F479121

General Info

Members Datasets Scaffolds Average Seq Length
751 307 751 64

Family's Representative Sequence

Representative Sequence 3300031911|Ga0307412_11260357|Ga0307412_112603572
Length 74
Sequence VEAARNDRSLMKWTDTQDIAIALVEAHPDKDPKTVNFVDLYKWVLALPEFSDDPKRCGERILEAIQQSWIDEAE

Samples

Sample ID Description Type Environment
1 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
5 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
21 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
24 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
28 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
29 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
30 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
31 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
34 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
39 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
40 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
58 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
79 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300012494 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.yng.030610 Metagenome Rhizosphere
85 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
86 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
87 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
88 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
92 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
98 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
145 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
146 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
147 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
148 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
149 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
150 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
151 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
153 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
155 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
156 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
159 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
160 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
161 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
162 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
163 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
164 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
168 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
169 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
170 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
171 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
172 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
173 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
174 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
175 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
176 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
177 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
178 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
179 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
180 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
181 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
182 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
183 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
186 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
187 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
188 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
189 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
190 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
191 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
192 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
193 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
194 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
195 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
197 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
199 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
200 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
201 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
202 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
203 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
204 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
205 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
206 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
207 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
208 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
209 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
210 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
211 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
212 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
213 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
214 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
215 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
216 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
217 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
218 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
219 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
220 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
223 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
227 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
228 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
229 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
230 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
231 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
232 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
233 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
234 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
235 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
236 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
237 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
238 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
239 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
240 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
241 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
242 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
243 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
246 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
247 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
248 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
249 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
250 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
251 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
252 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
253 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
254 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
255 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
256 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
257 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
258 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
261 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
264 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
265 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
266 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
267 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
268 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
269 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
270 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
271 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
272 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
273 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
274 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
275 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
276 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
277 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
278 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
279 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
280 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
281 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
282 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
288 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
289 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
290 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
303 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
304 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
306 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
307 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 0.13
Rhizosphere 99.2
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0065704_10449634 3300005289 Bacteria 706
2 Ga0065707_10110299 3300005295 Bacteria 2435
3 Ga0065707_10160834 3300005295 Bacteria 1559
4 Ga0070690_100000048 3300005330 Bacteria 57196
5 Ga0070690_100346623 3300005330 Bacteria 1077
6 Ga0070690_100369302 3300005330 Bacteria 1046
7 Ga0070690_100855288 3300005330 Bacteria 709
8 Ga0070670_102175077 3300005331 Bacteria 511
9 Ga0070677_10637978 3300005333 Bacteria 594
10 Ga0068869_100003924 3300005334 Bacteria 9183
11 Ga0068869_100864874 3300005334 Bacteria 781
12 Ga0068869_101283501 3300005334 Bacteria 645
13 Ga0068869_101579773 3300005334 Bacteria 584
14 Ga0070666_10070556 3300005335 Bacteria 2377
15 Ga0070680_100002906 3300005336 Bacteria 12727
16 Ga0070680_100057644 3300005336 Bacteria 3176
17 Ga0070680_100144219 3300005336 Bacteria 1997
18 Ga0070680_100521636 3300005336 Bacteria 1017
19 Ga0070680_101675449 3300005336 Bacteria 551
20 Ga0070682_100059435 3300005337 Bacteria 2415
21 Ga0068868_100000169 3300005338 Bacteria 42949
22 Ga0068868_101601021 3300005338 Bacteria 612
23 Ga0070689_100052142 3300005340 Bacteria 3164
24 Ga0070689_100105537 3300005340 Bacteria 2234
25 Ga0070689_100221257 3300005340 Bacteria 1553
26 Ga0070689_100222797 3300005340 Bacteria 1548
27 Ga0070691_10005631 3300005341 Bacteria 5707
28 Ga0070691_10228333 3300005341 Bacteria 989
29 Ga0070691_10264147 3300005341 Bacteria 928
30 Ga0070691_10769561 3300005341 Bacteria 584
31 Ga0070687_100000112 3300005343 Bacteria 27473
32 Ga0070687_100375502 3300005343 Bacteria 925
33 Ga0070687_100765667 3300005343 Bacteria 681
34 Ga0070687_101110797 3300005343 Bacteria 579
35 Ga0070692_10000771 3300005345 Bacteria 10540
36 Ga0070692_10004733 3300005345 Bacteria 5710
37 Ga0070692_10077194 3300005345 Bacteria 1787
38 Ga0070692_10119083 3300005345 Bacteria 1470
39 Ga0070692_10574394 3300005345 Bacteria 742
40 Ga0070692_11407243 3300005345 Bacteria 504
41 Ga0070668_100118907 3300005347 Bacteria 2110
42 Ga0070669_100070052 3300005353 Bacteria 2592
43 Ga0070669_100573438 3300005353 Bacteria 943
44 Ga0070675_100056290 3300005354 Bacteria 3240
45 Ga0070675_100230333 3300005354 Bacteria 1616
46 Ga0070671_100001186 3300005355 Bacteria 19510
47 Ga0070674_100861481 3300005356 Bacteria 787
48 Ga0070688_100129267 3300005365 Unclassified 1702
49 Ga0070688_101754115 3300005365 Bacteria 509
50 Ga0070709_10762205 3300005434 Bacteria 757
51 Ga0070709_11009296 3300005434 Bacteria 662
52 Ga0070714_100185510 3300005435 Bacteria 1895
53 Ga0070714_101906510 3300005435 Bacteria 580
54 Ga0070710_11336412 3300005437 Bacteria 534
55 Ga0070701_10001982 3300005438 Bacteria 7754
56 Ga0070701_10020823 3300005438 Bacteria 3120
57 Ga0070701_11350862 3300005438 Bacteria 511
58 Ga0070705_100000275 3300005440 Bacteria 31164
59 Ga0070705_100005488 3300005440 Bacteria 6181
60 Ga0070705_100090996 3300005440 Bacteria 1900
61 Ga0070705_100195727 3300005440 Bacteria 1382
62 Ga0070705_100563316 3300005440 Bacteria 876
63 Ga0070700_100000718 3300005441 Bacteria 16353
64 Ga0070700_100006936 3300005441 Bacteria 6083
65 Ga0070700_100159819 3300005441 Bacteria 1550
66 Ga0070700_100312331 3300005441 Bacteria 1152
67 Ga0070700_100513280 3300005441 Bacteria 924
68 Ga0070700_100602125 3300005441 Bacteria 861
69 Ga0070700_100907483 3300005441 Bacteria 718
70 Ga0070694_100000608 3300005444 Bacteria 19748
71 Ga0070694_100009317 3300005444 Bacteria 6028
72 Ga0070694_100014517 3300005444 Bacteria 4932
73 Ga0070694_100110866 3300005444 Bacteria 1954
74 Ga0070694_100132063 3300005444 Bacteria 1805
75 Ga0070694_100141175 3300005444 Bacteria 1750
76 Ga0070694_101888735 3300005444 Bacteria 510
77 Ga0070708_101677815 3300005445 Bacteria 591
78 Ga0070708_102242505 3300005445 Bacteria 504
79 Ga0070678_100324300 3300005456 Bacteria 1316
80 Ga0070662_101118929 3300005457 Bacteria 676
81 Ga0070681_10000198 3300005458 Bacteria 47037
82 Ga0070681_10557601 3300005458 Bacteria 1060
83 Ga0070681_11361542 3300005458 Bacteria 633
84 Ga0068867_100000568 3300005459 Bacteria 24458
85 Ga0068867_100023523 3300005459 Bacteria 4410
86 Ga0070706_100167580 3300005467 Bacteria 2051
87 Ga0070707_101001884 3300005468 Unclassified 801
88 Ga0070699_100095806 3300005518 Bacteria 2599
89 Ga0070699_100204649 3300005518 Bacteria 1756
90 Ga0070699_100258097 3300005518 Bacteria 1558
91 Ga0070699_101647209 3300005518 Bacteria 588
92 Ga0070679_100024440 3300005530 Bacteria 5920
93 Ga0070684_100904293 3300005535 Bacteria 827
94 Ga0070684_102311780 3300005535 Bacteria 507
95 Ga0070697_100002931 3300005536 Bacteria 13126
96 Ga0070697_100095073 3300005536 Bacteria 2470
97 Ga0070697_100373071 3300005536 Bacteria 1235
98 Ga0068853_100079777 3300005539 Bacteria 2863
99 Ga0070672_100467010 3300005543 Bacteria 1088
100 Ga0070672_101632546 3300005543 Bacteria 579
101 Ga0070686_100002218 3300005544 Bacteria 10728
102 Ga0070686_100160293 3300005544 Bacteria 1584
103 Ga0070686_100244972 3300005544 Bacteria 1307
104 Ga0070695_100000176 3300005545 Bacteria 30422
105 Ga0070695_100003592 3300005545 Bacteria 9056
106 Ga0070695_100075647 3300005545 Bacteria 2216
107 Ga0070695_100260639 3300005545 Bacteria 1266
108 Ga0070695_100366367 3300005545 Bacteria 1084
109 Ga0070695_100516992 3300005545 Bacteria 926
110 Ga0070695_100995412 3300005545 Bacteria 682
111 Ga0070695_101020545 3300005545 Bacteria 674
112 Ga0070695_101208833 3300005545 Bacteria 622
113 Ga0070696_100000137 3300005546 Bacteria 39854
114 Ga0070696_100001735 3300005546 Bacteria 14279
115 Ga0070696_100067694 3300005546 Bacteria 2506
116 Ga0070696_100259271 3300005546 Bacteria 1318
117 Ga0070696_100408338 3300005546 Bacteria 1064
118 Ga0070696_100557879 3300005546 Bacteria 918
119 Ga0070693_100001113 3300005547 Bacteria 12062
120 Ga0070693_101195606 3300005547 Bacteria 584
121 Ga0070693_101487955 3300005547 Bacteria 529
122 Ga0070704_100000057 3300005549 Bacteria 36313
123 Ga0070704_100046477 3300005549 Bacteria 3027
124 Ga0070704_100110016 3300005549 Bacteria 2095
125 Ga0070704_100500892 3300005549 Bacteria 1054
126 Ga0070704_101859060 3300005549 Bacteria 558
127 Ga0068855_100118320 3300005563 Bacteria 3034
128 Ga0068854_100797180 3300005578 Bacteria 823
129 Ga0068856_100175279 3300005614 Bacteria 2157
130 Ga0068856_100362114 3300005614 Bacteria 1469
131 Ga0070702_100000016 3300005615 Bacteria 48066
132 Ga0070702_100230352 3300005615 Bacteria 1244
133 Ga0070702_100674737 3300005615 Bacteria 785
134 Ga0068859_100011860 3300005617 Bacteria 8754
135 Ga0068859_100028423 3300005617 Bacteria 5605
136 Ga0068859_100520407 3300005617 Bacteria 1285
137 Ga0068859_101151732 3300005617 Bacteria 854
138 Ga0068866_10000914 3300005718 Bacteria 12952
139 Ga0068866_10554953 3300005718 Bacteria 769
140 Ga0068861_100000199 3300005719 Bacteria 32165
141 Ga0068861_100021205 3300005719 Bacteria 4669
142 Ga0068870_10077337 3300005840 Bacteria 1830
143 Ga0068870_10269225 3300005840 Bacteria 1063
144 Ga0068870_11255553 3300005840 Bacteria 538
145 Ga0068863_101860187 3300005841 Bacteria 612
146 Ga0068858_100003393 3300005842 Bacteria 15847
147 Ga0068858_100399398 3300005842 Bacteria 1321
148 Ga0068858_101623321 3300005842 Bacteria 638
149 Ga0068860_100001230 3300005843 Bacteria 27942
150 Ga0068860_100212273 3300005843 Bacteria 1878
151 Ga0068860_100850506 3300005843 Bacteria 927
152 Ga0068862_100010417 3300005844 Bacteria 7676
153 Ga0068862_100032132 3300005844 Bacteria 4434
154 Ga0068862_100306441 3300005844 Bacteria 1462
155 Ga0068862_101573513 3300005844 Bacteria 664
156 Ga0081538_10160025 3300005981 Bacteria 1002
157 Ga0081539_10000842 3300005985 Bacteria 58746
158 Ga0070716_101642595 3300006173 Bacteria 529
159 Ga0097621_100001888 3300006237 Bacteria 14313
160 Ga0097621_101776504 3300006237 Bacteria 588
161 Ga0068871_100000120 3300006358 Bacteria 49031
162 Ga0075428_100025250 3300006844 Bacteria 6576
163 Ga0075428_100251107 3300006844 Bacteria 1906
164 Ga0075428_101137687 3300006844 Bacteria 824
165 Ga0075428_101408710 3300006844 Bacteria 731
166 Ga0075430_100008695 3300006846 Bacteria 8567
167 Ga0075430_100584181 3300006846 Bacteria 922
168 Ga0075430_100899021 3300006846 Bacteria 729
169 Ga0075430_101037516 3300006846 Bacteria 675
170 Ga0075430_101072680 3300006846 Bacteria 663
171 Ga0075430_101228111 3300006846 Bacteria 617
172 Ga0075431_100066842 3300006847 Bacteria 3711
173 Ga0075431_100146517 3300006847 Bacteria 2433
174 Ga0075431_100250762 3300006847 Bacteria 1798
175 Ga0075431_100351111 3300006847 Bacteria 1483
176 Ga0075431_101741357 3300006847 Bacteria 580
177 Ga0075431_101963753 3300006847 Bacteria 540
178 Ga0075433_10042272 3300006852 Bacteria 3953
179 Ga0075433_10336485 3300006852 Bacteria 1334
180 Ga0075434_100000073 3300006871 Bacteria 52987
181 Ga0075434_100119458 3300006871 Bacteria 2650
182 Ga0075434_100451066 3300006871 Bacteria 1307
183 Ga0075434_100485931 3300006871 Bacteria 1256
184 Ga0075434_101355167 3300006871 Bacteria 722
185 Ga0075429_100001130 3300006880 Bacteria 21515
186 Ga0075429_100428394 3300006880 Bacteria 1159
187 Ga0075429_100737243 3300006880 Bacteria 863
188 Ga0075429_101138282 3300006880 Bacteria 681
189 Ga0075429_101804621 3300006880 Bacteria 530
190 Ga0068865_100001461 3300006881 Bacteria 13771
191 Ga0068865_100029927 3300006881 Bacteria 3617
192 Ga0068865_101701000 3300006881 Bacteria 569
193 Ga0075436_100000205 3300006914 Bacteria 36621
194 Ga0075436_100038706 3300006914 Bacteria 3291
195 Ga0075436_100058404 3300006914 Bacteria 2664
196 Ga0075436_100094461 3300006914 Bacteria 2079
197 Ga0075436_100403480 3300006914 Bacteria 991
198 Ga0075436_100558744 3300006914 Bacteria 841
199 Ga0075436_101073376 3300006914 Bacteria 606
200 Ga0097620_100011861 3300006931 Bacteria 8754
201 Ga0097620_100028423 3300006931 Bacteria 5605
202 Ga0097620_100520376 3300006931 Bacteria 1285
203 Ga0097620_101151728 3300006931 Bacteria 854
204 Ga0075435_100006291 3300007076 Bacteria 8385
205 Ga0075435_100140284 3300007076 Bacteria 2027
206 Ga0075435_100223166 3300007076 Bacteria 1600
207 Ga0075435_100239981 3300007076 Bacteria 1541
208 Ga0075435_100809709 3300007076 Bacteria 816
209 Ga0099794_10021997 3300007265 Bacteria 2903
210 Ga0099794_10066967 3300007265 Bacteria 1753
211 Ga0099794_10438859 3300007265 Bacteria 684
212 Ga0105250_10020860 3300009092 Bacteria 2645
213 Ga0111539_10037024 3300009094 Bacteria 5895
214 Ga0111539_10065584 3300009094 Bacteria 4289
215 Ga0111539_10131269 3300009094 Bacteria 2933
216 Ga0111539_10168418 3300009094 Bacteria 2560
217 Ga0111539_10222278 3300009094 Bacteria 2199
218 Ga0111539_10772667 3300009094 Bacteria 1118
219 Ga0111539_11095879 3300009094 Bacteria 925
220 Ga0111539_11334901 3300009094 Bacteria 832
221 Ga0111539_12495474 3300009094 Bacteria 599
222 Ga0105245_10000259 3300009098 Bacteria 50388
223 Ga0105245_11512819 3300009098 Bacteria 722
224 Ga0114129_10002101 3300009147 Bacteria 27413
225 Ga0114129_10373021 3300009147 Bacteria 1885
226 Ga0114129_10405770 3300009147 Bacteria 1795
227 Ga0114129_10495723 3300009147 Unclassified 1596
228 Ga0114129_10864388 3300009147 Bacteria 1149
229 Ga0114129_11760995 3300009147 Bacteria 754
230 Ga0114129_11940992 3300009147 Bacteria 713
231 Ga0114129_11976176 3300009147 Bacteria 706
232 Ga0114129_12027214 3300009147 Bacteria 695
233 Ga0105243_10003095 3300009148 Bacteria 13686
234 Ga0105243_10045531 3300009148 Bacteria 3448
235 Ga0105241_10010209 3300009174 Bacteria 6897
236 Ga0105241_12341199 3300009174 Bacteria 532
237 Ga0105242_10036544 3300009176 Bacteria 3941
238 Ga0105242_12629685 3300009176 Bacteria 552
239 Ga0105242_13254707 3300009176 Bacteria 505
240 Ga0105248_10559731 3300009177 Bacteria 1290
241 Ga0105248_13338330 3300009177 Bacteria 510
242 Ga0105249_10001070 3300009553 Bacteria 24290
243 Ga0105249_10050687 3300009553 Bacteria 3784
244 Ga0105249_10377074 3300009553 Bacteria 1444
245 Ga0105246_11558813 3300011119 Bacteria 623
246 Ga0157341_1018316 3300012494 Bacteria 669
247 Ga0157345_1017302 3300012498 Bacteria 701
248 Ga0157371_10835412 3300013102 Bacteria 696
249 Ga0157369_11800822 3300013105 Bacteria 622
250 Ga0157374_11458235 3300013296 Bacteria 707
251 Ga0157374_12380551 3300013296 Bacteria 557
252 Ga0157378_10000576 3300013297 Bacteria 34686
253 Ga0157378_10012127 3300013297 Bacteria 7549
254 Ga0157378_11059085 3300013297 Bacteria 847
255 Ga0157378_11778107 3300013297 Unclassified 664
256 Ga0163162_10199606 3300013306 Bacteria 2129
257 Ga0163162_10270175 3300013306 Bacteria 1832
258 Ga0157372_10981400 3300013307 Bacteria 979
259 Ga0157372_11908413 3300013307 Bacteria 683
260 Ga0157372_12198757 3300013307 Bacteria 634
261 Ga0157375_10093020 3300013308 Bacteria 3080
262 Ga0157375_10424353 3300013308 Bacteria 1496
263 Ga0157380_10011328 3300014326 Bacteria 6441
264 Ga0157380_10170367 3300014326 Bacteria 1902
265 Ga0157380_12854062 3300014326 Bacteria 550
266 Ga0157377_10194371 3300014745 Bacteria 1284
267 Ga0157376_10003705 3300014969 Bacteria 10559
268 Ga0163161_11485260 3300017792 Bacteria 594
269 Ga0163161_11845188 3300017792 Bacteria 538
270 Ga0213876_10501877 3300021384 Bacteria 646
271 Ga0207697_10385181 3300025315 Bacteria 623
272 Ga0207696_1115335 3300025711 Bacteria 726
273 Ga0207642_10124344 3300025899 Bacteria 1336
274 Ga0207642_10183429 3300025899 Bacteria 1142
275 Ga0207688_10103278 3300025901 Bacteria 1648
276 Ga0207680_10098405 3300025903 Bacteria 1875
277 Ga0207680_10458517 3300025903 Bacteria 905
278 Ga0207699_10611808 3300025906 Bacteria 794
279 Ga0207645_10053737 3300025907 Bacteria 2574
280 Ga0207684_10398182 3300025910 Bacteria 1184
281 Ga0207654_10004685 3300025911 Bacteria 6919
282 Ga0207707_10003333 3300025912 Bacteria 14259
283 Ga0207663_10655419 3300025916 Bacteria 829
284 Ga0207660_10001340 3300025917 Bacteria 16476
285 Ga0207660_10020821 3300025917 Bacteria 4408
286 Ga0207660_10252495 3300025917 Bacteria 1392
287 Ga0207662_10000106 3300025918 Bacteria 40137
288 Ga0207662_10043801 3300025918 Bacteria 2641
289 Ga0207662_10064715 3300025918 Bacteria 2200
290 Ga0207662_10528478 3300025918 Bacteria 815
291 Ga0207652_10007736 3300025921 Bacteria 8632
292 Ga0207652_10030844 3300025921 Bacteria 4494
293 Ga0207646_10881409 3300025922 Bacteria 794
294 Ga0207681_10006318 3300025923 Bacteria 7273
295 Ga0207681_11232805 3300025923 Bacteria 628
296 Ga0207650_10776621 3300025925 Bacteria 811
297 Ga0207659_10062589 3300025926 Bacteria 2686
298 Ga0207659_10089394 3300025926 Bacteria 2297
299 Ga0207687_10004274 3300025927 Bacteria 9553
300 Ga0207664_10065290 3300025929 Bacteria 2913
301 Ga0207644_10000781 3300025931 Bacteria 20183
302 Ga0207644_11839724 3300025931 Bacteria 506
303 Ga0207706_10766185 3300025933 Bacteria 821
304 Ga0207686_10000883 3300025934 Bacteria 18123
305 Ga0207709_10003980 3300025935 Bacteria 8621
306 Ga0207709_10007609 3300025935 Bacteria 6011
307 Ga0207670_10067768 3300025936 Bacteria 2456
308 Ga0207670_10089674 3300025936 Bacteria 2171
309 Ga0207670_10370929 3300025936 Bacteria 1138
310 Ga0207670_10933109 3300025936 Bacteria 728
311 Ga0207669_10003349 3300025937 Bacteria 6939
312 Ga0207669_10811645 3300025937 Bacteria 776
313 Ga0207669_11952863 3300025937 Bacteria 502
314 Ga0207704_10000434 3300025938 Bacteria 18663
315 Ga0207704_10007398 3300025938 Bacteria 5185
316 Ga0207704_11267462 3300025938 Bacteria 630
317 Ga0207691_10119742 3300025940 Bacteria 2334
318 Ga0207711_10801650 3300025941 Bacteria 877
319 Ga0207689_10000376 3300025942 Bacteria 41990
320 Ga0207689_10371845 3300025942 Bacteria 1189
321 Ga0207689_11486601 3300025942 Bacteria 566
322 Ga0207661_11615836 3300025944 Bacteria 593
323 Ga0207667_10134989 3300025949 Bacteria 2541
324 Ga0207651_11016019 3300025960 Bacteria 741
325 Ga0207651_11571522 3300025960 Bacteria 592
326 Ga0207712_10005157 3300025961 Bacteria 8264
327 Ga0207712_10027095 3300025961 Bacteria 3824
328 Ga0207712_10225900 3300025961 Bacteria 1500
329 Ga0207668_10037290 3300025972 Bacteria 3252
330 Ga0207640_10060273 3300025981 Bacteria 2507
331 Ga0207677_10004790 3300026023 Bacteria 7300
332 Ga0207677_10653886 3300026023 Bacteria 928
333 Ga0207703_10001886 3300026035 Bacteria 18616
334 Ga0207703_10064059 3300026035 Bacteria 3016
335 Ga0207703_11826460 3300026035 Bacteria 584
336 Ga0207639_10050531 3300026041 Bacteria 3158
337 Ga0207708_10000239 3300026075 Bacteria 43452
338 Ga0207708_10036334 3300026075 Bacteria 3750
339 Ga0207708_10225905 3300026075 Bacteria 1502
340 Ga0207708_10246018 3300026075 Bacteria 1440
341 Ga0207708_10904513 3300026075 Bacteria 764
342 Ga0207708_11269594 3300026075 Bacteria 645
343 Ga0207708_12019003 3300026075 Bacteria 505
344 Ga0207702_10056135 3300026078 Bacteria 3342
345 Ga0207641_10474389 3300026088 Bacteria 1212
346 Ga0207648_10000369 3300026089 Bacteria 49386
347 Ga0207648_10002987 3300026089 Bacteria 17871
348 Ga0207674_10699519 3300026116 Bacteria 978
349 Ga0207675_100000651 3300026118 Bacteria 34173
350 Ga0207675_100002559 3300026118 Bacteria 18014
351 Ga0209967_1005806 3300027364 Bacteria 1667
352 Ga0209967_1006851 3300027364 Bacteria 1552
353 Ga0209981_1009968 3300027378 Bacteria 1302
354 Ga0209981_1037131 3300027378 Bacteria 723
355 Ga0209996_1042690 3300027395 Bacteria 676
356 Ga0209996_1054216 3300027395 Bacteria 610
357 Ga0210000_1009349 3300027462 Bacteria 1442
358 Ga0210000_1016142 3300027462 Bacteria 1127
359 Ga0209995_1010851 3300027471 Bacteria 1480
360 Ga0209995_1012130 3300027471 Bacteria 1404
361 Ga0209995_1076999 3300027471 Bacteria 572
362 Ga0209968_1007653 3300027526 Bacteria 1636
363 Ga0209968_1032701 3300027526 Bacteria 873
364 Ga0209968_1088572 3300027526 Bacteria 560
365 Ga0209999_1004248 3300027543 Bacteria 2578
366 Ga0209999_1035560 3300027543 Bacteria 929
367 Ga0210002_1032968 3300027617 Bacteria 865
368 Ga0210002_1056094 3300027617 Bacteria 683
369 Ga0209588_1056698 3300027671 Bacteria 1266
370 Ga0209588_1061104 3300027671 Bacteria 1218
371 Ga0209971_1006528 3300027682 Bacteria 2759
372 Ga0209971_1130901 3300027682 Bacteria 618
373 Ga0209966_1014489 3300027695 Bacteria 1472
374 Ga0209966_1023390 3300027695 Bacteria 1214
375 Ga0209974_10011132 3300027876 Bacteria 3026
376 Ga0209974_10163834 3300027876 Bacteria 808
377 Ga0207428_10010784 3300027907 Bacteria 8147
378 Ga0207428_10019374 3300027907 Bacteria 5803
379 Ga0207428_10286072 3300027907 Bacteria 1223
380 Ga0207428_10322863 3300027907 Bacteria 1140
381 Ga0268265_10000781 3300028380 Bacteria 30469
382 Ga0268265_10001333 3300028380 Bacteria 21108
383 Ga0268265_10539870 3300028380 Bacteria 1105
384 Ga0268265_11132614 3300028380 Bacteria 778
385 Ga0268265_11891433 3300028380 Bacteria 603
386 Ga0268265_12491338 3300028380 Bacteria 523
387 Ga0268264_10001450 3300028381 Bacteria 22200
388 Ga0268264_10358617 3300028381 Bacteria 1390
389 Ga0268264_10617457 3300028381 Bacteria 1070
390 Ga0307408_100124562 3300031548 Bacteria 2002
391 Ga0307408_100328650 3300031548 Bacteria 1290
392 Ga0307408_100483338 3300031548 Bacteria 1081
393 Ga0307408_100558767 3300031548 Bacteria 1011
394 Ga0307408_100961731 3300031548 Bacteria 785
395 Ga0307408_101289976 3300031548 Bacteria 684
396 Ga0307408_102097161 3300031548 Bacteria 545
397 Ga0316575_10006460 3300031665 Bacteria 4219
398 Ga0307405_10166892 3300031731 Bacteria 1566
399 Ga0307405_10471668 3300031731 Bacteria 1000
400 Ga0307413_11098741 3300031824 Bacteria 687
401 Ga0307406_10254138 3300031901 Bacteria 1326
402 Ga0307406_11613841 3300031901 Bacteria 573
403 Ga0307407_10210867 3300031903 Bacteria 1308
404 Ga0307407_11689568 3300031903 Bacteria 504
405 Ga0307412_11260357 3300031911 Bacteria 664
406 Ga0307409_100169468 3300031995 Bacteria 1920
407 Ga0307409_102558923 3300031995 Bacteria 539
408 Ga0307416_100143175 3300032002 Bacteria 2177
409 Ga0307416_100191358 3300032002 Bacteria 1930
410 Ga0307416_100323996 3300032002 Bacteria 1545
411 Ga0307416_100689954 3300032002 Bacteria 1109
412 Ga0307416_100778181 3300032002 Bacteria 1051
413 Ga0307411_10151900 3300032005 Bacteria 1722
414 Ga0307411_10434441 3300032005 Bacteria 1094
415 Ga0307411_11042508 3300032005 Bacteria 734
416 Ga0307411_11219492 3300032005 Bacteria 683
417 Ga0307415_100624731 3300032126 Bacteria 962
418 Ga0373930_0043239 3300034816 Bacteria 966
419 Ga0373948_0011088 3300034817 Bacteria 1586
420 Ga0373950_0059922 3300034818 Bacteria 763
421 Ga0373958_0042239 3300034819 Bacteria 936
422 Ga0373959_0005843 3300034820 Bacteria 2027
423 Ga0373938_0003713 3300034957 Bacteria 2516
424 Ga0373938_0256590 3300034957 Bacteria 502
425 Ga0373926_0000230 3300035083 Bacteria 13313
426 Ga0373928_0019093 3300035084 Bacteria 1427
427 Ga0373929_0032794 3300035085 Bacteria 1119
428 Ga0373929_0137915 3300035085 Bacteria 645
429 Ga0373929_0158838 3300035085 Bacteria 611
430 Ga0373940_0027896 3300035088 Bacteria 1487
431 Ga0373940_0097071 3300035088 Bacteria 890
432 Ga0373940_0169713 3300035088 Bacteria 704
433 Ga0373944_0001903 3300035089 Bacteria 5278
434 Ga0373949_0053680 3300035090 Bacteria 1021
435 Ga0373949_0231393 3300035090 Bacteria 565
436 Ga0373952_0010396 3300035092 Bacteria 1798
437 Ga0373952_0069643 3300035092 Bacteria 877
438 Ga0373923_0140381 3300035111 Bacteria 1092
439 Ga0373932_0005565 3300035112 Bacteria 2963
440 Ga0373932_0202463 3300035112 Bacteria 706
441 Ga0373936_0018435 3300035113 Bacteria 2696
442 Ga0373936_0304874 3300035113 Bacteria 719
443 Ga0373939_0126159 3300035114 Bacteria 908
444 Ga0373939_0280336 3300035114 Bacteria 658
445 Ga0373941_0039893 3300035115 Bacteria 1445
446 Ga0373945_0004779 3300035116 Bacteria 4312
447 Ga0373945_0137355 3300035116 Bacteria 983
448 Ga0373960_0023136 3300035121 Bacteria 1671
449 Ga0373943_0020057 3300035170 Bacteria 3078
450 Ga0373943_0176629 3300035170 Bacteria 1171
451 Ga0373946_0005892 3300035171 Bacteria 4440
452 Ga0373942_0013904 3300035207 Bacteria 1941
453 Ga0373942_0078048 3300035207 Bacteria 978
454 Ga0373942_0183233 3300035207 Bacteria 687
455 Ga0373961_0008933 3300035241 Bacteria 2444
456 Ga0373962_0082296 3300035242 Bacteria 979
457 Ga0373962_0124605 3300035242 Bacteria 825
458 Ga0316574_0005586 3300035398 Bacteria 6719
459 Ga0373924_0059852 3300035410 Bacteria 1592
460 Ga0373931_0002129 3300035691 Bacteria 8722
461 Ga0373931_0004456 3300035691 Bacteria 6400
462 Ga0373931_0014988 3300035691 Bacteria 3798
463 Ga0373931_0128940 3300035691 Bacteria 1454
464 Ga0373931_0679438 3300035691 Bacteria 678
465 Ga0373935_0010842 3300035692 Bacteria 5474
466 Ga0373935_0094772 3300035692 Bacteria 1959
467 Ga0373927_0023238 3300035695 Bacteria 4061
468 Ga0373927_0136658 3300035695 Bacteria 1602
469 Ga0373927_0445904 3300035695 Bacteria 855
470 Ga0373947_0036854 3300035725 Bacteria 2900
471 Ga0373947_0046108 3300035725 Bacteria 2609
472 Ga0373925_0114896 3300037068 Bacteria 2083
473 Ga0373925_0212145 3300037068 Bacteria 1542
474 Ga0395905_1257181 3300037471 Bacteria 644
475 Ga0436365_0682788 3300039437 Bacteria 646
476 Ga0439436_0135206 3300041404 Bacteria 692
477 Ga0439439_0021515 3300041406 Bacteria 1608
478 Ga0439461_0002899 3300041410 Bacteria 2780
479 Ga0451839_0172504 3300041496 Bacteria 680
480 Ga0451839_0709667 3300041496 Bacteria 595
481 Ga0451849_1571619 3300041505 Bacteria 590
482 Ga0439441_000488 3300042001 Bacteria 4310
483 Ga0439441_045240 3300042001 Bacteria 893
484 Ga0439443_024153 3300042003 Bacteria 973
485 Ga0439443_109362 3300042003 Bacteria 535
486 Ga0439451_031250 3300042009 Bacteria 1070
487 Ga0439454_054397 3300042011 Bacteria 683
488 Ga0439456_159810 3300042013 Bacteria 527
489 Ga0439462_0012540 3300042015 Bacteria 2166
490 Ga0439462_0047167 3300042015 Bacteria 1155
491 Ga0450923_114106 3300042125 Bacteria 633
492 Ga0439446_0099969 3300042156 Bacteria 916
493 Ga0439446_0106820 3300042156 Bacteria 890
494 Ga0439434_0000076 3300042435 Bacteria 24744
495 Ga0439434_0103290 3300042435 Bacteria 919
496 Ga0439434_0288979 3300042435 Bacteria 565
497 Ga0439435_0001056 3300042436 Bacteria 4863
498 Ga0439435_0098919 3300042436 Bacteria 894
499 Ga0439435_0234829 3300042436 Bacteria 613
500 Ga0439444_0110830 3300042437 Bacteria 631
501 Ga0439460_0012019 3300042461 Bacteria 2239
502 Ga0439460_0040964 3300042461 Bacteria 1359
503 Ga0439460_0333123 3300042461 Bacteria 534
504 Ga0451577_0015044 3300042876 Bacteria 7198
505 Ga0466964_0754953 3300044706 Bacteria 546
506 Ga0466971_0284783 3300044719 Bacteria 791
507 Ga0466960_0133029 3300044901 Bacteria 1315
508 Ga0451576_0006734 3300045051 Bacteria 13997
509 Ga0451576_0033552 3300045051 Bacteria 5456
510 Ga0451576_0090352 3300045051 Bacteria 3185
511 Ga0451576_1015913 3300045051 Bacteria 869
512 Ga0451576_1282757 3300045051 Bacteria 764
513 Ga0451576_1310889 3300045051 Bacteria 755
514 Ga0451576_1717735 3300045051 Bacteria 650
515 Ga0466967_0113879 3300045976 Bacteria 2489
516 Ga0495603_0005705 3300046455 Bacteria 7441
517 Ga0495580_0023847 3300046472 Bacteria 4486
518 Ga0495582_0034547 3300046473 Bacteria 2779
519 Ga0495639_0005524 3300046475 Bacteria 5442
520 Ga0495584_0291568 3300046491 Bacteria 829
521 Ga0495630_0646802 3300046517 Bacteria 810
522 Ga0495666_0013837 3300046526 Bacteria 4023
523 Ga0495642_0449817 3300046528 Bacteria 569
524 Ga0495586_0484857 3300046535 Bacteria 713
525 Ga0495598_0052961 3300046537 Bacteria 1228
526 Ga0495598_0164097 3300046537 Bacteria 783
527 Ga0495621_0111561 3300046539 Bacteria 1049
528 Ga0495621_0123251 3300046539 Bacteria 1003
529 Ga0495622_0120892 3300046557 Bacteria 1196
530 Ga0495656_0127289 3300046615 Bacteria 1209
531 Ga0495659_0011438 3300046664 Bacteria 2858
532 Ga0495659_0227357 3300046664 Bacteria 772
533 Ga0495588_0044030 3300046674 Bacteria 2285
534 Ga0495647_0001395 3300046681 Bacteria 7454
535 Ga0495658_0003610 3300046683 Bacteria 7661
536 Ga0495669_0110952 3300046684 Bacteria 1280
537 Ga0495636_0421976 3300047318 Bacteria 638
538 Ga0495676_0011940 3300047321 Bacteria 7838
539 Ga0495677_0374455 3300047445 Bacteria 563
540 Ga0496106_0159383 3300048909 Bacteria 1784
541 Ga0501292_081566 3300049515 Bacteria 616
542 Ga0501297_069010 3300049520 Bacteria 555
543 Ga0501298_040277 3300049521 Bacteria 946
544 Ga0501298_048523 3300049521 Bacteria 876
545 Ga0501298_127085 3300049521 Bacteria 605
546 Ga0501298_143533 3300049521 Bacteria 579
547 Ga0501298_171583 3300049521 Bacteria 540
548 Ga0501299_084854 3300049522 Bacteria 710
549 Ga0501299_099549 3300049522 Bacteria 673
550 Ga0501299_113300 3300049522 Bacteria 644
551 Ga0501031_0059330 3300049568 Bacteria 2493
552 Ga0501031_0546700 3300049568 Bacteria 746
553 Ga0501031_0904167 3300049568 Bacteria 565
554 Ga0501031_0937643 3300049568 Bacteria 554
555 Ga0501032_0086786 3300049569 Bacteria 2079
556 Ga0501032_0435519 3300049569 Bacteria 841
557 Ga0501032_0567680 3300049569 Bacteria 723
558 Ga0501033_0011373 3300049570 Bacteria 6810
559 Ga0501033_0264915 3300049570 Bacteria 1216
560 Ga0501033_0280197 3300049570 Bacteria 1177
561 Ga0501036_0001921 3300049572 Bacteria 16137
562 Ga0501036_0085385 3300049572 Bacteria 2668
563 Ga0501036_0199103 3300049572 Bacteria 1685
564 Ga0501036_0953458 3300049572 Bacteria 703
565 Ga0501037_0013201 3300049573 Bacteria 6089
566 Ga0501037_0523020 3300049573 Bacteria 803
567 Ga0501037_0916323 3300049573 Bacteria 574
568 Ga0501038_0004982 3300049574 Bacteria 12341
569 Ga0501038_0960279 3300049574 Bacteria 629
570 Ga0501039_0000477 3300049575 Bacteria 28990
571 Ga0501039_0024671 3300049575 Bacteria 4619
572 Ga0501039_0027089 3300049575 Bacteria 4408
573 Ga0501039_0033414 3300049575 Bacteria 3966
574 Ga0501039_1301681 3300049575 Bacteria 561
575 Ga0501039_1424419 3300049575 Bacteria 533
576 Ga0501040_0000052 3300049576 Bacteria 54195
577 Ga0501040_0005360 3300049576 Bacteria 8294
578 Ga0501040_0113809 3300049576 Bacteria 1893
579 Ga0501040_0205892 3300049576 Bacteria 1398
580 Ga0501040_0531502 3300049576 Unclassified 848
581 Ga0501041_0000038 3300049577 Bacteria 44285
582 Ga0501041_0015649 3300049577 Bacteria 4506
583 Ga0501041_0015993 3300049577 Bacteria 4459
584 Ga0501041_0240071 3300049577 Bacteria 1139
585 Ga0501041_0586744 3300049577 Bacteria 711
586 Ga0501041_0981879 3300049577 Bacteria 543
587 Ga0501042_0000048 3300049578 Bacteria 40877
588 Ga0501042_0111133 3300049578 Bacteria 1973
589 Ga0501042_0338390 3300049578 Bacteria 1088
590 Ga0501042_0461190 3300049578 Bacteria 922
591 Ga0501042_0518961 3300049578 Bacteria 865
592 Ga0501042_0646354 3300049578 Bacteria 769
593 Ga0501042_0750397 3300049578 Bacteria 710
594 Ga0501043_0043047 3300049579 Bacteria 3549
595 Ga0501043_0630625 3300049579 Bacteria 789
596 Ga0501046_0000271 3300049580 Bacteria 52841
597 Ga0501046_0012984 3300049580 Bacteria 7072
598 Ga0501046_0773226 3300049580 Bacteria 674
599 Ga0501046_1083890 3300049580 Bacteria 554
600 Ga0501047_0136139 3300049581 Bacteria 2337
601 Ga0501048_0000378 3300049582 Bacteria 30854
602 Ga0501048_0010966 3300049582 Bacteria 6761
603 Ga0501048_0525886 3300049582 Bacteria 848
604 Ga0501068_0014809 3300049584 Bacteria 4464
605 Ga0501068_0067058 3300049584 Bacteria 2186
606 Ga0501068_0898316 3300049584 Bacteria 583
607 Ga0501068_0939433 3300049584 Bacteria 570
608 Ga0501069_0123294 3300049585 Bacteria 1481
609 Ga0501069_0408501 3300049585 Bacteria 804
610 Ga0501069_0454186 3300049585 Bacteria 762
611 Ga0501069_0541180 3300049585 Bacteria 696
612 Ga0501070_0159893 3300049586 Bacteria 1857
613 Ga0501070_1376099 3300049586 Bacteria 537
614 Ga0501071_0007914 3300049587 Bacteria 7009
615 Ga0501071_0027911 3300049587 Bacteria 3973
616 Ga0501071_0123447 3300049587 Bacteria 1920
617 Ga0501071_0128234 3300049587 Bacteria 1884
618 Ga0501071_1164333 3300049587 Bacteria 596
619 Ga0501071_1350089 3300049587 Bacteria 551
620 Ga0501072_0008011 3300049588 Bacteria 8018
621 Ga0501072_0009822 3300049588 Bacteria 7274
622 Ga0501072_0098053 3300049588 Bacteria 2329
623 Ga0501072_0214228 3300049588 Bacteria 1535
624 Ga0501072_0480438 3300049588 Bacteria 983
625 Ga0501072_0505954 3300049588 Bacteria 955
626 Ga0501072_0701731 3300049588 Bacteria 795
627 Ga0501072_0778182 3300049588 Bacteria 750
628 Ga0501073_0087209 3300049589 Bacteria 2171
629 Ga0501073_0204289 3300049589 Bacteria 1366
630 Ga0501074_0007335 3300049590 Bacteria 7972
631 Ga0501074_0066914 3300049590 Bacteria 2584
632 Ga0501074_0156342 3300049590 Bacteria 1629
633 Ga0501074_0472188 3300049590 Bacteria 889
634 Ga0501075_0000180 3300049591 Bacteria 32596
635 Ga0501075_0027409 3300049591 Bacteria 4199
636 Ga0501075_0059419 3300049591 Bacteria 2880
637 Ga0501075_0076969 3300049591 Bacteria 2524
638 Ga0501075_0148471 3300049591 Bacteria 1787
639 Ga0501076_0000290 3300049592 Bacteria 31327
640 Ga0501076_0000319 3300049592 Bacteria 29725
641 Ga0501076_0103371 3300049592 Bacteria 2298
642 Ga0501076_0195588 3300049592 Bacteria 1651
643 Ga0501076_1359840 3300049592 Bacteria 584
644 Ga0501077_0000222 3300049593 Bacteria 33397
645 Ga0501077_0104746 3300049593 Bacteria 1793
646 Ga0501077_0773240 3300049593 Bacteria 617
647 Ga0501216_009907 3300049660 Bacteria 1526
648 Ga0501230_090827 3300049667 Bacteria 649
649 Ga0501235_189635 3300049669 Bacteria 552
650 Ga0501236_060806 3300049670 Bacteria 670
651 Ga0501243_140459 3300049675 Bacteria 510
652 Ga0501257_249228 3300049686 Bacteria 526
653 Ga0501225_0046507 3300049705 Bacteria 1203
654 Ga0501079_0000061 3300049741 Bacteria 48925
655 Ga0501079_0047873 3300049741 Bacteria 3299
656 Ga0501079_0175760 3300049741 Bacteria 1670
657 Ga0501079_0929415 3300049741 Bacteria 685
658 Ga0501079_1020168 3300049741 Bacteria 652
659 Ga0501079_1130720 3300049741 Bacteria 617
660 Ga0501080_0007892 3300049742 Bacteria 9637
661 Ga0501080_0041403 3300049742 Bacteria 4293
662 Ga0501080_0311821 3300049742 Bacteria 1426
663 Ga0501080_0341293 3300049742 Bacteria 1353
664 Ga0501080_0940338 3300049742 Bacteria 752
665 Ga0501081_0000110 3300049743 Bacteria 34989
666 Ga0501081_0005740 3300049743 Bacteria 8036
667 Ga0501081_0300918 3300049743 Bacteria 1176
668 Ga0501081_0703957 3300049743 Bacteria 758
669 Ga0501083_0081556 3300049744 Bacteria 2144
670 Ga0501083_0112833 3300049744 Bacteria 1786
671 Ga0501083_0743650 3300049744 Unclassified 638
672 Ga0501270_067378 3300049767 Bacteria 685
673 Ga0501273_093281 3300049770 Bacteria 514
674 Ga0501283_029251 3300049779 Bacteria 917
675 Ga0501035_0021364 3300049822 Bacteria 5950
676 Ga0501044_0046768 3300049823 Bacteria 4479
677 Ga0501044_0612868 3300049823 Bacteria 981
678 Ga0501045_0000038 3300049824 Bacteria 55579
679 Ga0501045_0010295 3300049824 Bacteria 6552
680 nmdc:mga05p37_1111789_c1 3300050507 Bacteria 826
681 nmdc:mga05p37_1549627_c1 3300050507 Bacteria 656
682 nmdc:mga05p37_1991478_c1 3300050507 Bacteria 550
683 nmdc:mga05p37_2835_c1 3300050507 Bacteria 20152
684 nmdc:mga05p37_628868_c1 3300050507 Bacteria 1206
685 nmdc:mga05p37_869553_c1 3300050507 Bacteria 976
686 nmdc:mga09592_107109_c1 3300050508 Bacteria 2398
687 nmdc:mga09592_1506259_c1 3300050508 Bacteria 547
688 nmdc:mga09592_15465_c1 3300050508 Bacteria 6236
689 nmdc:mga09592_225263_c1 3300050508 Bacteria 1625
690 nmdc:mga0qj67_1084972_c1 3300050509 Bacteria 626
691 nmdc:mga0qj67_131916_c1 3300050509 Bacteria 2024
692 nmdc:mga0qj67_169646_c1 3300050509 Bacteria 1772
693 nmdc:mga0qj67_17987_c1 3300050509 Bacteria 5382
694 nmdc:mga0qj67_33460_c1 3300050509 Bacteria 4011
695 nmdc:mga0qj67_989403_c1 3300050509 Bacteria 660
696 nmdc:mga06r32_1275779_c1 3300050510 Bacteria 679
697 nmdc:mga06r32_1334071_c1 3300050510 Bacteria 661
698 nmdc:mga06r32_2009298_c1 3300050510 Bacteria 512
699 nmdc:mga06r32_213064_c1 3300050510 Bacteria 1920
700 nmdc:mga06r32_344765_c1 3300050510 Bacteria 1474
701 nmdc:mga06r32_41056_c1 3300050510 Bacteria 4394
702 nmdc:mga06r32_434960_c1 3300050510 Bacteria 1293
703 nmdc:mga08y16_131646_c1 3300050511 Bacteria 2601
704 nmdc:mga08y16_1413623_c1 3300050511 Bacteria 659
705 nmdc:mga08y16_188039_c1 3300050511 Bacteria 2143
706 nmdc:mga08y16_48362_c1 3300050511 Bacteria 4452
707 nmdc:mga08y16_552806_c1 3300050511 Bacteria 1165
708 nmdc:mga08y16_599224_c1 3300050511 Bacteria 1111
709 nmdc:mga08y16_63695_c1 3300050511 Bacteria 3851
710 nmdc:mga0n895_1567869_c1 3300050512 Bacteria 624
711 nmdc:mga0n895_1888319_c1 3300050512 Bacteria 556
712 nmdc:mga0n895_2006044_c1 3300050512 Bacteria 536
713 nmdc:mga0n895_649792_c1 3300050512 Bacteria 1054
714 nmdc:mga0rr50_1112541_c1 3300050513 Bacteria 672
715 nmdc:mga0rr50_132437_c1 3300050513 Bacteria 1998
716 nmdc:mga0rr50_19252_c1 3300050513 Bacteria 4603
717 nmdc:mga0rr50_346080_c1 3300050513 Bacteria 1249
718 nmdc:mga0rr50_573443_c1 3300050513 Bacteria 961
719 nmdc:mga08x19_1210957_c1 3300050514 Bacteria 535
720 nmdc:mga08x19_1858_c1 3300050514 Bacteria 12938
721 nmdc:mga08x19_328372_c1 3300050514 Bacteria 1065
722 nmdc:mga08x19_40646_c1 3300050514 Bacteria 2960
723 nmdc:mga08x19_530202_c1 3300050514 Bacteria 832
724 nmdc:mga08x19_74217_c1 3300050514 Bacteria 2222
725 nmdc:mga08x19_908167_c1 3300050514 Bacteria 626
726 nmdc:mga08x19_91610_c1 3300050514 Bacteria 2007
727 nmdc:mga08x19_98427_c1 3300050514 Bacteria 1938
728 nmdc:mga0a205_1345393_c1 3300050515 Bacteria 562
729 nmdc:mga0a205_18247_c1 3300050515 Bacteria 6592
730 nmdc:mga0a205_34658_c1 3300050515 Bacteria 4844
731 nmdc:mga0a205_357921_c1 3300050515 Bacteria 1326
732 nmdc:mga0a205_590292_c1 3300050515 Bacteria 964
733 Ga0501084_0005924 3300054114 Bacteria 10067
734 Ga0501084_0073589 3300054114 Bacteria 2861
735 Ga0501084_1073356 3300054114 Bacteria 676
736 Ga0501084_1465999 3300054114 Bacteria 571
737 Ga0590071_023052 3300059421 Bacteria 1470
738 Ga0590074_087158 3300059423 Bacteria 600
739 Ga0590077_063350 3300059426 Bacteria 840
740 Ga0590077_082449 3300059426 Bacteria 741
741 Ga0590077_096320 3300059426 Bacteria 689
742 Ga0590077_146073 3300059426 Bacteria 565
743 Ga0501082_0000430 3300060353 Bacteria 37227
744 Ga0501082_0014186 3300060353 Bacteria 6858
745 Ga0501082_0097046 3300060353 Bacteria 2548
746 Ga0501082_0827566 3300060353 Bacteria 810
747 Ga0501082_1607983 3300060353 Bacteria 567
748 Ga0530510_0000186 3300061734 Bacteria 37940
749 Ga0530510_0001727 3300061734 Bacteria 14851
750 Ga0530510_0136650 3300061734 Bacteria 1805
751 Ga0530510_0865813 3300061734 Bacteria 690

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005355 Ga0070671_100001186 Ga0070671_10000118613 63
2 3300006871 Ga0075434_100119458 Ga0075434_1001194583 63
3 3300013297 Ga0157378_10012127 Ga0157378_100121277 63
4 3300025903 Ga0207680_10098405 Ga0207680_100984053 63
5 3300025931 Ga0207644_10000781 Ga0207644_100007815 63
6 3300025937 Ga0207669_11952863 Ga0207669_119528632 63
7 3300005289 Ga0065704_10449634 Ga0065704_104496342 64
8 3300005295 Ga0065707_10110299 Ga0065707_101102993 64
9 3300005295 Ga0065707_10160834 Ga0065707_101608342 64
10 3300005330 Ga0070690_100000048 Ga0070690_10000004819 64
11 3300005330 Ga0070690_100346623 Ga0070690_1003466233 64
12 3300005330 Ga0070690_100369302 Ga0070690_1003693023 64
13 3300005330 Ga0070690_100855288 Ga0070690_1008552882 64
14 3300005331 Ga0070670_102175077 Ga0070670_1021750772 64
15 3300005333 Ga0070677_10637978 Ga0070677_106379782 64
16 3300005334 Ga0068869_100003924 Ga0068869_1000039243 64
17 3300005334 Ga0068869_100864874 Ga0068869_1008648742 64
18 3300005334 Ga0068869_101283501 Ga0068869_1012835012 64
19 3300005334 Ga0068869_101579773 Ga0068869_1015797732 64
20 3300005335 Ga0070666_10070556 Ga0070666_100705563 64
21 3300005336 Ga0070680_100002906 Ga0070680_10000290610 64
22 3300005336 Ga0070680_100057644 Ga0070680_1000576443 64
23 3300005336 Ga0070680_100144219 Ga0070680_1001442193 64
24 3300005336 Ga0070680_100521636 Ga0070680_1005216364 64
25 3300005336 Ga0070680_101675449 Ga0070680_1016754491 64
26 3300005337 Ga0070682_100059435 Ga0070682_1000594354 64
27 3300005338 Ga0068868_100000169 Ga0068868_10000016931 64
28 3300005338 Ga0068868_101601021 Ga0068868_1016010212 64
29 3300005340 Ga0070689_100052142 Ga0070689_1000521426 64
30 3300005340 Ga0070689_100105537 Ga0070689_1001055373 64
31 3300005340 Ga0070689_100221257 Ga0070689_1002212572 64
32 3300005340 Ga0070689_100222797 Ga0070689_1002227973 64
33 3300005341 Ga0070691_10005631 Ga0070691_100056317 64
34 3300005341 Ga0070691_10228333 Ga0070691_102283331 64
35 3300005341 Ga0070691_10264147 Ga0070691_102641472 64
36 3300005341 Ga0070691_10769561 Ga0070691_107695612 64
37 3300005343 Ga0070687_100000112 Ga0070687_1000001128 64
38 3300005343 Ga0070687_100375502 Ga0070687_1003755022 64
39 3300005343 Ga0070687_100765667 Ga0070687_1007656672 64
40 3300005343 Ga0070687_101110797 Ga0070687_1011107973 64
41 3300005345 Ga0070692_10000771 Ga0070692_1000077116 64
42 3300005345 Ga0070692_10004733 Ga0070692_100047334 64
43 3300005345 Ga0070692_10077194 Ga0070692_100771943 64
44 3300005345 Ga0070692_10119083 Ga0070692_101190831 64
45 3300005345 Ga0070692_10574394 Ga0070692_105743942 64
46 3300005345 Ga0070692_11407243 Ga0070692_114072431 64
47 3300005347 Ga0070668_100118907 Ga0070668_1001189072 64
48 3300005353 Ga0070669_100070052 Ga0070669_1000700523 64
49 3300005353 Ga0070669_100573438 Ga0070669_1005734381 64
50 3300005354 Ga0070675_100056290 Ga0070675_1000562903 64
51 3300005354 Ga0070675_100230333 Ga0070675_1002303334 64
52 3300005356 Ga0070674_100861481 Ga0070674_1008614811 64
53 3300005365 Ga0070688_100129267 Ga0070688_1001292673 64
54 3300005365 Ga0070688_101754115 Ga0070688_1017541152 64
55 3300005434 Ga0070709_10762205 Ga0070709_107622052 64
56 3300005434 Ga0070709_11009296 Ga0070709_110092962 64
57 3300005435 Ga0070714_100185510 Ga0070714_1001855103 64
58 3300005435 Ga0070714_101906510 Ga0070714_1019065102 64
59 3300005437 Ga0070710_11336412 Ga0070710_113364121 64
60 3300005438 Ga0070701_10001982 Ga0070701_100019823 64
61 3300005438 Ga0070701_10020823 Ga0070701_100208233 64
62 3300005438 Ga0070701_11350862 Ga0070701_113508621 64
63 3300005440 Ga0070705_100000275 Ga0070705_1000002753 64
64 3300005440 Ga0070705_100005488 Ga0070705_1000054883 64
65 3300005440 Ga0070705_100090996 Ga0070705_1000909963 64
66 3300005440 Ga0070705_100195727 Ga0070705_1001957273 64
67 3300005440 Ga0070705_100563316 Ga0070705_1005633162 64
68 3300005441 Ga0070700_100000718 Ga0070700_10000071819 64
69 3300005441 Ga0070700_100006936 Ga0070700_1000069363 64
70 3300005441 Ga0070700_100159819 Ga0070700_1001598194 64
71 3300005441 Ga0070700_100312331 Ga0070700_1003123312 64
72 3300005441 Ga0070700_100513280 Ga0070700_1005132803 64
73 3300005441 Ga0070700_100602125 Ga0070700_1006021252 64
74 3300005441 Ga0070700_100907483 Ga0070700_1009074832 64
75 3300005444 Ga0070694_100000608 Ga0070694_10000060824 64
76 3300005444 Ga0070694_100009317 Ga0070694_1000093176 64
77 3300005444 Ga0070694_100014517 Ga0070694_1000145175 64
78 3300005444 Ga0070694_100110866 Ga0070694_1001108662 64
79 3300005444 Ga0070694_100132063 Ga0070694_1001320631 64
80 3300005444 Ga0070694_100141175 Ga0070694_1001411753 64
81 3300005444 Ga0070694_101888735 Ga0070694_1018887352 64
82 3300005445 Ga0070708_101677815 Ga0070708_1016778152 64
83 3300005445 Ga0070708_102242505 Ga0070708_1022425051 64
84 3300005456 Ga0070678_100324300 Ga0070678_1003243002 64
85 3300005457 Ga0070662_101118929 Ga0070662_1011189292 64
86 3300005458 Ga0070681_10000198 Ga0070681_1000019834 64
87 3300005458 Ga0070681_10557601 Ga0070681_105576013 64
88 3300005458 Ga0070681_11361542 Ga0070681_113615422 64
89 3300005459 Ga0068867_100000568 Ga0068867_10000056826 64
90 3300005459 Ga0068867_100023523 Ga0068867_1000235235 64
91 3300005467 Ga0070706_100167580 Ga0070706_1001675801 64
92 3300005468 Ga0070707_101001884 Ga0070707_1010018841 64
93 3300005518 Ga0070699_100095806 Ga0070699_1000958063 64
94 3300005518 Ga0070699_100204649 Ga0070699_1002046492 64
95 3300005518 Ga0070699_100258097 Ga0070699_1002580973 64
96 3300005518 Ga0070699_101647209 Ga0070699_1016472091 64
97 3300005530 Ga0070679_100024440 Ga0070679_1000244403 64
98 3300005535 Ga0070684_100904293 Ga0070684_1009042931 64
99 3300005535 Ga0070684_102311780 Ga0070684_1023117801 64
100 3300005536 Ga0070697_100002931 Ga0070697_10000293116 64
101 3300005536 Ga0070697_100095073 Ga0070697_1000950733 64
102 3300005536 Ga0070697_100373071 Ga0070697_1003730712 64
103 3300005539 Ga0068853_100079777 Ga0068853_1000797772 64
104 3300005543 Ga0070672_100467010 Ga0070672_1004670102 64
105 3300005543 Ga0070672_101632546 Ga0070672_1016325462 64
106 3300005544 Ga0070686_100002218 Ga0070686_10000221813 64
107 3300005544 Ga0070686_100160293 Ga0070686_1001602933 64
108 3300005544 Ga0070686_100244972 Ga0070686_1002449722 64
109 3300005545 Ga0070695_100000176 Ga0070695_10000017618 64
110 3300005545 Ga0070695_100003592 Ga0070695_1000035923 64
111 3300005545 Ga0070695_100075647 Ga0070695_1000756474 64
112 3300005545 Ga0070695_100260639 Ga0070695_1002606391 64
113 3300005545 Ga0070695_100366367 Ga0070695_1003663673 64
114 3300005545 Ga0070695_100516992 Ga0070695_1005169923 64
115 3300005545 Ga0070695_100995412 Ga0070695_1009954121 64
116 3300005545 Ga0070695_101020545 Ga0070695_1010205452 64
117 3300005545 Ga0070695_101208833 Ga0070695_1012088332 64
118 3300005546 Ga0070696_100000137 Ga0070696_10000013716 64
119 3300005546 Ga0070696_100001735 Ga0070696_1000017353 64
120 3300005546 Ga0070696_100067694 Ga0070696_1000676943 64
121 3300005546 Ga0070696_100259271 Ga0070696_1002592713 64
122 3300005546 Ga0070696_100408338 Ga0070696_1004083383 64
123 3300005546 Ga0070696_100557879 Ga0070696_1005578792 64
124 3300005547 Ga0070693_100001113 Ga0070693_1000011137 64
125 3300005547 Ga0070693_101195606 Ga0070693_1011956062 64
126 3300005547 Ga0070693_101487955 Ga0070693_1014879552 64
127 3300005549 Ga0070704_100000057 Ga0070704_10000005732 64
128 3300005549 Ga0070704_100046477 Ga0070704_1000464773 64
129 3300005549 Ga0070704_100110016 Ga0070704_1001100163 64
130 3300005549 Ga0070704_100500892 Ga0070704_1005008922 64
131 3300005549 Ga0070704_101859060 Ga0070704_1018590602 64
132 3300005563 Ga0068855_100118320 Ga0068855_1001183203 64
133 3300005578 Ga0068854_100797180 Ga0068854_1007971803 64
134 3300005614 Ga0068856_100175279 Ga0068856_1001752792 64
135 3300005614 Ga0068856_100362114 Ga0068856_1003621143 64
136 3300005615 Ga0070702_100000016 Ga0070702_10000001624 64
137 3300005615 Ga0070702_100230352 Ga0070702_1002303523 64
138 3300005615 Ga0070702_100674737 Ga0070702_1006747371 64
139 3300005617 Ga0068859_100011860 Ga0068859_10001186012 64
140 3300005617 Ga0068859_100028423 Ga0068859_1000284233 64
141 3300005617 Ga0068859_100520407 Ga0068859_1005204072 64
142 3300005617 Ga0068859_101151732 Ga0068859_1011517322 64
143 3300005718 Ga0068866_10000914 Ga0068866_100009143 64
144 3300005718 Ga0068866_10554953 Ga0068866_105549533 64
145 3300005719 Ga0068861_100000199 Ga0068861_10000019927 64
146 3300005719 Ga0068861_100021205 Ga0068861_1000212055 64
147 3300005840 Ga0068870_10077337 Ga0068870_100773372 64
148 3300005840 Ga0068870_10269225 Ga0068870_102692252 64
149 3300005840 Ga0068870_11255553 Ga0068870_112555533 64
150 3300005841 Ga0068863_101860187 Ga0068863_1018601872 64
151 3300005842 Ga0068858_100003393 Ga0068858_1000033937 64
152 3300005842 Ga0068858_100399398 Ga0068858_1003993984 64
153 3300005842 Ga0068858_101623321 Ga0068858_1016233212 64
154 3300005843 Ga0068860_100001230 Ga0068860_10000123026 64
155 3300005843 Ga0068860_100212273 Ga0068860_1002122731 64
156 3300005843 Ga0068860_100850506 Ga0068860_1008505062 64
157 3300005844 Ga0068862_100010417 Ga0068862_1000104177 64
158 3300005844 Ga0068862_100032132 Ga0068862_1000321325 64
159 3300005844 Ga0068862_100306441 Ga0068862_1003064413 64
160 3300005844 Ga0068862_101573513 Ga0068862_1015735132 64
161 3300005981 Ga0081538_10160025 Ga0081538_101600253 64
162 3300005985 Ga0081539_10000842 Ga0081539_1000084250 64
163 3300006173 Ga0070716_101642595 Ga0070716_1016425952 64
164 3300006237 Ga0097621_100001888 Ga0097621_1000018883 64
165 3300006237 Ga0097621_101776504 Ga0097621_1017765042 64
166 3300006358 Ga0068871_100000120 Ga0068871_10000012043 64
167 3300006844 Ga0075428_100025250 Ga0075428_10002525011 64
168 3300006844 Ga0075428_100251107 Ga0075428_1002511073 64
169 3300006844 Ga0075428_101137687 Ga0075428_1011376872 64
170 3300006844 Ga0075428_101408710 Ga0075428_1014087102 64
171 3300006846 Ga0075430_100008695 Ga0075430_1000086955 64
172 3300006846 Ga0075430_100584181 Ga0075430_1005841812 64
173 3300006846 Ga0075430_100899021 Ga0075430_1008990212 64
174 3300006846 Ga0075430_101037516 Ga0075430_1010375162 64
175 3300006846 Ga0075430_101072680 Ga0075430_1010726802 64
176 3300006846 Ga0075430_101228111 Ga0075430_1012281112 64
177 3300006847 Ga0075431_100066842 Ga0075431_1000668422 64
178 3300006847 Ga0075431_100146517 Ga0075431_1001465173 64
179 3300006847 Ga0075431_100250762 Ga0075431_1002507622 64
180 3300006847 Ga0075431_100351111 Ga0075431_1003511113 64
181 3300006847 Ga0075431_101741357 Ga0075431_1017413571 64
182 3300006847 Ga0075431_101963753 Ga0075431_1019637532 64
183 3300006852 Ga0075433_10042272 Ga0075433_100422724 64
184 3300006852 Ga0075433_10336485 Ga0075433_103364854 64
185 3300006871 Ga0075434_100000073 Ga0075434_10000007328 64
186 3300006871 Ga0075434_100451066 Ga0075434_1004510662 64
187 3300006871 Ga0075434_100485931 Ga0075434_1004859312 64
188 3300006871 Ga0075434_101355167 Ga0075434_1013551672 64
189 3300006880 Ga0075429_100001130 Ga0075429_10000113027 64
190 3300006880 Ga0075429_100428394 Ga0075429_1004283943 64
191 3300006880 Ga0075429_100737243 Ga0075429_1007372432 64
192 3300006880 Ga0075429_101138282 Ga0075429_1011382821 64
193 3300006880 Ga0075429_101804621 Ga0075429_1018046211 64
194 3300006881 Ga0068865_100001461 Ga0068865_10000146112 64
195 3300006881 Ga0068865_100029927 Ga0068865_1000299273 64
196 3300006881 Ga0068865_101701000 Ga0068865_1017010002 64
197 3300006914 Ga0075436_100000205 Ga0075436_10000020514 64
198 3300006914 Ga0075436_100038706 Ga0075436_1000387063 64
199 3300006914 Ga0075436_100058404 Ga0075436_1000584043 64
200 3300006914 Ga0075436_100094461 Ga0075436_1000944612 64
201 3300006914 Ga0075436_100403480 Ga0075436_1004034803 64
202 3300006914 Ga0075436_100558744 Ga0075436_1005587443 64
203 3300006914 Ga0075436_101073376 Ga0075436_1010733761 64
204 3300006931 Ga0097620_100011861 Ga0097620_10001186112 64
205 3300006931 Ga0097620_100028423 Ga0097620_1000284237 64
206 3300006931 Ga0097620_100520376 Ga0097620_1005203762 64
207 3300006931 Ga0097620_101151728 Ga0097620_1011517282 64
208 3300007076 Ga0075435_100006291 Ga0075435_1000062916 64
209 3300007076 Ga0075435_100140284 Ga0075435_1001402844 64
210 3300007076 Ga0075435_100223166 Ga0075435_1002231662 64
211 3300007076 Ga0075435_100239981 Ga0075435_1002399813 64
212 3300007076 Ga0075435_100809709 Ga0075435_1008097092 64
213 3300007265 Ga0099794_10021997 Ga0099794_100219972 64
214 3300007265 Ga0099794_10066967 Ga0099794_100669673 64
215 3300007265 Ga0099794_10438859 Ga0099794_104388593 64
216 3300009092 Ga0105250_10020860 Ga0105250_100208603 64
217 3300009094 Ga0111539_10037024 Ga0111539_100370243 64
218 3300009094 Ga0111539_10065584 Ga0111539_100655845 64
219 3300009094 Ga0111539_10131269 Ga0111539_101312693 64
220 3300009094 Ga0111539_10168418 Ga0111539_101684183 64
221 3300009094 Ga0111539_10222278 Ga0111539_102222783 64
222 3300009094 Ga0111539_10772667 Ga0111539_107726672 64
223 3300009094 Ga0111539_11095879 Ga0111539_110958791 64
224 3300009094 Ga0111539_11334901 Ga0111539_113349012 64
225 3300009094 Ga0111539_12495474 Ga0111539_124954742 64
226 3300009098 Ga0105245_10000259 Ga0105245_1000025927 64
227 3300009098 Ga0105245_11512819 Ga0105245_115128193 64
228 3300009147 Ga0114129_10002101 Ga0114129_1000210128 64
229 3300009147 Ga0114129_10373021 Ga0114129_103730213 64
230 3300009147 Ga0114129_10405770 Ga0114129_104057703 64
231 3300009147 Ga0114129_10495723 Ga0114129_104957233 64
232 3300009147 Ga0114129_10864388 Ga0114129_108643882 64
233 3300009147 Ga0114129_11760995 Ga0114129_117609952 64
234 3300009147 Ga0114129_11940992 Ga0114129_119409921 64
235 3300009147 Ga0114129_11976176 Ga0114129_119761762 64
236 3300009147 Ga0114129_12027214 Ga0114129_120272141 64
237 3300009148 Ga0105243_10003095 Ga0105243_100030953 64
238 3300009148 Ga0105243_10045531 Ga0105243_100455313 64
239 3300009174 Ga0105241_10010209 Ga0105241_100102096 64
240 3300009174 Ga0105241_12341199 Ga0105241_123411991 64
241 3300009176 Ga0105242_10036544 Ga0105242_100365442 64
242 3300009176 Ga0105242_12629685 Ga0105242_126296852 64
243 3300009176 Ga0105242_13254707 Ga0105242_132547071 64
244 3300009177 Ga0105248_10559731 Ga0105248_105597312 64
245 3300009177 Ga0105248_13338330 Ga0105248_133383302 64
246 3300009553 Ga0105249_10001070 Ga0105249_1000107023 64
247 3300009553 Ga0105249_10050687 Ga0105249_100506875 64
248 3300009553 Ga0105249_10377074 Ga0105249_103770743 64
249 3300011119 Ga0105246_11558813 Ga0105246_115588132 64
250 3300012494 Ga0157341_1018316 Ga0157341_10183161 64
251 3300012498 Ga0157345_1017302 Ga0157345_10173021 64
252 3300013102 Ga0157371_10835412 Ga0157371_108354122 64
253 3300013105 Ga0157369_11800822 Ga0157369_118008222 64
254 3300013296 Ga0157374_11458235 Ga0157374_114582352 64
255 3300013296 Ga0157374_12380551 Ga0157374_123805511 64
256 3300013297 Ga0157378_10000576 Ga0157378_1000057623 64
257 3300013297 Ga0157378_11059085 Ga0157378_110590851 64
258 3300013297 Ga0157378_11778107 Ga0157378_117781072 64
259 3300013306 Ga0163162_10199606 Ga0163162_101996063 64
260 3300013306 Ga0163162_10270175 Ga0163162_102701753 64
261 3300013307 Ga0157372_10981400 Ga0157372_109814003 64
262 3300013307 Ga0157372_11908413 Ga0157372_119084132 64
263 3300013307 Ga0157372_12198757 Ga0157372_121987572 64
264 3300013308 Ga0157375_10093020 Ga0157375_100930203 64
265 3300013308 Ga0157375_10424353 Ga0157375_104243533 64
266 3300014326 Ga0157380_10011328 Ga0157380_100113284 64
267 3300014326 Ga0157380_10170367 Ga0157380_101703672 64
268 3300014326 Ga0157380_12854062 Ga0157380_128540621 64
269 3300014745 Ga0157377_10194371 Ga0157377_101943713 64
270 3300014969 Ga0157376_10003705 Ga0157376_1000370515 64
271 3300017792 Ga0163161_11485260 Ga0163161_114852601 64
272 3300017792 Ga0163161_11845188 Ga0163161_118451882 64
273 3300021384 Ga0213876_10501877 Ga0213876_105018772 64
274 3300025315 Ga0207697_10385181 Ga0207697_103851812 64
275 3300025711 Ga0207696_1115335 Ga0207696_11153352 64
276 3300025899 Ga0207642_10124344 Ga0207642_101243443 64
277 3300025899 Ga0207642_10183429 Ga0207642_101834293 64
278 3300025901 Ga0207688_10103278 Ga0207688_101032783 64
279 3300025903 Ga0207680_10458517 Ga0207680_104585172 64
280 3300025906 Ga0207699_10611808 Ga0207699_106118082 64
281 3300025907 Ga0207645_10053737 Ga0207645_100537374 64
282 3300025910 Ga0207684_10398182 Ga0207684_103981823 64
283 3300025911 Ga0207654_10004685 Ga0207654_100046858 64
284 3300025912 Ga0207707_10003333 Ga0207707_1000333313 64
285 3300025916 Ga0207663_10655419 Ga0207663_106554191 64
286 3300025917 Ga0207660_10001340 Ga0207660_1000134023 64
287 3300025917 Ga0207660_10020821 Ga0207660_100208215 64
288 3300025917 Ga0207660_10252495 Ga0207660_102524954 64
289 3300025918 Ga0207662_10000106 Ga0207662_1000010645 64
290 3300025918 Ga0207662_10043801 Ga0207662_100438014 64
291 3300025918 Ga0207662_10064715 Ga0207662_100647153 64
292 3300025918 Ga0207662_10528478 Ga0207662_105284782 64
293 3300025921 Ga0207652_10007736 Ga0207652_100077363 64
294 3300025921 Ga0207652_10030844 Ga0207652_100308443 64
295 3300025922 Ga0207646_10881409 Ga0207646_108814092 64
296 3300025923 Ga0207681_10006318 Ga0207681_100063189 64
297 3300025923 Ga0207681_11232805 Ga0207681_112328052 64
298 3300025925 Ga0207650_10776621 Ga0207650_107766212 64
299 3300025926 Ga0207659_10062589 Ga0207659_100625891 64
300 3300025926 Ga0207659_10089394 Ga0207659_100893943 64
301 3300025927 Ga0207687_10004274 Ga0207687_100042742 64
302 3300025929 Ga0207664_10065290 Ga0207664_100652907 64
303 3300025931 Ga0207644_11839724 Ga0207644_118397242 64
304 3300025933 Ga0207706_10766185 Ga0207706_107661852 64
305 3300025934 Ga0207686_10000883 Ga0207686_100008833 64
306 3300025935 Ga0207709_10003980 Ga0207709_1000398013 64
307 3300025935 Ga0207709_10007609 Ga0207709_100076095 64
308 3300025936 Ga0207670_10067768 Ga0207670_100677684 64
309 3300025936 Ga0207670_10089674 Ga0207670_100896742 64
310 3300025936 Ga0207670_10370929 Ga0207670_103709292 64
311 3300025936 Ga0207670_10933109 Ga0207670_109331093 64
312 3300025937 Ga0207669_10003349 Ga0207669_100033499 64
313 3300025937 Ga0207669_10811645 Ga0207669_108116453 64
314 3300025938 Ga0207704_10000434 Ga0207704_100004342 64
315 3300025938 Ga0207704_10007398 Ga0207704_100073984 64
316 3300025938 Ga0207704_11267462 Ga0207704_112674621 64
317 3300025940 Ga0207691_10119742 Ga0207691_101197423 64
318 3300025941 Ga0207711_10801650 Ga0207711_108016502 64
319 3300025942 Ga0207689_10000376 Ga0207689_1000037630 64
320 3300025942 Ga0207689_10371845 Ga0207689_103718451 64
321 3300025942 Ga0207689_11486601 Ga0207689_114866012 64
322 3300025944 Ga0207661_11615836 Ga0207661_116158362 64
323 3300025949 Ga0207667_10134989 Ga0207667_101349893 64
324 3300025960 Ga0207651_11016019 Ga0207651_110160191 64
325 3300025960 Ga0207651_11571522 Ga0207651_115715222 64
326 3300025961 Ga0207712_10005157 Ga0207712_1000515715 64
327 3300025961 Ga0207712_10027095 Ga0207712_100270955 64
328 3300025961 Ga0207712_10225900 Ga0207712_102259002 64
329 3300025972 Ga0207668_10037290 Ga0207668_100372903 64
330 3300025981 Ga0207640_10060273 Ga0207640_100602735 64
331 3300026023 Ga0207677_10004790 Ga0207677_100047903 64
332 3300026023 Ga0207677_10653886 Ga0207677_106538863 64
333 3300026035 Ga0207703_10001886 Ga0207703_1000188622 64
334 3300026035 Ga0207703_10064059 Ga0207703_100640592 64
335 3300026035 Ga0207703_11826460 Ga0207703_118264601 64
336 3300026041 Ga0207639_10050531 Ga0207639_100505312 64
337 3300026075 Ga0207708_10000239 Ga0207708_1000023942 64
338 3300026075 Ga0207708_10036334 Ga0207708_100363343 64
339 3300026075 Ga0207708_10225905 Ga0207708_102259053 64
340 3300026075 Ga0207708_10246018 Ga0207708_102460182 64
341 3300026075 Ga0207708_10904513 Ga0207708_109045132 64
342 3300026075 Ga0207708_11269594 Ga0207708_112695941 64
343 3300026075 Ga0207708_12019003 Ga0207708_120190032 64
344 3300026078 Ga0207702_10056135 Ga0207702_100561354 64
345 3300026088 Ga0207641_10474389 Ga0207641_104743893 64
346 3300026089 Ga0207648_10000369 Ga0207648_1000036925 64
347 3300026089 Ga0207648_10002987 Ga0207648_100029877 64
348 3300026116 Ga0207674_10699519 Ga0207674_106995192 64
349 3300026118 Ga0207675_100000651 Ga0207675_1000006516 64
350 3300026118 Ga0207675_100002559 Ga0207675_10000255925 64
351 3300027364 Ga0209967_1005806 Ga0209967_10058062 64
352 3300027364 Ga0209967_1006851 Ga0209967_10068513 64
353 3300027378 Ga0209981_1009968 Ga0209981_10099683 64
354 3300027378 Ga0209981_1037131 Ga0209981_10371312 64
355 3300027395 Ga0209996_1042690 Ga0209996_10426902 64
356 3300027395 Ga0209996_1054216 Ga0209996_10542162 64
357 3300027462 Ga0210000_1009349 Ga0210000_10093492 64
358 3300027462 Ga0210000_1016142 Ga0210000_10161422 64
359 3300027471 Ga0209995_1010851 Ga0209995_10108513 64
360 3300027471 Ga0209995_1012130 Ga0209995_10121302 64
361 3300027471 Ga0209995_1076999 Ga0209995_10769992 64
362 3300027526 Ga0209968_1007653 Ga0209968_10076532 64
363 3300027526 Ga0209968_1032701 Ga0209968_10327013 64
364 3300027526 Ga0209968_1088572 Ga0209968_10885722 64
365 3300027543 Ga0209999_1004248 Ga0209999_10042484 64
366 3300027543 Ga0209999_1035560 Ga0209999_10355602 64
367 3300027617 Ga0210002_1032968 Ga0210002_10329682 64
368 3300027617 Ga0210002_1056094 Ga0210002_10560942 64
369 3300027671 Ga0209588_1056698 Ga0209588_10566983 64
370 3300027671 Ga0209588_1061104 Ga0209588_10611042 64
371 3300027682 Ga0209971_1006528 Ga0209971_10065283 64
372 3300027682 Ga0209971_1130901 Ga0209971_11309011 64
373 3300027695 Ga0209966_1014489 Ga0209966_10144892 64
374 3300027695 Ga0209966_1023390 Ga0209966_10233903 64
375 3300027876 Ga0209974_10011132 Ga0209974_100111323 64
376 3300027876 Ga0209974_10163834 Ga0209974_101638342 64
377 3300027907 Ga0207428_10010784 Ga0207428_1001078410 64
378 3300027907 Ga0207428_10019374 Ga0207428_100193746 64
379 3300027907 Ga0207428_10286072 Ga0207428_102860723 64
380 3300027907 Ga0207428_10322863 Ga0207428_103228631 64
381 3300028380 Ga0268265_10000781 Ga0268265_1000078121 64
382 3300028380 Ga0268265_10001333 Ga0268265_100013336 64
383 3300028380 Ga0268265_10539870 Ga0268265_105398703 64
384 3300028380 Ga0268265_11132614 Ga0268265_111326143 64
385 3300028380 Ga0268265_11891433 Ga0268265_118914332 64
386 3300028380 Ga0268265_12491338 Ga0268265_124913382 64
387 3300028381 Ga0268264_10001450 Ga0268264_100014507 64
388 3300028381 Ga0268264_10358617 Ga0268264_103586173 64
389 3300028381 Ga0268264_10617457 Ga0268264_106174572 64
390 3300031548 Ga0307408_100124562 Ga0307408_1001245624 64
391 3300031548 Ga0307408_100328650 Ga0307408_1003286502 64
392 3300031548 Ga0307408_100483338 Ga0307408_1004833382 64
393 3300031548 Ga0307408_100558767 Ga0307408_1005587672 64
394 3300031548 Ga0307408_100961731 Ga0307408_1009617312 64
395 3300031548 Ga0307408_101289976 Ga0307408_1012899762 64
396 3300031548 Ga0307408_102097161 Ga0307408_1020971612 64
397 3300031665 Ga0316575_10006460 Ga0316575_100064601 64
398 3300031731 Ga0307405_10166892 Ga0307405_101668923 64
399 3300031731 Ga0307405_10471668 Ga0307405_104716682 64
400 3300031824 Ga0307413_11098741 Ga0307413_110987412 64
401 3300031901 Ga0307406_10254138 Ga0307406_102541383 64
402 3300031901 Ga0307406_11613841 Ga0307406_116138412 64
403 3300031903 Ga0307407_10210867 Ga0307407_102108673 64
404 3300031903 Ga0307407_11689568 Ga0307407_116895682 64
405 3300031911 Ga0307412_11260357 Ga0307412_112603572 64
406 3300031995 Ga0307409_100169468 Ga0307409_1001694683 64
407 3300031995 Ga0307409_102558923 Ga0307409_1025589232 64
408 3300032002 Ga0307416_100143175 Ga0307416_1001431752 64
409 3300032002 Ga0307416_100191358 Ga0307416_1001913583 64
410 3300032002 Ga0307416_100323996 Ga0307416_1003239963 64
411 3300032002 Ga0307416_100689954 Ga0307416_1006899543 64
412 3300032002 Ga0307416_100778181 Ga0307416_1007781812 64
413 3300032005 Ga0307411_10151900 Ga0307411_101519003 64
414 3300032005 Ga0307411_10434441 Ga0307411_104344412 64
415 3300032005 Ga0307411_11042508 Ga0307411_110425082 64
416 3300032005 Ga0307411_11219492 Ga0307411_112194922 64
417 3300032126 Ga0307415_100624731 Ga0307415_1006247312 64
418 3300034816 Ga0373930_0043239 Ga0373930_0043239_685_879 64
419 3300034817 Ga0373948_0011088 Ga0373948_0011088_204_398 64
420 3300034818 Ga0373950_0059922 Ga0373950_0059922_164_358 64
421 3300034819 Ga0373958_0042239 Ga0373958_0042239_657_851 64
422 3300034820 Ga0373959_0005843 Ga0373959_0005843_466_660 64
423 3300034957 Ga0373938_0003713 Ga0373938_0003713_749_943 64
424 3300034957 Ga0373938_0256590 Ga0373938_0256590_251_454 64
425 3300035083 Ga0373926_0000230 Ga0373926_0000230_6934_7128 64
426 3300035084 Ga0373928_0019093 Ga0373928_0019093_181_375 64
427 3300035085 Ga0373929_0032794 Ga0373929_0032794_530_724 64
428 3300035085 Ga0373929_0137915 Ga0373929_0137915_98_292 64
429 3300035085 Ga0373929_0158838 Ga0373929_0158838_301_495 64
430 3300035088 Ga0373940_0027896 Ga0373940_0027896_93_287 64
431 3300035088 Ga0373940_0097071 Ga0373940_0097071_503_697 64
432 3300035088 Ga0373940_0169713 Ga0373940_0169713_251_445 64
433 3300035089 Ga0373944_0001903 Ga0373944_0001903_4322_4516 64
434 3300035090 Ga0373949_0053680 Ga0373949_0053680_394_588 64
435 3300035090 Ga0373949_0231393 Ga0373949_0231393_232_426 64
436 3300035092 Ga0373952_0010396 Ga0373952_0010396_27_221 64
437 3300035092 Ga0373952_0069643 Ga0373952_0069643_620_814 64
438 3300035111 Ga0373923_0140381 Ga0373923_0140381_72_266 64
439 3300035112 Ga0373932_0005565 Ga0373932_0005565_1001_1195 64
440 3300035112 Ga0373932_0202463 Ga0373932_0202463_161_355 64
441 3300035113 Ga0373936_0018435 Ga0373936_0018435_828_1022 64
442 3300035113 Ga0373936_0304874 Ga0373936_0304874_361_555 64
443 3300035114 Ga0373939_0126159 Ga0373939_0126159_374_568 64
444 3300035114 Ga0373939_0280336 Ga0373939_0280336_200_403 64
445 3300035115 Ga0373941_0039893 Ga0373941_0039893_585_779 64
446 3300035116 Ga0373945_0004779 Ga0373945_0004779_1845_2039 64
447 3300035116 Ga0373945_0137355 Ga0373945_0137355_726_920 64
448 3300035121 Ga0373960_0023136 Ga0373960_0023136_636_830 64
449 3300035170 Ga0373943_0020057 Ga0373943_0020057_2706_2900 64
450 3300035170 Ga0373943_0176629 Ga0373943_0176629_211_405 64
451 3300035171 Ga0373946_0005892 Ga0373946_0005892_2464_2658 64
452 3300035207 Ga0373942_0013904 Ga0373942_0013904_303_497 64
453 3300035207 Ga0373942_0078048 Ga0373942_0078048_546_740 64
454 3300035207 Ga0373942_0183233 Ga0373942_0183233_412_606 64
455 3300035241 Ga0373961_0008933 Ga0373961_0008933_13_207 64
456 3300035242 Ga0373962_0082296 Ga0373962_0082296_374_568 64
457 3300035242 Ga0373962_0124605 Ga0373962_0124605_242_436 64
458 3300035398 Ga0316574_0005586 Ga0316574_0005586_1855_2049 64
459 3300035410 Ga0373924_0059852 Ga0373924_0059852_321_515 64
460 3300035691 Ga0373931_0002129 Ga0373931_0002129_6917_7111 64
461 3300035691 Ga0373931_0004456 Ga0373931_0004456_5560_5754 64
462 3300035691 Ga0373931_0014988 Ga0373931_0014988_3340_3534 64
463 3300035691 Ga0373931_0128940 Ga0373931_0128940_1140_1334 64
464 3300035691 Ga0373931_0679438 Ga0373931_0679438_427_621 64
465 3300035692 Ga0373935_0010842 Ga0373935_0010842_3606_3800 64
466 3300035692 Ga0373935_0094772 Ga0373935_0094772_1675_1869 64
467 3300035695 Ga0373927_0023238 Ga0373927_0023238_200_394 64
468 3300035695 Ga0373927_0136658 Ga0373927_0136658_471_665 64
469 3300035695 Ga0373927_0445904 Ga0373927_0445904_624_818 64
470 3300035725 Ga0373947_0036854 Ga0373947_0036854_983_1177 64
471 3300035725 Ga0373947_0046108 Ga0373947_0046108_763_957 64
472 3300037068 Ga0373925_0114896 Ga0373925_0114896_350_544 64
473 3300037068 Ga0373925_0212145 Ga0373925_0212145_201_395 64
474 3300037471 Ga0395905_1257181 Ga0395905_1257181_10_204 64
475 3300039437 Ga0436365_0682788 Ga0436365_0682788_20_214 64
476 3300041404 Ga0439436_0135206 Ga0439436_0135206_263_457 64
477 3300041406 Ga0439439_0021515 Ga0439439_0021515_464_658 64
478 3300041410 Ga0439461_0002899 Ga0439461_0002899_1522_1716 64
479 3300041496 Ga0451839_0172504 Ga0451839_0172504_437_631 64
480 3300041496 Ga0451839_0709667 Ga0451839_0709667_88_282 64
481 3300041505 Ga0451849_1571619 Ga0451849_1571619_226_420 64
482 3300042001 Ga0439441_000488 Ga0439441_000488_1199_1393 64
483 3300042001 Ga0439441_045240 Ga0439441_045240_409_603 64
484 3300042003 Ga0439443_024153 Ga0439443_024153_74_268 64
485 3300042003 Ga0439443_109362 Ga0439443_109362_193_387 64
486 3300042009 Ga0439451_031250 Ga0439451_031250_20_214 64
487 3300042011 Ga0439454_054397 Ga0439454_054397_429_623 64
488 3300042013 Ga0439456_159810 Ga0439456_159810_28_222 64
489 3300042015 Ga0439462_0012540 Ga0439462_0012540_441_635 64
490 3300042015 Ga0439462_0047167 Ga0439462_0047167_154_348 64
491 3300042125 Ga0450923_114106 Ga0450923_114106_409_603 64
492 3300042156 Ga0439446_0099969 Ga0439446_0099969_212_406 64
493 3300042156 Ga0439446_0106820 Ga0439446_0106820_509_703 64
494 3300042435 Ga0439434_0000076 Ga0439434_0000076_3013_3207 64
495 3300042435 Ga0439434_0103290 Ga0439434_0103290_112_306 64
496 3300042435 Ga0439434_0288979 Ga0439434_0288979_145_339 64
497 3300042436 Ga0439435_0001056 Ga0439435_0001056_3452_3646 64
498 3300042436 Ga0439435_0098919 Ga0439435_0098919_301_495 64
499 3300042436 Ga0439435_0234829 Ga0439435_0234829_388_582 64
500 3300042437 Ga0439444_0110830 Ga0439444_0110830_200_394 64
501 3300042461 Ga0439460_0012019 Ga0439460_0012019_2020_2214 64
502 3300042461 Ga0439460_0040964 Ga0439460_0040964_297_491 64
503 3300042461 Ga0439460_0333123 Ga0439460_0333123_131_325 64
504 3300042876 Ga0451577_0015044 Ga0451577_0015044_4676_4870 64
505 3300044706 Ga0466964_0754953 Ga0466964_0754953_260_454 64
506 3300044719 Ga0466971_0284783 Ga0466971_0284783_502_696 64
507 3300044901 Ga0466960_0133029 Ga0466960_0133029_873_1067 64
508 3300045051 Ga0451576_0006734 Ga0451576_0006734_32_226 64
509 3300045051 Ga0451576_0033552 Ga0451576_0033552_20_214 64
510 3300045051 Ga0451576_0090352 Ga0451576_0090352_1042_1236 64
511 3300045051 Ga0451576_1015913 Ga0451576_1015913_36_230 64
512 3300045051 Ga0451576_1282757 Ga0451576_1282757_125_319 64
513 3300045051 Ga0451576_1310889 Ga0451576_1310889_93_287 64
514 3300045051 Ga0451576_1717735 Ga0451576_1717735_54_248 64
515 3300045976 Ga0466967_0113879 Ga0466967_0113879_1389_1583 64
516 3300046455 Ga0495603_0005705 Ga0495603_0005705_663_857 64
517 3300046472 Ga0495580_0023847 Ga0495580_0023847_222_416 64
518 3300046473 Ga0495582_0034547 Ga0495582_0034547_1257_1451 64
519 3300046475 Ga0495639_0005524 Ga0495639_0005524_235_429 64
520 3300046491 Ga0495584_0291568 Ga0495584_0291568_624_818 64
521 3300046517 Ga0495630_0646802 Ga0495630_0646802_216_410 64
522 3300046526 Ga0495666_0013837 Ga0495666_0013837_506_700 64
523 3300046528 Ga0495642_0449817 Ga0495642_0449817_351_545 64
524 3300046535 Ga0495586_0484857 Ga0495586_0484857_290_484 64
525 3300046537 Ga0495598_0052961 Ga0495598_0052961_501_695 64
526 3300046537 Ga0495598_0164097 Ga0495598_0164097_334_528 64
527 3300046539 Ga0495621_0111561 Ga0495621_0111561_522_716 64
528 3300046539 Ga0495621_0123251 Ga0495621_0123251_470_664 64
529 3300046557 Ga0495622_0120892 Ga0495622_0120892_976_1170 64
530 3300046615 Ga0495656_0127289 Ga0495656_0127289_953_1147 64
531 3300046664 Ga0495659_0011438 Ga0495659_0011438_1845_2039 64
532 3300046664 Ga0495659_0227357 Ga0495659_0227357_480_674 64
533 3300046674 Ga0495588_0044030 Ga0495588_0044030_349_543 64
534 3300046681 Ga0495647_0001395 Ga0495647_0001395_5627_5821 64
535 3300046683 Ga0495658_0003610 Ga0495658_0003610_4198_4392 64
536 3300046684 Ga0495669_0110952 Ga0495669_0110952_457_651 64
537 3300047318 Ga0495636_0421976 Ga0495636_0421976_35_229 64
538 3300047321 Ga0495676_0011940 Ga0495676_0011940_290_484 64
539 3300047445 Ga0495677_0374455 Ga0495677_0374455_145_339 64
540 3300048909 Ga0496106_0159383 Ga0496106_0159383_306_500 64
541 3300049515 Ga0501292_081566 Ga0501292_081566_325_519 64
542 3300049520 Ga0501297_069010 Ga0501297_069010_162_356 64
543 3300049521 Ga0501298_040277 Ga0501298_040277_629_823 64
544 3300049521 Ga0501298_048523 Ga0501298_048523_69_263 64
545 3300049521 Ga0501298_127085 Ga0501298_127085_236_430 64
546 3300049521 Ga0501298_143533 Ga0501298_143533_232_426 64
547 3300049521 Ga0501298_171583 Ga0501298_171583_230_424 64
548 3300049522 Ga0501299_084854 Ga0501299_084854_51_245 64
549 3300049522 Ga0501299_099549 Ga0501299_099549_150_344 64
550 3300049522 Ga0501299_113300 Ga0501299_113300_46_240 64
551 3300049568 Ga0501031_0059330 Ga0501031_0059330_1076_1270 64
552 3300049568 Ga0501031_0546700 Ga0501031_0546700_295_492 64
553 3300049568 Ga0501031_0904167 Ga0501031_0904167_257_451 64
554 3300049568 Ga0501031_0937643 Ga0501031_0937643_66_260 64
555 3300049569 Ga0501032_0086786 Ga0501032_0086786_912_1106 64
556 3300049569 Ga0501032_0435519 Ga0501032_0435519_388_582 64
557 3300049569 Ga0501032_0567680 Ga0501032_0567680_69_263 64
558 3300049570 Ga0501033_0011373 Ga0501033_0011373_1601_1795 64
559 3300049570 Ga0501033_0264915 Ga0501033_0264915_355_549 64
560 3300049570 Ga0501033_0280197 Ga0501033_0280197_645_839 64
561 3300049572 Ga0501036_0001921 Ga0501036_0001921_10823_11017 64
562 3300049572 Ga0501036_0085385 Ga0501036_0085385_2227_2421 64
563 3300049572 Ga0501036_0199103 Ga0501036_0199103_160_354 64
564 3300049572 Ga0501036_0953458 Ga0501036_0953458_316_510 64
565 3300049573 Ga0501037_0013201 Ga0501037_0013201_4341_4535 64
566 3300049573 Ga0501037_0523020 Ga0501037_0523020_367_561 64
567 3300049573 Ga0501037_0916323 Ga0501037_0916323_46_240 64
568 3300049574 Ga0501038_0004982 Ga0501038_0004982_4377_4571 64
569 3300049574 Ga0501038_0960279 Ga0501038_0960279_182_376 64
570 3300049575 Ga0501039_0000477 Ga0501039_0000477_19237_19431 64
571 3300049575 Ga0501039_0024671 Ga0501039_0024671_4252_4446 64
572 3300049575 Ga0501039_0027089 Ga0501039_0027089_866_1060 64
573 3300049575 Ga0501039_0033414 Ga0501039_0033414_1452_1646 64
574 3300049575 Ga0501039_1301681 Ga0501039_1301681_277_471 64
575 3300049575 Ga0501039_1424419 Ga0501039_1424419_233_427 64
576 3300049576 Ga0501040_0000052 Ga0501040_0000052_27383_27577 64
577 3300049576 Ga0501040_0005360 Ga0501040_0005360_7604_7798 64
578 3300049576 Ga0501040_0113809 Ga0501040_0113809_145_339 64
579 3300049576 Ga0501040_0205892 Ga0501040_0205892_508_702 64
580 3300049576 Ga0501040_0531502 Ga0501040_0531502_61_255 64
581 3300049577 Ga0501041_0000038 Ga0501041_0000038_27613_27807 64
582 3300049577 Ga0501041_0015649 Ga0501041_0015649_3465_3659 64
583 3300049577 Ga0501041_0015993 Ga0501041_0015993_3332_3526 64
584 3300049577 Ga0501041_0240071 Ga0501041_0240071_105_299 64
585 3300049577 Ga0501041_0586744 Ga0501041_0586744_282_476 64
586 3300049577 Ga0501041_0981879 Ga0501041_0981879_34_228 64
587 3300049578 Ga0501042_0000048 Ga0501042_0000048_23047_23241 64
588 3300049578 Ga0501042_0111133 Ga0501042_0111133_341_535 64
589 3300049578 Ga0501042_0338390 Ga0501042_0338390_352_546 64
590 3300049578 Ga0501042_0461190 Ga0501042_0461190_484_678 64
591 3300049578 Ga0501042_0518961 Ga0501042_0518961_425_619 64
592 3300049578 Ga0501042_0646354 Ga0501042_0646354_243_437 64
593 3300049578 Ga0501042_0750397 Ga0501042_0750397_340_534 64
594 3300049579 Ga0501043_0043047 Ga0501043_0043047_931_1125 64
595 3300049579 Ga0501043_0630625 Ga0501043_0630625_201_395 64
596 3300049580 Ga0501046_0000271 Ga0501046_0000271_25438_25632 64
597 3300049580 Ga0501046_0012984 Ga0501046_0012984_4640_4834 64
598 3300049580 Ga0501046_0773226 Ga0501046_0773226_414_608 64
599 3300049580 Ga0501046_1083890 Ga0501046_1083890_305_499 64
600 3300049581 Ga0501047_0136139 Ga0501047_0136139_608_802 64
601 3300049582 Ga0501048_0000378 Ga0501048_0000378_3578_3772 64
602 3300049582 Ga0501048_0010966 Ga0501048_0010966_2415_2609 64
603 3300049582 Ga0501048_0525886 Ga0501048_0525886_552_746 64
604 3300049584 Ga0501068_0014809 Ga0501068_0014809_932_1126 64
605 3300049584 Ga0501068_0067058 Ga0501068_0067058_895_1089 64
606 3300049584 Ga0501068_0898316 Ga0501068_0898316_174_368 64
607 3300049584 Ga0501068_0939433 Ga0501068_0939433_177_371 64
608 3300049585 Ga0501069_0123294 Ga0501069_0123294_1018_1212 64
609 3300049585 Ga0501069_0408501 Ga0501069_0408501_111_305 64
610 3300049585 Ga0501069_0454186 Ga0501069_0454186_276_470 64
611 3300049585 Ga0501069_0541180 Ga0501069_0541180_486_680 64
612 3300049586 Ga0501070_0159893 Ga0501070_0159893_42_236 64
613 3300049586 Ga0501070_1376099 Ga0501070_1376099_295_489 64
614 3300049587 Ga0501071_0007914 Ga0501071_0007914_5160_5354 64
615 3300049587 Ga0501071_0027911 Ga0501071_0027911_3398_3592 64
616 3300049587 Ga0501071_0123447 Ga0501071_0123447_1320_1514 64
617 3300049587 Ga0501071_0128234 Ga0501071_0128234_940_1134 64
618 3300049587 Ga0501071_1164333 Ga0501071_1164333_53_247 64
619 3300049587 Ga0501071_1350089 Ga0501071_1350089_338_532 64
620 3300049588 Ga0501072_0008011 Ga0501072_0008011_3737_3931 64
621 3300049588 Ga0501072_0009822 Ga0501072_0009822_5552_5746 64
622 3300049588 Ga0501072_0098053 Ga0501072_0098053_1379_1573 64
623 3300049588 Ga0501072_0214228 Ga0501072_0214228_191_385 64
624 3300049588 Ga0501072_0480438 Ga0501072_0480438_386_580 64
625 3300049588 Ga0501072_0505954 Ga0501072_0505954_686_880 64
626 3300049588 Ga0501072_0701731 Ga0501072_0701731_191_385 64
627 3300049588 Ga0501072_0778182 Ga0501072_0778182_322_516 64
628 3300049589 Ga0501073_0087209 Ga0501073_0087209_202_396 64
629 3300049589 Ga0501073_0204289 Ga0501073_0204289_100_294 64
630 3300049590 Ga0501074_0007335 Ga0501074_0007335_6775_6969 64
631 3300049590 Ga0501074_0066914 Ga0501074_0066914_431_625 64
632 3300049590 Ga0501074_0156342 Ga0501074_0156342_859_1053 64
633 3300049590 Ga0501074_0472188 Ga0501074_0472188_509_703 64
634 3300049591 Ga0501075_0000180 Ga0501075_0000180_5349_5543 64
635 3300049591 Ga0501075_0027409 Ga0501075_0027409_1945_2139 64
636 3300049591 Ga0501075_0059419 Ga0501075_0059419_1544_1738 64
637 3300049591 Ga0501075_0076969 Ga0501075_0076969_121_315 64
638 3300049591 Ga0501075_0148471 Ga0501075_0148471_482_676 64
639 3300049592 Ga0501076_0000290 Ga0501076_0000290_25619_25813 64
640 3300049592 Ga0501076_0000319 Ga0501076_0000319_5591_5785 64
641 3300049592 Ga0501076_0103371 Ga0501076_0103371_23_217 64
642 3300049592 Ga0501076_0195588 Ga0501076_0195588_415_609 64
643 3300049592 Ga0501076_1359840 Ga0501076_1359840_243_437 64
644 3300049593 Ga0501077_0000222 Ga0501077_0000222_13886_14080 64
645 3300049593 Ga0501077_0104746 Ga0501077_0104746_1130_1324 64
646 3300049593 Ga0501077_0773240 Ga0501077_0773240_371_565 64
647 3300049660 Ga0501216_009907 Ga0501216_009907_1241_1435 64
648 3300049667 Ga0501230_090827 Ga0501230_090827_274_468 64
649 3300049669 Ga0501235_189635 Ga0501235_189635_221_415 64
650 3300049670 Ga0501236_060806 Ga0501236_060806_140_334 64
651 3300049675 Ga0501243_140459 Ga0501243_140459_155_349 64
652 3300049686 Ga0501257_249228 Ga0501257_249228_147_341 64
653 3300049705 Ga0501225_0046507 Ga0501225_0046507_538_732 64
654 3300049741 Ga0501079_0000061 Ga0501079_0000061_22281_22475 64
655 3300049741 Ga0501079_0047873 Ga0501079_0047873_282_476 64
656 3300049741 Ga0501079_0175760 Ga0501079_0175760_820_1014 64
657 3300049741 Ga0501079_0929415 Ga0501079_0929415_437_631 64
658 3300049741 Ga0501079_1020168 Ga0501079_1020168_406_600 64
659 3300049741 Ga0501079_1130720 Ga0501079_1130720_230_424 64
660 3300049742 Ga0501080_0007892 Ga0501080_0007892_8683_8877 64
661 3300049742 Ga0501080_0041403 Ga0501080_0041403_2394_2588 64
662 3300049742 Ga0501080_0311821 Ga0501080_0311821_47_241 64
663 3300049742 Ga0501080_0341293 Ga0501080_0341293_46_240 64
664 3300049742 Ga0501080_0940338 Ga0501080_0940338_472_666 64
665 3300049743 Ga0501081_0000110 Ga0501081_0000110_26923_27117 64
666 3300049743 Ga0501081_0005740 Ga0501081_0005740_3192_3386 64
667 3300049743 Ga0501081_0300918 Ga0501081_0300918_937_1131 64
668 3300049743 Ga0501081_0703957 Ga0501081_0703957_315_509 64
669 3300049744 Ga0501083_0081556 Ga0501083_0081556_712_906 64
670 3300049744 Ga0501083_0112833 Ga0501083_0112833_131_325 64
671 3300049744 Ga0501083_0743650 Ga0501083_0743650_323_517 64
672 3300049767 Ga0501270_067378 Ga0501270_067378_264_458 64
673 3300049770 Ga0501273_093281 Ga0501273_093281_221_415 64
674 3300049779 Ga0501283_029251 Ga0501283_029251_436_630 64
675 3300049822 Ga0501035_0021364 Ga0501035_0021364_3422_3616 64
676 3300049823 Ga0501044_0046768 Ga0501044_0046768_3210_3404 64
677 3300049823 Ga0501044_0612868 Ga0501044_0612868_757_951 64
678 3300049824 Ga0501045_0000038 Ga0501045_0000038_38905_39099 64
679 3300049824 Ga0501045_0010295 Ga0501045_0010295_6329_6523 64
680 3300050507 nmdc:mga05p37_1111789_c1 nmdc:mga05p37_1111789_c1_158_358 64
681 3300050507 nmdc:mga05p37_1549627_c1 nmdc:mga05p37_1549627_c1_125_319 64
682 3300050507 nmdc:mga05p37_1991478_c1 nmdc:mga05p37_1991478_c1_87_281 64
683 3300050507 nmdc:mga05p37_2835_c1 nmdc:mga05p37_2835_c1_14224_14418 64
684 3300050507 nmdc:mga05p37_628868_c1 nmdc:mga05p37_628868_c1_884_1078 64
685 3300050507 nmdc:mga05p37_869553_c1 nmdc:mga05p37_869553_c1_214_408 64
686 3300050508 nmdc:mga09592_107109_c1 nmdc:mga09592_107109_c1_580_774 64
687 3300050508 nmdc:mga09592_1506259_c1 nmdc:mga09592_1506259_c1_221_421 64
688 3300050508 nmdc:mga09592_15465_c1 nmdc:mga09592_15465_c1_3246_3440 64
689 3300050508 nmdc:mga09592_225263_c1 nmdc:mga09592_225263_c1_753_947 64
690 3300050509 nmdc:mga0qj67_1084972_c1 nmdc:mga0qj67_1084972_c1_90_284 64
691 3300050509 nmdc:mga0qj67_131916_c1 nmdc:mga0qj67_131916_c1_1429_1623 64
692 3300050509 nmdc:mga0qj67_169646_c1 nmdc:mga0qj67_169646_c1_1445_1639 64
693 3300050509 nmdc:mga0qj67_17987_c1 nmdc:mga0qj67_17987_c1_3450_3644 64
694 3300050509 nmdc:mga0qj67_33460_c1 nmdc:mga0qj67_33460_c1_463_657 64
695 3300050509 nmdc:mga0qj67_989403_c1 nmdc:mga0qj67_989403_c1_295_489 64
696 3300050510 nmdc:mga06r32_1275779_c1 nmdc:mga06r32_1275779_c1_270_464 64
697 3300050510 nmdc:mga06r32_1334071_c1 nmdc:mga06r32_1334071_c1_335_529 64
698 3300050510 nmdc:mga06r32_2009298_c1 nmdc:mga06r32_2009298_c1_37_231 64
699 3300050510 nmdc:mga06r32_213064_c1 nmdc:mga06r32_213064_c1_43_237 64
700 3300050510 nmdc:mga06r32_344765_c1 nmdc:mga06r32_344765_c1_959_1153 64
701 3300050510 nmdc:mga06r32_41056_c1 nmdc:mga06r32_41056_c1_3209_3403 64
702 3300050510 nmdc:mga06r32_434960_c1 nmdc:mga06r32_434960_c1_171_365 64
703 3300050511 nmdc:mga08y16_131646_c1 nmdc:mga08y16_131646_c1_1389_1583 64
704 3300050511 nmdc:mga08y16_1413623_c1 nmdc:mga08y16_1413623_c1_441_635 64
705 3300050511 nmdc:mga08y16_188039_c1 nmdc:mga08y16_188039_c1_803_997 64
706 3300050511 nmdc:mga08y16_48362_c1 nmdc:mga08y16_48362_c1_1840_2034 64
707 3300050511 nmdc:mga08y16_552806_c1 nmdc:mga08y16_552806_c1_922_1116 64
708 3300050511 nmdc:mga08y16_599224_c1 nmdc:mga08y16_599224_c1_898_1092 64
709 3300050511 nmdc:mga08y16_63695_c1 nmdc:mga08y16_63695_c1_2867_3061 64
710 3300050512 nmdc:mga0n895_1567869_c1 nmdc:mga0n895_1567869_c1_151_345 64
711 3300050512 nmdc:mga0n895_1888319_c1 nmdc:mga0n895_1888319_c1_286_480 64
712 3300050512 nmdc:mga0n895_2006044_c1 nmdc:mga0n895_2006044_c1_152_346 64
713 3300050512 nmdc:mga0n895_649792_c1 nmdc:mga0n895_649792_c1_409_603 64
714 3300050513 nmdc:mga0rr50_1112541_c1 nmdc:mga0rr50_1112541_c1_215_409 64
715 3300050513 nmdc:mga0rr50_132437_c1 nmdc:mga0rr50_132437_c1_1394_1588 64
716 3300050513 nmdc:mga0rr50_19252_c1 nmdc:mga0rr50_19252_c1_603_797 64
717 3300050513 nmdc:mga0rr50_346080_c1 nmdc:mga0rr50_346080_c1_192_386 64
718 3300050513 nmdc:mga0rr50_573443_c1 nmdc:mga0rr50_573443_c1_294_488 64
719 3300050514 nmdc:mga08x19_1210957_c1 nmdc:mga08x19_1210957_c1_229_423 64
720 3300050514 nmdc:mga08x19_1858_c1 nmdc:mga08x19_1858_c1_3837_4031 64
721 3300050514 nmdc:mga08x19_328372_c1 nmdc:mga08x19_328372_c1_134_328 64
722 3300050514 nmdc:mga08x19_40646_c1 nmdc:mga08x19_40646_c1_737_931 64
723 3300050514 nmdc:mga08x19_530202_c1 nmdc:mga08x19_530202_c1_178_372 64
724 3300050514 nmdc:mga08x19_74217_c1 nmdc:mga08x19_74217_c1_408_602 64
725 3300050514 nmdc:mga08x19_908167_c1 nmdc:mga08x19_908167_c1_350_544 64
726 3300050514 nmdc:mga08x19_91610_c1 nmdc:mga08x19_91610_c1_1271_1471 64
727 3300050514 nmdc:mga08x19_98427_c1 nmdc:mga08x19_98427_c1_797_991 64
728 3300050515 nmdc:mga0a205_1345393_c1 nmdc:mga0a205_1345393_c1_147_341 64
729 3300050515 nmdc:mga0a205_18247_c1 nmdc:mga0a205_18247_c1_5856_6050 64
730 3300050515 nmdc:mga0a205_34658_c1 nmdc:mga0a205_34658_c1_2941_3135 64
731 3300050515 nmdc:mga0a205_357921_c1 nmdc:mga0a205_357921_c1_40_234 64
732 3300050515 nmdc:mga0a205_590292_c1 nmdc:mga0a205_590292_c1_175_369 64
733 3300054114 Ga0501084_0005924 Ga0501084_0005924_5566_5760 64
734 3300054114 Ga0501084_0073589 Ga0501084_0073589_371_565 64
735 3300054114 Ga0501084_1073356 Ga0501084_1073356_113_307 64
736 3300054114 Ga0501084_1465999 Ga0501084_1465999_111_305 64
737 3300059421 Ga0590071_023052 Ga0590071_023052_404_598 64
738 3300059423 Ga0590074_087158 Ga0590074_087158_87_281 64
739 3300059426 Ga0590077_063350 Ga0590077_063350_593_787 64
740 3300059426 Ga0590077_082449 Ga0590077_082449_51_245 64
741 3300059426 Ga0590077_096320 Ga0590077_096320_409_603 64
742 3300059426 Ga0590077_146073 Ga0590077_146073_221_415 64
743 3300060353 Ga0501082_0000430 Ga0501082_0000430_17795_17989 64
744 3300060353 Ga0501082_0014186 Ga0501082_0014186_5324_5518 64
745 3300060353 Ga0501082_0097046 Ga0501082_0097046_686_880 64
746 3300060353 Ga0501082_0827566 Ga0501082_0827566_70_264 64
747 3300060353 Ga0501082_1607983 Ga0501082_1607983_209_403 64
748 3300061734 Ga0530510_0000186 Ga0530510_0000186_12207_12401 64
749 3300061734 Ga0530510_0001727 Ga0530510_0001727_11675_11869 64
750 3300061734 Ga0530510_0136650 Ga0530510_0136650_820_1014 64
751 3300061734 Ga0530510_0865813 Ga0530510_0865813_273_467 64

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04384

Fe-S_assembly

Iron-sulphur cluster assembly

11

74

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
1uj8-assembly1.cif.gz_A structures of orf3 in two crystal forms, a member of isc machinery of e. coli involved in the assembly of iron-sulfur clusters 0.9082 1 63
2bzt-assembly1.cif.gz_A nmr structure of the bacterial protein yfhj from e. coli 0.8992 1 64
2bzt-assembly1.cif.gz_A nmr structure of the bacterial protein yfhj from e. coli 0.8863 1 64
1uj8-assembly1.cif.gz_A structures of orf3 in two crystal forms, a member of isc machinery of e. coli involved in the assembly of iron-sulfur clusters 0.8818 1 63
5okc-assembly2.cif.gz_B crystal structure of the ctf18-1-8 module from ctf18-rfc 0.5965 6 55
ID Description Score Start End Superfamily
1uj8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like 0.9082 1 63 1.10.10.600
2bztA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like 0.8992 1 64 1.10.10.600
2bztA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like 0.8863 1 64 1.10.10.600
1uj8A00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;IscX-like 0.8818 1 63 1.10.10.600
af_P34561_601_744_1.10.357.110 Mainly Alpha;Orthogonal Bundle;Tetracycline Repressor; domain 2;Vacuolar protein sorting-associated protein 53, C-terminus 0.6879 1 62 1.10.357.110
ID Description Score Start End GO Terms
AF-A0A6L5CA48-F1-model_v4 deleted 0.971 4 64
AF-B6ALM1-F1-model_v4 FeS assembly protein IscX 0.9653 6 63 GO:0005829
GO:0008198
GO:0016226
AF-A0A357V7S9-F1-model_v4 Fe-S assembly protein IscX 0.9638 13 64 GO:0005829
GO:0008198
GO:0016226
AF-A0A1Y2K2Y4-F1-model_v4 Putative FeS assembly protein IscX 0.9636 7 64 GO:0005829
GO:0008198
GO:0016226
AF-A0A1F8RIB8-F1-model_v4 Fe-S assembly protein IscX 0.9619 9 63 GO:0016226

Feature Viewer

pLDDT pTM Quality
88.64 0.73 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map