 1558 |
| 91 | Ga0070699_101647209 | 3300005518 | Bacteria | 588 |
| 92 | Ga0070679_100024440 | 3300005530 | Bacteria | 5920 |
| 93 | Ga0070684_100904293 | 3300005535 | Bacteria | 827 |
| 94 | Ga0070684_102311780 | 3300005535 | Bacteria | 507 |
| 95 | Ga0070697_100002931 | 3300005536 | Bacteria | 13126 |
| 96 | Ga0070697_100095073 | 3300005536 | Bacteria | 2470 |
| 97 | Ga0070697_100373071 | 3300005536 | Bacteria | 1235 |
| 98 | Ga0068853_100079777 | 3300005539 | Bacteria | 2863 |
| 99 | Ga0070672_100467010 | 3300005543 | Bacteria | 1088 |
| 100 | Ga0070672_101632546 | 3300005543 | Bacteria | 579 |
| 101 | Ga0070686_100002218 | 3300005544 | Bacteria | 10728 |
| 102 | Ga0070686_100160293 | 3300005544 | Bacteria | 1584 |
| 103 | Ga0070686_100244972 | 3300005544 | Bacteria | 1307 |
| 104 | Ga0070695_100000176 | 3300005545 | Bacteria | 30422 |
| 105 | Ga0070695_100003592 | 3300005545 | Bacteria | 9056 |
| 106 | Ga0070695_100075647 | 3300005545 | Bacteria | 2216 |
| 107 | Ga0070695_100260639 | 3300005545 | Bacteria | 1266 |
| 108 | Ga0070695_100366367 | 3300005545 | Bacteria | 1084 |
| 109 | Ga0070695_100516992 | 3300005545 | Bacteria | 926 |
| 110 | Ga0070695_100995412 | 3300005545 | Bacteria | 682 |
| 111 | Ga0070695_101020545 | 3300005545 | Bacteria | 674 |
| 112 | Ga0070695_101208833 | 3300005545 | Bacteria | 622 |
| 113 | Ga0070696_100000137 | 3300005546 | Bacteria | 39854 |
| 114 | Ga0070696_100001735 | 3300005546 | Bacteria | 14279 |
| 115 | Ga0070696_100067694 | 3300005546 | Bacteria | 2506 |
| 116 | Ga0070696_100259271 | 3300005546 | Bacteria | 1318 |
| 117 | Ga0070696_100408338 | 3300005546 | Bacteria | 1064 |
| 118 | Ga0070696_100557879 | 3300005546 | Bacteria | 918 |
| 119 | Ga0070693_100001113 | 3300005547 | Bacteria | 12062 |
| 120 | Ga0070693_101195606 | 3300005547 | Bacteria | 584 |
| 121 | Ga0070693_101487955 | 3300005547 | Bacteria | 529 |
| 122 | Ga0070704_100000057 | 3300005549 | Bacteria | 36313 |
| 123 | Ga0070704_100046477 | 3300005549 | Bacteria | 3027 |
| 124 | Ga0070704_100110016 | 3300005549 | Bacteria | 2095 |
| 125 | Ga0070704_100500892 | 3300005549 | Bacteria | 1054 |
| 126 | Ga0070704_101859060 | 3300005549 | Bacteria | 558 |
| 127 | Ga0068855_100118320 | 3300005563 | Bacteria | 3034 |
| 128 | Ga0068854_100797180 | 3300005578 | Bacteria | 823 |
| 129 | Ga0068856_100175279 | 3300005614 | Bacteria | 2157 |
| 130 | Ga0068856_100362114 | 3300005614 | Bacteria | 1469 |
| 131 | Ga0070702_100000016 | 3300005615 | Bacteria | 48066 |
| 132 | Ga0070702_100230352 | 3300005615 | Bacteria | 1244 |
| 133 | Ga0070702_100674737 | 3300005615 | Bacteria | 785 |
| 134 | Ga0068859_100011860 | 3300005617 | Bacteria | 8754 |
| 135 | Ga0068859_100028423 | 3300005617 | Bacteria | 5605 |
| 136 | Ga0068859_100520407 | 3300005617 | Bacteria | 1285 |
| 137 | Ga0068859_101151732 | 3300005617 | Bacteria | 854 |
| 138 | Ga0068866_10000914 | 3300005718 | Bacteria | 12952 |
| 139 | Ga0068866_10554953 | 3300005718 | Bacteria | 769 |
| 140 | Ga0068861_100000199 | 3300005719 | Bacteria | 32165 |
| 141 | Ga0068861_100021205 | 3300005719 | Bacteria | 4669 |
| 142 | Ga0068870_10077337 | 3300005840 | Bacteria | 1830 |
| 143 | Ga0068870_10269225 | 3300005840 | Bacteria | 1063 |
| 144 | Ga0068870_11255553 | 3300005840 | Bacteria | 538 |
| 145 | Ga0068863_101860187 | 3300005841 | Bacteria | 612 |
| 146 | Ga0068858_100003393 | 3300005842 | Bacteria | 15847 |
| 147 | Ga0068858_100399398 | 3300005842 | Bacteria | 1321 |
| 148 | Ga0068858_101623321 | 3300005842 | Bacteria | 638 |
| 149 | Ga0068860_100001230 | 3300005843 | Bacteria | 27942 |
| 150 | Ga0068860_100212273 | 3300005843 | Bacteria | 1878 |
| 151 | Ga0068860_100850506 | 3300005843 | Bacteria | 927 |
| 152 | Ga0068862_100010417 | 3300005844 | Bacteria | 7676 |
| 153 | Ga0068862_100032132 | 3300005844 | Bacteria | 4434 |
| 154 | Ga0068862_100306441 | 3300005844 | Bacteria | 1462 |
| 155 | Ga0068862_101573513 | 3300005844 | Bacteria | 664 |
| 156 | Ga0081538_10160025 | 3300005981 | Bacteria | 1002 |
| 157 | Ga0081539_10000842 | 3300005985 | Bacteria | 58746 |
| 158 | Ga0070716_101642595 | 3300006173 | Bacteria | 529 |
| 159 | Ga0097621_100001888 | 3300006237 | Bacteria | 14313 |
| 160 | Ga0097621_101776504 | 3300006237 | Bacteria | 588 |
| 161 | Ga0068871_100000120 | 3300006358 | Bacteria | 49031 |
| 162 | Ga0075428_100025250 | 3300006844 | Bacteria | 6576 |
| 163 | Ga0075428_100251107 | 3300006844 | Bacteria | 1906 |
| 164 | Ga0075428_101137687 | 3300006844 | Bacteria | 824 |
| 165 | Ga0075428_101408710 | 3300006844 | Bacteria | 731 |
| 166 | Ga0075430_100008695 | 3300006846 | Bacteria | 8567 |
| 167 | Ga0075430_100584181 | 3300006846 | Bacteria | 922 |
| 168 | Ga0075430_100899021 | 3300006846 | Bacteria | 729 |
| 169 | Ga0075430_101037516 | 3300006846 | Bacteria | 675 |
| 170 | Ga0075430_101072680 | 3300006846 | Bacteria | 663 |
| 171 | Ga0075430_101228111 | 3300006846 | Bacteria | 617 |
| 172 | Ga0075431_100066842 | 3300006847 | Bacteria | 3711 |
| 173 | Ga0075431_100146517 | 3300006847 | Bacteria | 2433 |
| 174 | Ga0075431_100250762 | 3300006847 | Bacteria | 1798 |
| 175 | Ga0075431_100351111 | 3300006847 | Bacteria | 1483 |
| 176 | Ga0075431_101741357 | 3300006847 | Bacteria | 580 |
| 177 | Ga0075431_101963753 | 3300006847 | Bacteria | 540 |
| 178 | Ga0075433_10042272 | 3300006852 | Bacteria | 3953 |
| 179 | Ga0075433_10336485 | 3300006852 | Bacteria | 1334 |
| 180 | Ga0075434_100000073 | 3300006871 | Bacteria | 52987 |
| 181 | Ga0075434_100119458 | 3300006871 | Bacteria | 2650 |
| 182 | Ga0075434_100451066 | 3300006871 | Bacteria | 1307 |
| 183 | Ga0075434_100485931 | 3300006871 | Bacteria | 1256 |
| 184 | Ga0075434_101355167 | 3300006871 | Bacteria | 722 |
| 185 | Ga0075429_100001130 | 3300006880 | Bacteria | 21515 |
| 186 | Ga0075429_100428394 | 3300006880 | Bacteria | 1159 |
| 187 | Ga0075429_100737243 | 3300006880 | Bacteria | 863 |
| 188 | Ga0075429_101138282 | 3300006880 | Bacteria | 681 |
| 189 | Ga0075429_101804621 | 3300006880 | Bacteria | 530 |
| 190 | Ga0068865_100001461 | 3300006881 | Bacteria | 13771 |
| 191 | Ga0068865_100029927 | 3300006881 | Bacteria | 3617 |
| 192 | Ga0068865_101701000 | 3300006881 | Bacteria | 569 |
| 193 | Ga0075436_100000205 | 3300006914 | Bacteria | 36621 |
| 194 | Ga0075436_100038706 | 3300006914 | Bacteria | 3291 |
| 195 | Ga0075436_100058404 | 3300006914 | Bacteria | 2664 |
| 196 | Ga0075436_100094461 | 3300006914 | Bacteria | 2079 |
| 197 | Ga0075436_100403480 | 3300006914 | Bacteria | 991 |
| 198 | Ga0075436_100558744 | 3300006914 | Bacteria | 841 |
| 199 | Ga0075436_101073376 | 3300006914 | Bacteria | 606 |
| 200 | Ga0097620_100011861 | 3300006931 | Bacteria | 8754 |
| 201 | Ga0097620_100028423 | 3300006931 | Bacteria | 5605 |
| 202 | Ga0097620_100520376 | 3300006931 | Bacteria | 1285 |
| 203 | Ga0097620_101151728 | 3300006931 | Bacteria | 854 |
| 204 | Ga0075435_100006291 | 3300007076 | Bacteria | 8385 |
| 205 | Ga0075435_100140284 | 3300007076 | Bacteria | 2027 |
| 206 | Ga0075435_100223166 | 3300007076 | Bacteria | 1600 |
| 207 | Ga0075435_100239981 | 3300007076 | Bacteria | 1541 |
| 208 | Ga0075435_100809709 | 3300007076 | Bacteria | 816 |
| 209 | Ga0099794_10021997 | 3300007265 | Bacteria | 2903 |
| 210 | Ga0099794_10066967 | 3300007265 | Bacteria | 1753 |
| 211 | Ga0099794_10438859 | 3300007265 | Bacteria | 684 |
| 212 | Ga0105250_10020860 | 3300009092 | Bacteria | 2645 |
| 213 | Ga0111539_10037024 | 3300009094 | Bacteria | 5895 |
| 214 | Ga0111539_10065584 | 3300009094 | Bacteria | 4289 |
| 215 | Ga0111539_10131269 | 3300009094 | Bacteria | 2933 |
| 216 | Ga0111539_10168418 | 3300009094 | Bacteria | 2560 |
| 217 | Ga0111539_10222278 | 3300009094 | Bacteria | 2199 |
| 218 | Ga0111539_10772667 | 3300009094 | Bacteria | 1118 |
| 219 | Ga0111539_11095879 | 3300009094 | Bacteria | 925 |
| 220 | Ga0111539_11334901 | 3300009094 | Bacteria | 832 |
| 221 | Ga0111539_12495474 | 3300009094 | Bacteria | 599 |
| 222 | Ga0105245_10000259 | 3300009098 | Bacteria | 50388 |
| 223 | Ga0105245_11512819 | 3300009098 | Bacteria | 722 |
| 224 | Ga0114129_10002101 | 3300009147 | Bacteria | 27413 |
| 225 | Ga0114129_10373021 | 3300009147 | Bacteria | 1885 |
| 226 | Ga0114129_10405770 | 3300009147 | Bacteria | 1795 |
| 227 | Ga0114129_10495723 | 3300009147 | Unclassified | 1596 |
| 228 | Ga0114129_10864388 | 3300009147 | Bacteria | 1149 |
| 229 | Ga0114129_11760995 | 3300009147 | Bacteria | 754 |
| 230 | Ga0114129_11940992 | 3300009147 | Bacteria | 713 |
| 231 | Ga0114129_11976176 | 3300009147 | Bacteria | 706 |
| 232 | Ga0114129_12027214 | 3300009147 | Bacteria | 695 |
| 233 | Ga0105243_10003095 | 3300009148 | Bacteria | 13686 |
| 234 | Ga0105243_10045531 | 3300009148 | Bacteria | 3448 |
| 235 | Ga0105241_10010209 | 3300009174 | Bacteria | 6897 |
| 236 | Ga0105241_12341199 | 3300009174 | Bacteria | 532 |
| 237 | Ga0105242_10036544 | 3300009176 | Bacteria | 3941 |
| 238 | Ga0105242_12629685 | 3300009176 | Bacteria | 552 |
| 239 | Ga0105242_13254707 | 3300009176 | Bacteria | 505 |
| 240 | Ga0105248_10559731 | 3300009177 | Bacteria | 1290 |
| 241 | Ga0105248_13338330 | 3300009177 | Bacteria | 510 |
| 242 | Ga0105249_10001070 | 3300009553 | Bacteria | 24290 |
| 243 | Ga0105249_10050687 | 3300009553 | Bacteria | 3784 |
| 244 | Ga0105249_10377074 | 3300009553 | Bacteria | 1444 |
| 245 | Ga0105246_11558813 | 3300011119 | Bacteria | 623 |
| 246 | Ga0157341_1018316 | 3300012494 | Bacteria | 669 |
| 247 | Ga0157345_1017302 | 3300012498 | Bacteria | 701 |
| 248 | Ga0157371_10835412 | 3300013102 | Bacteria | 696 |
| 249 | Ga0157369_11800822 | 3300013105 | Bacteria | 622 |
| 250 | Ga0157374_11458235 | 3300013296 | Bacteria | 707 |
| 251 | Ga0157374_12380551 | 3300013296 | Bacteria | 557 |
| 252 | Ga0157378_10000576 | 3300013297 | Bacteria | 34686 |
| 253 | Ga0157378_10012127 | 3300013297 | Bacteria | 7549 |
| 254 | Ga0157378_11059085 | 3300013297 | Bacteria | 847 |
| 255 | Ga0157378_11778107 | 3300013297 | Unclassified | 664 |
| 256 | Ga0163162_10199606 | 3300013306 | Bacteria | 2129 |
| 257 | Ga0163162_10270175 | 3300013306 | Bacteria | 1832 |
| 258 | Ga0157372_10981400 | 3300013307 | Bacteria | 979 |
| 259 | Ga0157372_11908413 | 3300013307 | Bacteria | 683 |
| 260 | Ga0157372_12198757 | 3300013307 | Bacteria | 634 |
| 261 | Ga0157375_10093020 | 3300013308 | Bacteria | 3080 |
| 262 | Ga0157375_10424353 | 3300013308 | Bacteria | 1496 |
| 263 | Ga0157380_10011328 | 3300014326 | Bacteria | 6441 |
| 264 | Ga0157380_10170367 | 3300014326 | Bacteria | 1902 |
| 265 | Ga0157380_12854062 | 3300014326 | Bacteria | 550 |
| 266 | Ga0157377_10194371 | 3300014745 | Bacteria | 1284 |
| 267 | Ga0157376_10003705 | 3300014969 | Bacteria | 10559 |
| 268 | Ga0163161_11485260 | 3300017792 | Bacteria | 594 |
| 269 | Ga0163161_11845188 | 3300017792 | Bacteria | 538 |
| 270 | Ga0213876_10501877 | 3300021384 | Bacteria | 646 |
| 271 | Ga0207697_10385181 | 3300025315 | Bacteria | 623 |
| 272 | Ga0207696_1115335 | 3300025711 | Bacteria | 726 |
| 273 | Ga0207642_10124344 | 3300025899 | Bacteria | 1336 |
| 274 | Ga0207642_10183429 | 3300025899 | Bacteria | 1142 |
| 275 | Ga0207688_10103278 | 3300025901 | Bacteria | 1648 |
| 276 | Ga0207680_10098405 | 3300025903 | Bacteria | 1875 |
| 277 | Ga0207680_10458517 | 3300025903 | Bacteria | 905 |
| 278 | Ga0207699_10611808 | 3300025906 | Bacteria | 794 |
| 279 | Ga0207645_10053737 | 3300025907 | Bacteria | 2574 |
| 280 | Ga0207684_10398182 | 3300025910 | Bacteria | 1184 |
| 281 | Ga0207654_10004685 | 3300025911 | Bacteria | 6919 |
| 282 | Ga0207707_10003333 | 3300025912 | Bacteria | 14259 |
| 283 | Ga0207663_10655419 | 3300025916 | Bacteria | 829 |
| 284 | Ga0207660_10001340 | 3300025917 | Bacteria | 16476 |
| 285 | Ga0207660_10020821 | 3300025917 | Bacteria | 4408 |
| 286 | Ga0207660_10252495 | 3300025917 | Bacteria | 1392 |
| 287 | Ga0207662_10000106 | 3300025918 | Bacteria | 40137 |
| 288 | Ga0207662_10043801 | 3300025918 | Bacteria | 2641 |
| 289 | Ga0207662_10064715 | 3300025918 | Bacteria | 2200 |
| 290 | Ga0207662_10528478 | 3300025918 | Bacteria | 815 |
| 291 | Ga0207652_10007736 | 3300025921 | Bacteria | 8632 |
| 292 | Ga0207652_10030844 | 3300025921 | Bacteria | 4494 |
| 293 | Ga0207646_10881409 | 3300025922 | Bacteria | 794 |
| 294 | Ga0207681_10006318 | 3300025923 | Bacteria | 7273 |
| 295 | Ga0207681_11232805 | 3300025923 | Bacteria | 628 |
| 296 | Ga0207650_10776621 | 3300025925 | Bacteria | 811 |
| 297 | Ga0207659_10062589 | 3300025926 | Bacteria | 2686 |
| 298 | Ga0207659_10089394 | 3300025926 | Bacteria | 2297 |
| 299 | Ga0207687_10004274 | 3300025927 | Bacteria | 9553 |
| 300 | Ga0207664_10065290 | 3300025929 | Bacteria | 2913 |
| 301 | Ga0207644_10000781 | 3300025931 | Bacteria | 20183 |
| 302 | Ga0207644_11839724 | 3300025931 | Bacteria | 506 |
| 303 | Ga0207706_10766185 | 3300025933 | Bacteria | 821 |
| 304 | Ga0207686_10000883 | 3300025934 | Bacteria | 18123 |
| 305 | Ga0207709_10003980 | 3300025935 | Bacteria | 8621 |
| 306 | Ga0207709_10007609 | 3300025935 | Bacteria | 6011 |
| 307 | Ga0207670_10067768 | 3300025936 | Bacteria | 2456 |
| 308 | Ga0207670_10089674 | 3300025936 | Bacteria | 2171 |
| 309 | Ga0207670_10370929 | 3300025936 | Bacteria | 1138 |
| 310 | Ga0207670_10933109 | 3300025936 | Bacteria | 728 |
| 311 | Ga0207669_10003349 | 3300025937 | Bacteria | 6939 |
| 312 | Ga0207669_10811645 | 3300025937 | Bacteria | 776 |
| 313 | Ga0207669_11952863 | 3300025937 | Bacteria | 502 |
| 314 | Ga0207704_10000434 | 3300025938 | Bacteria | 18663 |
| 315 | Ga0207704_10007398 | 3300025938 | Bacteria | 5185 |
| 316 | Ga0207704_11267462 | 3300025938 | Bacteria | 630 |
| 317 | Ga0207691_10119742 | 3300025940 | Bacteria | 2334 |
| 318 | Ga0207711_10801650 | 3300025941 | Bacteria | 877 |
| 319 | Ga0207689_10000376 | 3300025942 | Bacteria | 41990 |
| 320 | Ga0207689_10371845 | 3300025942 | Bacteria | 1189 |
| 321 | Ga0207689_11486601 | 3300025942 | Bacteria | 566 |
| 322 | Ga0207661_11615836 | 3300025944 | Bacteria | 593 |
| 323 | Ga0207667_10134989 | 3300025949 | Bacteria | 2541 |
| 324 | Ga0207651_11016019 | 3300025960 | Bacteria | 741 |
| 325 | Ga0207651_11571522 | 3300025960 | Bacteria | 592 |
| 326 | Ga0207712_10005157 | 3300025961 | Bacteria | 8264 |
| 327 | Ga0207712_10027095 | 3300025961 | Bacteria | 3824 |
| 328 | Ga0207712_10225900 | 3300025961 | Bacteria | 1500 |
| 329 | Ga0207668_10037290 | 3300025972 | Bacteria | 3252 |
| 330 | Ga0207640_10060273 | 3300025981 | Bacteria | 2507 |
| 331 | Ga0207677_10004790 | 3300026023 | Bacteria | 7300 |
| 332 | Ga0207677_10653886 | 3300026023 | Bacteria | 928 |
| 333 | Ga0207703_10001886 | 3300026035 | Bacteria | 18616 |
| 334 | Ga0207703_10064059 | 3300026035 | Bacteria | 3016 |
| 335 | Ga0207703_11826460 | 3300026035 | Bacteria | 584 |
| 336 | Ga0207639_10050531 | 3300026041 | Bacteria | 3158 |
| 337 | Ga0207708_10000239 | 3300026075 | Bacteria | 43452 |
| 338 | Ga0207708_10036334 | 3300026075 | Bacteria | 3750 |
| 339 | Ga0207708_10225905 | 3300026075 | Bacteria | 1502 |
| 340 | Ga0207708_10246018 | 3300026075 | Bacteria | 1440 |
| 341 | Ga0207708_10904513 | 3300026075 | Bacteria | 764 |
| 342 | Ga0207708_11269594 | 3300026075 | Bacteria | 645 |
| 343 | Ga0207708_12019003 | 3300026075 | Bacteria | 505 |
| 344 | Ga0207702_10056135 | 3300026078 | Bacteria | 3342 |
| 345 | Ga0207641_10474389 | 3300026088 | Bacteria | 1212 |
| 346 | Ga0207648_10000369 | 3300026089 | Bacteria | 49386 |
| 347 | Ga0207648_10002987 | 3300026089 | Bacteria | 17871 |
| 348 | Ga0207674_10699519 | 3300026116 | Bacteria | 978 |
| 349 | Ga0207675_100000651 | 3300026118 | Bacteria | 34173 |
| 350 | Ga0207675_100002559 | 3300026118 | Bacteria | 18014 |
| 351 | Ga0209967_1005806 | 3300027364 | Bacteria | 1667 |
| 352 | Ga0209967_1006851 | 3300027364 | Bacteria | 1552 |
| 353 | Ga0209981_1009968 | 3300027378 | Bacteria | 1302 |
| 354 | Ga0209981_1037131 | 3300027378 | Bacteria | 723 |
| 355 | Ga0209996_1042690 | 3300027395 | Bacteria | 676 |
| 356 | Ga0209996_1054216 | 3300027395 | Bacteria | 610 |
| 357 | Ga0210000_1009349 | 3300027462 | Bacteria | 1442 |
| 358 | Ga0210000_1016142 | 3300027462 | Bacteria | 1127 |
| 359 | Ga0209995_1010851 | 3300027471 | Bacteria | 1480 |
| 360 | Ga0209995_1012130 | 3300027471 | Bacteria | 1404 |
| 361 | Ga0209995_1076999 | 3300027471 | Bacteria | 572 |
| 362 | Ga0209968_1007653 | 3300027526 | Bacteria | 1636 |
| 363 | Ga0209968_1032701 | 3300027526 | Bacteria | 873 |
| 364 | Ga0209968_1088572 | 3300027526 | Bacteria | 560 |
| 365 | Ga0209999_1004248 | 3300027543 | Bacteria | 2578 |
| 366 | Ga0209999_1035560 | 3300027543 | Bacteria | 929 |
| 367 | Ga0210002_1032968 | 3300027617 | Bacteria | 865 |
| 368 | Ga0210002_1056094 | 3300027617 | Bacteria | 683 |
| 369 | Ga0209588_1056698 | 3300027671 | Bacteria | 1266 |
| 370 | Ga0209588_1061104 | 3300027671 | Bacteria | 1218 |
| 371 | Ga0209971_1006528 | 3300027682 | Bacteria | 2759 |
| 372 | Ga0209971_1130901 | 3300027682 | Bacteria | 618 |
| 373 | Ga0209966_1014489 | 3300027695 | Bacteria | 1472 |
| 374 | Ga0209966_1023390 | 3300027695 | Bacteria | 1214 |
| 375 | Ga0209974_10011132 | 3300027876 | Bacteria | 3026 |
| 376 | Ga0209974_10163834 | 3300027876 | Bacteria | 808 |
| 377 | Ga0207428_10010784 | 3300027907 | Bacteria | 8147 |
| 378 | Ga0207428_10019374 | 3300027907 | Bacteria | 5803 |
| 379 | Ga0207428_10286072 | 3300027907 | Bacteria | 1223 |
| 380 | Ga0207428_10322863 | 3300027907 | Bacteria | 1140 |
| 381 | Ga0268265_10000781 | 3300028380 | Bacteria | 30469 |
| 382 | Ga0268265_10001333 | 3300028380 | Bacteria | 21108 |
| 383 | Ga0268265_10539870 | 3300028380 | Bacteria | 1105 |
| 384 | Ga0268265_11132614 | 3300028380 | Bacteria | 778 |
| 385 | Ga0268265_11891433 | 3300028380 | Bacteria | 603 |
| 386 | Ga0268265_12491338 | 3300028380 | Bacteria | 523 |
| 387 | Ga0268264_10001450 | 3300028381 | Bacteria | 22200 |
| 388 | Ga0268264_10358617 | 3300028381 | Bacteria | 1390 |
| 389 | Ga0268264_10617457 | 3300028381 | Bacteria | 1070 |
| 390 | Ga0307408_100124562 | 3300031548 | Bacteria | 2002 |
| 391 | Ga0307408_100328650 | 3300031548 | Bacteria | 1290 |
| 392 | Ga0307408_100483338 | 3300031548 | Bacteria | 1081 |
| 393 | Ga0307408_100558767 | 3300031548 | Bacteria | 1011 |
| 394 | Ga0307408_100961731 | 3300031548 | Bacteria | 785 |
| 395 | Ga0307408_101289976 | 3300031548 | Bacteria | 684 |
| 396 | Ga0307408_102097161 | 3300031548 | Bacteria | 545 |
| 397 | Ga0316575_10006460 | 3300031665 | Bacteria | 4219 |
| 398 | Ga0307405_10166892 | 3300031731 | Bacteria | 1566 |
| 399 | Ga0307405_10471668 | 3300031731 | Bacteria | 1000 |
| 400 | Ga0307413_11098741 | 3300031824 | Bacteria | 687 |
| 401 | Ga0307406_10254138 | 3300031901 | Bacteria | 1326 |
| 402 | Ga0307406_11613841 | 3300031901 | Bacteria | 573 |
| 403 | Ga0307407_10210867 | 3300031903 | Bacteria | 1308 |
| 404 | Ga0307407_11689568 | 3300031903 | Bacteria | 504 |
| 405 | Ga0307412_11260357 | 3300031911 | Bacteria | 664 |
| 406 | Ga0307409_100169468 | 3300031995 | Bacteria | 1920 |
| 407 | Ga0307409_102558923 | 3300031995 | Bacteria | 539 |
| 408 | Ga0307416_100143175 | 3300032002 | Bacteria | 2177 |
| 409 | Ga0307416_100191358 | 3300032002 | Bacteria | 1930 |
| 410 | Ga0307416_100323996 | 3300032002 | Bacteria | 1545 |
| 411 | Ga0307416_100689954 | 3300032002 | Bacteria | 1109 |
| 412 | Ga0307416_100778181 | 3300032002 | Bacteria | 1051 |
| 413 | Ga0307411_10151900 | 3300032005 | Bacteria | 1722 |
| 414 | Ga0307411_10434441 | 3300032005 | Bacteria | 1094 |
| 415 | Ga0307411_11042508 | 3300032005 | Bacteria | 734 |
| 416 | Ga0307411_11219492 | 3300032005 | Bacteria | 683 |
| 417 | Ga0307415_100624731 | 3300032126 | Bacteria | 962 |
| 418 | Ga0373930_0043239 | 3300034816 | Bacteria | 966 |
| 419 | Ga0373948_0011088 | 3300034817 | Bacteria | 1586 |
| 420 | Ga0373950_0059922 | 3300034818 | Bacteria | 763 |
| 421 | Ga0373958_0042239 | 3300034819 | Bacteria | 936 |
| 422 | Ga0373959_0005843 | 3300034820 | Bacteria | 2027 |
| 423 | Ga0373938_0003713 | 3300034957 | Bacteria | 2516 |
| 424 | Ga0373938_0256590 | 3300034957 | Bacteria | 502 |
| 425 | Ga0373926_0000230 | 3300035083 | Bacteria | 13313 |
| 426 | Ga0373928_0019093 | 3300035084 | Bacteria | 1427 |
| 427 | Ga0373929_0032794 | 3300035085 | Bacteria | 1119 |
| 428 | Ga0373929_0137915 | 3300035085 | Bacteria | 645 |
| 429 | Ga0373929_0158838 | 3300035085 | Bacteria | 611 |
| 430 | Ga0373940_0027896 | 3300035088 | Bacteria | 1487 |
| 431 | Ga0373940_0097071 | 3300035088 | Bacteria | 890 |
| 432 | Ga0373940_0169713 | 3300035088 | Bacteria | 704 |
| 433 | Ga0373944_0001903 | 3300035089 | Bacteria | 5278 |
| 434 | Ga0373949_0053680 | 3300035090 | Bacteria | 1021 |
| 435 | Ga0373949_0231393 | 3300035090 | Bacteria | 565 |
| 436 | Ga0373952_0010396 | 3300035092 | Bacteria | 1798 |
| 437 | Ga0373952_0069643 | 3300035092 | Bacteria | 877 |
| 438 | Ga0373923_0140381 | 3300035111 | Bacteria | 1092 |
| 439 | Ga0373932_0005565 | 3300035112 | Bacteria | 2963 |
| 440 | Ga0373932_0202463 | 3300035112 | Bacteria | 706 |
| 441 | Ga0373936_0018435 | 3300035113 | Bacteria | 2696 |
| 442 | Ga0373936_0304874 | 3300035113 | Bacteria | 719 |
| 443 | Ga0373939_0126159 | 3300035114 | Bacteria | 908 |
| 444 | Ga0373939_0280336 | 3300035114 | Bacteria | 658 |
| 445 | Ga0373941_0039893 | 3300035115 | Bacteria | 1445 |
| 446 | Ga0373945_0004779 | 3300035116 | Bacteria | 4312 |
| 447 | Ga0373945_0137355 | 3300035116 | Bacteria | 983 |
| 448 | Ga0373960_0023136 | 3300035121 | Bacteria | 1671 |
| 449 | Ga0373943_0020057 | 3300035170 | Bacteria | 3078 |
| 450 | Ga0373943_0176629 | 3300035170 | Bacteria | 1171 |
| 451 | Ga0373946_0005892 | 3300035171 | Bacteria | 4440 |
| 452 | Ga0373942_0013904 | 3300035207 | Bacteria | 1941 |
| 453 | Ga0373942_0078048 | 3300035207 | Bacteria | 978 |
| 454 | Ga0373942_0183233 | 3300035207 | Bacteria | 687 |
| 455 | Ga0373961_0008933 | 3300035241 | Bacteria | 2444 |
| 456 | Ga0373962_0082296 | 3300035242 | Bacteria | 979 |
| 457 | Ga0373962_0124605 | 3300035242 | Bacteria | 825 |
| 458 | Ga0316574_0005586 | 3300035398 | Bacteria | 6719 |
| 459 | Ga0373924_0059852 | 3300035410 | Bacteria | 1592 |
| 460 | Ga0373931_0002129 | 3300035691 | Bacteria | 8722 |
| 461 | Ga0373931_0004456 | 3300035691 | Bacteria | 6400 |
| 462 | Ga0373931_0014988 | 3300035691 | Bacteria | 3798 |
| 463 | Ga0373931_0128940 | 3300035691 | Bacteria | 1454 |
| 464 | Ga0373931_0679438 | 3300035691 | Bacteria | 678 |
| 465 | Ga0373935_0010842 | 3300035692 | Bacteria | 5474 |
| 466 | Ga0373935_0094772 | 3300035692 | Bacteria | 1959 |
| 467 | Ga0373927_0023238 | 3300035695 | Bacteria | 4061 |
| 468 | Ga0373927_0136658 | 3300035695 | Bacteria | 1602 |
| 469 | Ga0373927_0445904 | 3300035695 | Bacteria | 855 |
| 470 | Ga0373947_0036854 | 3300035725 | Bacteria | 2900 |
| 471 | Ga0373947_0046108 | 3300035725 | Bacteria | 2609 |
| 472 | Ga0373925_0114896 | 3300037068 | Bacteria | 2083 |
| 473 | Ga0373925_0212145 | 3300037068 | Bacteria | 1542 |
| 474 | Ga0395905_1257181 | 3300037471 | Bacteria | 644 |
| 475 | Ga0436365_0682788 | 3300039437 | Bacteria | 646 |
| 476 | Ga0439436_0135206 | 3300041404 | Bacteria | 692 |
| 477 | Ga0439439_0021515 | 3300041406 | Bacteria | 1608 |
| 478 | Ga0439461_0002899 | 3300041410 | Bacteria | 2780 |
| 479 | Ga0451839_0172504 | 3300041496 | Bacteria | 680 |
| 480 | Ga0451839_0709667 | 3300041496 | Bacteria | 595 |
| 481 | Ga0451849_1571619 | 3300041505 | Bacteria | 590 |
| 482 | Ga0439441_000488 | 3300042001 | Bacteria | 4310 |
| 483 | Ga0439441_045240 | 3300042001 | Bacteria | 893 |
| 484 | Ga0439443_024153 | 3300042003 | Bacteria | 973 |
| 485 | Ga0439443_109362 | 3300042003 | Bacteria | 535 |
| 486 | Ga0439451_031250 | 3300042009 | Bacteria | 1070 |
| 487 | Ga0439454_054397 | 3300042011 | Bacteria | 683 |
| 488 | Ga0439456_159810 | 3300042013 | Bacteria | 527 |
| 489 | Ga0439462_0012540 | 3300042015 | Bacteria | 2166 |
| 490 | Ga0439462_0047167 | 3300042015 | Bacteria | 1155 |
| 491 | Ga0450923_114106 | 3300042125 | Bacteria | 633 |
| 492 | Ga0439446_0099969 | 3300042156 | Bacteria | 916 |
| 493 | Ga0439446_0106820 | 3300042156 | Bacteria | 890 |
| 494 | Ga0439434_0000076 | 3300042435 | Bacteria | 24744 |
| 495 | Ga0439434_0103290 | 3300042435 | Bacteria | 919 |
| 496 | Ga0439434_0288979 | 3300042435 | Bacteria | 565 |
| 497 | Ga0439435_0001056 | 3300042436 | Bacteria | 4863 |
| 498 | Ga0439435_0098919 | 3300042436 | Bacteria | 894 |
| 499 | Ga0439435_0234829 | 3300042436 | Bacteria | 613 |
| 500 | Ga0439444_0110830 | 3300042437 | Bacteria | 631 |
| 501 | Ga0439460_0012019 | 3300042461 | Bacteria | 2239 |
| 502 | Ga0439460_0040964 | 3300042461 | Bacteria | 1359 |
| 503 | Ga0439460_0333123 | 3300042461 | Bacteria | 534 |
| 504 | Ga0451577_0015044 | 3300042876 | Bacteria | 7198 |
| 505 | Ga0466964_0754953 | 3300044706 | Bacteria | 546 |
| 506 | Ga0466971_0284783 | 3300044719 | Bacteria | 791 |
| 507 | Ga0466960_0133029 | 3300044901 | Bacteria | 1315 |
| 508 | Ga0451576_0006734 | 3300045051 | Bacteria | 13997 |
| 509 | Ga0451576_0033552 | 3300045051 | Bacteria | 5456 |
| 510 | Ga0451576_0090352 | 3300045051 | Bacteria | 3185 |
| 511 | Ga0451576_1015913 | 3300045051 | Bacteria | 869 |
| 512 | Ga0451576_1282757 | 3300045051 | Bacteria | 764 |
| 513 | Ga0451576_1310889 | 3300045051 | Bacteria | 755 |
| 514 | Ga0451576_1717735 | 3300045051 | Bacteria | 650 |
| 515 | Ga0466967_0113879 | 3300045976 | Bacteria | 2489 |
| 516 | Ga0495603_0005705 | 3300046455 | Bacteria | 7441 |
| 517 | Ga0495580_0023847 | 3300046472 | Bacteria | 4486 |
| 518 | Ga0495582_0034547 | 3300046473 | Bacteria | 2779 |
| 519 | Ga0495639_0005524 | 3300046475 | Bacteria | 5442 |
| 520 | Ga0495584_0291568 | 3300046491 | Bacteria | 829 |
| 521 | Ga0495630_0646802 | 3300046517 | Bacteria | 810 |
| 522 | Ga0495666_0013837 | 3300046526 | Bacteria | 4023 |
| 523 | Ga0495642_0449817 | 3300046528 | Bacteria | 569 |
| 524 | Ga0495586_0484857 | 3300046535 | Bacteria | 713 |
| 525 | Ga0495598_0052961 | 3300046537 | Bacteria | 1228 |
| 526 | Ga0495598_0164097 | 3300046537 | Bacteria | 783 |
| 527 | Ga0495621_0111561 | 3300046539 | Bacteria | 1049 |
| 528 | Ga0495621_0123251 | 3300046539 | Bacteria | 1003 |
| 529 | Ga0495622_0120892 | 3300046557 | Bacteria | 1196 |
| 530 | Ga0495656_0127289 | 3300046615 | Bacteria | 1209 |
| 531 | Ga0495659_0011438 | 3300046664 | Bacteria | 2858 |
| 532 | Ga0495659_0227357 | 3300046664 | Bacteria | 772 |
| 533 | Ga0495588_0044030 | 3300046674 | Bacteria | 2285 |
| 534 | Ga0495647_0001395 | 3300046681 | Bacteria | 7454 |
| 535 | Ga0495658_0003610 | 3300046683 | Bacteria | 7661 |
| 536 | Ga0495669_0110952 | 3300046684 | Bacteria | 1280 |
| 537 | Ga0495636_0421976 | 3300047318 | Bacteria | 638 |
| 538 | Ga0495676_0011940 | 3300047321 | Bacteria | 7838 |
| 539 | Ga0495677_0374455 | 3300047445 | Bacteria | 563 |
| 540 | Ga0496106_0159383 | 3300048909 | Bacteria | 1784 |
| 541 | Ga0501292_081566 | 3300049515 | Bacteria | 616 |
| 542 | Ga0501297_069010 | 3300049520 | Bacteria | 555 |
| 543 | Ga0501298_040277 | 3300049521 | Bacteria | 946 |
| 544 | Ga0501298_048523 | 3300049521 | Bacteria | 876 |
| 545 | Ga0501298_127085 | 3300049521 | Bacteria | 605 |
| 546 | Ga0501298_143533 | 3300049521 | Bacteria | 579 |
| 547 | Ga0501298_171583 | 3300049521 | Bacteria | 540 |
| 548 | Ga0501299_084854 | 3300049522 | Bacteria | 710 |
| 549 | Ga0501299_099549 | 3300049522 | Bacteria | 673 |
| 550 | Ga0501299_113300 | 3300049522 | Bacteria | 644 |
| 551 | Ga0501031_0059330 | 3300049568 | Bacteria | 2493 |
| 552 | Ga0501031_0546700 | 3300049568 | Bacteria | 746 |
| 553 | Ga0501031_0904167 | 3300049568 | Bacteria | 565 |
| 554 | Ga0501031_0937643 | 3300049568 | Bacteria | 554 |
| 555 | Ga0501032_0086786 | 3300049569 | Bacteria | 2079 |
| 556 | Ga0501032_0435519 | 3300049569 | Bacteria | 841 |
| 557 | Ga0501032_0567680 | 3300049569 | Bacteria | 723 |
| 558 | Ga0501033_0011373 | 3300049570 | Bacteria | 6810 |
| 559 | Ga0501033_0264915 | 3300049570 | Bacteria | 1216 |
| 560 | Ga0501033_0280197 | 3300049570 | Bacteria | 1177 |
| 561 | Ga0501036_0001921 | 3300049572 | Bacteria | 16137 |
| 562 | Ga0501036_0085385 | 3300049572 | Bacteria | 2668 |
| 563 | Ga0501036_0199103 | 3300049572 | Bacteria | 1685 |
| 564 | Ga0501036_0953458 | 3300049572 | Bacteria | 703 |
| 565 | Ga0501037_0013201 | 3300049573 | Bacteria | 6089 |
| 566 | Ga0501037_0523020 | 3300049573 | Bacteria | 803 |
| 567 | Ga0501037_0916323 | 3300049573 | Bacteria | 574 |
| 568 | Ga0501038_0004982 | 3300049574 | Bacteria | 12341 |
| 569 | Ga0501038_0960279 | 3300049574 | Bacteria | 629 |
| 570 | Ga0501039_0000477 | 3300049575 | Bacteria | 28990 |
| 571 | Ga0501039_0024671 | 3300049575 | Bacteria | 4619 |
| 572 | Ga0501039_0027089 | 3300049575 | Bacteria | 4408 |
| 573 | Ga0501039_0033414 | 3300049575 | Bacteria | 3966 |
| 574 | Ga0501039_1301681 | 3300049575 | Bacteria | 561 |
| 575 | Ga0501039_1424419 | 3300049575 | Bacteria | 533 |
| 576 | Ga0501040_0000052 | 3300049576 | Bacteria | 54195 |
| 577 | Ga0501040_0005360 | 3300049576 | Bacteria | 8294 |
| 578 | Ga0501040_0113809 | 3300049576 | Bacteria | 1893 |
| 579 | Ga0501040_0205892 | 3300049576 | Bacteria | 1398 |
| 580 | Ga0501040_0531502 | 3300049576 | Unclassified | 848 |
| 581 | Ga0501041_0000038 | 3300049577 | Bacteria | 44285 |
| 582 | Ga0501041_0015649 | 3300049577 | Bacteria | 4506 |
| 583 | Ga0501041_0015993 | 3300049577 | Bacteria | 4459 |
| 584 | Ga0501041_0240071 | 3300049577 | Bacteria | 1139 |
| 585 | Ga0501041_0586744 | 3300049577 | Bacteria | 711 |
| 586 | Ga0501041_0981879 | 3300049577 | Bacteria | 543 |
| 587 | Ga0501042_0000048 | 3300049578 | Bacteria | 40877 |
| 588 | Ga0501042_0111133 | 3300049578 | Bacteria | 1973 |
| 589 | Ga0501042_0338390 | 3300049578 | Bacteria | 1088 |
| 590 | Ga0501042_0461190 | 3300049578 | Bacteria | 922 |
| 591 | Ga0501042_0518961 | 3300049578 | Bacteria | 865 |
| 592 | Ga0501042_0646354 | 3300049578 | Bacteria | 769 |
| 593 | Ga0501042_0750397 | 3300049578 | Bacteria | 710 |
| 594 | Ga0501043_0043047 | 3300049579 | Bacteria | 3549 |
| 595 | Ga0501043_0630625 | 3300049579 | Bacteria | 789 |
| 596 | Ga0501046_0000271 | 3300049580 | Bacteria | 52841 |
| 597 | Ga0501046_0012984 | 3300049580 | Bacteria | 7072 |
| 598 | Ga0501046_0773226 | 3300049580 | Bacteria | 674 |
| 599 | Ga0501046_1083890 | 3300049580 | Bacteria | 554 |
| 600 | Ga0501047_0136139 | 3300049581 | Bacteria | 2337 |
| 601 | Ga0501048_0000378 | 3300049582 | Bacteria | 30854 |
| 602 | Ga0501048_0010966 | 3300049582 | Bacteria | 6761 |
| 603 | Ga0501048_0525886 | 3300049582 | Bacteria | 848 |
| 604 | Ga0501068_0014809 | 3300049584 | Bacteria | 4464 |
| 605 | Ga0501068_0067058 | 3300049584 | Bacteria | 2186 |
| 606 | Ga0501068_0898316 | 3300049584 | Bacteria | 583 |
| 607 | Ga0501068_0939433 | 3300049584 | Bacteria | 570 |
| 608 | Ga0501069_0123294 | 3300049585 | Bacteria | 1481 |
| 609 | Ga0501069_0408501 | 3300049585 | Bacteria | 804 |
| 610 | Ga0501069_0454186 | 3300049585 | Bacteria | 762 |
| 611 | Ga0501069_0541180 | 3300049585 | Bacteria | 696 |
| 612 | Ga0501070_0159893 | 3300049586 | Bacteria | 1857 |
| 613 | Ga0501070_1376099 | 3300049586 | Bacteria | 537 |
| 614 | Ga0501071_0007914 | 3300049587 | Bacteria | 7009 |
| 615 | Ga0501071_0027911 | 3300049587 | Bacteria | 3973 |
| 616 | Ga0501071_0123447 | 3300049587 | Bacteria | 1920 |
| 617 | Ga0501071_0128234 | 3300049587 | Bacteria | 1884 |
| 618 | Ga0501071_1164333 | 3300049587 | Bacteria | 596 |
| 619 | Ga0501071_1350089 | 3300049587 | Bacteria | 551 |
| 620 | Ga0501072_0008011 | 3300049588 | Bacteria | 8018 |
| 621 | Ga0501072_0009822 | 3300049588 | Bacteria | 7274 |
| 622 | Ga0501072_0098053 | 3300049588 | Bacteria | 2329 |
| 623 | Ga0501072_0214228 | 3300049588 | Bacteria | 1535 |
| 624 | Ga0501072_0480438 | 3300049588 | Bacteria | 983 |
| 625 | Ga0501072_0505954 | 3300049588 | Bacteria | 955 |
| 626 | Ga0501072_0701731 | 3300049588 | Bacteria | 795 |
| 627 | Ga0501072_0778182 | 3300049588 | Bacteria | 750 |
| 628 | Ga0501073_0087209 | 3300049589 | Bacteria | 2171 |
| 629 | Ga0501073_0204289 | 3300049589 | Bacteria | 1366 |
| 630 | Ga0501074_0007335 | 3300049590 | Bacteria | 7972 |
| 631 | Ga0501074_0066914 | 3300049590 | Bacteria | 2584 |
| 632 | Ga0501074_0156342 | 3300049590 | Bacteria | 1629 |
| 633 | Ga0501074_0472188 | 3300049590 | Bacteria | 889 |
| 634 | Ga0501075_0000180 | 3300049591 | Bacteria | 32596 |
| 635 | Ga0501075_0027409 | 3300049591 | Bacteria | 4199 |
| 636 | Ga0501075_0059419 | 3300049591 | Bacteria | 2880 |
| 637 | Ga0501075_0076969 | 3300049591 | Bacteria | 2524 |
| 638 | Ga0501075_0148471 | 3300049591 | Bacteria | 1787 |
| 639 | Ga0501076_0000290 | 3300049592 | Bacteria | 31327 |
| 640 | Ga0501076_0000319 | 3300049592 | Bacteria | 29725 |
| 641 | Ga0501076_0103371 | 3300049592 | Bacteria | 2298 |
| 642 | Ga0501076_0195588 | 3300049592 | Bacteria | 1651 |
| 643 | Ga0501076_1359840 | 3300049592 | Bacteria | 584 |
| 644 | Ga0501077_0000222 | 3300049593 | Bacteria | 33397 |
| 645 | Ga0501077_0104746 | 3300049593 | Bacteria | 1793 |
| 646 | Ga0501077_0773240 | 3300049593 | Bacteria | 617 |
| 647 | Ga0501216_009907 | 3300049660 | Bacteria | 1526 |
| 648 | Ga0501230_090827 | 3300049667 | Bacteria | 649 |
| 649 | Ga0501235_189635 | 3300049669 | Bacteria | 552 |
| 650 | Ga0501236_060806 | 3300049670 | Bacteria | 670 |
| 651 | Ga0501243_140459 | 3300049675 | Bacteria | 510 |
| 652 | Ga0501257_249228 | 3300049686 | Bacteria | 526 |
| 653 | Ga0501225_0046507 | 3300049705 | Bacteria | 1203 |
| 654 | Ga0501079_0000061 | 3300049741 | Bacteria | 48925 |
| 655 | Ga0501079_0047873 | 3300049741 | Bacteria | 3299 |
| 656 | Ga0501079_0175760 | 3300049741 | Bacteria | 1670 |
| 657 | Ga0501079_0929415 | 3300049741 | Bacteria | 685 |
| 658 | Ga0501079_1020168 | 3300049741 | Bacteria | 652 |
| 659 | Ga0501079_1130720 | 3300049741 | Bacteria | 617 |
| 660 | Ga0501080_0007892 | 3300049742 | Bacteria | 9637 |
| 661 | Ga0501080_0041403 | 3300049742 | Bacteria | 4293 |
| 662 | Ga0501080_0311821 | 3300049742 | Bacteria | 1426 |
| 663 | Ga0501080_0341293 | 3300049742 | Bacteria | 1353 |
| 664 | Ga0501080_0940338 | 3300049742 | Bacteria | 752 |
| 665 | Ga0501081_0000110 | 3300049743 | Bacteria | 34989 |
| 666 | Ga0501081_0005740 | 3300049743 | Bacteria | 8036 |
| 667 | Ga0501081_0300918 | 3300049743 | Bacteria | 1176 |
| 668 | Ga0501081_0703957 | 3300049743 | Bacteria | 758 |
| 669 | Ga0501083_0081556 | 3300049744 | Bacteria | 2144 |
| 670 | Ga0501083_0112833 | 3300049744 | Bacteria | 1786 |
| 671 | Ga0501083_0743650 | 3300049744 | Unclassified | 638 |
| 672 | Ga0501270_067378 | 3300049767 | Bacteria | 685 |
| 673 | Ga0501273_093281 | 3300049770 | Bacteria | 514 |
| 674 | Ga0501283_029251 | 3300049779 | Bacteria | 917 |
| 675 | Ga0501035_0021364 | 3300049822 | Bacteria | 5950 |
| 676 | Ga0501044_0046768 | 3300049823 | Bacteria | 4479 |
| 677 | Ga0501044_0612868 | 3300049823 | Bacteria | 981 |
| 678 | Ga0501045_0000038 | 3300049824 | Bacteria | 55579 |
| 679 | Ga0501045_0010295 | 3300049824 | Bacteria | 6552 |
| 680 | nmdc:mga05p37_1111789_c1 | 3300050507 | Bacteria | 826 |
| 681 | nmdc:mga05p37_1549627_c1 | 3300050507 | Bacteria | 656 |
| 682 | nmdc:mga05p37_1991478_c1 | 3300050507 | Bacteria | 550 |
| 683 | nmdc:mga05p37_2835_c1 | 3300050507 | Bacteria | 20152 |
| 684 | nmdc:mga05p37_628868_c1 | 3300050507 | Bacteria | 1206 |
| 685 | nmdc:mga05p37_869553_c1 | 3300050507 | Bacteria | 976 |
| 686 | nmdc:mga09592_107109_c1 | 3300050508 | Bacteria | 2398 |
| 687 | nmdc:mga09592_1506259_c1 | 3300050508 | Bacteria | 547 |
| 688 | nmdc:mga09592_15465_c1 | 3300050508 | Bacteria | 6236 |
| 689 | nmdc:mga09592_225263_c1 | 3300050508 | Bacteria | 1625 |
| 690 | nmdc:mga0qj67_1084972_c1 | 3300050509 | Bacteria | 626 |
| 691 | nmdc:mga0qj67_131916_c1 | 3300050509 | Bacteria | 2024 |
| 692 | nmdc:mga0qj67_169646_c1 | 3300050509 | Bacteria | 1772 |
| 693 | nmdc:mga0qj67_17987_c1 | 3300050509 | Bacteria | 5382 |
| 694 | nmdc:mga0qj67_33460_c1 | 3300050509 | Bacteria | 4011 |
| 695 | nmdc:mga0qj67_989403_c1 | 3300050509 | Bacteria | 660 |
| 696 | nmdc:mga06r32_1275779_c1 | 3300050510 | Bacteria | 679 |
| 697 | nmdc:mga06r32_1334071_c1 | 3300050510 | Bacteria | 661 |
| 698 | nmdc:mga06r32_2009298_c1 | 3300050510 | Bacteria | 512 |
| 699 | nmdc:mga06r32_213064_c1 | 3300050510 | Bacteria | 1920 |
| 700 | nmdc:mga06r32_344765_c1 | 3300050510 | Bacteria | 1474 |
| 701 | nmdc:mga06r32_41056_c1 | 3300050510 | Bacteria | 4394 |
| 702 | nmdc:mga06r32_434960_c1 | 3300050510 | Bacteria | 1293 |
| 703 | nmdc:mga08y16_131646_c1 | 3300050511 | Bacteria | 2601 |
| 704 | nmdc:mga08y16_1413623_c1 | 3300050511 | Bacteria | 659 |
| 705 | nmdc:mga08y16_188039_c1 | 3300050511 | Bacteria | 2143 |
| 706 | nmdc:mga08y16_48362_c1 | 3300050511 | Bacteria | 4452 |
| 707 | nmdc:mga08y16_552806_c1 | 3300050511 | Bacteria | 1165 |
| 708 | nmdc:mga08y16_599224_c1 | 3300050511 | Bacteria | 1111 |
| 709 | nmdc:mga08y16_63695_c1 | 3300050511 | Bacteria | 3851 |
| 710 | nmdc:mga0n895_1567869_c1 | 3300050512 | Bacteria | 624 |
| 711 | nmdc:mga0n895_1888319_c1 | 3300050512 | Bacteria | 556 |
| 712 | nmdc:mga0n895_2006044_c1 | 3300050512 | Bacteria | 536 |
| 713 | nmdc:mga0n895_649792_c1 | 3300050512 | Bacteria | 1054 |
| 714 | nmdc:mga0rr50_1112541_c1 | 3300050513 | Bacteria | 672 |
| 715 | nmdc:mga0rr50_132437_c1 | 3300050513 | Bacteria | 1998 |
| 716 | nmdc:mga0rr50_19252_c1 | 3300050513 | Bacteria | 4603 |
| 717 | nmdc:mga0rr50_346080_c1 | 3300050513 | Bacteria | 1249 |
| 718 | nmdc:mga0rr50_573443_c1 | 3300050513 | Bacteria | 961 |
| 719 | nmdc:mga08x19_1210957_c1 | 3300050514 | Bacteria | 535 |
| 720 | nmdc:mga08x19_1858_c1 | 3300050514 | Bacteria | 12938 |
| 721 | nmdc:mga08x19_328372_c1 | 3300050514 | Bacteria | 1065 |
| 722 | nmdc:mga08x19_40646_c1 | 3300050514 | Bacteria | 2960 |
| 723 | nmdc:mga08x19_530202_c1 | 3300050514 | Bacteria | 832 |
| 724 | nmdc:mga08x19_74217_c1 | 3300050514 | Bacteria | 2222 |
| 725 | nmdc:mga08x19_908167_c1 | 3300050514 | Bacteria | 626 |
| 726 | nmdc:mga08x19_91610_c1 | 3300050514 | Bacteria | 2007 |
| 727 | nmdc:mga08x19_98427_c1 | 3300050514 | Bacteria | 1938 |
| 728 | nmdc:mga0a205_1345393_c1 | 3300050515 | Bacteria | 562 |
| 729 | nmdc:mga0a205_18247_c1 | 3300050515 | Bacteria | 6592 |
| 730 | nmdc:mga0a205_34658_c1 | 3300050515 | Bacteria | 4844 |
| 731 | nmdc:mga0a205_357921_c1 | 3300050515 | Bacteria | 1326 |
| 732 | nmdc:mga0a205_590292_c1 | 3300050515 | Bacteria | 964 |
| 733 | Ga0501084_0005924 | 3300054114 | Bacteria | 10067 |
| 734 | Ga0501084_0073589 | 3300054114 | Bacteria | 2861 |
| 735 | Ga0501084_1073356 | 3300054114 | Bacteria | 676 |
| 736 | Ga0501084_1465999 | 3300054114 | Bacteria | 571 |
| 737 | Ga0590071_023052 | 3300059421 | Bacteria | 1470 |
| 738 | Ga0590074_087158 | 3300059423 | Bacteria | 600 |
| 739 | Ga0590077_063350 | 3300059426 | Bacteria | 840 |
| 740 | Ga0590077_082449 | 3300059426 | Bacteria | 741 |
| 741 | Ga0590077_096320 | 3300059426 | Bacteria | 689 |
| 742 | Ga0590077_146073 | 3300059426 | Bacteria | 565 |
| 743 | Ga0501082_0000430 | 3300060353 | Bacteria | 37227 |
| 744 | Ga0501082_0014186 | 3300060353 | Bacteria | 6858 |
| 745 | Ga0501082_0097046 | 3300060353 | Bacteria | 2548 |
| 746 | Ga0501082_0827566 | 3300060353 | Bacteria | 810 |
| 747 | Ga0501082_1607983 | 3300060353 | Bacteria | 567 |
| 748 | Ga0530510_0000186 | 3300061734 | Bacteria | 37940 |
| 749 | Ga0530510_0001727 | 3300061734 | Bacteria | 14851 |
| 750 | Ga0530510_0136650 | 3300061734 | Bacteria | 1805 |
| 751 | Ga0530510_0865813 | 3300061734 | Bacteria | 690 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005355 | Ga0070671_100001186 | Ga0070671_10000118613 | 63 |
| 2 | 3300006871 | Ga0075434_100119458 | Ga0075434_1001194583 | 63 |
| 3 | 3300013297 | Ga0157378_10012127 | Ga0157378_100121277 | 63 |
| 4 | 3300025903 | Ga0207680_10098405 | Ga0207680_100984053 | 63 |
| 5 | 3300025931 | Ga0207644_10000781 | Ga0207644_100007815 | 63 |
| 6 | 3300025937 | Ga0207669_11952863 | Ga0207669_119528632 | 63 |
| 7 | 3300005289 | Ga0065704_10449634 | Ga0065704_104496342 | 64 |
| 8 | 3300005295 | Ga0065707_10110299 | Ga0065707_101102993 | 64 |
| 9 | 3300005295 | Ga0065707_10160834 | Ga0065707_101608342 | 64 |
| 10 | 3300005330 | Ga0070690_100000048 | Ga0070690_10000004819 | 64 |
| 11 | 3300005330 | Ga0070690_100346623 | Ga0070690_1003466233 | 64 |
| 12 | 3300005330 | Ga0070690_100369302 | Ga0070690_1003693023 | 64 |
| 13 | 3300005330 | Ga0070690_100855288 | Ga0070690_1008552882 | 64 |
| 14 | 3300005331 | Ga0070670_102175077 | Ga0070670_1021750772 | 64 |
| 15 | 3300005333 | Ga0070677_10637978 | Ga0070677_106379782 | 64 |
| 16 | 3300005334 | Ga0068869_100003924 | Ga0068869_1000039243 | 64 |
| 17 | 3300005334 | Ga0068869_100864874 | Ga0068869_1008648742 | 64 |
| 18 | 3300005334 | Ga0068869_101283501 | Ga0068869_1012835012 | 64 |
| 19 | 3300005334 | Ga0068869_101579773 | Ga0068869_1015797732 | 64 |
| 20 | 3300005335 | Ga0070666_10070556 | Ga0070666_100705563 | 64 |
| 21 | 3300005336 | Ga0070680_100002906 | Ga0070680_10000290610 | 64 |
| 22 | 3300005336 | Ga0070680_100057644 | Ga0070680_1000576443 | 64 |
| 23 | 3300005336 | Ga0070680_100144219 | Ga0070680_1001442193 | 64 |
| 24 | 3300005336 | Ga0070680_100521636 | Ga0070680_1005216364 | 64 |
| 25 | 3300005336 | Ga0070680_101675449 | Ga0070680_1016754491 | 64 |
| 26 | 3300005337 | Ga0070682_100059435 | Ga0070682_1000594354 | 64 |
| 27 | 3300005338 | Ga0068868_100000169 | Ga0068868_10000016931 | 64 |
| 28 | 3300005338 | Ga0068868_101601021 | Ga0068868_1016010212 | 64 |
| 29 | 3300005340 | Ga0070689_100052142 | Ga0070689_1000521426 | 64 |
| 30 | 3300005340 | Ga0070689_100105537 | Ga0070689_1001055373 | 64 |
| 31 | 3300005340 | Ga0070689_100221257 | Ga0070689_1002212572 | 64 |
| 32 | 3300005340 | Ga0070689_100222797 | Ga0070689_1002227973 | 64 |
| 33 | 3300005341 | Ga0070691_10005631 | Ga0070691_100056317 | 64 |
| 34 | 3300005341 | Ga0070691_10228333 | Ga0070691_102283331 | 64 |
| 35 | 3300005341 | Ga0070691_10264147 | Ga0070691_102641472 | 64 |
| 36 | 3300005341 | Ga0070691_10769561 | Ga0070691_107695612 | 64 |
| 37 | 3300005343 | Ga0070687_100000112 | Ga0070687_1000001128 | 64 |
| 38 | 3300005343 | Ga0070687_100375502 | Ga0070687_1003755022 | 64 |
| 39 | 3300005343 | Ga0070687_100765667 | Ga0070687_1007656672 | 64 |
| 40 | 3300005343 | Ga0070687_101110797 | Ga0070687_1011107973 | 64 |
| 41 | 3300005345 | Ga0070692_10000771 | Ga0070692_1000077116 | 64 |
| 42 | 3300005345 | Ga0070692_10004733 | Ga0070692_100047334 | 64 |
| 43 | 3300005345 | Ga0070692_10077194 | Ga0070692_100771943 | 64 |
| 44 | 3300005345 | Ga0070692_10119083 | Ga0070692_101190831 | 64 |
| 45 | 3300005345 | Ga0070692_10574394 | Ga0070692_105743942 | 64 |
| 46 | 3300005345 | Ga0070692_11407243 | Ga0070692_114072431 | 64 |
| 47 | 3300005347 | Ga0070668_100118907 | Ga0070668_1001189072 | 64 |
| 48 | 3300005353 | Ga0070669_100070052 | Ga0070669_1000700523 | 64 |
| 49 | 3300005353 | Ga0070669_100573438 | Ga0070669_1005734381 | 64 |
| 50 | 3300005354 | Ga0070675_100056290 | Ga0070675_1000562903 | 64 |
| 51 | 3300005354 | Ga0070675_100230333 | Ga0070675_1002303334 | 64 |
| 52 | 3300005356 | Ga0070674_100861481 | Ga0070674_1008614811 | 64 |
| 53 | 3300005365 | Ga0070688_100129267 | Ga0070688_1001292673 | 64 |
| 54 | 3300005365 | Ga0070688_101754115 | Ga0070688_1017541152 | 64 |
| 55 | 3300005434 | Ga0070709_10762205 | Ga0070709_107622052 | 64 |
| 56 | 3300005434 | Ga0070709_11009296 | Ga0070709_110092962 | 64 |
| 57 | 3300005435 | Ga0070714_100185510 | Ga0070714_1001855103 | 64 |
| 58 | 3300005435 | Ga0070714_101906510 | Ga0070714_1019065102 | 64 |
| 59 | 3300005437 | Ga0070710_11336412 | Ga0070710_113364121 | 64 |
| 60 | 3300005438 | Ga0070701_10001982 | Ga0070701_100019823 | 64 |
| 61 | 3300005438 | Ga0070701_10020823 | Ga0070701_100208233 | 64 |
| 62 | 3300005438 | Ga0070701_11350862 | Ga0070701_113508621 | 64 |
| 63 | 3300005440 | Ga0070705_100000275 | Ga0070705_1000002753 | 64 |
| 64 | 3300005440 | Ga0070705_100005488 | Ga0070705_1000054883 | 64 |
| 65 | 3300005440 | Ga0070705_100090996 | Ga0070705_1000909963 | 64 |
| 66 | 3300005440 | Ga0070705_100195727 | Ga0070705_1001957273 | 64 |
| 67 | 3300005440 | Ga0070705_100563316 | Ga0070705_1005633162 | 64 |
| 68 | 3300005441 | Ga0070700_100000718 | Ga0070700_10000071819 | 64 |
| 69 | 3300005441 | Ga0070700_100006936 | Ga0070700_1000069363 | 64 |
| 70 | 3300005441 | Ga0070700_100159819 | Ga0070700_1001598194 | 64 |
| 71 | 3300005441 | Ga0070700_100312331 | Ga0070700_1003123312 | 64 |
| 72 | 3300005441 | Ga0070700_100513280 | Ga0070700_1005132803 | 64 |
| 73 | 3300005441 | Ga0070700_100602125 | Ga0070700_1006021252 | 64 |
| 74 | 3300005441 | Ga0070700_100907483 | Ga0070700_1009074832 | 64 |
| 75 | 3300005444 | Ga0070694_100000608 | Ga0070694_10000060824 | 64 |
| 76 | 3300005444 | Ga0070694_100009317 | Ga0070694_1000093176 | 64 |
| 77 | 3300005444 | Ga0070694_100014517 | Ga0070694_1000145175 | 64 |
| 78 | 3300005444 | Ga0070694_100110866 | Ga0070694_1001108662 | 64 |
| 79 | 3300005444 | Ga0070694_100132063 | Ga0070694_1001320631 | 64 |
| 80 | 3300005444 | Ga0070694_100141175 | Ga0070694_1001411753 | 64 |
| 81 | 3300005444 | Ga0070694_101888735 | Ga0070694_1018887352 | 64 |
| 82 | 3300005445 | Ga0070708_101677815 | Ga0070708_1016778152 | 64 |
| 83 | 3300005445 | Ga0070708_102242505 | Ga0070708_1022425051 | 64 |
| 84 | 3300005456 | Ga0070678_100324300 | Ga0070678_1003243002 | 64 |
| 85 | 3300005457 | Ga0070662_101118929 | Ga0070662_1011189292 | 64 |
| 86 | 3300005458 | Ga0070681_10000198 | Ga0070681_1000019834 | 64 |
| 87 | 3300005458 | Ga0070681_10557601 | Ga0070681_105576013 | 64 |
| 88 | 3300005458 | Ga0070681_11361542 | Ga0070681_113615422 | 64 |
| 89 | 3300005459 | Ga0068867_100000568 | Ga0068867_10000056826 | 64 |
| 90 | 3300005459 | Ga0068867_100023523 | Ga0068867_1000235235 | 64 |
| 91 | 3300005467 | Ga0070706_100167580 | Ga0070706_1001675801 | 64 |
| 92 | 3300005468 | Ga0070707_101001884 | Ga0070707_1010018841 | 64 |
| 93 | 3300005518 | Ga0070699_100095806 | Ga0070699_1000958063 | 64 |
| 94 | 3300005518 | Ga0070699_100204649 | Ga0070699_1002046492 | 64 |
| 95 | 3300005518 | Ga0070699_100258097 | Ga0070699_1002580973 | 64 |
| 96 | 3300005518 | Ga0070699_101647209 | Ga0070699_1016472091 | 64 |
| 97 | 3300005530 | Ga0070679_100024440 | Ga0070679_1000244403 | 64 |
| 98 | 3300005535 | Ga0070684_100904293 | Ga0070684_1009042931 | 64 |
| 99 | 3300005535 | Ga0070684_102311780 | Ga0070684_1023117801 | 64 |
| 100 | 3300005536 | Ga0070697_100002931 | Ga0070697_10000293116 | 64 |
| 101 | 3300005536 | Ga0070697_100095073 | Ga0070697_1000950733 | 64 |
| 102 | 3300005536 | Ga0070697_100373071 | Ga0070697_1003730712 | 64 |
| 103 | 3300005539 | Ga0068853_100079777 | Ga0068853_1000797772 | 64 |
| 104 | 3300005543 | Ga0070672_100467010 | Ga0070672_1004670102 | 64 |
| 105 | 3300005543 | Ga0070672_101632546 | Ga0070672_1016325462 | 64 |
| 106 | 3300005544 | Ga0070686_100002218 | Ga0070686_10000221813 | 64 |
| 107 | 3300005544 | Ga0070686_100160293 | Ga0070686_1001602933 | 64 |
| 108 | 3300005544 | Ga0070686_100244972 | Ga0070686_1002449722 | 64 |
| 109 | 3300005545 | Ga0070695_100000176 | Ga0070695_10000017618 | 64 |
| 110 | 3300005545 | Ga0070695_100003592 | Ga0070695_1000035923 | 64 |
| 111 | 3300005545 | Ga0070695_100075647 | Ga0070695_1000756474 | 64 |
| 112 | 3300005545 | Ga0070695_100260639 | Ga0070695_1002606391 | 64 |
| 113 | 3300005545 | Ga0070695_100366367 | Ga0070695_1003663673 | 64 |
| 114 | 3300005545 | Ga0070695_100516992 | Ga0070695_1005169923 | 64 |
| 115 | 3300005545 | Ga0070695_100995412 | Ga0070695_1009954121 | 64 |
| 116 | 3300005545 | Ga0070695_101020545 | Ga0070695_1010205452 | 64 |
| 117 | 3300005545 | Ga0070695_101208833 | Ga0070695_1012088332 | 64 |
| 118 | 3300005546 | Ga0070696_100000137 | Ga0070696_10000013716 | 64 |
| 119 | 3300005546 | Ga0070696_100001735 | Ga0070696_1000017353 | 64 |
| 120 | 3300005546 | Ga0070696_100067694 | Ga0070696_1000676943 | 64 |
| 121 | 3300005546 | Ga0070696_100259271 | Ga0070696_1002592713 | 64 |
| 122 | 3300005546 | Ga0070696_100408338 | Ga0070696_1004083383 | 64 |
| 123 | 3300005546 | Ga0070696_100557879 | Ga0070696_1005578792 | 64 |
| 124 | 3300005547 | Ga0070693_100001113 | Ga0070693_1000011137 | 64 |
| 125 | 3300005547 | Ga0070693_101195606 | Ga0070693_1011956062 | 64 |
| 126 | 3300005547 | Ga0070693_101487955 | Ga0070693_1014879552 | 64 |
| 127 | 3300005549 | Ga0070704_100000057 | Ga0070704_10000005732 | 64 |
| 128 | 3300005549 | Ga0070704_100046477 | Ga0070704_1000464773 | 64 |
| 129 | 3300005549 | Ga0070704_100110016 | Ga0070704_1001100163 | 64 |
| 130 | 3300005549 | Ga0070704_100500892 | Ga0070704_1005008922 | 64 |
| 131 | 3300005549 | Ga0070704_101859060 | Ga0070704_1018590602 | 64 |
| 132 | 3300005563 | Ga0068855_100118320 | Ga0068855_1001183203 | 64 |
| 133 | 3300005578 | Ga0068854_100797180 | Ga0068854_1007971803 | 64 |
| 134 | 3300005614 | Ga0068856_100175279 | Ga0068856_1001752792 | 64 |
| 135 | 3300005614 | Ga0068856_100362114 | Ga0068856_1003621143 | 64 |
| 136 | 3300005615 | Ga0070702_100000016 | Ga0070702_10000001624 | 64 |
| 137 | 3300005615 | Ga0070702_100230352 | Ga0070702_1002303523 | 64 |
| 138 | 3300005615 | Ga0070702_100674737 | Ga0070702_1006747371 | 64 |
| 139 | 3300005617 | Ga0068859_100011860 | Ga0068859_10001186012 | 64 |
| 140 | 3300005617 | Ga0068859_100028423 | Ga0068859_1000284233 | 64 |
| 141 | 3300005617 | Ga0068859_100520407 | Ga0068859_1005204072 | 64 |
| 142 | 3300005617 | Ga0068859_101151732 | Ga0068859_1011517322 | 64 |
| 143 | 3300005718 | Ga0068866_10000914 | Ga0068866_100009143 | 64 |
| 144 | 3300005718 | Ga0068866_10554953 | Ga0068866_105549533 | 64 |
| 145 | 3300005719 | Ga0068861_100000199 | Ga0068861_10000019927 | 64 |
| 146 | 3300005719 | Ga0068861_100021205 | Ga0068861_1000212055 | 64 |
| 147 | 3300005840 | Ga0068870_10077337 | Ga0068870_100773372 | 64 |
| 148 | 3300005840 | Ga0068870_10269225 | Ga0068870_102692252 | 64 |
| 149 | 3300005840 | Ga0068870_11255553 | Ga0068870_112555533 | 64 |
| 150 | 3300005841 | Ga0068863_101860187 | Ga0068863_1018601872 | 64 |
| 151 | 3300005842 | Ga0068858_100003393 | Ga0068858_1000033937 | 64 |
| 152 | 3300005842 | Ga0068858_100399398 | Ga0068858_1003993984 | 64 |
| 153 | 3300005842 | Ga0068858_101623321 | Ga0068858_1016233212 | 64 |
| 154 | 3300005843 | Ga0068860_100001230 | Ga0068860_10000123026 | 64 |
| 155 | 3300005843 | Ga0068860_100212273 | Ga0068860_1002122731 | 64 |
| 156 | 3300005843 | Ga0068860_100850506 | Ga0068860_1008505062 | 64 |
| 157 | 3300005844 | Ga0068862_100010417 | Ga0068862_1000104177 | 64 |
| 158 | 3300005844 | Ga0068862_100032132 | Ga0068862_1000321325 | 64 |
| 159 | 3300005844 | Ga0068862_100306441 | Ga0068862_1003064413 | 64 |
| 160 | 3300005844 | Ga0068862_101573513 | Ga0068862_1015735132 | 64 |
| 161 | 3300005981 | Ga0081538_10160025 | Ga0081538_101600253 | 64 |
| 162 | 3300005985 | Ga0081539_10000842 | Ga0081539_1000084250 | 64 |
| 163 | 3300006173 | Ga0070716_101642595 | Ga0070716_1016425952 | 64 |
| 164 | 3300006237 | Ga0097621_100001888 | Ga0097621_1000018883 | 64 |
| 165 | 3300006237 | Ga0097621_101776504 | Ga0097621_1017765042 | 64 |
| 166 | 3300006358 | Ga0068871_100000120 | Ga0068871_10000012043 | 64 |
| 167 | 3300006844 | Ga0075428_100025250 | Ga0075428_10002525011 | 64 |
| 168 | 3300006844 | Ga0075428_100251107 | Ga0075428_1002511073 | 64 |
| 169 | 3300006844 | Ga0075428_101137687 | Ga0075428_1011376872 | 64 |
| 170 | 3300006844 | Ga0075428_101408710 | Ga0075428_1014087102 | 64 |
| 171 | 3300006846 | Ga0075430_100008695 | Ga0075430_1000086955 | 64 |
| 172 | 3300006846 | Ga0075430_100584181 | Ga0075430_1005841812 | 64 |
| 173 | 3300006846 | Ga0075430_100899021 | Ga0075430_1008990212 | 64 |
| 174 | 3300006846 | Ga0075430_101037516 | Ga0075430_1010375162 | 64 |
| 175 | 3300006846 | Ga0075430_101072680 | Ga0075430_1010726802 | 64 |
| 176 | 3300006846 | Ga0075430_101228111 | Ga0075430_1012281112 | 64 |
| 177 | 3300006847 | Ga0075431_100066842 | Ga0075431_1000668422 | 64 |
| 178 | 3300006847 | Ga0075431_100146517 | Ga0075431_1001465173 | 64 |
| 179 | 3300006847 | Ga0075431_100250762 | Ga0075431_1002507622 | 64 |
| 180 | 3300006847 | Ga0075431_100351111 | Ga0075431_1003511113 | 64 |
| 181 | 3300006847 | Ga0075431_101741357 | Ga0075431_1017413571 | 64 |
| 182 | 3300006847 | Ga0075431_101963753 | Ga0075431_1019637532 | 64 |
| 183 | 3300006852 | Ga0075433_10042272 | Ga0075433_100422724 | 64 |
| 184 | 3300006852 | Ga0075433_10336485 | Ga0075433_103364854 | 64 |
| 185 | 3300006871 | Ga0075434_100000073 | Ga0075434_10000007328 | 64 |
| 186 | 3300006871 | Ga0075434_100451066 | Ga0075434_1004510662 | 64 |
| 187 | 3300006871 | Ga0075434_100485931 | Ga0075434_1004859312 | 64 |
| 188 | 3300006871 | Ga0075434_101355167 | Ga0075434_1013551672 | 64 |
| 189 | 3300006880 | Ga0075429_100001130 | Ga0075429_10000113027 | 64 |
| 190 | 3300006880 | Ga0075429_100428394 | Ga0075429_1004283943 | 64 |
| 191 | 3300006880 | Ga0075429_100737243 | Ga0075429_1007372432 | 64 |
| 192 | 3300006880 | Ga0075429_101138282 | Ga0075429_1011382821 | 64 |
| 193 | 3300006880 | Ga0075429_101804621 | Ga0075429_1018046211 | 64 |
| 194 | 3300006881 | Ga0068865_100001461 | Ga0068865_10000146112 | 64 |
| 195 | 3300006881 | Ga0068865_100029927 | Ga0068865_1000299273 | 64 |
| 196 | 3300006881 | Ga0068865_101701000 | Ga0068865_1017010002 | 64 |
| 197 | 3300006914 | Ga0075436_100000205 | Ga0075436_10000020514 | 64 |
| 198 | 3300006914 | Ga0075436_100038706 | Ga0075436_1000387063 | 64 |
| 199 | 3300006914 | Ga0075436_100058404 | Ga0075436_1000584043 | 64 |
| 200 | 3300006914 | Ga0075436_100094461 | Ga0075436_1000944612 | 64 |
| 201 | 3300006914 | Ga0075436_100403480 | Ga0075436_1004034803 | 64 |
| 202 | 3300006914 | Ga0075436_100558744 | Ga0075436_1005587443 | 64 |
| 203 | 3300006914 | Ga0075436_101073376 | Ga0075436_1010733761 | 64 |
| 204 | 3300006931 | Ga0097620_100011861 | Ga0097620_10001186112 | 64 |
| 205 | 3300006931 | Ga0097620_100028423 | Ga0097620_1000284237 | 64 |
| 206 | 3300006931 | Ga0097620_100520376 | Ga0097620_1005203762 | 64 |
| 207 | 3300006931 | Ga0097620_101151728 | Ga0097620_1011517282 | 64 |
| 208 | 3300007076 | Ga0075435_100006291 | Ga0075435_1000062916 | 64 |
| 209 | 3300007076 | Ga0075435_100140284 | Ga0075435_1001402844 | 64 |
| 210 | 3300007076 | Ga0075435_100223166 | Ga0075435_1002231662 | 64 |
| 211 | 3300007076 | Ga0075435_100239981 | Ga0075435_1002399813 | 64 |
| 212 | 3300007076 | Ga0075435_100809709 | Ga0075435_1008097092 | 64 |
| 213 | 3300007265 | Ga0099794_10021997 | Ga0099794_100219972 | 64 |
| 214 | 3300007265 | Ga0099794_10066967 | Ga0099794_100669673 | 64 |
| 215 | 3300007265 | Ga0099794_10438859 | Ga0099794_104388593 | 64 |
| 216 | 3300009092 | Ga0105250_10020860 | Ga0105250_100208603 | 64 |
| 217 | 3300009094 | Ga0111539_10037024 | Ga0111539_100370243 | 64 |
| 218 | 3300009094 | Ga0111539_10065584 | Ga0111539_100655845 | 64 |
| 219 | 3300009094 | Ga0111539_10131269 | Ga0111539_101312693 | 64 |
| 220 | 3300009094 | Ga0111539_10168418 | Ga0111539_101684183 | 64 |
| 221 | 3300009094 | Ga0111539_10222278 | Ga0111539_102222783 | 64 |
| 222 | 3300009094 | Ga0111539_10772667 | Ga0111539_107726672 | 64 |
| 223 | 3300009094 | Ga0111539_11095879 | Ga0111539_110958791 | 64 |
| 224 | 3300009094 | Ga0111539_11334901 | Ga0111539_113349012 | 64 |
| 225 | 3300009094 | Ga0111539_12495474 | Ga0111539_124954742 | 64 |
| 226 | 3300009098 | Ga0105245_10000259 | Ga0105245_1000025927 | 64 |
| 227 | 3300009098 | Ga0105245_11512819 | Ga0105245_115128193 | 64 |
| 228 | 3300009147 | Ga0114129_10002101 | Ga0114129_1000210128 | 64 |
| 229 | 3300009147 | Ga0114129_10373021 | Ga0114129_103730213 | 64 |
| 230 | 3300009147 | Ga0114129_10405770 | Ga0114129_104057703 | 64 |
| 231 | 3300009147 | Ga0114129_10495723 | Ga0114129_104957233 | 64 |
| 232 | 3300009147 | Ga0114129_10864388 | Ga0114129_108643882 | 64 |
| 233 | 3300009147 | Ga0114129_11760995 | Ga0114129_117609952 | 64 |
| 234 | 3300009147 | Ga0114129_11940992 | Ga0114129_119409921 | 64 |
| 235 | 3300009147 | Ga0114129_11976176 | Ga0114129_119761762 | 64 |
| 236 | 3300009147 | Ga0114129_12027214 | Ga0114129_120272141 | 64 |
| 237 | 3300009148 | Ga0105243_10003095 | Ga0105243_100030953 | 64 |
| 238 | 3300009148 | Ga0105243_10045531 | Ga0105243_100455313 | 64 |
| 239 | 3300009174 | Ga0105241_10010209 | Ga0105241_100102096 | 64 |
| 240 | 3300009174 | Ga0105241_12341199 | Ga0105241_123411991 | 64 |
| 241 | 3300009176 | Ga0105242_10036544 | Ga0105242_100365442 | 64 |
| 242 | 3300009176 | Ga0105242_12629685 | Ga0105242_126296852 | 64 |
| 243 | 3300009176 | Ga0105242_13254707 | Ga0105242_132547071 | 64 |
| 244 | 3300009177 | Ga0105248_10559731 | Ga0105248_105597312 | 64 |
| 245 | 3300009177 | Ga0105248_13338330 | Ga0105248_133383302 | 64 |
| 246 | 3300009553 | Ga0105249_10001070 | Ga0105249_1000107023 | 64 |
| 247 | 3300009553 | Ga0105249_10050687 | Ga0105249_100506875 | 64 |
| 248 | 3300009553 | Ga0105249_10377074 | Ga0105249_103770743 | 64 |
| 249 | 3300011119 | Ga0105246_11558813 | Ga0105246_115588132 | 64 |
| 250 | 3300012494 | Ga0157341_1018316 | Ga0157341_10183161 | 64 |
| 251 | 3300012498 | Ga0157345_1017302 | Ga0157345_10173021 | 64 |
| 252 | 3300013102 | Ga0157371_10835412 | Ga0157371_108354122 | 64 |
| 253 | 3300013105 | Ga0157369_11800822 | Ga0157369_118008222 | 64 |
| 254 | 3300013296 | Ga0157374_11458235 | Ga0157374_114582352 | 64 |
| 255 | 3300013296 | Ga0157374_12380551 | Ga0157374_123805511 | 64 |
| 256 | 3300013297 | Ga0157378_10000576 | Ga0157378_1000057623 | 64 |
| 257 | 3300013297 | Ga0157378_11059085 | Ga0157378_110590851 | 64 |
| 258 | 3300013297 | Ga0157378_11778107 | Ga0157378_117781072 | 64 |
| 259 | 3300013306 | Ga0163162_10199606 | Ga0163162_101996063 | 64 |
| 260 | 3300013306 | Ga0163162_10270175 | Ga0163162_102701753 | 64 |
| 261 | 3300013307 | Ga0157372_10981400 | Ga0157372_109814003 | 64 |
| 262 | 3300013307 | Ga0157372_11908413 | Ga0157372_119084132 | 64 |
| 263 | 3300013307 | Ga0157372_12198757 | Ga0157372_121987572 | 64 |
| 264 | 3300013308 | Ga0157375_10093020 | Ga0157375_100930203 | 64 |
| 265 | 3300013308 | Ga0157375_10424353 | Ga0157375_104243533 | 64 |
| 266 | 3300014326 | Ga0157380_10011328 | Ga0157380_100113284 | 64 |
| 267 | 3300014326 | Ga0157380_10170367 | Ga0157380_101703672 | 64 |
| 268 | 3300014326 | Ga0157380_12854062 | Ga0157380_128540621 | 64 |
| 269 | 3300014745 | Ga0157377_10194371 | Ga0157377_101943713 | 64 |
| 270 | 3300014969 | Ga0157376_10003705 | Ga0157376_1000370515 | 64 |
| 271 | 3300017792 | Ga0163161_11485260 | Ga0163161_114852601 | 64 |
| 272 | 3300017792 | Ga0163161_11845188 | Ga0163161_118451882 | 64 |
| 273 | 3300021384 | Ga0213876_10501877 | Ga0213876_105018772 | 64 |
| 274 | 3300025315 | Ga0207697_10385181 | Ga0207697_103851812 | 64 |
| 275 | 3300025711 | Ga0207696_1115335 | Ga0207696_11153352 | 64 |
| 276 | 3300025899 | Ga0207642_10124344 | Ga0207642_101243443 | 64 |
| 277 | 3300025899 | Ga0207642_10183429 | Ga0207642_101834293 | 64 |
| 278 | 3300025901 | Ga0207688_10103278 | Ga0207688_101032783 | 64 |
| 279 | 3300025903 | Ga0207680_10458517 | Ga0207680_104585172 | 64 |
| 280 | 3300025906 | Ga0207699_10611808 | Ga0207699_106118082 | 64 |
| 281 | 3300025907 | Ga0207645_10053737 | Ga0207645_100537374 | 64 |
| 282 | 3300025910 | Ga0207684_10398182 | Ga0207684_103981823 | 64 |
| 283 | 3300025911 | Ga0207654_10004685 | Ga0207654_100046858 | 64 |
| 284 | 3300025912 | Ga0207707_10003333 | Ga0207707_1000333313 | 64 |
| 285 | 3300025916 | Ga0207663_10655419 | Ga0207663_106554191 | 64 |
| 286 | 3300025917 | Ga0207660_10001340 | Ga0207660_1000134023 | 64 |
| 287 | 3300025917 | Ga0207660_10020821 | Ga0207660_100208215 | 64 |
| 288 | 3300025917 | Ga0207660_10252495 | Ga0207660_102524954 | 64 |
| 289 | 3300025918 | Ga0207662_10000106 | Ga0207662_1000010645 | 64 |
| 290 | 3300025918 | Ga0207662_10043801 | Ga0207662_100438014 | 64 |
| 291 | 3300025918 | Ga0207662_10064715 | Ga0207662_100647153 | 64 |
| 292 | 3300025918 | Ga0207662_10528478 | Ga0207662_105284782 | 64 |
| 293 | 3300025921 | Ga0207652_10007736 | Ga0207652_100077363 | 64 |
| 294 | 3300025921 | Ga0207652_10030844 | Ga0207652_100308443 | 64 |
| 295 | 3300025922 | Ga0207646_10881409 | Ga0207646_108814092 | 64 |
| 296 | 3300025923 | Ga0207681_10006318 | Ga0207681_100063189 | 64 |
| 297 | 3300025923 | Ga0207681_11232805 | Ga0207681_112328052 | 64 |
| 298 | 3300025925 | Ga0207650_10776621 | Ga0207650_107766212 | 64 |
| 299 | 3300025926 | Ga0207659_10062589 | Ga0207659_100625891 | 64 |
| 300 | 3300025926 | Ga0207659_10089394 | Ga0207659_100893943 | 64 |
| 301 | 3300025927 | Ga0207687_10004274 | Ga0207687_100042742 | 64 |
| 302 | 3300025929 | Ga0207664_10065290 | Ga0207664_100652907 | 64 |
| 303 | 3300025931 | Ga0207644_11839724 | Ga0207644_118397242 | 64 |
| 304 | 3300025933 | Ga0207706_10766185 | Ga0207706_107661852 | 64 |
| 305 | 3300025934 | Ga0207686_10000883 | Ga0207686_100008833 | 64 |
| 306 | 3300025935 | Ga0207709_10003980 | Ga0207709_1000398013 | 64 |
| 307 | 3300025935 | Ga0207709_10007609 | Ga0207709_100076095 | 64 |
| 308 | 3300025936 | Ga0207670_10067768 | Ga0207670_100677684 | 64 |
| 309 | 3300025936 | Ga0207670_10089674 | Ga0207670_100896742 | 64 |
| 310 | 3300025936 | Ga0207670_10370929 | Ga0207670_103709292 | 64 |
| 311 | 3300025936 | Ga0207670_10933109 | Ga0207670_109331093 | 64 |
| 312 | 3300025937 | Ga0207669_10003349 | Ga0207669_100033499 | 64 |
| 313 | 3300025937 | Ga0207669_10811645 | Ga0207669_108116453 | 64 |
| 314 | 3300025938 | Ga0207704_10000434 | Ga0207704_100004342 | 64 |
| 315 | 3300025938 | Ga0207704_10007398 | Ga0207704_100073984 | 64 |
| 316 | 3300025938 | Ga0207704_11267462 | Ga0207704_112674621 | 64 |
| 317 | 3300025940 | Ga0207691_10119742 | Ga0207691_101197423 | 64 |
| 318 | 3300025941 | Ga0207711_10801650 | Ga0207711_108016502 | 64 |
| 319 | 3300025942 | Ga0207689_10000376 | Ga0207689_1000037630 | 64 |
| 320 | 3300025942 | Ga0207689_10371845 | Ga0207689_103718451 | 64 |
| 321 | 3300025942 | Ga0207689_11486601 | Ga0207689_114866012 | 64 |
| 322 | 3300025944 | Ga0207661_11615836 | Ga0207661_116158362 | 64 |
| 323 | 3300025949 | Ga0207667_10134989 | Ga0207667_101349893 | 64 |
| 324 | 3300025960 | Ga0207651_11016019 | Ga0207651_110160191 | 64 |
| 325 | 3300025960 | Ga0207651_11571522 | Ga0207651_115715222 | 64 |
| 326 | 3300025961 | Ga0207712_10005157 | Ga0207712_1000515715 | 64 |
| 327 | 3300025961 | Ga0207712_10027095 | Ga0207712_100270955 | 64 |
| 328 | 3300025961 | Ga0207712_10225900 | Ga0207712_102259002 | 64 |
| 329 | 3300025972 | Ga0207668_10037290 | Ga0207668_100372903 | 64 |
| 330 | 3300025981 | Ga0207640_10060273 | Ga0207640_100602735 | 64 |
| 331 | 3300026023 | Ga0207677_10004790 | Ga0207677_100047903 | 64 |
| 332 | 3300026023 | Ga0207677_10653886 | Ga0207677_106538863 | 64 |
| 333 | 3300026035 | Ga0207703_10001886 | Ga0207703_1000188622 | 64 |
| 334 | 3300026035 | Ga0207703_10064059 | Ga0207703_100640592 | 64 |
| 335 | 3300026035 | Ga0207703_11826460 | Ga0207703_118264601 | 64 |
| 336 | 3300026041 | Ga0207639_10050531 | Ga0207639_100505312 | 64 |
| 337 | 3300026075 | Ga0207708_10000239 | Ga0207708_1000023942 | 64 |
| 338 | 3300026075 | Ga0207708_10036334 | Ga0207708_100363343 | 64 |
| 339 | 3300026075 | Ga0207708_10225905 | Ga0207708_102259053 | 64 |
| 340 | 3300026075 | Ga0207708_10246018 | Ga0207708_102460182 | 64 |
| 341 | 3300026075 | Ga0207708_10904513 | Ga0207708_109045132 | 64 |
| 342 | 3300026075 | Ga0207708_11269594 | Ga0207708_112695941 | 64 |
| 343 | 3300026075 | Ga0207708_12019003 | Ga0207708_120190032 | 64 |
| 344 | 3300026078 | Ga0207702_10056135 | Ga0207702_100561354 | 64 |
| 345 | 3300026088 | Ga0207641_10474389 | Ga0207641_104743893 | 64 |
| 346 | 3300026089 | Ga0207648_10000369 | Ga0207648_1000036925 | 64 |
| 347 | 3300026089 | Ga0207648_10002987 | Ga0207648_100029877 | 64 |
| 348 | 3300026116 | Ga0207674_10699519 | Ga0207674_106995192 | 64 |
| 349 | 3300026118 | Ga0207675_100000651 | Ga0207675_1000006516 | 64 |
| 350 | 3300026118 | Ga0207675_100002559 | Ga0207675_10000255925 | 64 |
| 351 | 3300027364 | Ga0209967_1005806 | Ga0209967_10058062 | 64 |
| 352 | 3300027364 | Ga0209967_1006851 | Ga0209967_10068513 | 64 |
| 353 | 3300027378 | Ga0209981_1009968 | Ga0209981_10099683 | 64 |
| 354 | 3300027378 | Ga0209981_1037131 | Ga0209981_10371312 | 64 |
| 355 | 3300027395 | Ga0209996_1042690 | Ga0209996_10426902 | 64 |
| 356 | 3300027395 | Ga0209996_1054216 | Ga0209996_10542162 | 64 |
| 357 | 3300027462 | Ga0210000_1009349 | Ga0210000_10093492 | 64 |
| 358 | 3300027462 | Ga0210000_1016142 | Ga0210000_10161422 | 64 |
| 359 | 3300027471 | Ga0209995_1010851 | Ga0209995_10108513 | 64 |
| 360 | 3300027471 | Ga0209995_1012130 | Ga0209995_10121302 | 64 |
| 361 | 3300027471 | Ga0209995_1076999 | Ga0209995_10769992 | 64 |
| 362 | 3300027526 | Ga0209968_1007653 | Ga0209968_10076532 | 64 |
| 363 | 3300027526 | Ga0209968_1032701 | Ga0209968_10327013 | 64 |
| 364 | 3300027526 | Ga0209968_1088572 | Ga0209968_10885722 | 64 |
| 365 | 3300027543 | Ga0209999_1004248 | Ga0209999_10042484 | 64 |
| 366 | 3300027543 | Ga0209999_1035560 | Ga0209999_10355602 | 64 |
| 367 | 3300027617 | Ga0210002_1032968 | Ga0210002_10329682 | 64 |
| 368 | 3300027617 | Ga0210002_1056094 | Ga0210002_10560942 | 64 |
| 369 | 3300027671 | Ga0209588_1056698 | Ga0209588_10566983 | 64 |
| 370 | 3300027671 | Ga0209588_1061104 | Ga0209588_10611042 | 64 |
| 371 | 3300027682 | Ga0209971_1006528 | Ga0209971_10065283 | 64 |
| 372 | 3300027682 | Ga0209971_1130901 | Ga0209971_11309011 | 64 |
| 373 | 3300027695 | Ga0209966_1014489 | Ga0209966_10144892 | 64 |
| 374 | 3300027695 | Ga0209966_1023390 | Ga0209966_10233903 | 64 |
| 375 | 3300027876 | Ga0209974_10011132 | Ga0209974_100111323 | 64 |
| 376 | 3300027876 | Ga0209974_10163834 | Ga0209974_101638342 | 64 |
| 377 | 3300027907 | Ga0207428_10010784 | Ga0207428_1001078410 | 64 |
| 378 | 3300027907 | Ga0207428_10019374 | Ga0207428_100193746 | 64 |
| 379 | 3300027907 | Ga0207428_10286072 | Ga0207428_102860723 | 64 |
| 380 | 3300027907 | Ga0207428_10322863 | Ga0207428_103228631 | 64 |
| 381 | 3300028380 | Ga0268265_10000781 | Ga0268265_1000078121 | 64 |
| 382 | 3300028380 | Ga0268265_10001333 | Ga0268265_100013336 | 64 |
| 383 | 3300028380 | Ga0268265_10539870 | Ga0268265_105398703 | 64 |
| 384 | 3300028380 | Ga0268265_11132614 | Ga0268265_111326143 | 64 |
| 385 | 3300028380 | Ga0268265_11891433 | Ga0268265_118914332 | 64 |
| 386 | 3300028380 | Ga0268265_12491338 | Ga0268265_124913382 | 64 |
| 387 | 3300028381 | Ga0268264_10001450 | Ga0268264_100014507 | 64 |
| 388 | 3300028381 | Ga0268264_10358617 | Ga0268264_103586173 | 64 |
| 389 | 3300028381 | Ga0268264_10617457 | Ga0268264_106174572 | 64 |
| 390 | 3300031548 | Ga0307408_100124562 | Ga0307408_1001245624 | 64 |
| 391 | 3300031548 | Ga0307408_100328650 | Ga0307408_1003286502 | 64 |
| 392 | 3300031548 | Ga0307408_100483338 | Ga0307408_1004833382 | 64 |
| 393 | 3300031548 | Ga0307408_100558767 | Ga0307408_1005587672 | 64 |
| 394 | 3300031548 | Ga0307408_100961731 | Ga0307408_1009617312 | 64 |
| 395 | 3300031548 | Ga0307408_101289976 | Ga0307408_1012899762 | 64 |
| 396 | 3300031548 | Ga0307408_102097161 | Ga0307408_1020971612 | 64 |
| 397 | 3300031665 | Ga0316575_10006460 | Ga0316575_100064601 | 64 |
| 398 | 3300031731 | Ga0307405_10166892 | Ga0307405_101668923 | 64 |
| 399 | 3300031731 | Ga0307405_10471668 | Ga0307405_104716682 | 64 |
| 400 | 3300031824 | Ga0307413_11098741 | Ga0307413_110987412 | 64 |
| 401 | 3300031901 | Ga0307406_10254138 | Ga0307406_102541383 | 64 |
| 402 | 3300031901 | Ga0307406_11613841 | Ga0307406_116138412 | 64 |
| 403 | 3300031903 | Ga0307407_10210867 | Ga0307407_102108673 | 64 |
| 404 | 3300031903 | Ga0307407_11689568 | Ga0307407_116895682 | 64 |
| 405 | 3300031911 | Ga0307412_11260357 | Ga0307412_112603572 | 64 |
| 406 | 3300031995 | Ga0307409_100169468 | Ga0307409_1001694683 | 64 |
| 407 | 3300031995 | Ga0307409_102558923 | Ga0307409_1025589232 | 64 |
| 408 | 3300032002 | Ga0307416_100143175 | Ga0307416_1001431752 | 64 |
| 409 | 3300032002 | Ga0307416_100191358 | Ga0307416_1001913583 | 64 |
| 410 | 3300032002 | Ga0307416_100323996 | Ga0307416_1003239963 | 64 |
| 411 | 3300032002 | Ga0307416_100689954 | Ga0307416_1006899543 | 64 |
| 412 | 3300032002 | Ga0307416_100778181 | Ga0307416_1007781812 | 64 |
| 413 | 3300032005 | Ga0307411_10151900 | Ga0307411_101519003 | 64 |
| 414 | 3300032005 | Ga0307411_10434441 | Ga0307411_104344412 | 64 |
| 415 | 3300032005 | Ga0307411_11042508 | Ga0307411_110425082 | 64 |
| 416 | 3300032005 | Ga0307411_11219492 | Ga0307411_112194922 | 64 |
| 417 | 3300032126 | Ga0307415_100624731 | Ga0307415_1006247312 | 64 |
| 418 | 3300034816 | Ga0373930_0043239 | Ga0373930_0043239_685_879 | 64 |
| 419 | 3300034817 | Ga0373948_0011088 | Ga0373948_0011088_204_398 | 64 |
| 420 | 3300034818 | Ga0373950_0059922 | Ga0373950_0059922_164_358 | 64 |
| 421 | 3300034819 | Ga0373958_0042239 | Ga0373958_0042239_657_851 | 64 |
| 422 | 3300034820 | Ga0373959_0005843 | Ga0373959_0005843_466_660 | 64 |
| 423 | 3300034957 | Ga0373938_0003713 | Ga0373938_0003713_749_943 | 64 |
| 424 | 3300034957 | Ga0373938_0256590 | Ga0373938_0256590_251_454 | 64 |
| 425 | 3300035083 | Ga0373926_0000230 | Ga0373926_0000230_6934_7128 | 64 |
| 426 | 3300035084 | Ga0373928_0019093 | Ga0373928_0019093_181_375 | 64 |
| 427 | 3300035085 | Ga0373929_0032794 | Ga0373929_0032794_530_724 | 64 |
| 428 | 3300035085 | Ga0373929_0137915 | Ga0373929_0137915_98_292 | 64 |
| 429 | 3300035085 | Ga0373929_0158838 | Ga0373929_0158838_301_495 | 64 |
| 430 | 3300035088 | Ga0373940_0027896 | Ga0373940_0027896_93_287 | 64 |
| 431 | 3300035088 | Ga0373940_0097071 | Ga0373940_0097071_503_697 | 64 |
| 432 | 3300035088 | Ga0373940_0169713 | Ga0373940_0169713_251_445 | 64 |
| 433 | 3300035089 | Ga0373944_0001903 | Ga0373944_0001903_4322_4516 | 64 |
| 434 | 3300035090 | Ga0373949_0053680 | Ga0373949_0053680_394_588 | 64 |
| 435 | 3300035090 | Ga0373949_0231393 | Ga0373949_0231393_232_426 | 64 |
| 436 | 3300035092 | Ga0373952_0010396 | Ga0373952_0010396_27_221 | 64 |
| 437 | 3300035092 | Ga0373952_0069643 | Ga0373952_0069643_620_814 | 64 |
| 438 | 3300035111 | Ga0373923_0140381 | Ga0373923_0140381_72_266 | 64 |
| 439 | 3300035112 | Ga0373932_0005565 | Ga0373932_0005565_1001_1195 | 64 |
| 440 | 3300035112 | Ga0373932_0202463 | Ga0373932_0202463_161_355 | 64 |
| 441 | 3300035113 | Ga0373936_0018435 | Ga0373936_0018435_828_1022 | 64 |
| 442 | 3300035113 | Ga0373936_0304874 | Ga0373936_0304874_361_555 | 64 |
| 443 | 3300035114 | Ga0373939_0126159 | Ga0373939_0126159_374_568 | 64 |
| 444 | 3300035114 | Ga0373939_0280336 | Ga0373939_0280336_200_403 | 64 |
| 445 | 3300035115 | Ga0373941_0039893 | Ga0373941_0039893_585_779 | 64 |
| 446 | 3300035116 | Ga0373945_0004779 | Ga0373945_0004779_1845_2039 | 64 |
| 447 | 3300035116 | Ga0373945_0137355 | Ga0373945_0137355_726_920 | 64 |
| 448 | 3300035121 | Ga0373960_0023136 | Ga0373960_0023136_636_830 | 64 |
| 449 | 3300035170 | Ga0373943_0020057 | Ga0373943_0020057_2706_2900 | 64 |
| 450 | 3300035170 | Ga0373943_0176629 | Ga0373943_0176629_211_405 | 64 |
| 451 | 3300035171 | Ga0373946_0005892 | Ga0373946_0005892_2464_2658 | 64 |
| 452 | 3300035207 | Ga0373942_0013904 | Ga0373942_0013904_303_497 | 64 |
| 453 | 3300035207 | Ga0373942_0078048 | Ga0373942_0078048_546_740 | 64 |
| 454 | 3300035207 | Ga0373942_0183233 | Ga0373942_0183233_412_606 | 64 |
| 455 | 3300035241 | Ga0373961_0008933 | Ga0373961_0008933_13_207 | 64 |
| 456 | 3300035242 | Ga0373962_0082296 | Ga0373962_0082296_374_568 | 64 |
| 457 | 3300035242 | Ga0373962_0124605 | Ga0373962_0124605_242_436 | 64 |
| 458 | 3300035398 | Ga0316574_0005586 | Ga0316574_0005586_1855_2049 | 64 |
| 459 | 3300035410 | Ga0373924_0059852 | Ga0373924_0059852_321_515 | 64 |
| 460 | 3300035691 | Ga0373931_0002129 | Ga0373931_0002129_6917_7111 | 64 |
| 461 | 3300035691 | Ga0373931_0004456 | Ga0373931_0004456_5560_5754 | 64 |
| 462 | 3300035691 | Ga0373931_0014988 | Ga0373931_0014988_3340_3534 | 64 |
| 463 | 3300035691 | Ga0373931_0128940 | Ga0373931_0128940_1140_1334 | 64 |
| 464 | 3300035691 | Ga0373931_0679438 | Ga0373931_0679438_427_621 | 64 |
| 465 | 3300035692 | Ga0373935_0010842 | Ga0373935_0010842_3606_3800 | 64 |
| 466 | 3300035692 | Ga0373935_0094772 | Ga0373935_0094772_1675_1869 | 64 |
| 467 | 3300035695 | Ga0373927_0023238 | Ga0373927_0023238_200_394 | 64 |
| 468 | 3300035695 | Ga0373927_0136658 | Ga0373927_0136658_471_665 | 64 |
| 469 | 3300035695 | Ga0373927_0445904 | Ga0373927_0445904_624_818 | 64 |
| 470 | 3300035725 | Ga0373947_0036854 | Ga0373947_0036854_983_1177 | 64 |
| 471 | 3300035725 | Ga0373947_0046108 | Ga0373947_0046108_763_957 | 64 |
| 472 | 3300037068 | Ga0373925_0114896 | Ga0373925_0114896_350_544 | 64 |
| 473 | 3300037068 | Ga0373925_0212145 | Ga0373925_0212145_201_395 | 64 |
| 474 | 3300037471 | Ga0395905_1257181 | Ga0395905_1257181_10_204 | 64 |
| 475 | 3300039437 | Ga0436365_0682788 | Ga0436365_0682788_20_214 | 64 |
| 476 | 3300041404 | Ga0439436_0135206 | Ga0439436_0135206_263_457 | 64 |
| 477 | 3300041406 | Ga0439439_0021515 | Ga0439439_0021515_464_658 | 64 |
| 478 | 3300041410 | Ga0439461_0002899 | Ga0439461_0002899_1522_1716 | 64 |
| 479 | 3300041496 | Ga0451839_0172504 | Ga0451839_0172504_437_631 | 64 |
| 480 | 3300041496 | Ga0451839_0709667 | Ga0451839_0709667_88_282 | 64 |
| 481 | 3300041505 | Ga0451849_1571619 | Ga0451849_1571619_226_420 | 64 |
| 482 | 3300042001 | Ga0439441_000488 | Ga0439441_000488_1199_1393 | 64 |
| 483 | 3300042001 | Ga0439441_045240 | Ga0439441_045240_409_603 | 64 |
| 484 | 3300042003 | Ga0439443_024153 | Ga0439443_024153_74_268 | 64 |
| 485 | 3300042003 | Ga0439443_109362 | Ga0439443_109362_193_387 | 64 |
| 486 | 3300042009 | Ga0439451_031250 | Ga0439451_031250_20_214 | 64 |
| 487 | 3300042011 | Ga0439454_054397 | Ga0439454_054397_429_623 | 64 |
| 488 | 3300042013 | Ga0439456_159810 | Ga0439456_159810_28_222 | 64 |
| 489 | 3300042015 | Ga0439462_0012540 | Ga0439462_0012540_441_635 | 64 |
| 490 | 3300042015 | Ga0439462_0047167 | Ga0439462_0047167_154_348 | 64 |
| 491 | 3300042125 | Ga0450923_114106 | Ga0450923_114106_409_603 | 64 |
| 492 | 3300042156 | Ga0439446_0099969 | Ga0439446_0099969_212_406 | 64 |
| 493 | 3300042156 | Ga0439446_0106820 | Ga0439446_0106820_509_703 | 64 |
| 494 | 3300042435 | Ga0439434_0000076 | Ga0439434_0000076_3013_3207 | 64 |
| 495 | 3300042435 | Ga0439434_0103290 | Ga0439434_0103290_112_306 | 64 |
| 496 | 3300042435 | Ga0439434_0288979 | Ga0439434_0288979_145_339 | 64 |
| 497 | 3300042436 | Ga0439435_0001056 | Ga0439435_0001056_3452_3646 | 64 |
| 498 | 3300042436 | Ga0439435_0098919 | Ga0439435_0098919_301_495 | 64 |
| 499 | 3300042436 | Ga0439435_0234829 | Ga0439435_0234829_388_582 | 64 |
| 500 | 3300042437 | Ga0439444_0110830 | Ga0439444_0110830_200_394 | 64 |
| 501 | 3300042461 | Ga0439460_0012019 | Ga0439460_0012019_2020_2214 | 64 |
| 502 | 3300042461 | Ga0439460_0040964 | Ga0439460_0040964_297_491 | 64 |
| 503 | 3300042461 | Ga0439460_0333123 | Ga0439460_0333123_131_325 | 64 |
| 504 | 3300042876 | Ga0451577_0015044 | Ga0451577_0015044_4676_4870 | 64 |
| 505 | 3300044706 | Ga0466964_0754953 | Ga0466964_0754953_260_454 | 64 |
| 506 | 3300044719 | Ga0466971_0284783 | Ga0466971_0284783_502_696 | 64 |
| 507 | 3300044901 | Ga0466960_0133029 | Ga0466960_0133029_873_1067 | 64 |
| 508 | 3300045051 | Ga0451576_0006734 | Ga0451576_0006734_32_226 | 64 |
| 509 | 3300045051 | Ga0451576_0033552 | Ga0451576_0033552_20_214 | 64 |
| 510 | 3300045051 | Ga0451576_0090352 | Ga0451576_0090352_1042_1236 | 64 |
| 511 | 3300045051 | Ga0451576_1015913 | Ga0451576_1015913_36_230 | 64 |
| 512 | 3300045051 | Ga0451576_1282757 | Ga0451576_1282757_125_319 | 64 |
| 513 | 3300045051 | Ga0451576_1310889 | Ga0451576_1310889_93_287 | 64 |
| 514 | 3300045051 | Ga0451576_1717735 | Ga0451576_1717735_54_248 | 64 |
| 515 | 3300045976 | Ga0466967_0113879 | Ga0466967_0113879_1389_1583 | 64 |
| 516 | 3300046455 | Ga0495603_0005705 | Ga0495603_0005705_663_857 | 64 |
| 517 | 3300046472 | Ga0495580_0023847 | Ga0495580_0023847_222_416 | 64 |
| 518 | 3300046473 | Ga0495582_0034547 | Ga0495582_0034547_1257_1451 | 64 |
| 519 | 3300046475 | Ga0495639_0005524 | Ga0495639_0005524_235_429 | 64 |
| 520 | 3300046491 | Ga0495584_0291568 | Ga0495584_0291568_624_818 | 64 |
| 521 | 3300046517 | Ga0495630_0646802 | Ga0495630_0646802_216_410 | 64 |
| 522 | 3300046526 | Ga0495666_0013837 | Ga0495666_0013837_506_700 | 64 |
| 523 | 3300046528 | Ga0495642_0449817 | Ga0495642_0449817_351_545 | 64 |
| 524 | 3300046535 | Ga0495586_0484857 | Ga0495586_0484857_290_484 | 64 |
| 525 | 3300046537 | Ga0495598_0052961 | Ga0495598_0052961_501_695 | 64 |
| 526 | 3300046537 | Ga0495598_0164097 | Ga0495598_0164097_334_528 | 64 |
| 527 | 3300046539 | Ga0495621_0111561 | Ga0495621_0111561_522_716 | 64 |
| 528 | 3300046539 | Ga0495621_0123251 | Ga0495621_0123251_470_664 | 64 |
| 529 | 3300046557 | Ga0495622_0120892 | Ga0495622_0120892_976_1170 | 64 |
| 530 | 3300046615 | Ga0495656_0127289 | Ga0495656_0127289_953_1147 | 64 |
| 531 | 3300046664 | Ga0495659_0011438 | Ga0495659_0011438_1845_2039 | 64 |
| 532 | 3300046664 | Ga0495659_0227357 | Ga0495659_0227357_480_674 | 64 |
| 533 | 3300046674 | Ga0495588_0044030 | Ga0495588_0044030_349_543 | 64 |
| 534 | 3300046681 | Ga0495647_0001395 | Ga0495647_0001395_5627_5821 | 64 |
| 535 | 3300046683 | Ga0495658_0003610 | Ga0495658_0003610_4198_4392 | 64 |
| 536 | 3300046684 | Ga0495669_0110952 | Ga0495669_0110952_457_651 | 64 |
| 537 | 3300047318 | Ga0495636_0421976 | Ga0495636_0421976_35_229 | 64 |
| 538 | 3300047321 | Ga0495676_0011940 | Ga0495676_0011940_290_484 | 64 |
| 539 | 3300047445 | Ga0495677_0374455 | Ga0495677_0374455_145_339 | 64 |
| 540 | 3300048909 | Ga0496106_0159383 | Ga0496106_0159383_306_500 | 64 |
| 541 | 3300049515 | Ga0501292_081566 | Ga0501292_081566_325_519 | 64 |
| 542 | 3300049520 | Ga0501297_069010 | Ga0501297_069010_162_356 | 64 |
| 543 | 3300049521 | Ga0501298_040277 | Ga0501298_040277_629_823 | 64 |
| 544 | 3300049521 | Ga0501298_048523 | Ga0501298_048523_69_263 | 64 |
| 545 | 3300049521 | Ga0501298_127085 | Ga0501298_127085_236_430 | 64 |
| 546 | 3300049521 | Ga0501298_143533 | Ga0501298_143533_232_426 | 64 |
| 547 | 3300049521 | Ga0501298_171583 | Ga0501298_171583_230_424 | 64 |
| 548 | 3300049522 | Ga0501299_084854 | Ga0501299_084854_51_245 | 64 |
| 549 | 3300049522 | Ga0501299_099549 | Ga0501299_099549_150_344 | 64 |
| 550 | 3300049522 | Ga0501299_113300 | Ga0501299_113300_46_240 | 64 |
| 551 | 3300049568 | Ga0501031_0059330 | Ga0501031_0059330_1076_1270 | 64 |
| 552 | 3300049568 | Ga0501031_0546700 | Ga0501031_0546700_295_492 | 64 |
| 553 | 3300049568 | Ga0501031_0904167 | Ga0501031_0904167_257_451 | 64 |
| 554 | 3300049568 | Ga0501031_0937643 | Ga0501031_0937643_66_260 | 64 |
| 555 | 3300049569 | Ga0501032_0086786 | Ga0501032_0086786_912_1106 | 64 |
| 556 | 3300049569 | Ga0501032_0435519 | Ga0501032_0435519_388_582 | 64 |
| 557 | 3300049569 | Ga0501032_0567680 | Ga0501032_0567680_69_263 | 64 |
| 558 | 3300049570 | Ga0501033_0011373 | Ga0501033_0011373_1601_1795 | 64 |
| 559 | 3300049570 | Ga0501033_0264915 | Ga0501033_0264915_355_549 | 64 |
| 560 | 3300049570 | Ga0501033_0280197 | Ga0501033_0280197_645_839 | 64 |
| 561 | 3300049572 | Ga0501036_0001921 | Ga0501036_0001921_10823_11017 | 64 |
| 562 | 3300049572 | Ga0501036_0085385 | Ga0501036_0085385_2227_2421 | 64 |
| 563 | 3300049572 | Ga0501036_0199103 | Ga0501036_0199103_160_354 | 64 |
| 564 | 3300049572 | Ga0501036_0953458 | Ga0501036_0953458_316_510 | 64 |
| 565 | 3300049573 | Ga0501037_0013201 | Ga0501037_0013201_4341_4535 | 64 |
| 566 | 3300049573 | Ga0501037_0523020 | Ga0501037_0523020_367_561 | 64 |
| 567 | 3300049573 | Ga0501037_0916323 | Ga0501037_0916323_46_240 | 64 |
| 568 | 3300049574 | Ga0501038_0004982 | Ga0501038_0004982_4377_4571 | 64 |
| 569 | 3300049574 | Ga0501038_0960279 | Ga0501038_0960279_182_376 | 64 |
| 570 | 3300049575 | Ga0501039_0000477 | Ga0501039_0000477_19237_19431 | 64 |
| 571 | 3300049575 | Ga0501039_0024671 | Ga0501039_0024671_4252_4446 | 64 |
| 572 | 3300049575 | Ga0501039_0027089 | Ga0501039_0027089_866_1060 | 64 |
| 573 | 3300049575 | Ga0501039_0033414 | Ga0501039_0033414_1452_1646 | 64 |
| 574 | 3300049575 | Ga0501039_1301681 | Ga0501039_1301681_277_471 | 64 |
| 575 | 3300049575 | Ga0501039_1424419 | Ga0501039_1424419_233_427 | 64 |
| 576 | 3300049576 | Ga0501040_0000052 | Ga0501040_0000052_27383_27577 | 64 |
| 577 | 3300049576 | Ga0501040_0005360 | Ga0501040_0005360_7604_7798 | 64 |
| 578 | 3300049576 | Ga0501040_0113809 | Ga0501040_0113809_145_339 | 64 |
| 579 | 3300049576 | Ga0501040_0205892 | Ga0501040_0205892_508_702 | 64 |
| 580 | 3300049576 | Ga0501040_0531502 | Ga0501040_0531502_61_255 | 64 |
| 581 | 3300049577 | Ga0501041_0000038 | Ga0501041_0000038_27613_27807 | 64 |
| 582 | 3300049577 | Ga0501041_0015649 | Ga0501041_0015649_3465_3659 | 64 |
| 583 | 3300049577 | Ga0501041_0015993 | Ga0501041_0015993_3332_3526 | 64 |
| 584 | 3300049577 | Ga0501041_0240071 | Ga0501041_0240071_105_299 | 64 |
| 585 | 3300049577 | Ga0501041_0586744 | Ga0501041_0586744_282_476 | 64 |
| 586 | 3300049577 | Ga0501041_0981879 | Ga0501041_0981879_34_228 | 64 |
| 587 | 3300049578 | Ga0501042_0000048 | Ga0501042_0000048_23047_23241 | 64 |
| 588 | 3300049578 | Ga0501042_0111133 | Ga0501042_0111133_341_535 | 64 |
| 589 | 3300049578 | Ga0501042_0338390 | Ga0501042_0338390_352_546 | 64 |
| 590 | 3300049578 | Ga0501042_0461190 | Ga0501042_0461190_484_678 | 64 |
| 591 | 3300049578 | Ga0501042_0518961 | Ga0501042_0518961_425_619 | 64 |
| 592 | 3300049578 | Ga0501042_0646354 | Ga0501042_0646354_243_437 | 64 |
| 593 | 3300049578 | Ga0501042_0750397 | Ga0501042_0750397_340_534 | 64 |
| 594 | 3300049579 | Ga0501043_0043047 | Ga0501043_0043047_931_1125 | 64 |
| 595 | 3300049579 | Ga0501043_0630625 | Ga0501043_0630625_201_395 | 64 |
| 596 | 3300049580 | Ga0501046_0000271 | Ga0501046_0000271_25438_25632 | 64 |
| 597 | 3300049580 | Ga0501046_0012984 | Ga0501046_0012984_4640_4834 | 64 |
| 598 | 3300049580 | Ga0501046_0773226 | Ga0501046_0773226_414_608 | 64 |
| 599 | 3300049580 | Ga0501046_1083890 | Ga0501046_1083890_305_499 | 64 |
| 600 | 3300049581 | Ga0501047_0136139 | Ga0501047_0136139_608_802 | 64 |
| 601 | 3300049582 | Ga0501048_0000378 | Ga0501048_0000378_3578_3772 | 64 |
| 602 | 3300049582 | Ga0501048_0010966 | Ga0501048_0010966_2415_2609 | 64 |
| 603 | 3300049582 | Ga0501048_0525886 | Ga0501048_0525886_552_746 | 64 |
| 604 | 3300049584 | Ga0501068_0014809 | Ga0501068_0014809_932_1126 | 64 |
| 605 | 3300049584 | Ga0501068_0067058 | Ga0501068_0067058_895_1089 | 64 |
| 606 | 3300049584 | Ga0501068_0898316 | Ga0501068_0898316_174_368 | 64 |
| 607 | 3300049584 | Ga0501068_0939433 | Ga0501068_0939433_177_371 | 64 |
| 608 | 3300049585 | Ga0501069_0123294 | Ga0501069_0123294_1018_1212 | 64 |
| 609 | 3300049585 | Ga0501069_0408501 | Ga0501069_0408501_111_305 | 64 |
| 610 | 3300049585 | Ga0501069_0454186 | Ga0501069_0454186_276_470 | 64 |
| 611 | 3300049585 | Ga0501069_0541180 | Ga0501069_0541180_486_680 | 64 |
| 612 | 3300049586 | Ga0501070_0159893 | Ga0501070_0159893_42_236 | 64 |
| 613 | 3300049586 | Ga0501070_1376099 | Ga0501070_1376099_295_489 | 64 |
| 614 | 3300049587 | Ga0501071_0007914 | Ga0501071_0007914_5160_5354 | 64 |
| 615 | 3300049587 | Ga0501071_0027911 | Ga0501071_0027911_3398_3592 | 64 |
| 616 | 3300049587 | Ga0501071_0123447 | Ga0501071_0123447_1320_1514 | 64 |
| 617 | 3300049587 | Ga0501071_0128234 | Ga0501071_0128234_940_1134 | 64 |
| 618 | 3300049587 | Ga0501071_1164333 | Ga0501071_1164333_53_247 | 64 |
| 619 | 3300049587 | Ga0501071_1350089 | Ga0501071_1350089_338_532 | 64 |
| 620 | 3300049588 | Ga0501072_0008011 | Ga0501072_0008011_3737_3931 | 64 |
| 621 | 3300049588 | Ga0501072_0009822 | Ga0501072_0009822_5552_5746 | 64 |
| 622 | 3300049588 | Ga0501072_0098053 | Ga0501072_0098053_1379_1573 | 64 |
| 623 | 3300049588 | Ga0501072_0214228 | Ga0501072_0214228_191_385 | 64 |
| 624 | 3300049588 | Ga0501072_0480438 | Ga0501072_0480438_386_580 | 64 |
| 625 | 3300049588 | Ga0501072_0505954 | Ga0501072_0505954_686_880 | 64 |
| 626 | 3300049588 | Ga0501072_0701731 | Ga0501072_0701731_191_385 | 64 |
| 627 | 3300049588 | Ga0501072_0778182 | Ga0501072_0778182_322_516 | 64 |
| 628 | 3300049589 | Ga0501073_0087209 | Ga0501073_0087209_202_396 | 64 |
| 629 | 3300049589 | Ga0501073_0204289 | Ga0501073_0204289_100_294 | 64 |
| 630 | 3300049590 | Ga0501074_0007335 | Ga0501074_0007335_6775_6969 | 64 |
| 631 | 3300049590 | Ga0501074_0066914 | Ga0501074_0066914_431_625 | 64 |
| 632 | 3300049590 | Ga0501074_0156342 | Ga0501074_0156342_859_1053 | 64 |
| 633 | 3300049590 | Ga0501074_0472188 | Ga0501074_0472188_509_703 | 64 |
| 634 | 3300049591 | Ga0501075_0000180 | Ga0501075_0000180_5349_5543 | 64 |
| 635 | 3300049591 | Ga0501075_0027409 | Ga0501075_0027409_1945_2139 | 64 |
| 636 | 3300049591 | Ga0501075_0059419 | Ga0501075_0059419_1544_1738 | 64 |
| 637 | 3300049591 | Ga0501075_0076969 | Ga0501075_0076969_121_315 | 64 |
| 638 | 3300049591 | Ga0501075_0148471 | Ga0501075_0148471_482_676 | 64 |
| 639 | 3300049592 | Ga0501076_0000290 | Ga0501076_0000290_25619_25813 | 64 |
| 640 | 3300049592 | Ga0501076_0000319 | Ga0501076_0000319_5591_5785 | 64 |
| 641 | 3300049592 | Ga0501076_0103371 | Ga0501076_0103371_23_217 | 64 |
| 642 | 3300049592 | Ga0501076_0195588 | Ga0501076_0195588_415_609 | 64 |
| 643 | 3300049592 | Ga0501076_1359840 | Ga0501076_1359840_243_437 | 64 |
| 644 | 3300049593 | Ga0501077_0000222 | Ga0501077_0000222_13886_14080 | 64 |
| 645 | 3300049593 | Ga0501077_0104746 | Ga0501077_0104746_1130_1324 | 64 |
| 646 | 3300049593 | Ga0501077_0773240 | Ga0501077_0773240_371_565 | 64 |
| 647 | 3300049660 | Ga0501216_009907 | Ga0501216_009907_1241_1435 | 64 |
| 648 | 3300049667 | Ga0501230_090827 | Ga0501230_090827_274_468 | 64 |
| 649 | 3300049669 | Ga0501235_189635 | Ga0501235_189635_221_415 | 64 |
| 650 | 3300049670 | Ga0501236_060806 | Ga0501236_060806_140_334 | 64 |
| 651 | 3300049675 | Ga0501243_140459 | Ga0501243_140459_155_349 | 64 |
| 652 | 3300049686 | Ga0501257_249228 | Ga0501257_249228_147_341 | 64 |
| 653 | 3300049705 | Ga0501225_0046507 | Ga0501225_0046507_538_732 | 64 |
| 654 | 3300049741 | Ga0501079_0000061 | Ga0501079_0000061_22281_22475 | 64 |
| 655 | 3300049741 | Ga0501079_0047873 | Ga0501079_0047873_282_476 | 64 |
| 656 | 3300049741 | Ga0501079_0175760 | Ga0501079_0175760_820_1014 | 64 |
| 657 | 3300049741 | Ga0501079_0929415 | Ga0501079_0929415_437_631 | 64 |
| 658 | 3300049741 | Ga0501079_1020168 | Ga0501079_1020168_406_600 | 64 |
| 659 | 3300049741 | Ga0501079_1130720 | Ga0501079_1130720_230_424 | 64 |
| 660 | 3300049742 | Ga0501080_0007892 | Ga0501080_0007892_8683_8877 | 64 |
| 661 | 3300049742 | Ga0501080_0041403 | Ga0501080_0041403_2394_2588 | 64 |
| 662 | 3300049742 | Ga0501080_0311821 | Ga0501080_0311821_47_241 | 64 |
| 663 | 3300049742 | Ga0501080_0341293 | Ga0501080_0341293_46_240 | 64 |
| 664 | 3300049742 | Ga0501080_0940338 | Ga0501080_0940338_472_666 | 64 |
| 665 | 3300049743 | Ga0501081_0000110 | Ga0501081_0000110_26923_27117 | 64 |
| 666 | 3300049743 | Ga0501081_0005740 | Ga0501081_0005740_3192_3386 | 64 |
| 667 | 3300049743 | Ga0501081_0300918 | Ga0501081_0300918_937_1131 | 64 |
| 668 | 3300049743 | Ga0501081_0703957 | Ga0501081_0703957_315_509 | 64 |
| 669 | 3300049744 | Ga0501083_0081556 | Ga0501083_0081556_712_906 | 64 |
| 670 | 3300049744 | Ga0501083_0112833 | Ga0501083_0112833_131_325 | 64 |
| 671 | 3300049744 | Ga0501083_0743650 | Ga0501083_0743650_323_517 | 64 |
| 672 | 3300049767 | Ga0501270_067378 | Ga0501270_067378_264_458 | 64 |
| 673 | 3300049770 | Ga0501273_093281 | Ga0501273_093281_221_415 | 64 |
| 674 | 3300049779 | Ga0501283_029251 | Ga0501283_029251_436_630 | 64 |
| 675 | 3300049822 | Ga0501035_0021364 | Ga0501035_0021364_3422_3616 | 64 |
| 676 | 3300049823 | Ga0501044_0046768 | Ga0501044_0046768_3210_3404 | 64 |
| 677 | 3300049823 | Ga0501044_0612868 | Ga0501044_0612868_757_951 | 64 |
| 678 | 3300049824 | Ga0501045_0000038 | Ga0501045_0000038_38905_39099 | 64 |
| 679 | 3300049824 | Ga0501045_0010295 | Ga0501045_0010295_6329_6523 | 64 |
| 680 | 3300050507 | nmdc:mga05p37_1111789_c1 | nmdc:mga05p37_1111789_c1_158_358 | 64 |
| 681 | 3300050507 | nmdc:mga05p37_1549627_c1 | nmdc:mga05p37_1549627_c1_125_319 | 64 |
| 682 | 3300050507 | nmdc:mga05p37_1991478_c1 | nmdc:mga05p37_1991478_c1_87_281 | 64 |
| 683 | 3300050507 | nmdc:mga05p37_2835_c1 | nmdc:mga05p37_2835_c1_14224_14418 | 64 |
| 684 | 3300050507 | nmdc:mga05p37_628868_c1 | nmdc:mga05p37_628868_c1_884_1078 | 64 |
| 685 | 3300050507 | nmdc:mga05p37_869553_c1 | nmdc:mga05p37_869553_c1_214_408 | 64 |
| 686 | 3300050508 | nmdc:mga09592_107109_c1 | nmdc:mga09592_107109_c1_580_774 | 64 |
| 687 | 3300050508 | nmdc:mga09592_1506259_c1 | nmdc:mga09592_1506259_c1_221_421 | 64 |
| 688 | 3300050508 | nmdc:mga09592_15465_c1 | nmdc:mga09592_15465_c1_3246_3440 | 64 |
| 689 | 3300050508 | nmdc:mga09592_225263_c1 | nmdc:mga09592_225263_c1_753_947 | 64 |
| 690 | 3300050509 | nmdc:mga0qj67_1084972_c1 | nmdc:mga0qj67_1084972_c1_90_284 | 64 |
| 691 | 3300050509 | nmdc:mga0qj67_131916_c1 | nmdc:mga0qj67_131916_c1_1429_1623 | 64 |
| 692 | 3300050509 | nmdc:mga0qj67_169646_c1 | nmdc:mga0qj67_169646_c1_1445_1639 | 64 |
| 693 | 3300050509 | nmdc:mga0qj67_17987_c1 | nmdc:mga0qj67_17987_c1_3450_3644 | 64 |
| 694 | 3300050509 | nmdc:mga0qj67_33460_c1 | nmdc:mga0qj67_33460_c1_463_657 | 64 |
| 695 | 3300050509 | nmdc:mga0qj67_989403_c1 | nmdc:mga0qj67_989403_c1_295_489 | 64 |
| 696 | 3300050510 | nmdc:mga06r32_1275779_c1 | nmdc:mga06r32_1275779_c1_270_464 | 64 |
| 697 | 3300050510 | nmdc:mga06r32_1334071_c1 | nmdc:mga06r32_1334071_c1_335_529 | 64 |
| 698 | 3300050510 | nmdc:mga06r32_2009298_c1 | nmdc:mga06r32_2009298_c1_37_231 | 64 |
| 699 | 3300050510 | nmdc:mga06r32_213064_c1 | nmdc:mga06r32_213064_c1_43_237 | 64 |
| 700 | 3300050510 | nmdc:mga06r32_344765_c1 | nmdc:mga06r32_344765_c1_959_1153 | 64 |
| 701 | 3300050510 | nmdc:mga06r32_41056_c1 | nmdc:mga06r32_41056_c1_3209_3403 | 64 |
| 702 | 3300050510 | nmdc:mga06r32_434960_c1 | nmdc:mga06r32_434960_c1_171_365 | 64 |
| 703 | 3300050511 | nmdc:mga08y16_131646_c1 | nmdc:mga08y16_131646_c1_1389_1583 | 64 |
| 704 | 3300050511 | nmdc:mga08y16_1413623_c1 | nmdc:mga08y16_1413623_c1_441_635 | 64 |
| 705 | 3300050511 | nmdc:mga08y16_188039_c1 | nmdc:mga08y16_188039_c1_803_997 | 64 |
| 706 | 3300050511 | nmdc:mga08y16_48362_c1 | nmdc:mga08y16_48362_c1_1840_2034 | 64 |
| 707 | 3300050511 | nmdc:mga08y16_552806_c1 | nmdc:mga08y16_552806_c1_922_1116 | 64 |
| 708 | 3300050511 | nmdc:mga08y16_599224_c1 | nmdc:mga08y16_599224_c1_898_1092 | 64 |
| 709 | 3300050511 | nmdc:mga08y16_63695_c1 | nmdc:mga08y16_63695_c1_2867_3061 | 64 |
| 710 | 3300050512 | nmdc:mga0n895_1567869_c1 | nmdc:mga0n895_1567869_c1_151_345 | 64 |
| 711 | 3300050512 | nmdc:mga0n895_1888319_c1 | nmdc:mga0n895_1888319_c1_286_480 | 64 |
| 712 | 3300050512 | nmdc:mga0n895_2006044_c1 | nmdc:mga0n895_2006044_c1_152_346 | 64 |
| 713 | 3300050512 | nmdc:mga0n895_649792_c1 | nmdc:mga0n895_649792_c1_409_603 | 64 |
| 714 | 3300050513 | nmdc:mga0rr50_1112541_c1 | nmdc:mga0rr50_1112541_c1_215_409 | 64 |
| 715 | 3300050513 | nmdc:mga0rr50_132437_c1 | nmdc:mga0rr50_132437_c1_1394_1588 | 64 |
| 716 | 3300050513 | nmdc:mga0rr50_19252_c1 | nmdc:mga0rr50_19252_c1_603_797 | 64 |
| 717 | 3300050513 | nmdc:mga0rr50_346080_c1 | nmdc:mga0rr50_346080_c1_192_386 | 64 |
| 718 | 3300050513 | nmdc:mga0rr50_573443_c1 | nmdc:mga0rr50_573443_c1_294_488 | 64 |
| 719 | 3300050514 | nmdc:mga08x19_1210957_c1 | nmdc:mga08x19_1210957_c1_229_423 | 64 |
| 720 | 3300050514 | nmdc:mga08x19_1858_c1 | nmdc:mga08x19_1858_c1_3837_4031 | 64 |
| 721 | 3300050514 | nmdc:mga08x19_328372_c1 | nmdc:mga08x19_328372_c1_134_328 | 64 |
| 722 | 3300050514 | nmdc:mga08x19_40646_c1 | nmdc:mga08x19_40646_c1_737_931 | 64 |
| 723 | 3300050514 | nmdc:mga08x19_530202_c1 | nmdc:mga08x19_530202_c1_178_372 | 64 |
| 724 | 3300050514 | nmdc:mga08x19_74217_c1 | nmdc:mga08x19_74217_c1_408_602 | 64 |
| 725 | 3300050514 | nmdc:mga08x19_908167_c1 | nmdc:mga08x19_908167_c1_350_544 | 64 |
| 726 | 3300050514 | nmdc:mga08x19_91610_c1 | nmdc:mga08x19_91610_c1_1271_1471 | 64 |
| 727 | 3300050514 | nmdc:mga08x19_98427_c1 | nmdc:mga08x19_98427_c1_797_991 | 64 |
| 728 | 3300050515 | nmdc:mga0a205_1345393_c1 | nmdc:mga0a205_1345393_c1_147_341 | 64 |
| 729 | 3300050515 | nmdc:mga0a205_18247_c1 | nmdc:mga0a205_18247_c1_5856_6050 | 64 |
| 730 | 3300050515 | nmdc:mga0a205_34658_c1 | nmdc:mga0a205_34658_c1_2941_3135 | 64 |
| 731 | 3300050515 | nmdc:mga0a205_357921_c1 | nmdc:mga0a205_357921_c1_40_234 | 64 |
| 732 | 3300050515 | nmdc:mga0a205_590292_c1 | nmdc:mga0a205_590292_c1_175_369 | 64 |
| 733 | 3300054114 | Ga0501084_0005924 | Ga0501084_0005924_5566_5760 | 64 |
| 734 | 3300054114 | Ga0501084_0073589 | Ga0501084_0073589_371_565 | 64 |
| 735 | 3300054114 | Ga0501084_1073356 | Ga0501084_1073356_113_307 | 64 |
| 736 | 3300054114 | Ga0501084_1465999 | Ga0501084_1465999_111_305 | 64 |
| 737 | 3300059421 | Ga0590071_023052 | Ga0590071_023052_404_598 | 64 |
| 738 | 3300059423 | Ga0590074_087158 | Ga0590074_087158_87_281 | 64 |
| 739 | 3300059426 | Ga0590077_063350 | Ga0590077_063350_593_787 | 64 |
| 740 | 3300059426 | Ga0590077_082449 | Ga0590077_082449_51_245 | 64 |
| 741 | 3300059426 | Ga0590077_096320 | Ga0590077_096320_409_603 | 64 |
| 742 | 3300059426 | Ga0590077_146073 | Ga0590077_146073_221_415 | 64 |
| 743 | 3300060353 | Ga0501082_0000430 | Ga0501082_0000430_17795_17989 | 64 |
| 744 | 3300060353 | Ga0501082_0014186 | Ga0501082_0014186_5324_5518 | 64 |
| 745 | 3300060353 | Ga0501082_0097046 | Ga0501082_0097046_686_880 | 64 |
| 746 | 3300060353 | Ga0501082_0827566 | Ga0501082_0827566_70_264 | 64 |
| 747 | 3300060353 | Ga0501082_1607983 | Ga0501082_1607983_209_403 | 64 |
| 748 | 3300061734 | Ga0530510_0000186 | Ga0530510_0000186_12207_12401 | 64 |
| 749 | 3300061734 | Ga0530510_0001727 | Ga0530510_0001727_11675_11869 | 64 |
| 750 | 3300061734 | Ga0530510_0136650 | Ga0530510_0136650_820_1014 | 64 |
| 751 | 3300061734 | Ga0530510_0865813 | Ga0530510_0865813_273_467 | 64 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1uj8-assembly1.cif.gz_A | structures of orf3 in two crystal forms, a member of isc machinery of e. coli involved in the assembly of iron-sulfur clusters | 0.9082 | 1 | 63 |
| 2bzt-assembly1.cif.gz_A | nmr structure of the bacterial protein yfhj from e. coli | 0.8992 | 1 | 64 |
| 2bzt-assembly1.cif.gz_A | nmr structure of the bacterial protein yfhj from e. coli | 0.8863 | 1 | 64 |
| 1uj8-assembly1.cif.gz_A | structures of orf3 in two crystal forms, a member of isc machinery of e. coli involved in the assembly of iron-sulfur clusters | 0.8818 | 1 | 63 |
| 5okc-assembly2.cif.gz_B | crystal structure of the ctf18-1-8 module from ctf18-rfc | 0.5965 | 6 | 55 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1uj8A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like | 0.9082 | 1 | 63 | 1.10.10.600 |
| 2bztA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like | 0.8992 | 1 | 64 | 1.10.10.600 |
| 2bztA00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like | 0.8863 | 1 | 64 | 1.10.10.600 |
| 1uj8A00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like | 0.8818 | 1 | 63 | 1.10.10.600 |
| af_P34561_601_744_1.10.357.110 | Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Vacuolar protein sorting-associated protein 53, C-terminus | 0.6879 | 1 | 62 | 1.10.357.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6L5CA48-F1-model_v4 | deleted | 0.971 | 4 | 64 |
|
| AF-B6ALM1-F1-model_v4 | FeS assembly protein IscX | 0.9653 | 6 | 63 |
GO:0005829
GO:0008198 GO:0016226 |
| AF-A0A357V7S9-F1-model_v4 | Fe-S assembly protein IscX | 0.9638 | 13 | 64 |
GO:0005829
GO:0008198 GO:0016226 |
| AF-A0A1Y2K2Y4-F1-model_v4 | Putative FeS assembly protein IscX | 0.9636 | 7 | 64 |
GO:0005829
GO:0008198 GO:0016226 |
| AF-A0A1F8RIB8-F1-model_v4 | Fe-S assembly protein IscX | 0.9619 | 9 | 63 |
GO:0016226
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar