F479074
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 750 | 432 | 663 | 342 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2643221548|2643761820 |
| Length | 394 |
| Sequence | LHDGGEHRRAVRGADPSAPSRPPNPIDPGPQAAFGMPRPGAFTRYQVQGAAAVKALVKQKAEPGLWLMDVPEPEIGPADVLIKVLRTGICGTDLHIRDYDGWAQQAVRTPLVLGHEFVGEVADLGSDVVDIKVGDLVSGEGHLVCGKCRNCLAGRRHLCRSTLGLGVGRDGAFAEYLSLPASNVWVHRDKVDLDVAAIFDPFGNAVHTALSFPLVGEDVLITGAGPIGIMAAAVARHAGARSVVITDVSEARLELARKVGVSLALDVGKETIADGQRHLGLREGFDIGLEMSGRPEAMQDMIANMTHGGRIAMLGLPAGQFPVDWSRVVTSMLTIKGIYGREMYETWYAMSVLLEGGLDLAPVITGRYGYRDFEAAFDDAASGLGGKVLLDWSA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 2 | 2547132111 | Streptomyces sp. TOR3209 | Isolate | Rhizosphere |
| 3 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 4 | 2558860280 | Kutzneria sp. 744 | Isolate | Unclassified |
| 5 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 6 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 7 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 8 | 2616644814 | Streptomyces mirabilis OK461 | Isolate | Rhizosphere |
| 9 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 10 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 11 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 12 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 13 | 2643221601 | Kitasatospora sp. Root187 | Isolate | Unclassified |
| 14 | 2643221631 | Kitasatospora sp. Root107 | Isolate | Unclassified |
| 15 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 16 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 17 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 18 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 19 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 20 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 21 | 2675903058 | Actinopolymorpha cephalotaxi CPCC 202808 | Isolate | Rhizosphere |
| 22 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 23 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 24 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 25 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 26 | 2795385470 | Labedaea rhizosphaerae DSM 45361 | Isolate | Rhizosphere |
| 27 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 28 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 29 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 30 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 31 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 32 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 33 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 34 | 2818991472 | Kitasatospora viridis DSM 44826 | Isolate | Rhizosphere |
| 35 | 2827628540 | Actinopolymorpha cephalotaxi DSM 45117 | Isolate | Rhizosphere |
| 36 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 37 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 38 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 39 | 2862290372 | Streptomyces triticagri NEAU-YY421 | Isolate | Rhizosphere |
| 40 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 41 | 2862507626 | Streptomyces sp. NWU339 | Isolate | Unclassified |
| 42 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 43 | 2863067949 | Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) | Isolate | Rhizosphere |
| 44 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 45 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 46 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 47 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 48 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 49 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 50 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 51 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 52 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 53 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 54 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 55 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 56 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 57 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 58 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 59 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 60 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 61 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 62 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 63 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 64 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 65 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 66 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 67 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 68 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 69 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 70 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 71 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 72 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 73 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 74 | 2995463766 | Streptacidiphilus fuscans NEAU-YB345 | Isolate | Unclassified |
| 75 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 76 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 77 | 3006486233 | Streptomyces sp. BR123 | Isolate | Rhizosphere |
| 78 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 79 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 80 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 81 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 82 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 83 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 84 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 85 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 87 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 89 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 91 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 92 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 93 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 94 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 95 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 96 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 97 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 98 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 99 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 103 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 104 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 106 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 109 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 110 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 111 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 112 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 115 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 116 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 117 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 118 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 119 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 120 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 121 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 122 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 123 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 124 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 126 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 127 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 128 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 129 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 130 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 132 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 133 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 134 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 135 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 137 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 138 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 139 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 140 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 142 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 143 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 145 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 146 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 147 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 148 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 149 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 150 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 151 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 152 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 153 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 154 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 155 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 156 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 157 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 158 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 159 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 160 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 161 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 162 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 163 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 164 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 165 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 166 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 168 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 208 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 209 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 211 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 212 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 213 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 214 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 215 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 216 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 217 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 218 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 219 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 220 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 222 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 223 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 224 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 225 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 226 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 228 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 229 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 230 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 231 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 232 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 233 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 236 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 237 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 238 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 239 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 240 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 241 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 242 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 243 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 244 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 245 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 246 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 247 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 248 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 251 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 252 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 253 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 254 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 256 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 262 | 3300038725 | Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 | Metagenome | Unclassified |
| 263 | 3300038726 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 | Metagenome | Unclassified |
| 264 | 3300038741 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 | Metagenome | Unclassified |
| 265 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 266 | 3300039110 | Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 | Metagenome | Unclassified |
| 267 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 268 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 269 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 271 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 272 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 273 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 274 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 275 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 276 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 277 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 278 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 279 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 280 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 281 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 282 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 283 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 284 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 285 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 286 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 287 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 288 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 289 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 290 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 291 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 292 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 293 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 294 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 295 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 296 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 368 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 369 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 370 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 371 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 372 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 373 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 374 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 375 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 376 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 377 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 378 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 379 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 380 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 384 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 389 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 393 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 394 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 397 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 398 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 399 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 400 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 401 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 402 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 403 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 404 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 405 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 407 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 408 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 409 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 410 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 411 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 412 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 413 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 414 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 415 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 417 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 418 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 419 | 3300053101 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere | Metagenome | Endosphere |
| 420 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 421 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 422 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 423 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 424 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 425 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 426 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 427 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 428 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 429 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 430 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 431 | 8056447290 | Streptomyces huiliensis SCA2-4 | Isolate | Rhizosphere |
| 432 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.73 |
| Metatranscriptomes | 0.67 |
| Isolates | 11.6 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.4 |
| Nodule | 0.67 |
| Rhizoplane | 3.47 |
| Rhizosphere | 84.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.2 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10012771 | 3300001990 | Bacteria | 2738 |
| 2 | rootH1_10029222 | 3300003316 | Bacteria | 3288 |
| 3 | rootL2_10042722 | 3300003322 | Bacteria | 3417 |
| 4 | JGI25160J50197_1003960 | 3300003354 | Bacteria | 6475 |
| 5 | Ga0006562J51391_1071585 | 3300003578 | Bacteria | 3790 |
| 6 | Ga0006562J51391_1071588 | 3300003578 | Bacteria | 2592 |
| 7 | Ga0065715_10157574 | 3300005293 | Bacteria | 1661 |
| 8 | Ga0070658_10000254 | 3300005327 | Bacteria | 46924 |
| 9 | Ga0070683_100000609 | 3300005329 | Bacteria | 25672 |
| 10 | Ga0070683_100094264 | 3300005329 | Bacteria | 2813 |
| 11 | Ga0070670_100009939 | 3300005331 | Bacteria | 8121 |
| 12 | Ga0070670_100123104 | 3300005331 | Bacteria | 2237 |
| 13 | Ga0070670_100127535 | 3300005331 | Bacteria | 2196 |
| 14 | Ga0068869_100015677 | 3300005334 | Bacteria | 5091 |
| 15 | Ga0070682_100106736 | 3300005337 | Bacteria | 1859 |
| 16 | Ga0070689_100021197 | 3300005340 | Bacteria | 4832 |
| 17 | Ga0070691_10011804 | 3300005341 | Bacteria | 3996 |
| 18 | Ga0070661_100077066 | 3300005344 | Bacteria | 2457 |
| 19 | Ga0070675_100408284 | 3300005354 | Bacteria | 1213 |
| 20 | Ga0070674_100159345 | 3300005356 | Bacteria | 1711 |
| 21 | Ga0070688_100149419 | 3300005365 | Bacteria | 1596 |
| 22 | Ga0070714_100000377 | 3300005435 | Bacteria | 33238 |
| 23 | Ga0070714_100000468 | 3300005435 | Bacteria | 29346 |
| 24 | Ga0070714_100022363 | 3300005435 | Bacteria | 5185 |
| 25 | Ga0070714_100026140 | 3300005435 | Bacteria | 4823 |
| 26 | Ga0070714_100070095 | 3300005435 | Bacteria | 3030 |
| 27 | Ga0070713_100003967 | 3300005436 | Bacteria | 9839 |
| 28 | Ga0070713_100229447 | 3300005436 | Bacteria | 1687 |
| 29 | Ga0070710_10000005 | 3300005437 | Bacteria | 238049 |
| 30 | Ga0070710_10084391 | 3300005437 | Bacteria | 1861 |
| 31 | Ga0070710_10086350 | 3300005437 | Bacteria | 1842 |
| 32 | Ga0070711_100023293 | 3300005439 | Bacteria | 4025 |
| 33 | Ga0070708_100021157 | 3300005445 | Bacteria | 5495 |
| 34 | Ga0070708_100052316 | 3300005445 | Bacteria | 3621 |
| 35 | Ga0070708_100452080 | 3300005445 | Bacteria | 1212 |
| 36 | Ga0070678_100008415 | 3300005456 | Bacteria | 6178 |
| 37 | Ga0070681_10000034 | 3300005458 | Bacteria | 98600 |
| 38 | Ga0070681_10005337 | 3300005458 | Bacteria | 12405 |
| 39 | Ga0070681_10217262 | 3300005458 | Bacteria | 1827 |
| 40 | Ga0070685_10244742 | 3300005466 | Bacteria | 1185 |
| 41 | Ga0070706_100003390 | 3300005467 | Bacteria | 15712 |
| 42 | Ga0070706_100013961 | 3300005467 | Bacteria | 7420 |
| 43 | Ga0070706_100016021 | 3300005467 | Bacteria | 6923 |
| 44 | Ga0070706_100046674 | 3300005467 | Bacteria | 3998 |
| 45 | Ga0070706_100087688 | 3300005467 | Bacteria | 2885 |
| 46 | Ga0070707_100002696 | 3300005468 | Bacteria | 16886 |
| 47 | Ga0070707_100002739 | 3300005468 | Bacteria | 16768 |
| 48 | Ga0070707_100005643 | 3300005468 | Bacteria | 11687 |
| 49 | Ga0070707_100037090 | 3300005468 | Bacteria | 4651 |
| 50 | Ga0070707_100043064 | 3300005468 | Bacteria | 4321 |
| 51 | Ga0070698_100005256 | 3300005471 | Bacteria | 14160 |
| 52 | Ga0070698_100153898 | 3300005471 | Bacteria | 2245 |
| 53 | Ga0070699_100206465 | 3300005518 | Bacteria | 1748 |
| 54 | Ga0070679_100000270 | 3300005530 | Bacteria | 43437 |
| 55 | Ga0070679_100037284 | 3300005530 | Bacteria | 4828 |
| 56 | Ga0070679_100209390 | 3300005530 | Bacteria | 1914 |
| 57 | Ga0070684_100000132 | 3300005535 | Bacteria | 49550 |
| 58 | Ga0070684_100024493 | 3300005535 | Bacteria | 5063 |
| 59 | Ga0070684_100064458 | 3300005535 | Bacteria | 3214 |
| 60 | Ga0070684_100134280 | 3300005535 | Bacteria | 2234 |
| 61 | Ga0068853_100000551 | 3300005539 | Bacteria | 25570 |
| 62 | Ga0068853_100008839 | 3300005539 | Bacteria | 8103 |
| 63 | Ga0068853_100197230 | 3300005539 | Bacteria | 1831 |
| 64 | Ga0068855_100000414 | 3300005563 | Bacteria | 52978 |
| 65 | Ga0068855_100024619 | 3300005563 | Bacteria | 7201 |
| 66 | Ga0068855_100140150 | 3300005563 | Bacteria | 2757 |
| 67 | Ga0070664_100026447 | 3300005564 | Bacteria | 4813 |
| 68 | Ga0070664_100270112 | 3300005564 | Bacteria | 1532 |
| 69 | Ga0068857_100000178 | 3300005577 | Bacteria | 40384 |
| 70 | Ga0068857_100002576 | 3300005577 | Bacteria | 14854 |
| 71 | Ga0068854_100020542 | 3300005578 | Bacteria | 4471 |
| 72 | Ga0068856_100000541 | 3300005614 | Bacteria | 41709 |
| 73 | Ga0068856_100004114 | 3300005614 | Bacteria | 14538 |
| 74 | Ga0068856_100063338 | 3300005614 | Bacteria | 3653 |
| 75 | Ga0070702_100005174 | 3300005615 | Bacteria | 6041 |
| 76 | Ga0068852_100000641 | 3300005616 | Bacteria | 22869 |
| 77 | Ga0068852_100199729 | 3300005616 | Bacteria | 1892 |
| 78 | Ga0068859_100050634 | 3300005617 | Bacteria | 4172 |
| 79 | Ga0068864_100081054 | 3300005618 | Bacteria | 2845 |
| 80 | Ga0068864_100091894 | 3300005618 | Bacteria | 2678 |
| 81 | Ga0068866_10008160 | 3300005718 | Bacteria | 4400 |
| 82 | Ga0068858_100059316 | 3300005842 | Bacteria | 3537 |
| 83 | Ga0068860_100023387 | 3300005843 | Bacteria | 5972 |
| 84 | Ga0081455_10113915 | 3300005937 | Bacteria | 2144 |
| 85 | Ga0070717_10000001 | 3300006028 | Bacteria | 465573 |
| 86 | Ga0070717_10005944 | 3300006028 | Bacteria | 8937 |
| 87 | Ga0070717_10008670 | 3300006028 | Bacteria | 7605 |
| 88 | Ga0070717_10018740 | 3300006028 | Bacteria | 5412 |
| 89 | Ga0075368_10011022 | 3300006042 | Bacteria | 3283 |
| 90 | Ga0075363_100013598 | 3300006048 | Bacteria | 3951 |
| 91 | Ga0070715_10040245 | 3300006163 | Bacteria | 1953 |
| 92 | Ga0070712_100080623 | 3300006175 | Bacteria | 2356 |
| 93 | Ga0070712_100183374 | 3300006175 | Bacteria | 1633 |
| 94 | Ga0075367_10000715 | 3300006178 | Bacteria | 12829 |
| 95 | Ga0097621_100000014 | 3300006237 | Bacteria | 100839 |
| 96 | Ga0097621_100004781 | 3300006237 | Bacteria | 9477 |
| 97 | Ga0068871_100001973 | 3300006358 | Bacteria | 13910 |
| 98 | Ga0075433_10064999 | 3300006852 | Bacteria | 3199 |
| 99 | Ga0075434_100006102 | 3300006871 | Bacteria | 11029 |
| 100 | Ga0075436_100002055 | 3300006914 | Bacteria | 13881 |
| 101 | Ga0075436_100004446 | 3300006914 | Bacteria | 9619 |
| 102 | Ga0097620_100050643 | 3300006931 | Bacteria | 4172 |
| 103 | Ga0097620_100210867 | 3300006931 | Bacteria | 2029 |
| 104 | Ga0099826_10110194 | 3300006948 | Bacteria | 1641 |
| 105 | Ga0075435_100051451 | 3300007076 | Bacteria | 3318 |
| 106 | Ga0075435_100065475 | 3300007076 | Bacteria | 2954 |
| 107 | Ga0099794_10065577 | 3300007265 | Bacteria | 1771 |
| 108 | Ga0105240_10090665 | 3300009093 | Bacteria | 3736 |
| 109 | Ga0105240_10102318 | 3300009093 | Bacteria | 3481 |
| 110 | Ga0105240_10108702 | 3300009093 | Bacteria | 3359 |
| 111 | Ga0105240_10131752 | 3300009093 | Bacteria | 2998 |
| 112 | Ga0105240_10188710 | 3300009093 | Bacteria | 2425 |
| 113 | Ga0105240_10229568 | 3300009093 | Bacteria | 2158 |
| 114 | Ga0111539_10052868 | 3300009094 | Bacteria | 4835 |
| 115 | Ga0105245_10013643 | 3300009098 | Bacteria | 7079 |
| 116 | Ga0105245_10050134 | 3300009098 | Bacteria | 3740 |
| 117 | Ga0105247_10019731 | 3300009101 | Bacteria | 4048 |
| 118 | Ga0114129_10273754 | 3300009147 | Bacteria | 2258 |
| 119 | Ga0105243_10042551 | 3300009148 | Bacteria | 3556 |
| 120 | Ga0105241_10003085 | 3300009174 | Bacteria | 12409 |
| 121 | Ga0105241_10007013 | 3300009174 | Bacteria | 8289 |
| 122 | Ga0105241_10061137 | 3300009174 | Bacteria | 2900 |
| 123 | Ga0105241_10268923 | 3300009174 | Bacteria | 1451 |
| 124 | Ga0105242_10018518 | 3300009176 | Bacteria | 5446 |
| 125 | Ga0105248_10030353 | 3300009177 | Bacteria | 6035 |
| 126 | Ga0105237_10011061 | 3300009545 | Bacteria | 9568 |
| 127 | Ga0105237_10035387 | 3300009545 | Bacteria | 5053 |
| 128 | Ga0105237_10060977 | 3300009545 | Bacteria | 3772 |
| 129 | Ga0105238_10000099 | 3300009551 | Bacteria | 97818 |
| 130 | Ga0105238_10004170 | 3300009551 | Bacteria | 14341 |
| 131 | Ga0105238_10064232 | 3300009551 | Bacteria | 3671 |
| 132 | Ga0105249_10307208 | 3300009553 | Bacteria | 1593 |
| 133 | Ga0105239_10020990 | 3300010375 | Bacteria | 7208 |
| 134 | Ga0105239_10050797 | 3300010375 | Bacteria | 4546 |
| 135 | Ga0105239_10280370 | 3300010375 | Bacteria | 1876 |
| 136 | Ga0157313_1002337 | 3300012503 | Bacteria | 1124 |
| 137 | Ga0157369_10000042 | 3300013105 | Bacteria | 181784 |
| 138 | Ga0157369_10006793 | 3300013105 | Bacteria | 13198 |
| 139 | Ga0157369_10011777 | 3300013105 | Bacteria | 9932 |
| 140 | Ga0157369_10022583 | 3300013105 | Bacteria | 7018 |
| 141 | Ga0157369_10052608 | 3300013105 | Bacteria | 4406 |
| 142 | Ga0157369_10071211 | 3300013105 | Bacteria | 3733 |
| 143 | Ga0157378_10003197 | 3300013297 | Bacteria | 14554 |
| 144 | Ga0157378_10011532 | 3300013297 | Bacteria | 7738 |
| 145 | Ga0163162_10173466 | 3300013306 | Bacteria | 2281 |
| 146 | Ga0163162_10208372 | 3300013306 | Bacteria | 2084 |
| 147 | Ga0157372_10003621 | 3300013307 | Bacteria | 16626 |
| 148 | Ga0157372_10018475 | 3300013307 | Bacteria | 7495 |
| 149 | Ga0157372_10053080 | 3300013307 | Bacteria | 4516 |
| 150 | Ga0157372_10085747 | 3300013307 | Bacteria | 3572 |
| 151 | Ga0157372_10122034 | 3300013307 | Bacteria | 2994 |
| 152 | Ga0157372_10149382 | 3300013307 | Bacteria | 2696 |
| 153 | Ga0157372_10435565 | 3300013307 | Bacteria | 1528 |
| 154 | Ga0157372_10461069 | 3300013307 | Bacteria | 1481 |
| 155 | Ga0157372_10629394 | 3300013307 | Bacteria | 1250 |
| 156 | Ga0157375_10176918 | 3300013308 | Bacteria | 2284 |
| 157 | Ga0157375_10239914 | 3300013308 | Bacteria | 1972 |
| 158 | Ga0157375_10440818 | 3300013308 | Bacteria | 1468 |
| 159 | Ga0157380_10243156 | 3300014326 | Bacteria | 1624 |
| 160 | Ga0157380_10419080 | 3300014326 | Bacteria | 1276 |
| 161 | Ga0182008_10004052 | 3300014497 | Bacteria | 8648 |
| 162 | Ga0157379_10003200 | 3300014968 | Bacteria | 13870 |
| 163 | Ga0157376_10009682 | 3300014969 | Bacteria | 7012 |
| 164 | Ga0157376_10019952 | 3300014969 | Bacteria | 5177 |
| 165 | Ga0157376_10067977 | 3300014969 | Bacteria | 3016 |
| 166 | Ga0157376_10470705 | 3300014969 | Bacteria | 1229 |
| 167 | Ga0182007_10001956 | 3300015262 | Bacteria | 10656 |
| 168 | Ga0183367_1001 | 3300015688 | Bacteria | 1225545 |
| 169 | Ga0163161_10001814 | 3300017792 | Bacteria | 15591 |
| 170 | Ga0224712_10009523 | 3300022467 | Bacteria | 2931 |
| 171 | Ga0224712_10013952 | 3300022467 | Bacteria | 2574 |
| 172 | Ga0209758_1006936 | 3300025297 | Bacteria | 7900 |
| 173 | Ga0207426_1006931 | 3300025302 | Bacteria | 4816 |
| 174 | Ga0207426_1016694 | 3300025302 | Bacteria | 2627 |
| 175 | Ga0207426_1023614 | 3300025302 | Bacteria | 2096 |
| 176 | Ga0207692_10000003 | 3300025898 | Bacteria | 431531 |
| 177 | Ga0207692_10032641 | 3300025898 | Bacteria | 2504 |
| 178 | Ga0207642_10022607 | 3300025899 | Bacteria | 2498 |
| 179 | Ga0207710_10003720 | 3300025900 | Bacteria | 6755 |
| 180 | Ga0207705_10035200 | 3300025909 | Bacteria | 3582 |
| 181 | Ga0207684_10003467 | 3300025910 | Bacteria | 15385 |
| 182 | Ga0207684_10026271 | 3300025910 | Bacteria | 4964 |
| 183 | Ga0207684_10073766 | 3300025910 | Bacteria | 2899 |
| 184 | Ga0207684_10136900 | 3300025910 | Bacteria | 2103 |
| 185 | Ga0207684_10376186 | 3300025910 | Bacteria | 1222 |
| 186 | Ga0207654_10000890 | 3300025911 | Bacteria | 16560 |
| 187 | Ga0207654_10008960 | 3300025911 | Bacteria | 5076 |
| 188 | Ga0207654_10202920 | 3300025911 | Bacteria | 1306 |
| 189 | Ga0207707_10000891 | 3300025912 | Bacteria | 29182 |
| 190 | Ga0207707_10213260 | 3300025912 | Bacteria | 1682 |
| 191 | Ga0207695_10001825 | 3300025913 | Bacteria | 33474 |
| 192 | Ga0207695_10133720 | 3300025913 | Bacteria | 2435 |
| 193 | Ga0207695_10159707 | 3300025913 | Bacteria | 2186 |
| 194 | Ga0207671_10001322 | 3300025914 | Bacteria | 29026 |
| 195 | Ga0207671_10020313 | 3300025914 | Bacteria | 5059 |
| 196 | Ga0207671_10244021 | 3300025914 | Bacteria | 1411 |
| 197 | Ga0207663_10077450 | 3300025916 | Bacteria | 2164 |
| 198 | Ga0207657_10186137 | 3300025919 | Bacteria | 1677 |
| 199 | Ga0207649_10010711 | 3300025920 | Bacteria | 5042 |
| 200 | Ga0207652_10001281 | 3300025921 | Bacteria | 22398 |
| 201 | Ga0207652_10284455 | 3300025921 | Bacteria | 1492 |
| 202 | Ga0207652_10328715 | 3300025921 | Bacteria | 1380 |
| 203 | Ga0207646_10001004 | 3300025922 | Bacteria | 36159 |
| 204 | Ga0207646_10005717 | 3300025922 | Bacteria | 13042 |
| 205 | Ga0207646_10007233 | 3300025922 | Bacteria | 11321 |
| 206 | Ga0207646_10071491 | 3300025922 | Bacteria | 3099 |
| 207 | Ga0207646_10154381 | 3300025922 | Bacteria | 2070 |
| 208 | Ga0207694_10000745 | 3300025924 | Bacteria | 29280 |
| 209 | Ga0207694_10000936 | 3300025924 | Bacteria | 25749 |
| 210 | Ga0207650_10086270 | 3300025925 | Bacteria | 2390 |
| 211 | Ga0207650_10087307 | 3300025925 | Bacteria | 2376 |
| 212 | Ga0207650_10313326 | 3300025925 | Bacteria | 1284 |
| 213 | Ga0207687_10030070 | 3300025927 | Bacteria | 3659 |
| 214 | Ga0207687_10047069 | 3300025927 | Bacteria | 2988 |
| 215 | Ga0207700_10022195 | 3300025928 | Bacteria | 4350 |
| 216 | Ga0207700_10158681 | 3300025928 | Bacteria | 1876 |
| 217 | Ga0207700_10165434 | 3300025928 | Bacteria | 1840 |
| 218 | Ga0207700_10233759 | 3300025928 | Bacteria | 1564 |
| 219 | Ga0207664_10004432 | 3300025929 | Bacteria | 9508 |
| 220 | Ga0207664_10011778 | 3300025929 | Bacteria | 6234 |
| 221 | Ga0207664_10014836 | 3300025929 | Bacteria | 5641 |
| 222 | Ga0207664_10025013 | 3300025929 | Bacteria | 4490 |
| 223 | Ga0207664_10261785 | 3300025929 | Bacteria | 1513 |
| 224 | Ga0207686_10012449 | 3300025934 | Bacteria | 4679 |
| 225 | Ga0207709_10031284 | 3300025935 | Bacteria | 3106 |
| 226 | Ga0207670_10074270 | 3300025936 | Bacteria | 2359 |
| 227 | Ga0207669_10011581 | 3300025937 | Bacteria | 4299 |
| 228 | Ga0207665_10017771 | 3300025939 | Bacteria | 4674 |
| 229 | Ga0207691_10089552 | 3300025940 | Bacteria | 2759 |
| 230 | Ga0207661_10002130 | 3300025944 | Bacteria | 13615 |
| 231 | Ga0207679_10015776 | 3300025945 | Bacteria | 5004 |
| 232 | Ga0207679_10048689 | 3300025945 | Bacteria | 3087 |
| 233 | Ga0207679_10184517 | 3300025945 | Bacteria | 1728 |
| 234 | Ga0207667_10000535 | 3300025949 | Bacteria | 50094 |
| 235 | Ga0207667_10001693 | 3300025949 | Bacteria | 27732 |
| 236 | Ga0207667_10147097 | 3300025949 | Bacteria | 2425 |
| 237 | Ga0207712_10036119 | 3300025961 | Bacteria | 3363 |
| 238 | Ga0207712_10246497 | 3300025961 | Bacteria | 1442 |
| 239 | Ga0207640_10004910 | 3300025981 | Bacteria | 7267 |
| 240 | Ga0207677_10022394 | 3300026023 | Bacteria | 3883 |
| 241 | Ga0207703_10060165 | 3300026035 | Bacteria | 3105 |
| 242 | Ga0207703_10268220 | 3300026035 | Bacteria | 1545 |
| 243 | Ga0207639_10000531 | 3300026041 | Bacteria | 26255 |
| 244 | Ga0207639_10153390 | 3300026041 | Bacteria | 1932 |
| 245 | Ga0207702_10001271 | 3300026078 | Bacteria | 25346 |
| 246 | Ga0207702_10008594 | 3300026078 | Bacteria | 8609 |
| 247 | Ga0207702_10011794 | 3300026078 | Bacteria | 7278 |
| 248 | Ga0207702_10083303 | 3300026078 | Bacteria | 2782 |
| 249 | Ga0207641_10478165 | 3300026088 | Bacteria | 1207 |
| 250 | Ga0207674_10000157 | 3300026116 | Bacteria | 80435 |
| 251 | Ga0207675_100397484 | 3300026118 | Bacteria | 1358 |
| 252 | Ga0207683_10000257 | 3300026121 | Bacteria | 47314 |
| 253 | Ga0207698_10000319 | 3300026142 | Bacteria | 28739 |
| 254 | Ga0207698_10097004 | 3300026142 | Bacteria | 2431 |
| 255 | Ga0209282_1100217 | 3300027666 | Bacteria | 1493 |
| 256 | Ga0209813_10013124 | 3300027866 | Bacteria | 2205 |
| 257 | Ga0268264_10005209 | 3300028381 | Bacteria | 11012 |
| 258 | Ga0265319_1031551 | 3300028563 | Bacteria | 1844 |
| 259 | Ga0307517_10025660 | 3300028786 | Bacteria | 7194 |
| 260 | Ga0307515_10000287 | 3300028794 | Bacteria | 123976 |
| 261 | Ga0307515_10028816 | 3300028794 | Bacteria | 9419 |
| 262 | Ga0307515_10089178 | 3300028794 | Bacteria | 3887 |
| 263 | Ga0307515_10223615 | 3300028794 | Bacteria | 1693 |
| 264 | Ga0265338_10035020 | 3300028800 | Bacteria | 4837 |
| 265 | Ga0265324_10008434 | 3300029957 | Bacteria | 4095 |
| 266 | Ga0307511_10001720 | 3300030521 | Bacteria | 23047 |
| 267 | Ga0307511_10026702 | 3300030521 | Bacteria | 5290 |
| 268 | Ga0307511_10035848 | 3300030521 | Bacteria | 4324 |
| 269 | Ga0307511_10049182 | 3300030521 | Bacteria | 3418 |
| 270 | Ga0307512_10005793 | 3300030522 | Bacteria | 12730 |
| 271 | Ga0307512_10024136 | 3300030522 | Bacteria | 5418 |
| 272 | Ga0265320_10044366 | 3300031240 | Bacteria | 2191 |
| 273 | Ga0265325_10017986 | 3300031241 | Bacteria | 3923 |
| 274 | Ga0265340_10003313 | 3300031247 | Bacteria | 9133 |
| 275 | Ga0265339_10016133 | 3300031249 | Bacteria | 4461 |
| 276 | Ga0307513_10028756 | 3300031456 | Bacteria | 6349 |
| 277 | Ga0307513_10346281 | 3300031456 | Bacteria | 1235 |
| 278 | Ga0307509_10025474 | 3300031507 | Bacteria | 6604 |
| 279 | Ga0307408_100023575 | 3300031548 | Bacteria | 4194 |
| 280 | Ga0307508_10037588 | 3300031616 | Bacteria | 4352 |
| 281 | Ga0307508_10235180 | 3300031616 | Bacteria | 1430 |
| 282 | Ga0307514_10012027 | 3300031649 | Bacteria | 7201 |
| 283 | Ga0265342_10019358 | 3300031712 | Bacteria | 4389 |
| 284 | Ga0316576_10052009 | 3300031727 | Bacteria | 2982 |
| 285 | Ga0307516_10032499 | 3300031730 | Bacteria | 5254 |
| 286 | Ga0307516_10042401 | 3300031730 | Bacteria | 4514 |
| 287 | Ga0307405_10003908 | 3300031731 | Bacteria | 6957 |
| 288 | Ga0316577_10060846 | 3300031733 | Bacteria | 2107 |
| 289 | Ga0316577_10061419 | 3300031733 | Bacteria | 2097 |
| 290 | Ga0307413_10001470 | 3300031824 | Bacteria | 8956 |
| 291 | Ga0307413_10013839 | 3300031824 | Bacteria | 4074 |
| 292 | Ga0307518_10069369 | 3300031838 | Bacteria | 2554 |
| 293 | Ga0307410_10000352 | 3300031852 | Bacteria | 17818 |
| 294 | Ga0307410_10002093 | 3300031852 | Bacteria | 9461 |
| 295 | Ga0307410_10306656 | 3300031852 | Bacteria | 1255 |
| 296 | Ga0307406_10072546 | 3300031901 | Bacteria | 2260 |
| 297 | Ga0307406_10108324 | 3300031901 | Bacteria | 1907 |
| 298 | Ga0307407_10049140 | 3300031903 | Bacteria | 2405 |
| 299 | Ga0307407_10088068 | 3300031903 | Bacteria | 1896 |
| 300 | Ga0307412_10007170 | 3300031911 | Bacteria | 6327 |
| 301 | Ga0307412_10008106 | 3300031911 | Bacteria | 5987 |
| 302 | Ga0307412_10017502 | 3300031911 | Bacteria | 4291 |
| 303 | Ga0307409_100002421 | 3300031995 | Bacteria | 9747 |
| 304 | Ga0307409_100003377 | 3300031995 | Bacteria | 8662 |
| 305 | Ga0307409_100017832 | 3300031995 | Bacteria | 4747 |
| 306 | Ga0307409_100019649 | 3300031995 | Bacteria | 4581 |
| 307 | Ga0307416_100015076 | 3300032002 | Bacteria | 5323 |
| 308 | Ga0307416_100040667 | 3300032002 | Bacteria | 3614 |
| 309 | Ga0307416_100237284 | 3300032002 | Bacteria | 1763 |
| 310 | Ga0307414_10025594 | 3300032004 | Bacteria | 3783 |
| 311 | Ga0307414_10161847 | 3300032004 | Bacteria | 1779 |
| 312 | Ga0307411_10002733 | 3300032005 | Bacteria | 7920 |
| 313 | Ga0307411_10014107 | 3300032005 | Bacteria | 4435 |
| 314 | Ga0307411_10390621 | 3300032005 | Bacteria | 1147 |
| 315 | Ga0307415_100006574 | 3300032126 | Bacteria | 6284 |
| 316 | Ga0307415_100007489 | 3300032126 | Bacteria | 5974 |
| 317 | Ga0316585_10028916 | 3300032137 | Bacteria | 1735 |
| 318 | Ga0307507_10010287 | 3300033179 | Bacteria | 12137 |
| 319 | Ga0307507_10019151 | 3300033179 | Bacteria | 7726 |
| 320 | Ga0307510_10000644 | 3300033180 | Bacteria | 35417 |
| 321 | Ga0373926_0001784 | 3300035083 | Bacteria | 6685 |
| 322 | Ga0373954_0039189 | 3300035118 | Bacteria | 2206 |
| 323 | Ga0373954_0042239 | 3300035118 | Bacteria | 2126 |
| 324 | Ga0373954_0042753 | 3300035118 | Bacteria | 2113 |
| 325 | Ga0373956_0017063 | 3300035119 | Bacteria | 3056 |
| 326 | Ga0373956_0029030 | 3300035119 | Bacteria | 2410 |
| 327 | Ga0373957_0081256 | 3300035120 | Bacteria | 1280 |
| 328 | Ga0373955_0009399 | 3300035172 | Bacteria | 4574 |
| 329 | Ga0373924_0004127 | 3300035410 | Bacteria | 5056 |
| 330 | Ga0373924_0038744 | 3300035410 | Bacteria | 1945 |
| 331 | Ga0373935_0000094 | 3300035692 | Bacteria | 39144 |
| 332 | Ga0373933_0032693 | 3300035724 | Bacteria | 3024 |
| 333 | Ga0373947_0000011 | 3300035725 | Bacteria | 160778 |
| 334 | Ga0373947_0183480 | 3300035725 | Bacteria | 1363 |
| 335 | Ga0373937_0020699 | 3300036401 | Bacteria | 5900 |
| 336 | Ga0373937_0068561 | 3300036401 | Bacteria | 3270 |
| 337 | Ga0373937_0088064 | 3300036401 | Bacteria | 2874 |
| 338 | Ga0316582_0092835 | 3300036647 | Bacteria | 1990 |
| 339 | Ga0316584_0006850 | 3300036712 | Bacteria | 7740 |
| 340 | Ga0316584_0056615 | 3300036712 | Bacteria | 2935 |
| 341 | Ga0395900_0424995 | 3300037418 | Bacteria | 1289 |
| 342 | Ga0395898_0022337 | 3300037466 | Bacteria | 6407 |
| 343 | Ga0395898_0041040 | 3300037466 | Bacteria | 4573 |
| 344 | Ga0395905_0163487 | 3300037471 | Bacteria | 2092 |
| 345 | Ga0436364_1442308 | 3300037853 | Bacteria | 2270 |
| 346 | Ga0395901_0246940 | 3300038443 | Bacteria | 1860 |
| 347 | Ga0400484_42200 | 3300038725 | Bacteria | 10636 |
| 348 | Ga0400490_05965 | 3300038726 | Bacteria | 10488 |
| 349 | Ga0400490_24841 | 3300038726 | Bacteria | 1768 |
| 350 | Ga0400488_31331 | 3300038741 | Bacteria | 3081 |
| 351 | Ga0400483_218673 | 3300039062 | Bacteria | 21299 |
| 352 | Ga0400487_05605 | 3300039110 | Bacteria | 3096 |
| 353 | Ga0400487_27158 | 3300039110 | Bacteria | 6330 |
| 354 | Ga0439436_0007626 | 3300041404 | Bacteria | 3331 |
| 355 | Ga0439439_0000566 | 3300041406 | Bacteria | 6444 |
| 356 | Ga0439439_0006105 | 3300041406 | Bacteria | 2777 |
| 357 | Ga0451791_0161359 | 3300041451 | Bacteria | 1771 |
| 358 | Ga0451839_1355463 | 3300041496 | Bacteria | 931 |
| 359 | Ga0439433_0001912 | 3300041999 | Bacteria | 4357 |
| 360 | Ga0439448_0010688 | 3300042005 | Bacteria | 2725 |
| 361 | Ga0439449_0000174 | 3300042007 | Bacteria | 22298 |
| 362 | Ga0439449_0039242 | 3300042007 | Bacteria | 1760 |
| 363 | Ga0439455_0004473 | 3300042012 | Bacteria | 2770 |
| 364 | Ga0439457_001137 | 3300042014 | Bacteria | 8012 |
| 365 | Ga0439457_001725 | 3300042014 | Bacteria | 6479 |
| 366 | Ga0450894_002160 | 3300042131 | Bacteria | 2675 |
| 367 | Ga0450896_000923 | 3300042133 | Bacteria | 3395 |
| 368 | Ga0450899_000712 | 3300042135 | Bacteria | 3796 |
| 369 | Ga0450903_001042 | 3300042138 | Bacteria | 5286 |
| 370 | Ga0439458_0001351 | 3300042157 | Bacteria | 6182 |
| 371 | Ga0451577_0230952 | 3300042876 | Bacteria | 1673 |
| 372 | Ga0466969_0025351 | 3300044656 | Bacteria | 3049 |
| 373 | Ga0466969_0043086 | 3300044656 | Bacteria | 2250 |
| 374 | Ga0466969_0060287 | 3300044656 | Bacteria | 1844 |
| 375 | Ga0466972_0008641 | 3300044658 | Bacteria | 5108 |
| 376 | Ga0466972_0083628 | 3300044658 | Bacteria | 1518 |
| 377 | Ga0466972_0098991 | 3300044658 | Bacteria | 1380 |
| 378 | Ga0466965_0174065 | 3300044683 | Bacteria | 1133 |
| 379 | Ga0466966_0053212 | 3300044684 | Bacteria | 2568 |
| 380 | Ga0466966_0120758 | 3300044684 | Bacteria | 1610 |
| 381 | Ga0466961_0027528 | 3300044693 | Bacteria | 3656 |
| 382 | Ga0466963_0010310 | 3300044694 | Bacteria | 5655 |
| 383 | Ga0466963_0031124 | 3300044694 | Bacteria | 3447 |
| 384 | Ga0466963_0112519 | 3300044694 | Bacteria | 1869 |
| 385 | Ga0466964_0013638 | 3300044706 | Bacteria | 3084 |
| 386 | Ga0453684_0000045 | 3300044712 | Bacteria | 582917 |
| 387 | Ga0466970_0007115 | 3300044765 | Bacteria | 5599 |
| 388 | Ga0466970_0009315 | 3300044765 | Bacteria | 4959 |
| 389 | Ga0466970_0041897 | 3300044765 | Bacteria | 2434 |
| 390 | Ga0466970_0109727 | 3300044765 | Bacteria | 1506 |
| 391 | Ga0466957_0161065 | 3300044842 | Bacteria | 1457 |
| 392 | Ga0466960_0008493 | 3300044901 | Bacteria | 4208 |
| 393 | Ga0466959_0002626 | 3300045049 | Bacteria | 11539 |
| 394 | Ga0466959_0012597 | 3300045049 | Bacteria | 6117 |
| 395 | Ga0466959_0061500 | 3300045049 | Bacteria | 2730 |
| 396 | Ga0466958_0070297 | 3300045836 | Bacteria | 2142 |
| 397 | Ga0466967_0124248 | 3300045976 | Bacteria | 2389 |
| 398 | Ga0466967_0244556 | 3300045976 | Bacteria | 1712 |
| 399 | Ga0495617_007022 | 3300046452 | Bacteria | 3925 |
| 400 | Ga0495627_033301 | 3300046453 | Bacteria | 1616 |
| 401 | Ga0495627_051779 | 3300046453 | Bacteria | 1233 |
| 402 | Ga0495592_0004051 | 3300046454 | Bacteria | 10655 |
| 403 | Ga0495592_0022978 | 3300046454 | Bacteria | 4745 |
| 404 | Ga0495592_0026097 | 3300046454 | Bacteria | 4432 |
| 405 | Ga0495592_0041037 | 3300046454 | Bacteria | 3469 |
| 406 | Ga0495603_0014958 | 3300046455 | Bacteria | 4691 |
| 407 | Ga0495603_0110149 | 3300046455 | Bacteria | 1606 |
| 408 | Ga0495629_0001877 | 3300046459 | Bacteria | 16400 |
| 409 | Ga0495629_0002031 | 3300046459 | Bacteria | 15733 |
| 410 | Ga0495629_0003393 | 3300046459 | Bacteria | 12051 |
| 411 | Ga0495629_0028925 | 3300046459 | Bacteria | 3933 |
| 412 | Ga0495629_0068281 | 3300046459 | Bacteria | 2480 |
| 413 | Ga0495629_0120839 | 3300046459 | Bacteria | 1825 |
| 414 | Ga0495629_0210073 | 3300046459 | Bacteria | 1344 |
| 415 | Ga0495638_0094084 | 3300046460 | Bacteria | 1801 |
| 416 | Ga0495651_0002330 | 3300046462 | Bacteria | 14656 |
| 417 | Ga0495651_0003385 | 3300046462 | Bacteria | 12238 |
| 418 | Ga0495651_0012853 | 3300046462 | Bacteria | 6468 |
| 419 | Ga0495651_0201905 | 3300046462 | Bacteria | 1391 |
| 420 | Ga0495653_0029384 | 3300046463 | Bacteria | 4388 |
| 421 | Ga0495653_0040822 | 3300046463 | Bacteria | 3624 |
| 422 | Ga0495580_0052614 | 3300046472 | Bacteria | 2875 |
| 423 | Ga0495582_0129856 | 3300046473 | Bacteria | 1423 |
| 424 | Ga0495605_0017442 | 3300046474 | Bacteria | 3865 |
| 425 | Ga0495639_0023359 | 3300046475 | Bacteria | 2717 |
| 426 | Ga0495662_0000436 | 3300046476 | Bacteria | 18733 |
| 427 | Ga0495662_0000592 | 3300046476 | Bacteria | 16737 |
| 428 | Ga0495662_0007753 | 3300046476 | Bacteria | 5287 |
| 429 | Ga0495662_0103287 | 3300046476 | Bacteria | 1394 |
| 430 | Ga0495662_0124039 | 3300046476 | Bacteria | 1268 |
| 431 | Ga0495664_0003142 | 3300046477 | Bacteria | 8967 |
| 432 | Ga0495664_0005397 | 3300046477 | Bacteria | 7019 |
| 433 | Ga0495664_0007847 | 3300046477 | Bacteria | 5939 |
| 434 | Ga0495664_0047667 | 3300046477 | Bacteria | 2543 |
| 435 | Ga0495594_0000282 | 3300046499 | Bacteria | 25010 |
| 436 | Ga0495594_0046474 | 3300046499 | Bacteria | 2384 |
| 437 | Ga0495594_0050080 | 3300046499 | Bacteria | 2297 |
| 438 | Ga0495594_0055983 | 3300046499 | Bacteria | 2175 |
| 439 | Ga0495594_0079025 | 3300046499 | Bacteria | 1836 |
| 440 | Ga0495606_0004135 | 3300046507 | Bacteria | 14728 |
| 441 | Ga0495608_0007002 | 3300046511 | Bacteria | 7981 |
| 442 | Ga0495608_0145243 | 3300046511 | Bacteria | 1513 |
| 443 | Ga0495616_0014269 | 3300046513 | Bacteria | 4454 |
| 444 | Ga0495618_0090725 | 3300046514 | Bacteria | 1953 |
| 445 | Ga0495618_0094808 | 3300046514 | Bacteria | 1908 |
| 446 | Ga0495628_0044011 | 3300046516 | Bacteria | 3553 |
| 447 | Ga0495628_0062553 | 3300046516 | Bacteria | 2917 |
| 448 | Ga0495628_0078572 | 3300046516 | Bacteria | 2566 |
| 449 | Ga0495628_0331253 | 3300046516 | Bacteria | 1122 |
| 450 | Ga0495630_0017245 | 3300046517 | Bacteria | 5288 |
| 451 | Ga0495630_0030227 | 3300046517 | Bacteria | 4029 |
| 452 | Ga0495630_0111220 | 3300046517 | Bacteria | 2075 |
| 453 | Ga0495631_0018611 | 3300046518 | Bacteria | 3267 |
| 454 | Ga0495643_0074567 | 3300046522 | Bacteria | 1776 |
| 455 | Ga0495648_0037243 | 3300046524 | Bacteria | 3128 |
| 456 | Ga0495666_0014181 | 3300046526 | Bacteria | 3971 |
| 457 | Ga0495666_0019026 | 3300046526 | Bacteria | 3411 |
| 458 | Ga0495652_0033905 | 3300046529 | Bacteria | 4452 |
| 459 | Ga0495652_0043080 | 3300046529 | Bacteria | 3890 |
| 460 | Ga0495652_0085304 | 3300046529 | Bacteria | 2595 |
| 461 | Ga0495652_0133309 | 3300046529 | Bacteria | 1963 |
| 462 | Ga0495652_0141861 | 3300046529 | Bacteria | 1888 |
| 463 | Ga0495665_0002822 | 3300046531 | Bacteria | 9369 |
| 464 | Ga0495665_0049993 | 3300046531 | Bacteria | 2216 |
| 465 | Ga0495665_0090567 | 3300046531 | Bacteria | 1607 |
| 466 | Ga0495640_0003158 | 3300046533 | Bacteria | 13271 |
| 467 | Ga0495640_0005478 | 3300046533 | Bacteria | 10098 |
| 468 | Ga0495640_0007378 | 3300046533 | Bacteria | 8652 |
| 469 | Ga0495640_0062298 | 3300046533 | Bacteria | 2530 |
| 470 | Ga0495586_0017217 | 3300046535 | Bacteria | 3841 |
| 471 | Ga0495586_0029203 | 3300046535 | Bacteria | 2951 |
| 472 | Ga0495587_0007220 | 3300046536 | Bacteria | 7208 |
| 473 | Ga0495587_0024290 | 3300046536 | Bacteria | 3716 |
| 474 | Ga0495587_0063726 | 3300046536 | Bacteria | 2155 |
| 475 | Ga0495587_0073214 | 3300046536 | Bacteria | 1990 |
| 476 | Ga0495609_0025039 | 3300046538 | Bacteria | 2736 |
| 477 | Ga0495597_0023558 | 3300046542 | Bacteria | 2847 |
| 478 | Ga0495645_0033582 | 3300046543 | Bacteria | 3743 |
| 479 | Ga0495622_0052319 | 3300046557 | Bacteria | 1894 |
| 480 | Ga0495633_0010944 | 3300046558 | Bacteria | 4926 |
| 481 | Ga0495667_0006232 | 3300046559 | Bacteria | 8083 |
| 482 | Ga0495667_0022517 | 3300046559 | Bacteria | 4244 |
| 483 | Ga0495667_0042645 | 3300046559 | Bacteria | 3009 |
| 484 | Ga0495668_0019922 | 3300046616 | Bacteria | 3859 |
| 485 | Ga0495634_0005624 | 3300046642 | Bacteria | 9602 |
| 486 | Ga0495634_0016321 | 3300046642 | Bacteria | 5312 |
| 487 | Ga0495634_0039425 | 3300046642 | Bacteria | 3216 |
| 488 | Ga0495634_0042581 | 3300046642 | Bacteria | 3079 |
| 489 | Ga0495634_0107489 | 3300046642 | Bacteria | 1797 |
| 490 | Ga0495625_0031265 | 3300046660 | Bacteria | 3962 |
| 491 | Ga0495625_0042721 | 3300046660 | Bacteria | 3291 |
| 492 | Ga0495625_0061899 | 3300046660 | Bacteria | 2646 |
| 493 | Ga0495635_0019232 | 3300046663 | Bacteria | 4764 |
| 494 | Ga0495635_0048568 | 3300046663 | Bacteria | 2925 |
| 495 | Ga0495661_0029268 | 3300046665 | Bacteria | 3518 |
| 496 | Ga0495588_0000819 | 3300046674 | Bacteria | 13858 |
| 497 | Ga0495588_0133260 | 3300046674 | Bacteria | 1311 |
| 498 | Ga0495657_0007036 | 3300046675 | Bacteria | 8725 |
| 499 | Ga0495657_0010436 | 3300046675 | Bacteria | 6989 |
| 500 | Ga0495657_0018875 | 3300046675 | Bacteria | 4983 |
| 501 | Ga0495657_0031722 | 3300046675 | Bacteria | 3690 |
| 502 | Ga0495657_0034607 | 3300046675 | Bacteria | 3507 |
| 503 | Ga0495599_0023244 | 3300046678 | Bacteria | 3874 |
| 504 | Ga0495599_0047234 | 3300046678 | Bacteria | 2698 |
| 505 | Ga0495599_0125134 | 3300046678 | Bacteria | 1598 |
| 506 | Ga0495623_0008819 | 3300046679 | Bacteria | 6544 |
| 507 | Ga0495623_0068381 | 3300046679 | Bacteria | 2215 |
| 508 | Ga0495623_0073147 | 3300046679 | Bacteria | 2131 |
| 509 | Ga0495646_0008053 | 3300046680 | Bacteria | 6699 |
| 510 | Ga0495646_0008679 | 3300046680 | Bacteria | 6460 |
| 511 | Ga0495658_0017872 | 3300046683 | Bacteria | 3675 |
| 512 | Ga0495658_0040377 | 3300046683 | Bacteria | 2594 |
| 513 | Ga0495613_0000904 | 3300046689 | Bacteria | 22821 |
| 514 | Ga0495613_0004025 | 3300046689 | Bacteria | 10998 |
| 515 | Ga0495613_0019745 | 3300046689 | Bacteria | 5022 |
| 516 | Ga0495613_0021426 | 3300046689 | Bacteria | 4817 |
| 517 | Ga0495613_0038415 | 3300046689 | Bacteria | 3548 |
| 518 | Ga0495613_0052346 | 3300046689 | Bacteria | 3007 |
| 519 | Ga0495613_0053846 | 3300046689 | Bacteria | 2959 |
| 520 | Ga0495624_0023985 | 3300046690 | Bacteria | 4019 |
| 521 | Ga0495624_0161755 | 3300046690 | Bacteria | 1367 |
| 522 | Ga0495649_0044038 | 3300046694 | Bacteria | 2436 |
| 523 | Ga0495589_0054727 | 3300046794 | Bacteria | 1967 |
| 524 | Ga0495600_0024191 | 3300046809 | Bacteria | 3908 |
| 525 | Ga0495600_0064435 | 3300046809 | Bacteria | 2395 |
| 526 | Ga0495600_0125929 | 3300046809 | Bacteria | 1666 |
| 527 | Ga0495660_0065994 | 3300046810 | Bacteria | 1930 |
| 528 | Ga0495581_0013956 | 3300047315 | Bacteria | 4659 |
| 529 | Ga0495581_0022890 | 3300047315 | Bacteria | 3619 |
| 530 | Ga0495581_0060517 | 3300047315 | Bacteria | 2188 |
| 531 | Ga0495604_0002310 | 3300047317 | Bacteria | 15280 |
| 532 | Ga0495604_0004139 | 3300047317 | Bacteria | 11518 |
| 533 | Ga0495604_0009936 | 3300047317 | Bacteria | 7534 |
| 534 | Ga0495604_0044770 | 3300047317 | Bacteria | 3455 |
| 535 | Ga0495604_0072502 | 3300047317 | Bacteria | 2602 |
| 536 | Ga0495636_0007135 | 3300047318 | Bacteria | 4398 |
| 537 | Ga0495636_0022063 | 3300047318 | Bacteria | 2573 |
| 538 | Ga0495636_0070236 | 3300047318 | Bacteria | 1493 |
| 539 | Ga0495674_0034062 | 3300047319 | Bacteria | 4607 |
| 540 | Ga0495674_0034642 | 3300047319 | Bacteria | 4563 |
| 541 | Ga0495674_0154623 | 3300047319 | Bacteria | 1922 |
| 542 | Ga0495674_0327923 | 3300047319 | Bacteria | 1246 |
| 543 | Ga0495676_0011428 | 3300047321 | Bacteria | 8015 |
| 544 | Ga0495676_0015587 | 3300047321 | Bacteria | 6762 |
| 545 | Ga0495676_0052822 | 3300047321 | Bacteria | 3241 |
| 546 | Ga0495676_0103609 | 3300047321 | Bacteria | 2100 |
| 547 | Ga0495680_0006882 | 3300047322 | Bacteria | 10495 |
| 548 | Ga0495680_0028785 | 3300047322 | Bacteria | 4553 |
| 549 | Ga0495680_0267396 | 3300047322 | Bacteria | 1208 |
| 550 | Ga0495683_0068160 | 3300047323 | Bacteria | 1750 |
| 551 | Ga0495687_001601 | 3300047443 | Bacteria | 20428 |
| 552 | Ga0495675_0015948 | 3300047444 | Bacteria | 4751 |
| 553 | Ga0495675_0031290 | 3300047444 | Bacteria | 3397 |
| 554 | Ga0495675_0049850 | 3300047444 | Bacteria | 2660 |
| 555 | Ga0495675_0050288 | 3300047444 | Bacteria | 2649 |
| 556 | Ga0495675_0058530 | 3300047444 | Bacteria | 2443 |
| 557 | Ga0495675_0108669 | 3300047444 | Bacteria | 1732 |
| 558 | Ga0495677_0053781 | 3300047445 | Bacteria | 1485 |
| 559 | Ga0495685_022249 | 3300047447 | Bacteria | 2182 |
| 560 | Ga0495681_0003265 | 3300047470 | Bacteria | 11308 |
| 561 | Ga0495681_0050128 | 3300047470 | Bacteria | 1969 |
| 562 | Ga0495684_0053550 | 3300047471 | Bacteria | 3079 |
| 563 | Ga0495686_0128814 | 3300047472 | Bacteria | 1502 |
| 564 | Ga0495593_0000283 | 3300047673 | Bacteria | 27649 |
| 565 | Ga0495593_0019174 | 3300047673 | Bacteria | 3838 |
| 566 | Ga0495593_0028303 | 3300047673 | Bacteria | 3078 |
| 567 | Ga0495602_0017320 | 3300048088 | Bacteria | 7224 |
| 568 | Ga0495602_0018554 | 3300048088 | Bacteria | 6942 |
| 569 | Ga0495602_0042791 | 3300048088 | Bacteria | 4123 |
| 570 | Ga0495602_0058724 | 3300048088 | Bacteria | 3365 |
| 571 | Ga0495614_0000345 | 3300048089 | Bacteria | 18437 |
| 572 | Ga0495614_0025655 | 3300048089 | Bacteria | 2541 |
| 573 | Ga0495614_0027182 | 3300048089 | Bacteria | 2467 |
| 574 | Ga0496100_0011567 | 3300048903 | Bacteria | 5028 |
| 575 | Ga0496101_0006825 | 3300048904 | Bacteria | 7367 |
| 576 | Ga0496103_0023960 | 3300048906 | Bacteria | 3682 |
| 577 | Ga0496104_0004325 | 3300048907 | Bacteria | 12361 |
| 578 | Ga0496104_0065750 | 3300048907 | Bacteria | 3442 |
| 579 | Ga0496104_0183277 | 3300048907 | Bacteria | 2004 |
| 580 | Ga0496104_0273541 | 3300048907 | Bacteria | 1602 |
| 581 | Ga0496105_0027258 | 3300048908 | Bacteria | 4664 |
| 582 | Ga0496105_0141814 | 3300048908 | Bacteria | 1978 |
| 583 | Ga0496105_0306760 | 3300048908 | Bacteria | 1275 |
| 584 | Ga0496106_0003631 | 3300048909 | Bacteria | 11507 |
| 585 | Ga0496108_0026608 | 3300048911 | Bacteria | 4772 |
| 586 | Ga0496108_0065414 | 3300048911 | Bacteria | 3065 |
| 587 | Ga0496109_0008973 | 3300048912 | Bacteria | 8517 |
| 588 | Ga0496109_0060423 | 3300048912 | Bacteria | 3463 |
| 589 | Ga0496109_0138073 | 3300048912 | Bacteria | 2279 |
| 590 | Ga0496110_0009486 | 3300048913 | Bacteria | 7880 |
| 591 | Ga0496111_0072878 | 3300048914 | Bacteria | 2500 |
| 592 | Ga0496112_0010903 | 3300048915 | Bacteria | 8275 |
| 593 | Ga0496112_0020724 | 3300048915 | Bacteria | 6237 |
| 594 | Ga0496112_0320519 | 3300048915 | Bacteria | 1494 |
| 595 | Ga0496113_0100131 | 3300048916 | Bacteria | 2245 |
| 596 | Ga0496114_0037320 | 3300048917 | Bacteria | 4018 |
| 597 | Ga0496114_0094503 | 3300048917 | Bacteria | 2543 |
| 598 | Ga0496115_0065815 | 3300048918 | Bacteria | 2928 |
| 599 | Ga0501323_000501 | 3300049539 | Bacteria | 2935 |
| 600 | Ga0501031_0019173 | 3300049568 | Bacteria | 4454 |
| 601 | Ga0501031_0023838 | 3300049568 | Bacteria | 3990 |
| 602 | Ga0501032_0021013 | 3300049569 | Bacteria | 4541 |
| 603 | Ga0501033_0007870 | 3300049570 | Bacteria | 8259 |
| 604 | Ga0501033_0022792 | 3300049570 | Bacteria | 4721 |
| 605 | Ga0501034_0002162 | 3300049571 | Bacteria | 24379 |
| 606 | Ga0501036_0001507 | 3300049572 | Bacteria | 17961 |
| 607 | Ga0501036_0003633 | 3300049572 | Bacteria | 12334 |
| 608 | Ga0501036_0016135 | 3300049572 | Bacteria | 6242 |
| 609 | Ga0501036_0022337 | 3300049572 | Bacteria | 5321 |
| 610 | Ga0501037_0034136 | 3300049573 | Bacteria | 3755 |
| 611 | Ga0501037_0069660 | 3300049573 | Bacteria | 2560 |
| 612 | Ga0501038_0053726 | 3300049574 | Bacteria | 3467 |
| 613 | Ga0501038_0060378 | 3300049574 | Bacteria | 3245 |
| 614 | Ga0501039_0003767 | 3300049575 | Bacteria | 11397 |
| 615 | Ga0501042_0161417 | 3300049578 | Bacteria | 1617 |
| 616 | Ga0501043_0002374 | 3300049579 | Bacteria | 15938 |
| 617 | Ga0501043_0005810 | 3300049579 | Bacteria | 9924 |
| 618 | Ga0501043_0198419 | 3300049579 | Bacteria | 1558 |
| 619 | Ga0501047_0000068 | 3300049581 | Bacteria | 129241 |
| 620 | Ga0501047_0010336 | 3300049581 | Bacteria | 8827 |
| 621 | Ga0501048_0009177 | 3300049582 | Bacteria | 7435 |
| 622 | Ga0501068_0171705 | 3300049584 | Bacteria | 1369 |
| 623 | Ga0501069_0067206 | 3300049585 | Bacteria | 2005 |
| 624 | Ga0501070_0004372 | 3300049586 | Bacteria | 12143 |
| 625 | Ga0501242_001153 | 3300049674 | Bacteria | 2591 |
| 626 | Ga0501247_000034 | 3300049677 | Bacteria | 7923 |
| 627 | Ga0501257_002518 | 3300049686 | Bacteria | 3866 |
| 628 | Ga0501258_000911 | 3300049687 | Bacteria | 2230 |
| 629 | Ga0501225_0008530 | 3300049705 | Bacteria | 2937 |
| 630 | Ga0501267_000307 | 3300049764 | Bacteria | 3612 |
| 631 | Ga0501268_000956 | 3300049765 | Bacteria | 3413 |
| 632 | Ga0501270_000164 | 3300049767 | Bacteria | 5342 |
| 633 | Ga0501273_000321 | 3300049770 | Bacteria | 3732 |
| 634 | Ga0501035_0008382 | 3300049822 | Bacteria | 9624 |
| 635 | Ga0501035_0016266 | 3300049822 | Bacteria | 6862 |
| 636 | Ga0501044_0001473 | 3300049823 | Bacteria | 27597 |
| 637 | Ga0501044_0036328 | 3300049823 | Bacteria | 5154 |
| 638 | Ga0501044_0073204 | 3300049823 | Bacteria | 3483 |
| 639 | Ga0501044_0379298 | 3300049823 | Bacteria | 1329 |
| 640 | nmdc:mga03n38_39319_c1 | 3300050490 | Bacteria | 2051 |
| 641 | nmdc:mga06z11_1011_c1 | 3300050494 | Bacteria | 10273 |
| 642 | nmdc:mga04h51_1208_c1 | 3300050495 | Bacteria | 4636 |
| 643 | nmdc:mga06r32_120317_c1 | 3300050510 | Bacteria | 2589 |
| 644 | nmdc:mga08y16_43378_c1 | 3300050511 | Bacteria | 4713 |
| 645 | nmdc:mga0n895_23600_c1 | 3300050512 | Bacteria | 5784 |
| 646 | nmdc:mga0rr50_12614_c1 | 3300050513 | Bacteria | 5471 |
| 647 | nmdc:mga08x19_156167_c1 | 3300050514 | Bacteria | 1197 |
| 648 | nmdc:mga08x19_20996_c1 | 3300050514 | Bacteria | 4028 |
| 649 | nmdc:mga08x19_2566_c1 | 3300050514 | Bacteria | 11043 |
| 650 | nmdc:mga0a205_20389_c1 | 3300050515 | Bacteria | 6253 |
| 651 | Ga0495601_0049833 | 3300053077 | Bacteria | 2641 |
| 652 | Ga0495601_0117163 | 3300053077 | Bacteria | 1728 |
| 653 | Ga0495612_0007880 | 3300053078 | Bacteria | 4343 |
| 654 | Ga0495612_0017663 | 3300053078 | Bacteria | 2856 |
| 655 | Ga0495612_0086781 | 3300053078 | Bacteria | 1320 |
| 656 | Ga0495619_0092619 | 3300053085 | Bacteria | 2047 |
| 657 | Ga0495619_0121996 | 3300053085 | Bacteria | 1787 |
| 658 | Ga0500553_032257 | 3300053101 | Bacteria | 2610 |
| 659 | Ga0500560_035406 | 3300053107 | Bacteria | 1536 |
| 660 | Ga0500573_0128214 | 3300053140 | Bacteria | 1407 |
| 661 | Ga0500600_0074394 | 3300053149 | Bacteria | 1854 |
| 662 | Ga0500600_0097981 | 3300053149 | Bacteria | 1552 |
| 663 | Ga0500634_0100345 | 3300053161 | Bacteria | 1450 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300041496 | Ga0451839_1355463 | Ga0451839_1355463_20_859 | 256 |
| 2 | 3300046477 | Ga0495664_0005397 | Ga0495664_0005397_15_962 | 274 |
| 3 | 3300046689 | Ga0495613_0052346 | Ga0495613_0052346_15_962 | 274 |
| 4 | 3300025940 | Ga0207691_10089552 | Ga0207691_100895521 | 275 |
| 5 | 3300046454 | Ga0495592_0004051 | Ga0495592_0004051_2039_3022 | 286 |
| 6 | 3300046476 | Ga0495662_0000592 | Ga0495662_0000592_11836_12819 | 286 |
| 7 | 3300046517 | Ga0495630_0017245 | Ga0495630_0017245_3605_4588 | 286 |
| 8 | 3300046526 | Ga0495666_0014181 | Ga0495666_0014181_961_1944 | 286 |
| 9 | 3300046529 | Ga0495652_0033905 | Ga0495652_0033905_757_1740 | 286 |
| 10 | 3300046531 | Ga0495665_0002822 | Ga0495665_0002822_3785_4768 | 286 |
| 11 | 3300046535 | Ga0495586_0017217 | Ga0495586_0017217_2481_3464 | 286 |
| 12 | 3300046536 | Ga0495587_0024290 | Ga0495587_0024290_1247_2230 | 286 |
| 13 | 3300046642 | Ga0495634_0039425 | Ga0495634_0039425_352_1335 | 286 |
| 14 | 3300046663 | Ga0495635_0048568 | Ga0495635_0048568_982_1965 | 286 |
| 15 | 3300046680 | Ga0495646_0008679 | Ga0495646_0008679_3223_4206 | 286 |
| 16 | 3300047317 | Ga0495604_0002310 | Ga0495604_0002310_3042_4025 | 286 |
| 17 | 3300047319 | Ga0495674_0034062 | Ga0495674_0034062_1242_2225 | 286 |
| 18 | 3300053078 | Ga0495612_0086781 | Ga0495612_0086781_96_1079 | 286 |
| 19 | 3300053085 | Ga0495619_0092619 | Ga0495619_0092619_1041_2024 | 286 |
| 20 | 3300046463 | Ga0495653_0029384 | Ga0495653_0029384_2569_3585 | 297 |
| 21 | 3300046472 | Ga0495580_0052614 | Ga0495580_0052614_829_1845 | 297 |
| 22 | 3300046511 | Ga0495608_0007002 | Ga0495608_0007002_2423_3439 | 297 |
| 23 | 3300046514 | Ga0495618_0094808 | Ga0495618_0094808_308_1324 | 297 |
| 24 | 3300046533 | Ga0495640_0007378 | Ga0495640_0007378_319_1335 | 297 |
| 25 | 3300046559 | Ga0495667_0022517 | Ga0495667_0022517_2396_3412 | 297 |
| 26 | 3300046675 | Ga0495657_0031722 | Ga0495657_0031722_743_1759 | 297 |
| 27 | 3300046809 | Ga0495600_0024191 | Ga0495600_0024191_108_1124 | 297 |
| 28 | 3300047315 | Ga0495581_0013956 | Ga0495581_0013956_2968_3984 | 297 |
| 29 | 3300047673 | Ga0495593_0019174 | Ga0495593_0019174_1276_2292 | 297 |
| 30 | 3300048088 | Ga0495602_0058724 | Ga0495602_0058724_961_1977 | 297 |
| 31 | 3300031507 | Ga0307509_10025474 | Ga0307509_100254747 | 301 |
| 32 | 3300005293 | Ga0065715_10157574 | Ga0065715_101575741 | 308 |
| 33 | 3300005331 | Ga0070670_100009939 | Ga0070670_1000099395 | 308 |
| 34 | 3300044712 | Ga0453684_0000045 | Ga0453684_0000045_443215_444285 | 311 |
| 35 | 3300044765 | Ga0466970_0041897 | Ga0466970_0041897_1190_2251 | 313 |
| 36 | 3300045049 | Ga0466959_0061500 | Ga0466959_0061500_188_1249 | 313 |
| 37 | 3300047319 | Ga0495674_0327923 | Ga0495674_0327923_190_1224 | 315 |
| 38 | 3300005435 | Ga0070714_100000468 | Ga0070714_10000046822 | 316 |
| 39 | 3300025929 | Ga0207664_10004432 | Ga0207664_100044322 | 316 |
| 40 | 3300037466 | Ga0395898_0041040 | Ga0395898_0041040_1178_2206 | 316 |
| 41 | iso_pu_bacteria | 2515154155 | 2515854792 | 316 |
| 42 | iso_pu_bacteria | 2912757875 | 2912764013 | 316 |
| 43 | iso_pu_bacteria | 8025530807 | 8025533333 | 316 |
| 44 | iso_pu_bacteria | 2547132111 | 2547412287 | 317 |
| 45 | iso_pu_bacteria | 2554235005 | 2554260764 | 317 |
| 46 | iso_pu_bacteria | 2582581312 | 2585296966 | 317 |
| 47 | iso_pu_bacteria | 2582581313 | 2585304102 | 317 |
| 48 | iso_pu_bacteria | 2582581314 | 2585312095 | 317 |
| 49 | iso_pu_bacteria | 2616644814 | 2616698941 | 317 |
| 50 | iso_pu_bacteria | 2616644941 | 2616902441 | 317 |
| 51 | iso_pu_bacteria | 2643221578 | 2643904114 | 317 |
| 52 | iso_pu_bacteria | 2643221587 | 2643947173 | 317 |
| 53 | iso_pu_bacteria | 2643221601 | 2644016932 | 317 |
| 54 | iso_pu_bacteria | 2643221631 | 2644177760 | 317 |
| 55 | iso_pu_bacteria | 2643221647 | 2644263868 | 317 |
| 56 | iso_pu_bacteria | 2643221673 | 2644402469 | 317 |
| 57 | iso_pu_bacteria | 2643221677 | 2644433356 | 317 |
| 58 | iso_pu_bacteria | 2643221678 | 2644440955 | 317 |
| 59 | iso_pu_bacteria | 2643221714 | 2644632511 | 317 |
| 60 | iso_pu_bacteria | 2675903058 | 2676477308 | 317 |
| 61 | iso_pu_bacteria | 2784132148 | 2784591953 | 317 |
| 62 | iso_pu_bacteria | 2784746763 | 2785339761 | 317 |
| 63 | iso_pu_bacteria | 2784746768 | 2785373185 | 317 |
| 64 | iso_pu_bacteria | 2786546132 | 2786674819 | 317 |
| 65 | iso_pu_bacteria | 2795385470 | 2795780892 | 317 |
| 66 | iso_pu_bacteria | 2808606359 | 2808845322 | 317 |
| 67 | iso_pu_bacteria | 2808606375 | 2808915027 | 317 |
| 68 | iso_pu_bacteria | 2808606448 | 2809235591 | 317 |
| 69 | iso_pu_bacteria | 2808606982 | 2811842942 | 317 |
| 70 | iso_pu_bacteria | 2811994879 | 2812354387 | 317 |
| 71 | iso_pu_bacteria | 2811994917 | 2812477367 | 317 |
| 72 | iso_pu_bacteria | 2818991463 | 2819699551 | 317 |
| 73 | iso_pu_bacteria | 2818991472 | 2819746707 | 317 |
| 74 | iso_pu_bacteria | 2827628540 | 2827633714 | 317 |
| 75 | iso_pu_bacteria | 2852635781 | 2852636009 | 317 |
| 76 | iso_pu_bacteria | 2862178590 | 2862184219 | 317 |
| 77 | iso_pu_bacteria | 2862281513 | 2862283045 | 317 |
| 78 | iso_pu_bacteria | 2862290372 | 2862291841 | 317 |
| 79 | iso_pu_bacteria | 2862382967 | 2862384058 | 317 |
| 80 | iso_pu_bacteria | 2862574272 | 2862576183 | 317 |
| 81 | iso_pu_bacteria | 2863067949 | 2863070766 | 317 |
| 82 | iso_pu_bacteria | 2863404153 | 2863410262 | 317 |
| 83 | iso_pu_bacteria | 2867428634 | 2867436378 | 317 |
| 84 | iso_pu_bacteria | 2867475112 | 2867478734 | 317 |
| 85 | iso_pu_bacteria | 2873151551 | 2873152629 | 317 |
| 86 | iso_pu_bacteria | 2875391855 | 2875397412 | 317 |
| 87 | iso_pu_bacteria | 2877676314 | 2877677716 | 317 |
| 88 | iso_pu_bacteria | 2912715099 | 2912716007 | 317 |
| 89 | iso_pu_bacteria | 2912723979 | 2912728964 | 317 |
| 90 | iso_pu_bacteria | 2919468124 | 2919475175 | 317 |
| 91 | iso_pu_bacteria | 2935390628 | 2935393108 | 317 |
| 92 | iso_pu_bacteria | 2946045630 | 2946047102 | 317 |
| 93 | iso_pu_bacteria | 2946064051 | 2946071316 | 317 |
| 94 | iso_pu_bacteria | 2946072368 | 2946079153 | 317 |
| 95 | iso_pu_bacteria | 2947224130 | 2947225429 | 317 |
| 96 | iso_pu_bacteria | 2954002825 | 2954009643 | 317 |
| 97 | iso_pu_bacteria | 2954380949 | 2954382492 | 317 |
| 98 | iso_pu_bacteria | 2954673503 | 2954680583 | 317 |
| 99 | iso_pu_bacteria | 2954682443 | 2954683570 | 317 |
| 100 | iso_pu_bacteria | 2954691527 | 2954693293 | 317 |
| 101 | iso_pu_bacteria | 2954701450 | 2954708386 | 317 |
| 102 | iso_pu_bacteria | 2954711539 | 2954712970 | 317 |
| 103 | iso_pu_bacteria | 2954721474 | 2954722929 | 317 |
| 104 | iso_pu_bacteria | 2954731030 | 2954738901 | 317 |
| 105 | iso_pu_bacteria | 2954740390 | 2954741838 | 317 |
| 106 | iso_pu_bacteria | 2954749733 | 2954757758 | 317 |
| 107 | iso_pu_bacteria | 2954759201 | 2954760817 | 317 |
| 108 | iso_pu_bacteria | 2990059506 | 2990063377 | 317 |
| 109 | iso_pu_bacteria | 2995463766 | 2995465772 | 317 |
| 110 | iso_pu_bacteria | 2997451912 | 2997452316 | 317 |
| 111 | iso_pu_bacteria | 3006393351 | 3006396996 | 317 |
| 112 | iso_pu_bacteria | 3006486233 | 3006488136 | 317 |
| 113 | iso_pu_bacteria | 3006493962 | 3006494615 | 317 |
| 114 | iso_pu_bacteria | 8008558824 | 8008564258 | 317 |
| 115 | iso_pu_bacteria | 8008574985 | 8008575874 | 317 |
| 116 | iso_pu_bacteria | 8023623736 | 8023624231 | 317 |
| 117 | iso_pu_bacteria | 8025478263 | 8025484344 | 317 |
| 118 | iso_pu_bacteria | 8054160619 | 8054162635 | 317 |
| 119 | iso_pu_bacteria | 8056447290 | 8056447427 | 317 |
| 120 | iso_pu_bacteria | 8056829672 | 8056836106 | 317 |
| 121 | 3300038725 | Ga0400484_42200 | Ga0400484_42200_8575_9600 | 319 |
| 122 | 3300038726 | Ga0400490_24841 | Ga0400490_24841_601_1626 | 319 |
| 123 | 3300038741 | Ga0400488_31331 | Ga0400488_31331_679_1713 | 319 |
| 124 | 3300039062 | Ga0400483_218673 | Ga0400483_218673_11095_12120 | 319 |
| 125 | 3300039110 | Ga0400487_05605 | Ga0400487_05605_1986_3011 | 319 |
| 126 | 3300049822 | Ga0501035_0008382 | Ga0501035_0008382_334_1362 | 319 |
| 127 | iso_pu_bacteria | 2862507626 | 2862507641 | 319 |
| 128 | iso_pu_bacteria | 2918501144 | 2918501816 | 319 |
| 129 | iso_pu_bacteria | 8048406513 | 8048411904 | 319 |
| 130 | 3300005435 | Ga0070714_100000377 | Ga0070714_10000037718 | 320 |
| 131 | 3300005436 | Ga0070713_100229447 | Ga0070713_1002294472 | 320 |
| 132 | 3300005937 | Ga0081455_10113915 | Ga0081455_101139152 | 320 |
| 133 | 3300012503 | Ga0157313_1002337 | Ga0157313_10023371 | 320 |
| 134 | 3300025928 | Ga0207700_10233759 | Ga0207700_102337592 | 320 |
| 135 | 3300029957 | Ga0265324_10008434 | Ga0265324_100084343 | 320 |
| 136 | 3300037853 | Ga0436364_1442308 | Ga0436364_1442308_520_1545 | 320 |
| 137 | 3300038726 | Ga0400490_05965 | Ga0400490_05965_2270_3307 | 320 |
| 138 | 3300039110 | Ga0400487_27158 | Ga0400487_27158_1299_2336 | 320 |
| 139 | 3300049572 | Ga0501036_0003633 | Ga0501036_0003633_5202_6230 | 320 |
| 140 | 3300001990 | JGI24737J22298_10012771 | JGI24737J22298_100127713 | 321 |
| 141 | 3300003316 | rootH1_10029222 | rootH1_100292222 | 321 |
| 142 | 3300003322 | rootL2_10042722 | rootL2_100427225 | 321 |
| 143 | 3300003354 | JGI25160J50197_1003960 | JGI25160J50197_10039602 | 321 |
| 144 | 3300003578 | Ga0006562J51391_1071585 | Ga0006562J51391_10715855 | 321 |
| 145 | 3300003578 | Ga0006562J51391_1071588 | Ga0006562J51391_10715882 | 321 |
| 146 | 3300005327 | Ga0070658_10000254 | Ga0070658_100002546 | 321 |
| 147 | 3300005329 | Ga0070683_100000609 | Ga0070683_10000060924 | 321 |
| 148 | 3300005329 | Ga0070683_100094264 | Ga0070683_1000942642 | 321 |
| 149 | 3300005331 | Ga0070670_100123104 | Ga0070670_1001231042 | 321 |
| 150 | 3300005331 | Ga0070670_100127535 | Ga0070670_1001275352 | 321 |
| 151 | 3300005334 | Ga0068869_100015677 | Ga0068869_1000156773 | 321 |
| 152 | 3300005337 | Ga0070682_100106736 | Ga0070682_1001067361 | 321 |
| 153 | 3300005340 | Ga0070689_100021197 | Ga0070689_1000211973 | 321 |
| 154 | 3300005341 | Ga0070691_10011804 | Ga0070691_100118043 | 321 |
| 155 | 3300005344 | Ga0070661_100077066 | Ga0070661_1000770662 | 321 |
| 156 | 3300005354 | Ga0070675_100408284 | Ga0070675_1004082841 | 321 |
| 157 | 3300005356 | Ga0070674_100159345 | Ga0070674_1001593451 | 321 |
| 158 | 3300005365 | Ga0070688_100149419 | Ga0070688_1001494191 | 321 |
| 159 | 3300005435 | Ga0070714_100022363 | Ga0070714_1000223633 | 321 |
| 160 | 3300005435 | Ga0070714_100026140 | Ga0070714_1000261404 | 321 |
| 161 | 3300005435 | Ga0070714_100070095 | Ga0070714_1000700952 | 321 |
| 162 | 3300005436 | Ga0070713_100003967 | Ga0070713_1000039674 | 321 |
| 163 | 3300005437 | Ga0070710_10000005 | Ga0070710_10000005149 | 321 |
| 164 | 3300005437 | Ga0070710_10084391 | Ga0070710_100843912 | 321 |
| 165 | 3300005437 | Ga0070710_10086350 | Ga0070710_100863502 | 321 |
| 166 | 3300005439 | Ga0070711_100023293 | Ga0070711_1000232932 | 321 |
| 167 | 3300005445 | Ga0070708_100021157 | Ga0070708_1000211574 | 321 |
| 168 | 3300005445 | Ga0070708_100052316 | Ga0070708_1000523163 | 321 |
| 169 | 3300005445 | Ga0070708_100452080 | Ga0070708_1004520802 | 321 |
| 170 | 3300005456 | Ga0070678_100008415 | Ga0070678_1000084152 | 321 |
| 171 | 3300005458 | Ga0070681_10000034 | Ga0070681_1000003422 | 321 |
| 172 | 3300005458 | Ga0070681_10005337 | Ga0070681_100053376 | 321 |
| 173 | 3300005458 | Ga0070681_10217262 | Ga0070681_102172622 | 321 |
| 174 | 3300005466 | Ga0070685_10244742 | Ga0070685_102447421 | 321 |
| 175 | 3300005467 | Ga0070706_100003390 | Ga0070706_1000033908 | 321 |
| 176 | 3300005467 | Ga0070706_100013961 | Ga0070706_1000139614 | 321 |
| 177 | 3300005467 | Ga0070706_100016021 | Ga0070706_1000160211 | 321 |
| 178 | 3300005467 | Ga0070706_100046674 | Ga0070706_1000466743 | 321 |
| 179 | 3300005467 | Ga0070706_100087688 | Ga0070706_1000876881 | 321 |
| 180 | 3300005468 | Ga0070707_100002696 | Ga0070707_1000026968 | 321 |
| 181 | 3300005468 | Ga0070707_100002739 | Ga0070707_1000027397 | 321 |
| 182 | 3300005468 | Ga0070707_100005643 | Ga0070707_1000056438 | 321 |
| 183 | 3300005468 | Ga0070707_100037090 | Ga0070707_1000370902 | 321 |
| 184 | 3300005468 | Ga0070707_100043064 | Ga0070707_1000430645 | 321 |
| 185 | 3300005471 | Ga0070698_100005256 | Ga0070698_1000052566 | 321 |
| 186 | 3300005471 | Ga0070698_100153898 | Ga0070698_1001538982 | 321 |
| 187 | 3300005518 | Ga0070699_100206465 | Ga0070699_1002064652 | 321 |
| 188 | 3300005530 | Ga0070679_100000270 | Ga0070679_10000027023 | 321 |
| 189 | 3300005530 | Ga0070679_100037284 | Ga0070679_1000372843 | 321 |
| 190 | 3300005530 | Ga0070679_100209390 | Ga0070679_1002093901 | 321 |
| 191 | 3300005535 | Ga0070684_100000132 | Ga0070684_1000001324 | 321 |
| 192 | 3300005535 | Ga0070684_100024493 | Ga0070684_1000244933 | 321 |
| 193 | 3300005535 | Ga0070684_100064458 | Ga0070684_1000644584 | 321 |
| 194 | 3300005535 | Ga0070684_100134280 | Ga0070684_1001342802 | 321 |
| 195 | 3300005539 | Ga0068853_100000551 | Ga0068853_1000005512 | 321 |
| 196 | 3300005539 | Ga0068853_100008839 | Ga0068853_10000883911 | 321 |
| 197 | 3300005539 | Ga0068853_100197230 | Ga0068853_1001972302 | 321 |
| 198 | 3300005563 | Ga0068855_100000414 | Ga0068855_10000041419 | 321 |
| 199 | 3300005563 | Ga0068855_100024619 | Ga0068855_1000246193 | 321 |
| 200 | 3300005563 | Ga0068855_100140150 | Ga0068855_1001401502 | 321 |
| 201 | 3300005564 | Ga0070664_100026447 | Ga0070664_1000264473 | 321 |
| 202 | 3300005564 | Ga0070664_100270112 | Ga0070664_1002701122 | 321 |
| 203 | 3300005577 | Ga0068857_100000178 | Ga0068857_1000001788 | 321 |
| 204 | 3300005577 | Ga0068857_100002576 | Ga0068857_10000257610 | 321 |
| 205 | 3300005578 | Ga0068854_100020542 | Ga0068854_1000205423 | 321 |
| 206 | 3300005614 | Ga0068856_100000541 | Ga0068856_10000054132 | 321 |
| 207 | 3300005614 | Ga0068856_100004114 | Ga0068856_1000041148 | 321 |
| 208 | 3300005614 | Ga0068856_100063338 | Ga0068856_1000633382 | 321 |
| 209 | 3300005615 | Ga0070702_100005174 | Ga0070702_1000051744 | 321 |
| 210 | 3300005616 | Ga0068852_100000641 | Ga0068852_10000064115 | 321 |
| 211 | 3300005616 | Ga0068852_100199729 | Ga0068852_1001997292 | 321 |
| 212 | 3300005617 | Ga0068859_100050634 | Ga0068859_1000506345 | 321 |
| 213 | 3300005618 | Ga0068864_100081054 | Ga0068864_1000810542 | 321 |
| 214 | 3300005618 | Ga0068864_100091894 | Ga0068864_1000918942 | 321 |
| 215 | 3300005718 | Ga0068866_10008160 | Ga0068866_100081604 | 321 |
| 216 | 3300005842 | Ga0068858_100059316 | Ga0068858_1000593162 | 321 |
| 217 | 3300005843 | Ga0068860_100023387 | Ga0068860_1000233872 | 321 |
| 218 | 3300006028 | Ga0070717_10000001 | Ga0070717_10000001340 | 321 |
| 219 | 3300006028 | Ga0070717_10005944 | Ga0070717_100059447 | 321 |
| 220 | 3300006028 | Ga0070717_10008670 | Ga0070717_100086706 | 321 |
| 221 | 3300006028 | Ga0070717_10018740 | Ga0070717_100187404 | 321 |
| 222 | 3300006042 | Ga0075368_10011022 | Ga0075368_100110224 | 321 |
| 223 | 3300006048 | Ga0075363_100013598 | Ga0075363_1000135984 | 321 |
| 224 | 3300006163 | Ga0070715_10040245 | Ga0070715_100402452 | 321 |
| 225 | 3300006175 | Ga0070712_100080623 | Ga0070712_1000806232 | 321 |
| 226 | 3300006175 | Ga0070712_100183374 | Ga0070712_1001833742 | 321 |
| 227 | 3300006178 | Ga0075367_10000715 | Ga0075367_100007156 | 321 |
| 228 | 3300006237 | Ga0097621_100000014 | Ga0097621_1000000146 | 321 |
| 229 | 3300006237 | Ga0097621_100004781 | Ga0097621_1000047817 | 321 |
| 230 | 3300006358 | Ga0068871_100001973 | Ga0068871_1000019735 | 321 |
| 231 | 3300006852 | Ga0075433_10064999 | Ga0075433_100649992 | 321 |
| 232 | 3300006871 | Ga0075434_100006102 | Ga0075434_1000061029 | 321 |
| 233 | 3300006914 | Ga0075436_100002055 | Ga0075436_1000020557 | 321 |
| 234 | 3300006914 | Ga0075436_100004446 | Ga0075436_10000444611 | 321 |
| 235 | 3300006931 | Ga0097620_100050643 | Ga0097620_1000506435 | 321 |
| 236 | 3300006931 | Ga0097620_100210867 | Ga0097620_1002108672 | 321 |
| 237 | 3300006948 | Ga0099826_10110194 | Ga0099826_101101942 | 321 |
| 238 | 3300007076 | Ga0075435_100051451 | Ga0075435_1000514514 | 321 |
| 239 | 3300007076 | Ga0075435_100065475 | Ga0075435_1000654752 | 321 |
| 240 | 3300007265 | Ga0099794_10065577 | Ga0099794_100655772 | 321 |
| 241 | 3300009093 | Ga0105240_10090665 | Ga0105240_100906654 | 321 |
| 242 | 3300009093 | Ga0105240_10102318 | Ga0105240_101023182 | 321 |
| 243 | 3300009093 | Ga0105240_10108702 | Ga0105240_101087022 | 321 |
| 244 | 3300009093 | Ga0105240_10131752 | Ga0105240_101317522 | 321 |
| 245 | 3300009093 | Ga0105240_10188710 | Ga0105240_101887106 | 321 |
| 246 | 3300009093 | Ga0105240_10229568 | Ga0105240_102295683 | 321 |
| 247 | 3300009094 | Ga0111539_10052868 | Ga0111539_100528682 | 321 |
| 248 | 3300009098 | Ga0105245_10013643 | Ga0105245_100136436 | 321 |
| 249 | 3300009098 | Ga0105245_10050134 | Ga0105245_100501342 | 321 |
| 250 | 3300009101 | Ga0105247_10019731 | Ga0105247_100197314 | 321 |
| 251 | 3300009147 | Ga0114129_10273754 | Ga0114129_102737542 | 321 |
| 252 | 3300009148 | Ga0105243_10042551 | Ga0105243_100425513 | 321 |
| 253 | 3300009174 | Ga0105241_10003085 | Ga0105241_100030852 | 321 |
| 254 | 3300009174 | Ga0105241_10007013 | Ga0105241_100070139 | 321 |
| 255 | 3300009174 | Ga0105241_10061137 | Ga0105241_100611372 | 321 |
| 256 | 3300009174 | Ga0105241_10268923 | Ga0105241_102689232 | 321 |
| 257 | 3300009176 | Ga0105242_10018518 | Ga0105242_100185182 | 321 |
| 258 | 3300009177 | Ga0105248_10030353 | Ga0105248_100303534 | 321 |
| 259 | 3300009545 | Ga0105237_10011061 | Ga0105237_100110619 | 321 |
| 260 | 3300009545 | Ga0105237_10035387 | Ga0105237_100353874 | 321 |
| 261 | 3300009545 | Ga0105237_10060977 | Ga0105237_100609772 | 321 |
| 262 | 3300009551 | Ga0105238_10000099 | Ga0105238_100000994 | 321 |
| 263 | 3300009551 | Ga0105238_10004170 | Ga0105238_1000417010 | 321 |
| 264 | 3300009551 | Ga0105238_10064232 | Ga0105238_100642323 | 321 |
| 265 | 3300009553 | Ga0105249_10307208 | Ga0105249_103072081 | 321 |
| 266 | 3300010375 | Ga0105239_10020990 | Ga0105239_100209902 | 321 |
| 267 | 3300010375 | Ga0105239_10050797 | Ga0105239_100507973 | 321 |
| 268 | 3300010375 | Ga0105239_10280370 | Ga0105239_102803703 | 321 |
| 269 | 3300013105 | Ga0157369_10000042 | Ga0157369_1000004278 | 321 |
| 270 | 3300013105 | Ga0157369_10006793 | Ga0157369_100067938 | 321 |
| 271 | 3300013105 | Ga0157369_10011777 | Ga0157369_100117772 | 321 |
| 272 | 3300013105 | Ga0157369_10022583 | Ga0157369_100225833 | 321 |
| 273 | 3300013105 | Ga0157369_10052608 | Ga0157369_100526085 | 321 |
| 274 | 3300013105 | Ga0157369_10071211 | Ga0157369_100712112 | 321 |
| 275 | 3300013297 | Ga0157378_10003197 | Ga0157378_100031975 | 321 |
| 276 | 3300013297 | Ga0157378_10011532 | Ga0157378_100115324 | 321 |
| 277 | 3300013306 | Ga0163162_10173466 | Ga0163162_101734662 | 321 |
| 278 | 3300013306 | Ga0163162_10208372 | Ga0163162_102083722 | 321 |
| 279 | 3300013307 | Ga0157372_10003621 | Ga0157372_100036213 | 321 |
| 280 | 3300013307 | Ga0157372_10018475 | Ga0157372_100184756 | 321 |
| 281 | 3300013307 | Ga0157372_10053080 | Ga0157372_100530803 | 321 |
| 282 | 3300013307 | Ga0157372_10085747 | Ga0157372_100857472 | 321 |
| 283 | 3300013307 | Ga0157372_10122034 | Ga0157372_101220343 | 321 |
| 284 | 3300013307 | Ga0157372_10149382 | Ga0157372_101493822 | 321 |
| 285 | 3300013307 | Ga0157372_10435565 | Ga0157372_104355652 | 321 |
| 286 | 3300013307 | Ga0157372_10461069 | Ga0157372_104610691 | 321 |
| 287 | 3300013307 | Ga0157372_10629394 | Ga0157372_106293941 | 321 |
| 288 | 3300013308 | Ga0157375_10176918 | Ga0157375_101769182 | 321 |
| 289 | 3300013308 | Ga0157375_10239914 | Ga0157375_102399142 | 321 |
| 290 | 3300013308 | Ga0157375_10440818 | Ga0157375_104408182 | 321 |
| 291 | 3300014326 | Ga0157380_10243156 | Ga0157380_102431561 | 321 |
| 292 | 3300014326 | Ga0157380_10419080 | Ga0157380_104190801 | 321 |
| 293 | 3300014497 | Ga0182008_10004052 | Ga0182008_1000405210 | 321 |
| 294 | 3300014968 | Ga0157379_10003200 | Ga0157379_1000320012 | 321 |
| 295 | 3300014969 | Ga0157376_10009682 | Ga0157376_100096825 | 321 |
| 296 | 3300014969 | Ga0157376_10019952 | Ga0157376_100199524 | 321 |
| 297 | 3300014969 | Ga0157376_10067977 | Ga0157376_100679772 | 321 |
| 298 | 3300014969 | Ga0157376_10470705 | Ga0157376_104707052 | 321 |
| 299 | 3300015262 | Ga0182007_10001956 | Ga0182007_100019569 | 321 |
| 300 | 3300015688 | Ga0183367_1001 | Ga0183367_1001906 | 321 |
| 301 | 3300017792 | Ga0163161_10001814 | Ga0163161_100018143 | 321 |
| 302 | 3300022467 | Ga0224712_10009523 | Ga0224712_100095232 | 321 |
| 303 | 3300022467 | Ga0224712_10013952 | Ga0224712_100139522 | 321 |
| 304 | 3300025297 | Ga0209758_1006936 | Ga0209758_10069367 | 321 |
| 305 | 3300025302 | Ga0207426_1006931 | Ga0207426_10069312 | 321 |
| 306 | 3300025302 | Ga0207426_1016694 | Ga0207426_10166942 | 321 |
| 307 | 3300025302 | Ga0207426_1023614 | Ga0207426_10236142 | 321 |
| 308 | 3300025898 | Ga0207692_10000003 | Ga0207692_10000003420 | 321 |
| 309 | 3300025898 | Ga0207692_10032641 | Ga0207692_100326412 | 321 |
| 310 | 3300025899 | Ga0207642_10022607 | Ga0207642_100226072 | 321 |
| 311 | 3300025900 | Ga0207710_10003720 | Ga0207710_100037202 | 321 |
| 312 | 3300025909 | Ga0207705_10035200 | Ga0207705_100352003 | 321 |
| 313 | 3300025910 | Ga0207684_10003467 | Ga0207684_100034675 | 321 |
| 314 | 3300025910 | Ga0207684_10026271 | Ga0207684_100262713 | 321 |
| 315 | 3300025910 | Ga0207684_10073766 | Ga0207684_100737662 | 321 |
| 316 | 3300025910 | Ga0207684_10136900 | Ga0207684_101369002 | 321 |
| 317 | 3300025910 | Ga0207684_10376186 | Ga0207684_103761861 | 321 |
| 318 | 3300025911 | Ga0207654_10000890 | Ga0207654_100008902 | 321 |
| 319 | 3300025911 | Ga0207654_10008960 | Ga0207654_100089604 | 321 |
| 320 | 3300025911 | Ga0207654_10202920 | Ga0207654_102029201 | 321 |
| 321 | 3300025912 | Ga0207707_10000891 | Ga0207707_1000089118 | 321 |
| 322 | 3300025912 | Ga0207707_10213260 | Ga0207707_102132601 | 321 |
| 323 | 3300025913 | Ga0207695_10001825 | Ga0207695_1000182517 | 321 |
| 324 | 3300025913 | Ga0207695_10133720 | Ga0207695_101337203 | 321 |
| 325 | 3300025913 | Ga0207695_10159707 | Ga0207695_101597072 | 321 |
| 326 | 3300025914 | Ga0207671_10001322 | Ga0207671_100013223 | 321 |
| 327 | 3300025914 | Ga0207671_10020313 | Ga0207671_100203135 | 321 |
| 328 | 3300025914 | Ga0207671_10244021 | Ga0207671_102440211 | 321 |
| 329 | 3300025916 | Ga0207663_10077450 | Ga0207663_100774501 | 321 |
| 330 | 3300025919 | Ga0207657_10186137 | Ga0207657_101861371 | 321 |
| 331 | 3300025920 | Ga0207649_10010711 | Ga0207649_100107112 | 321 |
| 332 | 3300025921 | Ga0207652_10001281 | Ga0207652_1000128116 | 321 |
| 333 | 3300025921 | Ga0207652_10284455 | Ga0207652_102844552 | 321 |
| 334 | 3300025921 | Ga0207652_10328715 | Ga0207652_103287151 | 321 |
| 335 | 3300025922 | Ga0207646_10001004 | Ga0207646_1000100432 | 321 |
| 336 | 3300025922 | Ga0207646_10005717 | Ga0207646_100057175 | 321 |
| 337 | 3300025922 | Ga0207646_10007233 | Ga0207646_100072331 | 321 |
| 338 | 3300025922 | Ga0207646_10071491 | Ga0207646_100714912 | 321 |
| 339 | 3300025922 | Ga0207646_10154381 | Ga0207646_101543811 | 321 |
| 340 | 3300025924 | Ga0207694_10000745 | Ga0207694_100007458 | 321 |
| 341 | 3300025924 | Ga0207694_10000936 | Ga0207694_1000093623 | 321 |
| 342 | 3300025925 | Ga0207650_10086270 | Ga0207650_100862702 | 321 |
| 343 | 3300025925 | Ga0207650_10087307 | Ga0207650_100873072 | 321 |
| 344 | 3300025925 | Ga0207650_10313326 | Ga0207650_103133261 | 321 |
| 345 | 3300025927 | Ga0207687_10030070 | Ga0207687_100300703 | 321 |
| 346 | 3300025927 | Ga0207687_10047069 | Ga0207687_100470692 | 321 |
| 347 | 3300025928 | Ga0207700_10022195 | Ga0207700_100221954 | 321 |
| 348 | 3300025928 | Ga0207700_10158681 | Ga0207700_101586812 | 321 |
| 349 | 3300025928 | Ga0207700_10165434 | Ga0207700_101654341 | 321 |
| 350 | 3300025929 | Ga0207664_10011778 | Ga0207664_100117786 | 321 |
| 351 | 3300025929 | Ga0207664_10014836 | Ga0207664_100148363 | 321 |
| 352 | 3300025929 | Ga0207664_10025013 | Ga0207664_100250134 | 321 |
| 353 | 3300025929 | Ga0207664_10261785 | Ga0207664_102617852 | 321 |
| 354 | 3300025934 | Ga0207686_10012449 | Ga0207686_100124492 | 321 |
| 355 | 3300025935 | Ga0207709_10031284 | Ga0207709_100312842 | 321 |
| 356 | 3300025936 | Ga0207670_10074270 | Ga0207670_100742702 | 321 |
| 357 | 3300025937 | Ga0207669_10011581 | Ga0207669_100115815 | 321 |
| 358 | 3300025939 | Ga0207665_10017771 | Ga0207665_100177712 | 321 |
| 359 | 3300025944 | Ga0207661_10002130 | Ga0207661_100021308 | 321 |
| 360 | 3300025945 | Ga0207679_10015776 | Ga0207679_100157763 | 321 |
| 361 | 3300025945 | Ga0207679_10048689 | Ga0207679_100486893 | 321 |
| 362 | 3300025945 | Ga0207679_10184517 | Ga0207679_101845172 | 321 |
| 363 | 3300025949 | Ga0207667_10000535 | Ga0207667_1000053523 | 321 |
| 364 | 3300025949 | Ga0207667_10001693 | Ga0207667_1000169315 | 321 |
| 365 | 3300025949 | Ga0207667_10147097 | Ga0207667_101470973 | 321 |
| 366 | 3300025961 | Ga0207712_10036119 | Ga0207712_100361192 | 321 |
| 367 | 3300025961 | Ga0207712_10246497 | Ga0207712_102464972 | 321 |
| 368 | 3300025981 | Ga0207640_10004910 | Ga0207640_100049105 | 321 |
| 369 | 3300026023 | Ga0207677_10022394 | Ga0207677_100223943 | 321 |
| 370 | 3300026035 | Ga0207703_10060165 | Ga0207703_100601652 | 321 |
| 371 | 3300026035 | Ga0207703_10268220 | Ga0207703_102682202 | 321 |
| 372 | 3300026041 | Ga0207639_10000531 | Ga0207639_100005312 | 321 |
| 373 | 3300026041 | Ga0207639_10153390 | Ga0207639_101533902 | 321 |
| 374 | 3300026078 | Ga0207702_10001271 | Ga0207702_100012718 | 321 |
| 375 | 3300026078 | Ga0207702_10008594 | Ga0207702_100085942 | 321 |
| 376 | 3300026078 | Ga0207702_10011794 | Ga0207702_100117948 | 321 |
| 377 | 3300026078 | Ga0207702_10083303 | Ga0207702_100833033 | 321 |
| 378 | 3300026088 | Ga0207641_10478165 | Ga0207641_104781652 | 321 |
| 379 | 3300026116 | Ga0207674_10000157 | Ga0207674_1000015771 | 321 |
| 380 | 3300026118 | Ga0207675_100397484 | Ga0207675_1003974841 | 321 |
| 381 | 3300026121 | Ga0207683_10000257 | Ga0207683_1000025719 | 321 |
| 382 | 3300026142 | Ga0207698_10000319 | Ga0207698_1000031914 | 321 |
| 383 | 3300026142 | Ga0207698_10097004 | Ga0207698_100970041 | 321 |
| 384 | 3300027666 | Ga0209282_1100217 | Ga0209282_11002172 | 321 |
| 385 | 3300027866 | Ga0209813_10013124 | Ga0209813_100131242 | 321 |
| 386 | 3300028381 | Ga0268264_10005209 | Ga0268264_100052098 | 321 |
| 387 | 3300028563 | Ga0265319_1031551 | Ga0265319_10315512 | 321 |
| 388 | 3300028786 | Ga0307517_10025660 | Ga0307517_100256608 | 321 |
| 389 | 3300028794 | Ga0307515_10000287 | Ga0307515_1000028751 | 321 |
| 390 | 3300028794 | Ga0307515_10028816 | Ga0307515_100288167 | 321 |
| 391 | 3300028794 | Ga0307515_10089178 | Ga0307515_100891784 | 321 |
| 392 | 3300028794 | Ga0307515_10223615 | Ga0307515_102236152 | 321 |
| 393 | 3300028800 | Ga0265338_10035020 | Ga0265338_100350204 | 321 |
| 394 | 3300030521 | Ga0307511_10001720 | Ga0307511_1000172012 | 321 |
| 395 | 3300030521 | Ga0307511_10026702 | Ga0307511_100267025 | 321 |
| 396 | 3300030521 | Ga0307511_10035848 | Ga0307511_100358486 | 321 |
| 397 | 3300030521 | Ga0307511_10049182 | Ga0307511_100491823 | 321 |
| 398 | 3300030522 | Ga0307512_10005793 | Ga0307512_100057939 | 321 |
| 399 | 3300030522 | Ga0307512_10024136 | Ga0307512_100241367 | 321 |
| 400 | 3300031240 | Ga0265320_10044366 | Ga0265320_100443662 | 321 |
| 401 | 3300031241 | Ga0265325_10017986 | Ga0265325_100179863 | 321 |
| 402 | 3300031247 | Ga0265340_10003313 | Ga0265340_100033133 | 321 |
| 403 | 3300031249 | Ga0265339_10016133 | Ga0265339_100161334 | 321 |
| 404 | 3300031456 | Ga0307513_10028756 | Ga0307513_100287562 | 321 |
| 405 | 3300031456 | Ga0307513_10346281 | Ga0307513_103462812 | 321 |
| 406 | 3300031548 | Ga0307408_100023575 | Ga0307408_1000235755 | 321 |
| 407 | 3300031616 | Ga0307508_10037588 | Ga0307508_100375882 | 321 |
| 408 | 3300031616 | Ga0307508_10235180 | Ga0307508_102351802 | 321 |
| 409 | 3300031649 | Ga0307514_10012027 | Ga0307514_100120272 | 321 |
| 410 | 3300031712 | Ga0265342_10019358 | Ga0265342_100193584 | 321 |
| 411 | 3300031727 | Ga0316576_10052009 | Ga0316576_100520093 | 321 |
| 412 | 3300031730 | Ga0307516_10032499 | Ga0307516_100324995 | 321 |
| 413 | 3300031730 | Ga0307516_10042401 | Ga0307516_100424015 | 321 |
| 414 | 3300031731 | Ga0307405_10003908 | Ga0307405_100039086 | 321 |
| 415 | 3300031733 | Ga0316577_10060846 | Ga0316577_100608461 | 321 |
| 416 | 3300031733 | Ga0316577_10061419 | Ga0316577_100614192 | 321 |
| 417 | 3300031824 | Ga0307413_10001470 | Ga0307413_100014709 | 321 |
| 418 | 3300031824 | Ga0307413_10013839 | Ga0307413_100138395 | 321 |
| 419 | 3300031838 | Ga0307518_10069369 | Ga0307518_100693692 | 321 |
| 420 | 3300031852 | Ga0307410_10000352 | Ga0307410_1000035210 | 321 |
| 421 | 3300031852 | Ga0307410_10002093 | Ga0307410_100020933 | 321 |
| 422 | 3300031852 | Ga0307410_10306656 | Ga0307410_103066561 | 321 |
| 423 | 3300031901 | Ga0307406_10072546 | Ga0307406_100725462 | 321 |
| 424 | 3300031901 | Ga0307406_10108324 | Ga0307406_101083242 | 321 |
| 425 | 3300031903 | Ga0307407_10049140 | Ga0307407_100491403 | 321 |
| 426 | 3300031903 | Ga0307407_10088068 | Ga0307407_100880682 | 321 |
| 427 | 3300031911 | Ga0307412_10007170 | Ga0307412_100071708 | 321 |
| 428 | 3300031911 | Ga0307412_10008106 | Ga0307412_100081062 | 321 |
| 429 | 3300031911 | Ga0307412_10017502 | Ga0307412_100175023 | 321 |
| 430 | 3300031995 | Ga0307409_100002421 | Ga0307409_1000024215 | 321 |
| 431 | 3300031995 | Ga0307409_100003377 | Ga0307409_10000337711 | 321 |
| 432 | 3300031995 | Ga0307409_100017832 | Ga0307409_1000178321 | 321 |
| 433 | 3300031995 | Ga0307409_100019649 | Ga0307409_1000196493 | 321 |
| 434 | 3300032002 | Ga0307416_100015076 | Ga0307416_1000150763 | 321 |
| 435 | 3300032002 | Ga0307416_100040667 | Ga0307416_1000406672 | 321 |
| 436 | 3300032002 | Ga0307416_100237284 | Ga0307416_1002372842 | 321 |
| 437 | 3300032004 | Ga0307414_10025594 | Ga0307414_100255944 | 321 |
| 438 | 3300032004 | Ga0307414_10161847 | Ga0307414_101618472 | 321 |
| 439 | 3300032005 | Ga0307411_10002733 | Ga0307411_100027337 | 321 |
| 440 | 3300032005 | Ga0307411_10014107 | Ga0307411_100141073 | 321 |
| 441 | 3300032005 | Ga0307411_10390621 | Ga0307411_103906211 | 321 |
| 442 | 3300032126 | Ga0307415_100006574 | Ga0307415_1000065743 | 321 |
| 443 | 3300032126 | Ga0307415_100007489 | Ga0307415_1000074893 | 321 |
| 444 | 3300032137 | Ga0316585_10028916 | Ga0316585_100289162 | 321 |
| 445 | 3300033179 | Ga0307507_10010287 | Ga0307507_1001028712 | 321 |
| 446 | 3300033179 | Ga0307507_10019151 | Ga0307507_100191519 | 321 |
| 447 | 3300033180 | Ga0307510_10000644 | Ga0307510_1000064427 | 321 |
| 448 | 3300035083 | Ga0373926_0001784 | Ga0373926_0001784_487_1518 | 321 |
| 449 | 3300035118 | Ga0373954_0039189 | Ga0373954_0039189_611_1645 | 321 |
| 450 | 3300035118 | Ga0373954_0042239 | Ga0373954_0042239_156_1193 | 321 |
| 451 | 3300035118 | Ga0373954_0042753 | Ga0373954_0042753_1057_2088 | 321 |
| 452 | 3300035119 | Ga0373956_0017063 | Ga0373956_0017063_1074_2117 | 321 |
| 453 | 3300035119 | Ga0373956_0029030 | Ga0373956_0029030_1236_2267 | 321 |
| 454 | 3300035120 | Ga0373957_0081256 | Ga0373957_0081256_159_1208 | 321 |
| 455 | 3300035172 | Ga0373955_0009399 | Ga0373955_0009399_760_1791 | 321 |
| 456 | 3300035410 | Ga0373924_0004127 | Ga0373924_0004127_3953_4996 | 321 |
| 457 | 3300035410 | Ga0373924_0038744 | Ga0373924_0038744_850_1881 | 321 |
| 458 | 3300035692 | Ga0373935_0000094 | Ga0373935_0000094_4478_5509 | 321 |
| 459 | 3300035724 | Ga0373933_0032693 | Ga0373933_0032693_201_1232 | 321 |
| 460 | 3300035725 | Ga0373947_0000011 | Ga0373947_0000011_152245_153276 | 321 |
| 461 | 3300035725 | Ga0373947_0183480 | Ga0373947_0183480_127_1170 | 321 |
| 462 | 3300036401 | Ga0373937_0020699 | Ga0373937_0020699_3461_4522 | 321 |
| 463 | 3300036401 | Ga0373937_0068561 | Ga0373937_0068561_852_1895 | 321 |
| 464 | 3300036401 | Ga0373937_0088064 | Ga0373937_0088064_1692_2723 | 321 |
| 465 | 3300036647 | Ga0316582_0092835 | Ga0316582_0092835_294_1325 | 321 |
| 466 | 3300036712 | Ga0316584_0006850 | Ga0316584_0006850_4491_5522 | 321 |
| 467 | 3300036712 | Ga0316584_0056615 | Ga0316584_0056615_1832_2872 | 321 |
| 468 | 3300037418 | Ga0395900_0424995 | Ga0395900_0424995_201_1229 | 321 |
| 469 | 3300037466 | Ga0395898_0022337 | Ga0395898_0022337_4088_5116 | 321 |
| 470 | 3300037471 | Ga0395905_0163487 | Ga0395905_0163487_737_1765 | 321 |
| 471 | 3300038443 | Ga0395901_0246940 | Ga0395901_0246940_600_1628 | 321 |
| 472 | 3300041404 | Ga0439436_0007626 | Ga0439436_0007626_301_1329 | 321 |
| 473 | 3300041406 | Ga0439439_0000566 | Ga0439439_0000566_4533_5561 | 321 |
| 474 | 3300041406 | Ga0439439_0006105 | Ga0439439_0006105_159_1193 | 321 |
| 475 | 3300041451 | Ga0451791_0161359 | Ga0451791_0161359_481_1509 | 321 |
| 476 | 3300041999 | Ga0439433_0001912 | Ga0439433_0001912_262_1290 | 321 |
| 477 | 3300042005 | Ga0439448_0010688 | Ga0439448_0010688_197_1225 | 321 |
| 478 | 3300042007 | Ga0439449_0000174 | Ga0439449_0000174_9791_10819 | 321 |
| 479 | 3300042007 | Ga0439449_0039242 | Ga0439449_0039242_38_1066 | 321 |
| 480 | 3300042012 | Ga0439455_0004473 | Ga0439455_0004473_370_1398 | 321 |
| 481 | 3300042014 | Ga0439457_001137 | Ga0439457_001137_3207_4241 | 321 |
| 482 | 3300042014 | Ga0439457_001725 | Ga0439457_001725_2473_3501 | 321 |
| 483 | 3300042131 | Ga0450894_002160 | Ga0450894_002160_1200_2228 | 321 |
| 484 | 3300042133 | Ga0450896_000923 | Ga0450896_000923_1334_2362 | 321 |
| 485 | 3300042135 | Ga0450899_000712 | Ga0450899_000712_2619_3647 | 321 |
| 486 | 3300042138 | Ga0450903_001042 | Ga0450903_001042_453_1481 | 321 |
| 487 | 3300042157 | Ga0439458_0001351 | Ga0439458_0001351_2842_3870 | 321 |
| 488 | 3300042876 | Ga0451577_0230952 | Ga0451577_0230952_49_1080 | 321 |
| 489 | 3300044656 | Ga0466969_0025351 | Ga0466969_0025351_1224_2291 | 321 |
| 490 | 3300044656 | Ga0466969_0043086 | Ga0466969_0043086_153_1181 | 321 |
| 491 | 3300044656 | Ga0466969_0060287 | Ga0466969_0060287_672_1739 | 321 |
| 492 | 3300044658 | Ga0466972_0008641 | Ga0466972_0008641_3766_4794 | 321 |
| 493 | 3300044658 | Ga0466972_0083628 | Ga0466972_0083628_77_1105 | 321 |
| 494 | 3300044658 | Ga0466972_0098991 | Ga0466972_0098991_119_1147 | 321 |
| 495 | 3300044683 | Ga0466965_0174065 | Ga0466965_0174065_45_1073 | 321 |
| 496 | 3300044684 | Ga0466966_0053212 | Ga0466966_0053212_1117_2184 | 321 |
| 497 | 3300044684 | Ga0466966_0120758 | Ga0466966_0120758_335_1402 | 321 |
| 498 | 3300044693 | Ga0466961_0027528 | Ga0466961_0027528_1955_3022 | 321 |
| 499 | 3300044694 | Ga0466963_0010310 | Ga0466963_0010310_469_1497 | 321 |
| 500 | 3300044694 | Ga0466963_0031124 | Ga0466963_0031124_2405_3433 | 321 |
| 501 | 3300044694 | Ga0466963_0112519 | Ga0466963_0112519_450_1478 | 321 |
| 502 | 3300044706 | Ga0466964_0013638 | Ga0466964_0013638_1580_2608 | 321 |
| 503 | 3300044765 | Ga0466970_0007115 | Ga0466970_0007115_2729_3757 | 321 |
| 504 | 3300044765 | Ga0466970_0009315 | Ga0466970_0009315_1926_2993 | 321 |
| 505 | 3300044765 | Ga0466970_0109727 | Ga0466970_0109727_342_1370 | 321 |
| 506 | 3300044842 | Ga0466957_0161065 | Ga0466957_0161065_244_1272 | 321 |
| 507 | 3300044901 | Ga0466960_0008493 | Ga0466960_0008493_707_1735 | 321 |
| 508 | 3300045049 | Ga0466959_0002626 | Ga0466959_0002626_8622_9689 | 321 |
| 509 | 3300045049 | Ga0466959_0012597 | Ga0466959_0012597_4747_5790 | 321 |
| 510 | 3300045836 | Ga0466958_0070297 | Ga0466958_0070297_366_1394 | 321 |
| 511 | 3300045976 | Ga0466967_0124248 | Ga0466967_0124248_871_1899 | 321 |
| 512 | 3300045976 | Ga0466967_0244556 | Ga0466967_0244556_149_1177 | 321 |
| 513 | 3300046452 | Ga0495617_007022 | Ga0495617_007022_1188_2216 | 321 |
| 514 | 3300046453 | Ga0495627_033301 | Ga0495627_033301_321_1349 | 321 |
| 515 | 3300046453 | Ga0495627_051779 | Ga0495627_051779_58_1107 | 321 |
| 516 | 3300046454 | Ga0495592_0022978 | Ga0495592_0022978_2831_3865 | 321 |
| 517 | 3300046454 | Ga0495592_0026097 | Ga0495592_0026097_2713_3741 | 321 |
| 518 | 3300046454 | Ga0495592_0041037 | Ga0495592_0041037_1444_2472 | 321 |
| 519 | 3300046455 | Ga0495603_0014958 | Ga0495603_0014958_2827_3855 | 321 |
| 520 | 3300046455 | Ga0495603_0110149 | Ga0495603_0110149_521_1549 | 321 |
| 521 | 3300046459 | Ga0495629_0001877 | Ga0495629_0001877_570_1598 | 321 |
| 522 | 3300046459 | Ga0495629_0002031 | Ga0495629_0002031_333_1361 | 321 |
| 523 | 3300046459 | Ga0495629_0003393 | Ga0495629_0003393_5220_6248 | 321 |
| 524 | 3300046459 | Ga0495629_0028925 | Ga0495629_0028925_554_1582 | 321 |
| 525 | 3300046459 | Ga0495629_0068281 | Ga0495629_0068281_765_1799 | 321 |
| 526 | 3300046459 | Ga0495629_0120839 | Ga0495629_0120839_144_1193 | 321 |
| 527 | 3300046459 | Ga0495629_0210073 | Ga0495629_0210073_277_1305 | 321 |
| 528 | 3300046460 | Ga0495638_0094084 | Ga0495638_0094084_312_1340 | 321 |
| 529 | 3300046462 | Ga0495651_0002330 | Ga0495651_0002330_9809_10840 | 321 |
| 530 | 3300046462 | Ga0495651_0003385 | Ga0495651_0003385_3170_4204 | 321 |
| 531 | 3300046462 | Ga0495651_0012853 | Ga0495651_0012853_3459_4487 | 321 |
| 532 | 3300046462 | Ga0495651_0201905 | Ga0495651_0201905_300_1361 | 321 |
| 533 | 3300046463 | Ga0495653_0040822 | Ga0495653_0040822_957_1988 | 321 |
| 534 | 3300046473 | Ga0495582_0129856 | Ga0495582_0129856_356_1399 | 321 |
| 535 | 3300046474 | Ga0495605_0017442 | Ga0495605_0017442_317_1345 | 321 |
| 536 | 3300046475 | Ga0495639_0023359 | Ga0495639_0023359_396_1424 | 321 |
| 537 | 3300046476 | Ga0495662_0000436 | Ga0495662_0000436_3001_4035 | 321 |
| 538 | 3300046476 | Ga0495662_0007753 | Ga0495662_0007753_3352_4380 | 321 |
| 539 | 3300046476 | Ga0495662_0103287 | Ga0495662_0103287_18_1046 | 321 |
| 540 | 3300046476 | Ga0495662_0124039 | Ga0495662_0124039_201_1244 | 321 |
| 541 | 3300046477 | Ga0495664_0003142 | Ga0495664_0003142_3699_4742 | 321 |
| 542 | 3300046477 | Ga0495664_0007847 | Ga0495664_0007847_1687_2721 | 321 |
| 543 | 3300046477 | Ga0495664_0047667 | Ga0495664_0047667_643_1671 | 321 |
| 544 | 3300046499 | Ga0495594_0000282 | Ga0495594_0000282_20563_21591 | 321 |
| 545 | 3300046499 | Ga0495594_0046474 | Ga0495594_0046474_1214_2242 | 321 |
| 546 | 3300046499 | Ga0495594_0050080 | Ga0495594_0050080_1108_2136 | 321 |
| 547 | 3300046499 | Ga0495594_0055983 | Ga0495594_0055983_652_1680 | 321 |
| 548 | 3300046499 | Ga0495594_0079025 | Ga0495594_0079025_647_1681 | 321 |
| 549 | 3300046507 | Ga0495606_0004135 | Ga0495606_0004135_11668_12696 | 321 |
| 550 | 3300046511 | Ga0495608_0145243 | Ga0495608_0145243_471_1499 | 321 |
| 551 | 3300046513 | Ga0495616_0014269 | Ga0495616_0014269_1332_2360 | 321 |
| 552 | 3300046514 | Ga0495618_0090725 | Ga0495618_0090725_327_1355 | 321 |
| 553 | 3300046516 | Ga0495628_0044011 | Ga0495628_0044011_290_1318 | 321 |
| 554 | 3300046516 | Ga0495628_0062553 | Ga0495628_0062553_561_1595 | 321 |
| 555 | 3300046516 | Ga0495628_0078572 | Ga0495628_0078572_1451_2479 | 321 |
| 556 | 3300046516 | Ga0495628_0331253 | Ga0495628_0331253_67_1098 | 321 |
| 557 | 3300046517 | Ga0495630_0030227 | Ga0495630_0030227_113_1147 | 321 |
| 558 | 3300046517 | Ga0495630_0111220 | Ga0495630_0111220_459_1496 | 321 |
| 559 | 3300046518 | Ga0495631_0018611 | Ga0495631_0018611_2221_3249 | 321 |
| 560 | 3300046522 | Ga0495643_0074567 | Ga0495643_0074567_217_1245 | 321 |
| 561 | 3300046524 | Ga0495648_0037243 | Ga0495648_0037243_1420_2448 | 321 |
| 562 | 3300046526 | Ga0495666_0019026 | Ga0495666_0019026_424_1452 | 321 |
| 563 | 3300046529 | Ga0495652_0043080 | Ga0495652_0043080_1532_2563 | 321 |
| 564 | 3300046529 | Ga0495652_0085304 | Ga0495652_0085304_225_1253 | 321 |
| 565 | 3300046529 | Ga0495652_0133309 | Ga0495652_0133309_294_1322 | 321 |
| 566 | 3300046529 | Ga0495652_0141861 | Ga0495652_0141861_567_1610 | 321 |
| 567 | 3300046531 | Ga0495665_0049993 | Ga0495665_0049993_1066_2109 | 321 |
| 568 | 3300046531 | Ga0495665_0090567 | Ga0495665_0090567_355_1383 | 321 |
| 569 | 3300046533 | Ga0495640_0003158 | Ga0495640_0003158_10291_11319 | 321 |
| 570 | 3300046533 | Ga0495640_0005478 | Ga0495640_0005478_992_2020 | 321 |
| 571 | 3300046533 | Ga0495640_0062298 | Ga0495640_0062298_1242_2276 | 321 |
| 572 | 3300046535 | Ga0495586_0029203 | Ga0495586_0029203_1758_2801 | 321 |
| 573 | 3300046536 | Ga0495587_0007220 | Ga0495587_0007220_680_1714 | 321 |
| 574 | 3300046536 | Ga0495587_0063726 | Ga0495587_0063726_312_1343 | 321 |
| 575 | 3300046536 | Ga0495587_0073214 | Ga0495587_0073214_381_1424 | 321 |
| 576 | 3300046538 | Ga0495609_0025039 | Ga0495609_0025039_219_1247 | 321 |
| 577 | 3300046542 | Ga0495597_0023558 | Ga0495597_0023558_388_1416 | 321 |
| 578 | 3300046543 | Ga0495645_0033582 | Ga0495645_0033582_523_1551 | 321 |
| 579 | 3300046557 | Ga0495622_0052319 | Ga0495622_0052319_30_1058 | 321 |
| 580 | 3300046558 | Ga0495633_0010944 | Ga0495633_0010944_2143_3171 | 321 |
| 581 | 3300046559 | Ga0495667_0006232 | Ga0495667_0006232_5883_6914 | 321 |
| 582 | 3300046559 | Ga0495667_0042645 | Ga0495667_0042645_1372_2400 | 321 |
| 583 | 3300046616 | Ga0495668_0019922 | Ga0495668_0019922_1732_2763 | 321 |
| 584 | 3300046642 | Ga0495634_0005624 | Ga0495634_0005624_3679_4713 | 321 |
| 585 | 3300046642 | Ga0495634_0016321 | Ga0495634_0016321_830_1858 | 321 |
| 586 | 3300046642 | Ga0495634_0042581 | Ga0495634_0042581_852_1895 | 321 |
| 587 | 3300046642 | Ga0495634_0107489 | Ga0495634_0107489_295_1338 | 321 |
| 588 | 3300046660 | Ga0495625_0031265 | Ga0495625_0031265_760_1791 | 321 |
| 589 | 3300046660 | Ga0495625_0042721 | Ga0495625_0042721_2033_3061 | 321 |
| 590 | 3300046660 | Ga0495625_0061899 | Ga0495625_0061899_1300_2328 | 321 |
| 591 | 3300046663 | Ga0495635_0019232 | Ga0495635_0019232_2257_3291 | 321 |
| 592 | 3300046665 | Ga0495661_0029268 | Ga0495661_0029268_2428_3456 | 321 |
| 593 | 3300046674 | Ga0495588_0000819 | Ga0495588_0000819_1173_2201 | 321 |
| 594 | 3300046674 | Ga0495588_0133260 | Ga0495588_0133260_42_1076 | 321 |
| 595 | 3300046675 | Ga0495657_0007036 | Ga0495657_0007036_5933_6964 | 321 |
| 596 | 3300046675 | Ga0495657_0010436 | Ga0495657_0010436_2038_3066 | 321 |
| 597 | 3300046675 | Ga0495657_0018875 | Ga0495657_0018875_2363_3397 | 321 |
| 598 | 3300046675 | Ga0495657_0034607 | Ga0495657_0034607_1232_2260 | 321 |
| 599 | 3300046678 | Ga0495599_0023244 | Ga0495599_0023244_1958_3001 | 321 |
| 600 | 3300046678 | Ga0495599_0047234 | Ga0495599_0047234_223_1254 | 321 |
| 601 | 3300046678 | Ga0495599_0125134 | Ga0495599_0125134_249_1277 | 321 |
| 602 | 3300046679 | Ga0495623_0008819 | Ga0495623_0008819_1637_2668 | 321 |
| 603 | 3300046679 | Ga0495623_0068381 | Ga0495623_0068381_303_1331 | 321 |
| 604 | 3300046679 | Ga0495623_0073147 | Ga0495623_0073147_846_1874 | 321 |
| 605 | 3300046680 | Ga0495646_0008053 | Ga0495646_0008053_2553_3587 | 321 |
| 606 | 3300046683 | Ga0495658_0017872 | Ga0495658_0017872_1134_2168 | 321 |
| 607 | 3300046683 | Ga0495658_0040377 | Ga0495658_0040377_738_1781 | 321 |
| 608 | 3300046689 | Ga0495613_0000904 | Ga0495613_0000904_20483_21517 | 321 |
| 609 | 3300046689 | Ga0495613_0004025 | Ga0495613_0004025_8092_9120 | 321 |
| 610 | 3300046689 | Ga0495613_0019745 | Ga0495613_0019745_1355_2383 | 321 |
| 611 | 3300046689 | Ga0495613_0021426 | Ga0495613_0021426_594_1622 | 321 |
| 612 | 3300046689 | Ga0495613_0038415 | Ga0495613_0038415_594_1622 | 321 |
| 613 | 3300046689 | Ga0495613_0053846 | Ga0495613_0053846_951_1979 | 321 |
| 614 | 3300046690 | Ga0495624_0023985 | Ga0495624_0023985_618_1646 | 321 |
| 615 | 3300046690 | Ga0495624_0161755 | Ga0495624_0161755_135_1178 | 321 |
| 616 | 3300046694 | Ga0495649_0044038 | Ga0495649_0044038_765_1793 | 321 |
| 617 | 3300046794 | Ga0495589_0054727 | Ga0495589_0054727_519_1547 | 321 |
| 618 | 3300046809 | Ga0495600_0064435 | Ga0495600_0064435_680_1714 | 321 |
| 619 | 3300046809 | Ga0495600_0125929 | Ga0495600_0125929_598_1626 | 321 |
| 620 | 3300046810 | Ga0495660_0065994 | Ga0495660_0065994_872_1900 | 321 |
| 621 | 3300047315 | Ga0495581_0022890 | Ga0495581_0022890_760_1794 | 321 |
| 622 | 3300047315 | Ga0495581_0060517 | Ga0495581_0060517_979_2022 | 321 |
| 623 | 3300047317 | Ga0495604_0004139 | Ga0495604_0004139_2839_3873 | 321 |
| 624 | 3300047317 | Ga0495604_0009936 | Ga0495604_0009936_5183_6211 | 321 |
| 625 | 3300047317 | Ga0495604_0044770 | Ga0495604_0044770_1180_2208 | 321 |
| 626 | 3300047317 | Ga0495604_0072502 | Ga0495604_0072502_1243_2274 | 321 |
| 627 | 3300047318 | Ga0495636_0007135 | Ga0495636_0007135_406_1434 | 321 |
| 628 | 3300047318 | Ga0495636_0022063 | Ga0495636_0022063_495_1523 | 321 |
| 629 | 3300047318 | Ga0495636_0070236 | Ga0495636_0070236_74_1102 | 321 |
| 630 | 3300047319 | Ga0495674_0034642 | Ga0495674_0034642_2377_3420 | 321 |
| 631 | 3300047319 | Ga0495674_0154623 | Ga0495674_0154623_573_1607 | 321 |
| 632 | 3300047321 | Ga0495676_0011428 | Ga0495676_0011428_1786_2814 | 321 |
| 633 | 3300047321 | Ga0495676_0015587 | Ga0495676_0015587_3501_4529 | 321 |
| 634 | 3300047321 | Ga0495676_0052822 | Ga0495676_0052822_823_1851 | 321 |
| 635 | 3300047321 | Ga0495676_0103609 | Ga0495676_0103609_676_1710 | 321 |
| 636 | 3300047322 | Ga0495680_0006882 | Ga0495680_0006882_5514_6545 | 321 |
| 637 | 3300047322 | Ga0495680_0028785 | Ga0495680_0028785_1446_2489 | 321 |
| 638 | 3300047322 | Ga0495680_0267396 | Ga0495680_0267396_106_1134 | 321 |
| 639 | 3300047323 | Ga0495683_0068160 | Ga0495683_0068160_524_1552 | 321 |
| 640 | 3300047443 | Ga0495687_001601 | Ga0495687_001601_16125_17153 | 321 |
| 641 | 3300047444 | Ga0495675_0015948 | Ga0495675_0015948_1105_2133 | 321 |
| 642 | 3300047444 | Ga0495675_0031290 | Ga0495675_0031290_2285_3316 | 321 |
| 643 | 3300047444 | Ga0495675_0049850 | Ga0495675_0049850_901_1944 | 321 |
| 644 | 3300047444 | Ga0495675_0050288 | Ga0495675_0050288_1176_2204 | 321 |
| 645 | 3300047444 | Ga0495675_0058530 | Ga0495675_0058530_1146_2174 | 321 |
| 646 | 3300047444 | Ga0495675_0108669 | Ga0495675_0108669_11_1039 | 321 |
| 647 | 3300047445 | Ga0495677_0053781 | Ga0495677_0053781_395_1423 | 321 |
| 648 | 3300047447 | Ga0495685_022249 | Ga0495685_022249_74_1102 | 321 |
| 649 | 3300047470 | Ga0495681_0003265 | Ga0495681_0003265_8345_9373 | 321 |
| 650 | 3300047470 | Ga0495681_0050128 | Ga0495681_0050128_125_1153 | 321 |
| 651 | 3300047471 | Ga0495684_0053550 | Ga0495684_0053550_1637_2668 | 321 |
| 652 | 3300047472 | Ga0495686_0128814 | Ga0495686_0128814_391_1419 | 321 |
| 653 | 3300047673 | Ga0495593_0000283 | Ga0495593_0000283_1427_2461 | 321 |
| 654 | 3300047673 | Ga0495593_0028303 | Ga0495593_0028303_903_1931 | 321 |
| 655 | 3300048088 | Ga0495602_0017320 | Ga0495602_0017320_173_1204 | 321 |
| 656 | 3300048088 | Ga0495602_0018554 | Ga0495602_0018554_2075_3106 | 321 |
| 657 | 3300048088 | Ga0495602_0042791 | Ga0495602_0042791_1017_2051 | 321 |
| 658 | 3300048089 | Ga0495614_0000345 | Ga0495614_0000345_4599_5627 | 321 |
| 659 | 3300048089 | Ga0495614_0025655 | Ga0495614_0025655_606_1634 | 321 |
| 660 | 3300048089 | Ga0495614_0027182 | Ga0495614_0027182_552_1586 | 321 |
| 661 | 3300048903 | Ga0496100_0011567 | Ga0496100_0011567_2182_3210 | 321 |
| 662 | 3300048904 | Ga0496101_0006825 | Ga0496101_0006825_991_2019 | 321 |
| 663 | 3300048906 | Ga0496103_0023960 | Ga0496103_0023960_1724_2752 | 321 |
| 664 | 3300048907 | Ga0496104_0004325 | Ga0496104_0004325_10397_11425 | 321 |
| 665 | 3300048907 | Ga0496104_0065750 | Ga0496104_0065750_1426_2463 | 321 |
| 666 | 3300048907 | Ga0496104_0183277 | Ga0496104_0183277_533_1564 | 321 |
| 667 | 3300048907 | Ga0496104_0273541 | Ga0496104_0273541_232_1260 | 321 |
| 668 | 3300048908 | Ga0496105_0027258 | Ga0496105_0027258_1787_2815 | 321 |
| 669 | 3300048908 | Ga0496105_0141814 | Ga0496105_0141814_599_1630 | 321 |
| 670 | 3300048908 | Ga0496105_0306760 | Ga0496105_0306760_173_1201 | 321 |
| 671 | 3300048909 | Ga0496106_0003631 | Ga0496106_0003631_1785_2813 | 321 |
| 672 | 3300048911 | Ga0496108_0026608 | Ga0496108_0026608_1170_2201 | 321 |
| 673 | 3300048911 | Ga0496108_0065414 | Ga0496108_0065414_145_1173 | 321 |
| 674 | 3300048912 | Ga0496109_0008973 | Ga0496109_0008973_5485_6516 | 321 |
| 675 | 3300048912 | Ga0496109_0060423 | Ga0496109_0060423_694_1722 | 321 |
| 676 | 3300048912 | Ga0496109_0138073 | Ga0496109_0138073_1192_2226 | 321 |
| 677 | 3300048913 | Ga0496110_0009486 | Ga0496110_0009486_3021_4052 | 321 |
| 678 | 3300048914 | Ga0496111_0072878 | Ga0496111_0072878_145_1182 | 321 |
| 679 | 3300048915 | Ga0496112_0010903 | Ga0496112_0010903_377_1405 | 321 |
| 680 | 3300048915 | Ga0496112_0020724 | Ga0496112_0020724_38_1069 | 321 |
| 681 | 3300048915 | Ga0496112_0320519 | Ga0496112_0320519_153_1181 | 321 |
| 682 | 3300048916 | Ga0496113_0100131 | Ga0496113_0100131_472_1503 | 321 |
| 683 | 3300048917 | Ga0496114_0037320 | Ga0496114_0037320_1165_2193 | 321 |
| 684 | 3300048917 | Ga0496114_0094503 | Ga0496114_0094503_430_1464 | 321 |
| 685 | 3300048918 | Ga0496115_0065815 | Ga0496115_0065815_329_1357 | 321 |
| 686 | 3300049539 | Ga0501323_000501 | Ga0501323_000501_70_1098 | 321 |
| 687 | 3300049568 | Ga0501031_0019173 | Ga0501031_0019173_2269_3297 | 321 |
| 688 | 3300049568 | Ga0501031_0023838 | Ga0501031_0023838_629_1657 | 321 |
| 689 | 3300049569 | Ga0501032_0021013 | Ga0501032_0021013_2304_3332 | 321 |
| 690 | 3300049570 | Ga0501033_0007870 | Ga0501033_0007870_424_1452 | 321 |
| 691 | 3300049570 | Ga0501033_0022792 | Ga0501033_0022792_1444_2472 | 321 |
| 692 | 3300049571 | Ga0501034_0002162 | Ga0501034_0002162_22171_23199 | 321 |
| 693 | 3300049572 | Ga0501036_0001507 | Ga0501036_0001507_9071_10099 | 321 |
| 694 | 3300049572 | Ga0501036_0016135 | Ga0501036_0016135_4921_5949 | 321 |
| 695 | 3300049572 | Ga0501036_0022337 | Ga0501036_0022337_1431_2459 | 321 |
| 696 | 3300049573 | Ga0501037_0034136 | Ga0501037_0034136_2614_3642 | 321 |
| 697 | 3300049573 | Ga0501037_0069660 | Ga0501037_0069660_747_1775 | 321 |
| 698 | 3300049574 | Ga0501038_0053726 | Ga0501038_0053726_2045_3073 | 321 |
| 699 | 3300049574 | Ga0501038_0060378 | Ga0501038_0060378_1279_2307 | 321 |
| 700 | 3300049575 | Ga0501039_0003767 | Ga0501039_0003767_9922_10950 | 321 |
| 701 | 3300049578 | Ga0501042_0161417 | Ga0501042_0161417_238_1266 | 321 |
| 702 | 3300049579 | Ga0501043_0002374 | Ga0501043_0002374_12492_13520 | 321 |
| 703 | 3300049579 | Ga0501043_0005810 | Ga0501043_0005810_6003_7031 | 321 |
| 704 | 3300049579 | Ga0501043_0198419 | Ga0501043_0198419_120_1148 | 321 |
| 705 | 3300049581 | Ga0501047_0000068 | Ga0501047_0000068_26582_27610 | 321 |
| 706 | 3300049581 | Ga0501047_0010336 | Ga0501047_0010336_2452_3480 | 321 |
| 707 | 3300049582 | Ga0501048_0009177 | Ga0501048_0009177_1401_2429 | 321 |
| 708 | 3300049584 | Ga0501068_0171705 | Ga0501068_0171705_308_1336 | 321 |
| 709 | 3300049585 | Ga0501069_0067206 | Ga0501069_0067206_159_1190 | 321 |
| 710 | 3300049586 | Ga0501070_0004372 | Ga0501070_0004372_8461_9489 | 321 |
| 711 | 3300049674 | Ga0501242_001153 | Ga0501242_001153_1043_2074 | 321 |
| 712 | 3300049677 | Ga0501247_000034 | Ga0501247_000034_2382_3413 | 321 |
| 713 | 3300049686 | Ga0501257_002518 | Ga0501257_002518_2213_3244 | 321 |
| 714 | 3300049687 | Ga0501258_000911 | Ga0501258_000911_606_1637 | 321 |
| 715 | 3300049705 | Ga0501225_0008530 | Ga0501225_0008530_1085_2116 | 321 |
| 716 | 3300049764 | Ga0501267_000307 | Ga0501267_000307_1605_2636 | 321 |
| 717 | 3300049765 | Ga0501268_000956 | Ga0501268_000956_1687_2718 | 321 |
| 718 | 3300049767 | Ga0501270_000164 | Ga0501270_000164_3271_4302 | 321 |
| 719 | 3300049770 | Ga0501273_000321 | Ga0501273_000321_2234_3265 | 321 |
| 720 | 3300049822 | Ga0501035_0016266 | Ga0501035_0016266_2655_3683 | 321 |
| 721 | 3300049823 | Ga0501044_0001473 | Ga0501044_0001473_16068_17096 | 321 |
| 722 | 3300049823 | Ga0501044_0036328 | Ga0501044_0036328_2325_3353 | 321 |
| 723 | 3300049823 | Ga0501044_0073204 | Ga0501044_0073204_2009_3037 | 321 |
| 724 | 3300049823 | Ga0501044_0379298 | Ga0501044_0379298_176_1204 | 321 |
| 725 | 3300050490 | nmdc:mga03n38_39319_c1 | nmdc:mga03n38_39319_c1_130_1272 | 321 |
| 726 | 3300050494 | nmdc:mga06z11_1011_c1 | nmdc:mga06z11_1011_c1_7970_8998 | 321 |
| 727 | 3300050495 | nmdc:mga04h51_1208_c1 | nmdc:mga04h51_1208_c1_2630_3658 | 321 |
| 728 | 3300050510 | nmdc:mga06r32_120317_c1 | nmdc:mga06r32_120317_c1_623_1678 | 321 |
| 729 | 3300050511 | nmdc:mga08y16_43378_c1 | nmdc:mga08y16_43378_c1_2772_3803 | 321 |
| 730 | 3300050512 | nmdc:mga0n895_23600_c1 | nmdc:mga0n895_23600_c1_1346_2389 | 321 |
| 731 | 3300050513 | nmdc:mga0rr50_12614_c1 | nmdc:mga0rr50_12614_c1_3474_4517 | 321 |
| 732 | 3300050514 | nmdc:mga08x19_156167_c1 | nmdc:mga08x19_156167_c1_128_1156 | 321 |
| 733 | 3300050514 | nmdc:mga08x19_20996_c1 | nmdc:mga08x19_20996_c1_2377_3408 | 321 |
| 734 | 3300050514 | nmdc:mga08x19_2566_c1 | nmdc:mga08x19_2566_c1_4418_5446 | 321 |
| 735 | 3300050515 | nmdc:mga0a205_20389_c1 | nmdc:mga0a205_20389_c1_2189_3232 | 321 |
| 736 | 3300053077 | Ga0495601_0049833 | Ga0495601_0049833_278_1321 | 321 |
| 737 | 3300053077 | Ga0495601_0117163 | Ga0495601_0117163_290_1333 | 321 |
| 738 | 3300053078 | Ga0495612_0007880 | Ga0495612_0007880_1821_2864 | 321 |
| 739 | 3300053078 | Ga0495612_0017663 | Ga0495612_0017663_1367_2410 | 321 |
| 740 | 3300053085 | Ga0495619_0121996 | Ga0495619_0121996_319_1353 | 321 |
| 741 | 3300053101 | Ga0500553_032257 | Ga0500553_032257_1295_2329 | 321 |
| 742 | 3300053107 | Ga0500560_035406 | Ga0500560_035406_331_1359 | 321 |
| 743 | 3300053140 | Ga0500573_0128214 | Ga0500573_0128214_223_1257 | 321 |
| 744 | 3300053149 | Ga0500600_0074394 | Ga0500600_0074394_185_1213 | 321 |
| 745 | 3300053149 | Ga0500600_0097981 | Ga0500600_0097981_294_1325 | 321 |
| 746 | 3300053161 | Ga0500634_0100345 | Ga0500634_0100345_50_1078 | 321 |
| 747 | iso_pu_bacteria | 2558860280 | 2559427499 | 321 |
| 748 | iso_pu_bacteria | 2643221548 | 2643761820 | 321 |
| 749 | iso_pu_bacteria | 2643221682 | 2644460753 | 321 |
| 750 | iso_pu_bacteria | 2966598605 | 2966600126 | 321 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5kia-assembly1.cif.gz_A-2 | crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis | 0.9452 | 2 | 319 |
| 2dfv-assembly3.cif.gz_C | hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii | 0.9421 | 2 | 318 |
| 2dq4-assembly1.cif.gz_A | crystal structure of threonine 3-dehydrogenase | 0.939 | 1 | 321 |
| 3gfb-assembly1.cif.gz_C | l-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis | 0.9371 | 2 | 318 |
| 2dq4-assembly1.cif.gz_A | crystal structure of threonine 3-dehydrogenase | 0.9362 | 1 | 321 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P07913_2_151_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9717 | 2 | 150 | 3.90.180.10 |
| 5kiaA01 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9693 | 2 | 319 | 3.90.180.10 |
| af_P07913_2_151_3.90.180.10 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.959 | 2 | 150 | 3.90.180.10 |
| 5kiaA01 | Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain | 0.9509 | 2 | 319 | 3.90.180.10 |
| af_A0A0R4IGI3_166_529_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9458 | 162 | 198 | 3.50.50.60 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A527J3A8-F1-model_v4 | L-threonine 3-dehydrogenase (EC 1.1.1.103) | 0.9806 | 14 | 123 |
GO:0008270
GO:0008743 |
| AF-A0A527J3A8-F1-model_v4 | L-threonine 3-dehydrogenase (EC 1.1.1.103) | 0.9719 | 14 | 123 |
GO:0008270
GO:0008743 |
| AF-A0A3D1R0P5-F1-model_v4 | L-threonine 3-dehydrogenase (EC 1.1.1.103) | 0.971 | 1 | 169 |
GO:0008270
GO:0008743 |
| AF-A0A3N6GBZ0-F1-model_v4 | L-threonine 3-dehydrogenase (TDH) (EC 1.1.1.103) | 0.9673 | 2 | 321 |
GO:0005737
GO:0008270 GO:0008743 GO:0019518 |
| AF-A0A527CUV2-F1-model_v4 | L-threonine 3-dehydrogenase (EC 1.1.1.103) | 0.9673 | 25 | 117 |
GO:0008270
GO:0008743 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar