F479074

General Info

Members Datasets Scaffolds Average Seq Length
750 432 663 342

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2643221548|2643761820
Length 394
Sequence LHDGGEHRRAVRGADPSAPSRPPNPIDPGPQAAFGMPRPGAFTRYQVQGAAAVKALVKQKAEPGLWLMDVPEPEIGPADVLIKVLRTGICGTDLHIRDYDGWAQQAVRTPLVLGHEFVGEVADLGSDVVDIKVGDLVSGEGHLVCGKCRNCLAGRRHLCRSTLGLGVGRDGAFAEYLSLPASNVWVHRDKVDLDVAAIFDPFGNAVHTALSFPLVGEDVLITGAGPIGIMAAAVARHAGARSVVITDVSEARLELARKVGVSLALDVGKETIADGQRHLGLREGFDIGLEMSGRPEAMQDMIANMTHGGRIAMLGLPAGQFPVDWSRVVTSMLTIKGIYGREMYETWYAMSVLLEGGLDLAPVITGRYGYRDFEAAFDDAASGLGGKVLLDWSA

Samples

Sample ID Description Type Environment
1 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
2 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
3 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
4 2558860280 Kutzneria sp. 744 Isolate Unclassified
5 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
6 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
7 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
8 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
9 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
10 2643221548 Streptomyces sp. Root55 Isolate Unclassified
11 2643221578 Streptomyces sp. Root63 Isolate Unclassified
12 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
13 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
14 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
15 2643221647 Streptomyces sp. Root369 Isolate Unclassified
16 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
17 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
18 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
19 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
20 2643221714 Streptomyces sp. Root264 Isolate Unclassified
21 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
22 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
23 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
24 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
25 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
26 2795385470 Labedaea rhizosphaerae DSM 45361 Isolate Rhizosphere
27 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
28 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
29 2808606448 Streptomyces sp. 193411 Isolate Unclassified
30 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
31 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
32 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
33 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
34 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
35 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
36 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
37 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
38 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
39 2862290372 Streptomyces triticagri NEAU-YY421 Isolate Rhizosphere
40 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
41 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
42 2862574272 Streptomyces sp. AcE210 Isolate Nodule
43 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
44 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
45 2867428634 Streptomyces sp. RP5T Isolate Unclassified
46 2867475112 Streptomyces sp. TM32 Isolate Unclassified
47 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
48 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
49 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
50 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
51 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
52 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
53 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
54 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
55 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
56 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
57 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
58 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
59 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
60 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
61 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
62 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
63 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
64 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
65 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
66 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
67 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
68 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
69 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
70 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
71 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
72 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
73 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
74 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
75 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
76 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
77 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
78 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
79 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
80 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
81 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
82 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
83 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
84 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
85 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
86 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
87 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
88 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
89 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
90 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
91 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
92 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
93 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
94 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
95 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
96 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
97 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
98 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
99 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
100 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
101 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
102 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
103 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
104 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
105 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
106 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
107 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
108 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
109 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
110 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
115 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
116 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
117 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
118 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
119 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
120 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
121 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
122 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
123 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
124 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
125 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
126 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
127 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
128 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
129 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
130 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
131 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
132 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
133 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
134 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
135 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
136 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
137 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
138 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
139 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
140 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
141 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
142 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
143 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
144 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
145 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
146 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
147 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
148 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
149 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
150 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
151 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
152 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
153 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
154 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
155 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
156 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
157 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
158 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
159 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
160 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
161 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
162 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
163 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
164 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
165 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
166 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
167 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
168 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
208 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
209 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
211 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
212 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
213 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
214 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
215 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
216 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
217 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
218 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
219 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
225 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
228 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
229 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
230 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
231 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
232 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
233 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
236 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
237 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
242 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
243 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
244 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
245 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
246 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
247 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
248 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
251 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
252 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
253 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
254 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
255 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
256 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
262 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
263 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
264 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
265 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
266 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
267 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
268 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
269 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
270 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
271 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
272 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
273 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
274 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
275 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
276 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
277 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
278 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
279 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
280 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
281 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
282 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
283 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
284 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
285 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
286 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
287 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
288 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
289 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
290 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
291 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
292 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
293 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
294 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
295 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
296 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
297 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
298 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
299 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
300 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
301 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
302 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
303 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
304 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
305 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
306 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
307 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
308 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
309 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
310 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
311 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
312 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
313 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
314 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
315 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
316 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
317 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
318 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
319 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
320 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
321 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
322 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
323 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
324 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
325 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
326 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
327 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
328 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
329 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
330 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
331 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
332 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
333 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
334 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
335 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
336 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
337 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
338 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
339 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
340 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
341 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
342 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
343 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
344 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
345 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
346 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
347 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
348 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
349 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
350 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
351 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
352 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
353 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
354 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
355 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
356 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
357 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
358 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
359 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
360 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
361 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
362 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
363 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
364 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
365 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
366 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
367 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
368 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
369 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
370 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
371 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
372 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
373 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
374 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
375 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
376 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
377 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
378 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
379 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
380 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
382 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
384 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
385 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
389 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
390 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
392 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
393 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
394 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
395 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
396 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
397 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
398 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
399 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
400 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
401 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
402 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
403 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
404 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
405 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
407 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
408 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
409 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
410 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
411 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
412 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
413 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
414 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
415 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
416 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
417 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
418 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
419 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
420 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
421 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
422 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
423 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
424 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
425 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
426 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
427 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
428 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
429 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
430 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
431 8056447290 Streptomyces huiliensis SCA2-4 Isolate Rhizosphere
432 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.73
Metatranscriptomes 0.67
Isolates 11.6

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.4
Nodule 0.67
Rhizoplane 3.47
Rhizosphere 84.27
Stem 0
Stem Tuber 0
Unclassified 9.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10012771 3300001990 Bacteria 2738
2 rootH1_10029222 3300003316 Bacteria 3288
3 rootL2_10042722 3300003322 Bacteria 3417
4 JGI25160J50197_1003960 3300003354 Bacteria 6475
5 Ga0006562J51391_1071585 3300003578 Bacteria 3790
6 Ga0006562J51391_1071588 3300003578 Bacteria 2592
7 Ga0065715_10157574 3300005293 Bacteria 1661
8 Ga0070658_10000254 3300005327 Bacteria 46924
9 Ga0070683_100000609 3300005329 Bacteria 25672
10 Ga0070683_100094264 3300005329 Bacteria 2813
11 Ga0070670_100009939 3300005331 Bacteria 8121
12 Ga0070670_100123104 3300005331 Bacteria 2237
13 Ga0070670_100127535 3300005331 Bacteria 2196
14 Ga0068869_100015677 3300005334 Bacteria 5091
15 Ga0070682_100106736 3300005337 Bacteria 1859
16 Ga0070689_100021197 3300005340 Bacteria 4832
17 Ga0070691_10011804 3300005341 Bacteria 3996
18 Ga0070661_100077066 3300005344 Bacteria 2457
19 Ga0070675_100408284 3300005354 Bacteria 1213
20 Ga0070674_100159345 3300005356 Bacteria 1711
21 Ga0070688_100149419 3300005365 Bacteria 1596
22 Ga0070714_100000377 3300005435 Bacteria 33238
23 Ga0070714_100000468 3300005435 Bacteria 29346
24 Ga0070714_100022363 3300005435 Bacteria 5185
25 Ga0070714_100026140 3300005435 Bacteria 4823
26 Ga0070714_100070095 3300005435 Bacteria 3030
27 Ga0070713_100003967 3300005436 Bacteria 9839
28 Ga0070713_100229447 3300005436 Bacteria 1687
29 Ga0070710_10000005 3300005437 Bacteria 238049
30 Ga0070710_10084391 3300005437 Bacteria 1861
31 Ga0070710_10086350 3300005437 Bacteria 1842
32 Ga0070711_100023293 3300005439 Bacteria 4025
33 Ga0070708_100021157 3300005445 Bacteria 5495
34 Ga0070708_100052316 3300005445 Bacteria 3621
35 Ga0070708_100452080 3300005445 Bacteria 1212
36 Ga0070678_100008415 3300005456 Bacteria 6178
37 Ga0070681_10000034 3300005458 Bacteria 98600
38 Ga0070681_10005337 3300005458 Bacteria 12405
39 Ga0070681_10217262 3300005458 Bacteria 1827
40 Ga0070685_10244742 3300005466 Bacteria 1185
41 Ga0070706_100003390 3300005467 Bacteria 15712
42 Ga0070706_100013961 3300005467 Bacteria 7420
43 Ga0070706_100016021 3300005467 Bacteria 6923
44 Ga0070706_100046674 3300005467 Bacteria 3998
45 Ga0070706_100087688 3300005467 Bacteria 2885
46 Ga0070707_100002696 3300005468 Bacteria 16886
47 Ga0070707_100002739 3300005468 Bacteria 16768
48 Ga0070707_100005643 3300005468 Bacteria 11687
49 Ga0070707_100037090 3300005468 Bacteria 4651
50 Ga0070707_100043064 3300005468 Bacteria 4321
51 Ga0070698_100005256 3300005471 Bacteria 14160
52 Ga0070698_100153898 3300005471 Bacteria 2245
53 Ga0070699_100206465 3300005518 Bacteria 1748
54 Ga0070679_100000270 3300005530 Bacteria 43437
55 Ga0070679_100037284 3300005530 Bacteria 4828
56 Ga0070679_100209390 3300005530 Bacteria 1914
57 Ga0070684_100000132 3300005535 Bacteria 49550
58 Ga0070684_100024493 3300005535 Bacteria 5063
59 Ga0070684_100064458 3300005535 Bacteria 3214
60 Ga0070684_100134280 3300005535 Bacteria 2234
61 Ga0068853_100000551 3300005539 Bacteria 25570
62 Ga0068853_100008839 3300005539 Bacteria 8103
63 Ga0068853_100197230 3300005539 Bacteria 1831
64 Ga0068855_100000414 3300005563 Bacteria 52978
65 Ga0068855_100024619 3300005563 Bacteria 7201
66 Ga0068855_100140150 3300005563 Bacteria 2757
67 Ga0070664_100026447 3300005564 Bacteria 4813
68 Ga0070664_100270112 3300005564 Bacteria 1532
69 Ga0068857_100000178 3300005577 Bacteria 40384
70 Ga0068857_100002576 3300005577 Bacteria 14854
71 Ga0068854_100020542 3300005578 Bacteria 4471
72 Ga0068856_100000541 3300005614 Bacteria 41709
73 Ga0068856_100004114 3300005614 Bacteria 14538
74 Ga0068856_100063338 3300005614 Bacteria 3653
75 Ga0070702_100005174 3300005615 Bacteria 6041
76 Ga0068852_100000641 3300005616 Bacteria 22869
77 Ga0068852_100199729 3300005616 Bacteria 1892
78 Ga0068859_100050634 3300005617 Bacteria 4172
79 Ga0068864_100081054 3300005618 Bacteria 2845
80 Ga0068864_100091894 3300005618 Bacteria 2678
81 Ga0068866_10008160 3300005718 Bacteria 4400
82 Ga0068858_100059316 3300005842 Bacteria 3537
83 Ga0068860_100023387 3300005843 Bacteria 5972
84 Ga0081455_10113915 3300005937 Bacteria 2144
85 Ga0070717_10000001 3300006028 Bacteria 465573
86 Ga0070717_10005944 3300006028 Bacteria 8937
87 Ga0070717_10008670 3300006028 Bacteria 7605
88 Ga0070717_10018740 3300006028 Bacteria 5412
89 Ga0075368_10011022 3300006042 Bacteria 3283
90 Ga0075363_100013598 3300006048 Bacteria 3951
91 Ga0070715_10040245 3300006163 Bacteria 1953
92 Ga0070712_100080623 3300006175 Bacteria 2356
93 Ga0070712_100183374 3300006175 Bacteria 1633
94 Ga0075367_10000715 3300006178 Bacteria 12829
95 Ga0097621_100000014 3300006237 Bacteria 100839
96 Ga0097621_100004781 3300006237 Bacteria 9477
97 Ga0068871_100001973 3300006358 Bacteria 13910
98 Ga0075433_10064999 3300006852 Bacteria 3199
99 Ga0075434_100006102 3300006871 Bacteria 11029
100 Ga0075436_100002055 3300006914 Bacteria 13881
101 Ga0075436_100004446 3300006914 Bacteria 9619
102 Ga0097620_100050643 3300006931 Bacteria 4172
103 Ga0097620_100210867 3300006931 Bacteria 2029
104 Ga0099826_10110194 3300006948 Bacteria 1641
105 Ga0075435_100051451 3300007076 Bacteria 3318
106 Ga0075435_100065475 3300007076 Bacteria 2954
107 Ga0099794_10065577 3300007265 Bacteria 1771
108 Ga0105240_10090665 3300009093 Bacteria 3736
109 Ga0105240_10102318 3300009093 Bacteria 3481
110 Ga0105240_10108702 3300009093 Bacteria 3359
111 Ga0105240_10131752 3300009093 Bacteria 2998
112 Ga0105240_10188710 3300009093 Bacteria 2425
113 Ga0105240_10229568 3300009093 Bacteria 2158
114 Ga0111539_10052868 3300009094 Bacteria 4835
115 Ga0105245_10013643 3300009098 Bacteria 7079
116 Ga0105245_10050134 3300009098 Bacteria 3740
117 Ga0105247_10019731 3300009101 Bacteria 4048
118 Ga0114129_10273754 3300009147 Bacteria 2258
119 Ga0105243_10042551 3300009148 Bacteria 3556
120 Ga0105241_10003085 3300009174 Bacteria 12409
121 Ga0105241_10007013 3300009174 Bacteria 8289
122 Ga0105241_10061137 3300009174 Bacteria 2900
123 Ga0105241_10268923 3300009174 Bacteria 1451
124 Ga0105242_10018518 3300009176 Bacteria 5446
125 Ga0105248_10030353 3300009177 Bacteria 6035
126 Ga0105237_10011061 3300009545 Bacteria 9568
127 Ga0105237_10035387 3300009545 Bacteria 5053
128 Ga0105237_10060977 3300009545 Bacteria 3772
129 Ga0105238_10000099 3300009551 Bacteria 97818
130 Ga0105238_10004170 3300009551 Bacteria 14341
131 Ga0105238_10064232 3300009551 Bacteria 3671
132 Ga0105249_10307208 3300009553 Bacteria 1593
133 Ga0105239_10020990 3300010375 Bacteria 7208
134 Ga0105239_10050797 3300010375 Bacteria 4546
135 Ga0105239_10280370 3300010375 Bacteria 1876
136 Ga0157313_1002337 3300012503 Bacteria 1124
137 Ga0157369_10000042 3300013105 Bacteria 181784
138 Ga0157369_10006793 3300013105 Bacteria 13198
139 Ga0157369_10011777 3300013105 Bacteria 9932
140 Ga0157369_10022583 3300013105 Bacteria 7018
141 Ga0157369_10052608 3300013105 Bacteria 4406
142 Ga0157369_10071211 3300013105 Bacteria 3733
143 Ga0157378_10003197 3300013297 Bacteria 14554
144 Ga0157378_10011532 3300013297 Bacteria 7738
145 Ga0163162_10173466 3300013306 Bacteria 2281
146 Ga0163162_10208372 3300013306 Bacteria 2084
147 Ga0157372_10003621 3300013307 Bacteria 16626
148 Ga0157372_10018475 3300013307 Bacteria 7495
149 Ga0157372_10053080 3300013307 Bacteria 4516
150 Ga0157372_10085747 3300013307 Bacteria 3572
151 Ga0157372_10122034 3300013307 Bacteria 2994
152 Ga0157372_10149382 3300013307 Bacteria 2696
153 Ga0157372_10435565 3300013307 Bacteria 1528
154 Ga0157372_10461069 3300013307 Bacteria 1481
155 Ga0157372_10629394 3300013307 Bacteria 1250
156 Ga0157375_10176918 3300013308 Bacteria 2284
157 Ga0157375_10239914 3300013308 Bacteria 1972
158 Ga0157375_10440818 3300013308 Bacteria 1468
159 Ga0157380_10243156 3300014326 Bacteria 1624
160 Ga0157380_10419080 3300014326 Bacteria 1276
161 Ga0182008_10004052 3300014497 Bacteria 8648
162 Ga0157379_10003200 3300014968 Bacteria 13870
163 Ga0157376_10009682 3300014969 Bacteria 7012
164 Ga0157376_10019952 3300014969 Bacteria 5177
165 Ga0157376_10067977 3300014969 Bacteria 3016
166 Ga0157376_10470705 3300014969 Bacteria 1229
167 Ga0182007_10001956 3300015262 Bacteria 10656
168 Ga0183367_1001 3300015688 Bacteria 1225545
169 Ga0163161_10001814 3300017792 Bacteria 15591
170 Ga0224712_10009523 3300022467 Bacteria 2931
171 Ga0224712_10013952 3300022467 Bacteria 2574
172 Ga0209758_1006936 3300025297 Bacteria 7900
173 Ga0207426_1006931 3300025302 Bacteria 4816
174 Ga0207426_1016694 3300025302 Bacteria 2627
175 Ga0207426_1023614 3300025302 Bacteria 2096
176 Ga0207692_10000003 3300025898 Bacteria 431531
177 Ga0207692_10032641 3300025898 Bacteria 2504
178 Ga0207642_10022607 3300025899 Bacteria 2498
179 Ga0207710_10003720 3300025900 Bacteria 6755
180 Ga0207705_10035200 3300025909 Bacteria 3582
181 Ga0207684_10003467 3300025910 Bacteria 15385
182 Ga0207684_10026271 3300025910 Bacteria 4964
183 Ga0207684_10073766 3300025910 Bacteria 2899
184 Ga0207684_10136900 3300025910 Bacteria 2103
185 Ga0207684_10376186 3300025910 Bacteria 1222
186 Ga0207654_10000890 3300025911 Bacteria 16560
187 Ga0207654_10008960 3300025911 Bacteria 5076
188 Ga0207654_10202920 3300025911 Bacteria 1306
189 Ga0207707_10000891 3300025912 Bacteria 29182
190 Ga0207707_10213260 3300025912 Bacteria 1682
191 Ga0207695_10001825 3300025913 Bacteria 33474
192 Ga0207695_10133720 3300025913 Bacteria 2435
193 Ga0207695_10159707 3300025913 Bacteria 2186
194 Ga0207671_10001322 3300025914 Bacteria 29026
195 Ga0207671_10020313 3300025914 Bacteria 5059
196 Ga0207671_10244021 3300025914 Bacteria 1411
197 Ga0207663_10077450 3300025916 Bacteria 2164
198 Ga0207657_10186137 3300025919 Bacteria 1677
199 Ga0207649_10010711 3300025920 Bacteria 5042
200 Ga0207652_10001281 3300025921 Bacteria 22398
201 Ga0207652_10284455 3300025921 Bacteria 1492
202 Ga0207652_10328715 3300025921 Bacteria 1380
203 Ga0207646_10001004 3300025922 Bacteria 36159
204 Ga0207646_10005717 3300025922 Bacteria 13042
205 Ga0207646_10007233 3300025922 Bacteria 11321
206 Ga0207646_10071491 3300025922 Bacteria 3099
207 Ga0207646_10154381 3300025922 Bacteria 2070
208 Ga0207694_10000745 3300025924 Bacteria 29280
209 Ga0207694_10000936 3300025924 Bacteria 25749
210 Ga0207650_10086270 3300025925 Bacteria 2390
211 Ga0207650_10087307 3300025925 Bacteria 2376
212 Ga0207650_10313326 3300025925 Bacteria 1284
213 Ga0207687_10030070 3300025927 Bacteria 3659
214 Ga0207687_10047069 3300025927 Bacteria 2988
215 Ga0207700_10022195 3300025928 Bacteria 4350
216 Ga0207700_10158681 3300025928 Bacteria 1876
217 Ga0207700_10165434 3300025928 Bacteria 1840
218 Ga0207700_10233759 3300025928 Bacteria 1564
219 Ga0207664_10004432 3300025929 Bacteria 9508
220 Ga0207664_10011778 3300025929 Bacteria 6234
221 Ga0207664_10014836 3300025929 Bacteria 5641
222 Ga0207664_10025013 3300025929 Bacteria 4490
223 Ga0207664_10261785 3300025929 Bacteria 1513
224 Ga0207686_10012449 3300025934 Bacteria 4679
225 Ga0207709_10031284 3300025935 Bacteria 3106
226 Ga0207670_10074270 3300025936 Bacteria 2359
227 Ga0207669_10011581 3300025937 Bacteria 4299
228 Ga0207665_10017771 3300025939 Bacteria 4674
229 Ga0207691_10089552 3300025940 Bacteria 2759
230 Ga0207661_10002130 3300025944 Bacteria 13615
231 Ga0207679_10015776 3300025945 Bacteria 5004
232 Ga0207679_10048689 3300025945 Bacteria 3087
233 Ga0207679_10184517 3300025945 Bacteria 1728
234 Ga0207667_10000535 3300025949 Bacteria 50094
235 Ga0207667_10001693 3300025949 Bacteria 27732
236 Ga0207667_10147097 3300025949 Bacteria 2425
237 Ga0207712_10036119 3300025961 Bacteria 3363
238 Ga0207712_10246497 3300025961 Bacteria 1442
239 Ga0207640_10004910 3300025981 Bacteria 7267
240 Ga0207677_10022394 3300026023 Bacteria 3883
241 Ga0207703_10060165 3300026035 Bacteria 3105
242 Ga0207703_10268220 3300026035 Bacteria 1545
243 Ga0207639_10000531 3300026041 Bacteria 26255
244 Ga0207639_10153390 3300026041 Bacteria 1932
245 Ga0207702_10001271 3300026078 Bacteria 25346
246 Ga0207702_10008594 3300026078 Bacteria 8609
247 Ga0207702_10011794 3300026078 Bacteria 7278
248 Ga0207702_10083303 3300026078 Bacteria 2782
249 Ga0207641_10478165 3300026088 Bacteria 1207
250 Ga0207674_10000157 3300026116 Bacteria 80435
251 Ga0207675_100397484 3300026118 Bacteria 1358
252 Ga0207683_10000257 3300026121 Bacteria 47314
253 Ga0207698_10000319 3300026142 Bacteria 28739
254 Ga0207698_10097004 3300026142 Bacteria 2431
255 Ga0209282_1100217 3300027666 Bacteria 1493
256 Ga0209813_10013124 3300027866 Bacteria 2205
257 Ga0268264_10005209 3300028381 Bacteria 11012
258 Ga0265319_1031551 3300028563 Bacteria 1844
259 Ga0307517_10025660 3300028786 Bacteria 7194
260 Ga0307515_10000287 3300028794 Bacteria 123976
261 Ga0307515_10028816 3300028794 Bacteria 9419
262 Ga0307515_10089178 3300028794 Bacteria 3887
263 Ga0307515_10223615 3300028794 Bacteria 1693
264 Ga0265338_10035020 3300028800 Bacteria 4837
265 Ga0265324_10008434 3300029957 Bacteria 4095
266 Ga0307511_10001720 3300030521 Bacteria 23047
267 Ga0307511_10026702 3300030521 Bacteria 5290
268 Ga0307511_10035848 3300030521 Bacteria 4324
269 Ga0307511_10049182 3300030521 Bacteria 3418
270 Ga0307512_10005793 3300030522 Bacteria 12730
271 Ga0307512_10024136 3300030522 Bacteria 5418
272 Ga0265320_10044366 3300031240 Bacteria 2191
273 Ga0265325_10017986 3300031241 Bacteria 3923
274 Ga0265340_10003313 3300031247 Bacteria 9133
275 Ga0265339_10016133 3300031249 Bacteria 4461
276 Ga0307513_10028756 3300031456 Bacteria 6349
277 Ga0307513_10346281 3300031456 Bacteria 1235
278 Ga0307509_10025474 3300031507 Bacteria 6604
279 Ga0307408_100023575 3300031548 Bacteria 4194
280 Ga0307508_10037588 3300031616 Bacteria 4352
281 Ga0307508_10235180 3300031616 Bacteria 1430
282 Ga0307514_10012027 3300031649 Bacteria 7201
283 Ga0265342_10019358 3300031712 Bacteria 4389
284 Ga0316576_10052009 3300031727 Bacteria 2982
285 Ga0307516_10032499 3300031730 Bacteria 5254
286 Ga0307516_10042401 3300031730 Bacteria 4514
287 Ga0307405_10003908 3300031731 Bacteria 6957
288 Ga0316577_10060846 3300031733 Bacteria 2107
289 Ga0316577_10061419 3300031733 Bacteria 2097
290 Ga0307413_10001470 3300031824 Bacteria 8956
291 Ga0307413_10013839 3300031824 Bacteria 4074
292 Ga0307518_10069369 3300031838 Bacteria 2554
293 Ga0307410_10000352 3300031852 Bacteria 17818
294 Ga0307410_10002093 3300031852 Bacteria 9461
295 Ga0307410_10306656 3300031852 Bacteria 1255
296 Ga0307406_10072546 3300031901 Bacteria 2260
297 Ga0307406_10108324 3300031901 Bacteria 1907
298 Ga0307407_10049140 3300031903 Bacteria 2405
299 Ga0307407_10088068 3300031903 Bacteria 1896
300 Ga0307412_10007170 3300031911 Bacteria 6327
301 Ga0307412_10008106 3300031911 Bacteria 5987
302 Ga0307412_10017502 3300031911 Bacteria 4291
303 Ga0307409_100002421 3300031995 Bacteria 9747
304 Ga0307409_100003377 3300031995 Bacteria 8662
305 Ga0307409_100017832 3300031995 Bacteria 4747
306 Ga0307409_100019649 3300031995 Bacteria 4581
307 Ga0307416_100015076 3300032002 Bacteria 5323
308 Ga0307416_100040667 3300032002 Bacteria 3614
309 Ga0307416_100237284 3300032002 Bacteria 1763
310 Ga0307414_10025594 3300032004 Bacteria 3783
311 Ga0307414_10161847 3300032004 Bacteria 1779
312 Ga0307411_10002733 3300032005 Bacteria 7920
313 Ga0307411_10014107 3300032005 Bacteria 4435
314 Ga0307411_10390621 3300032005 Bacteria 1147
315 Ga0307415_100006574 3300032126 Bacteria 6284
316 Ga0307415_100007489 3300032126 Bacteria 5974
317 Ga0316585_10028916 3300032137 Bacteria 1735
318 Ga0307507_10010287 3300033179 Bacteria 12137
319 Ga0307507_10019151 3300033179 Bacteria 7726
320 Ga0307510_10000644 3300033180 Bacteria 35417
321 Ga0373926_0001784 3300035083 Bacteria 6685
322 Ga0373954_0039189 3300035118 Bacteria 2206
323 Ga0373954_0042239 3300035118 Bacteria 2126
324 Ga0373954_0042753 3300035118 Bacteria 2113
325 Ga0373956_0017063 3300035119 Bacteria 3056
326 Ga0373956_0029030 3300035119 Bacteria 2410
327 Ga0373957_0081256 3300035120 Bacteria 1280
328 Ga0373955_0009399 3300035172 Bacteria 4574
329 Ga0373924_0004127 3300035410 Bacteria 5056
330 Ga0373924_0038744 3300035410 Bacteria 1945
331 Ga0373935_0000094 3300035692 Bacteria 39144
332 Ga0373933_0032693 3300035724 Bacteria 3024
333 Ga0373947_0000011 3300035725 Bacteria 160778
334 Ga0373947_0183480 3300035725 Bacteria 1363
335 Ga0373937_0020699 3300036401 Bacteria 5900
336 Ga0373937_0068561 3300036401 Bacteria 3270
337 Ga0373937_0088064 3300036401 Bacteria 2874
338 Ga0316582_0092835 3300036647 Bacteria 1990
339 Ga0316584_0006850 3300036712 Bacteria 7740
340 Ga0316584_0056615 3300036712 Bacteria 2935
341 Ga0395900_0424995 3300037418 Bacteria 1289
342 Ga0395898_0022337 3300037466 Bacteria 6407
343 Ga0395898_0041040 3300037466 Bacteria 4573
344 Ga0395905_0163487 3300037471 Bacteria 2092
345 Ga0436364_1442308 3300037853 Bacteria 2270
346 Ga0395901_0246940 3300038443 Bacteria 1860
347 Ga0400484_42200 3300038725 Bacteria 10636
348 Ga0400490_05965 3300038726 Bacteria 10488
349 Ga0400490_24841 3300038726 Bacteria 1768
350 Ga0400488_31331 3300038741 Bacteria 3081
351 Ga0400483_218673 3300039062 Bacteria 21299
352 Ga0400487_05605 3300039110 Bacteria 3096
353 Ga0400487_27158 3300039110 Bacteria 6330
354 Ga0439436_0007626 3300041404 Bacteria 3331
355 Ga0439439_0000566 3300041406 Bacteria 6444
356 Ga0439439_0006105 3300041406 Bacteria 2777
357 Ga0451791_0161359 3300041451 Bacteria 1771
358 Ga0451839_1355463 3300041496 Bacteria 931
359 Ga0439433_0001912 3300041999 Bacteria 4357
360 Ga0439448_0010688 3300042005 Bacteria 2725
361 Ga0439449_0000174 3300042007 Bacteria 22298
362 Ga0439449_0039242 3300042007 Bacteria 1760
363 Ga0439455_0004473 3300042012 Bacteria 2770
364 Ga0439457_001137 3300042014 Bacteria 8012
365 Ga0439457_001725 3300042014 Bacteria 6479
366 Ga0450894_002160 3300042131 Bacteria 2675
367 Ga0450896_000923 3300042133 Bacteria 3395
368 Ga0450899_000712 3300042135 Bacteria 3796
369 Ga0450903_001042 3300042138 Bacteria 5286
370 Ga0439458_0001351 3300042157 Bacteria 6182
371 Ga0451577_0230952 3300042876 Bacteria 1673
372 Ga0466969_0025351 3300044656 Bacteria 3049
373 Ga0466969_0043086 3300044656 Bacteria 2250
374 Ga0466969_0060287 3300044656 Bacteria 1844
375 Ga0466972_0008641 3300044658 Bacteria 5108
376 Ga0466972_0083628 3300044658 Bacteria 1518
377 Ga0466972_0098991 3300044658 Bacteria 1380
378 Ga0466965_0174065 3300044683 Bacteria 1133
379 Ga0466966_0053212 3300044684 Bacteria 2568
380 Ga0466966_0120758 3300044684 Bacteria 1610
381 Ga0466961_0027528 3300044693 Bacteria 3656
382 Ga0466963_0010310 3300044694 Bacteria 5655
383 Ga0466963_0031124 3300044694 Bacteria 3447
384 Ga0466963_0112519 3300044694 Bacteria 1869
385 Ga0466964_0013638 3300044706 Bacteria 3084
386 Ga0453684_0000045 3300044712 Bacteria 582917
387 Ga0466970_0007115 3300044765 Bacteria 5599
388 Ga0466970_0009315 3300044765 Bacteria 4959
389 Ga0466970_0041897 3300044765 Bacteria 2434
390 Ga0466970_0109727 3300044765 Bacteria 1506
391 Ga0466957_0161065 3300044842 Bacteria 1457
392 Ga0466960_0008493 3300044901 Bacteria 4208
393 Ga0466959_0002626 3300045049 Bacteria 11539
394 Ga0466959_0012597 3300045049 Bacteria 6117
395 Ga0466959_0061500 3300045049 Bacteria 2730
396 Ga0466958_0070297 3300045836 Bacteria 2142
397 Ga0466967_0124248 3300045976 Bacteria 2389
398 Ga0466967_0244556 3300045976 Bacteria 1712
399 Ga0495617_007022 3300046452 Bacteria 3925
400 Ga0495627_033301 3300046453 Bacteria 1616
401 Ga0495627_051779 3300046453 Bacteria 1233
402 Ga0495592_0004051 3300046454 Bacteria 10655
403 Ga0495592_0022978 3300046454 Bacteria 4745
404 Ga0495592_0026097 3300046454 Bacteria 4432
405 Ga0495592_0041037 3300046454 Bacteria 3469
406 Ga0495603_0014958 3300046455 Bacteria 4691
407 Ga0495603_0110149 3300046455 Bacteria 1606
408 Ga0495629_0001877 3300046459 Bacteria 16400
409 Ga0495629_0002031 3300046459 Bacteria 15733
410 Ga0495629_0003393 3300046459 Bacteria 12051
411 Ga0495629_0028925 3300046459 Bacteria 3933
412 Ga0495629_0068281 3300046459 Bacteria 2480
413 Ga0495629_0120839 3300046459 Bacteria 1825
414 Ga0495629_0210073 3300046459 Bacteria 1344
415 Ga0495638_0094084 3300046460 Bacteria 1801
416 Ga0495651_0002330 3300046462 Bacteria 14656
417 Ga0495651_0003385 3300046462 Bacteria 12238
418 Ga0495651_0012853 3300046462 Bacteria 6468
419 Ga0495651_0201905 3300046462 Bacteria 1391
420 Ga0495653_0029384 3300046463 Bacteria 4388
421 Ga0495653_0040822 3300046463 Bacteria 3624
422 Ga0495580_0052614 3300046472 Bacteria 2875
423 Ga0495582_0129856 3300046473 Bacteria 1423
424 Ga0495605_0017442 3300046474 Bacteria 3865
425 Ga0495639_0023359 3300046475 Bacteria 2717
426 Ga0495662_0000436 3300046476 Bacteria 18733
427 Ga0495662_0000592 3300046476 Bacteria 16737
428 Ga0495662_0007753 3300046476 Bacteria 5287
429 Ga0495662_0103287 3300046476 Bacteria 1394
430 Ga0495662_0124039 3300046476 Bacteria 1268
431 Ga0495664_0003142 3300046477 Bacteria 8967
432 Ga0495664_0005397 3300046477 Bacteria 7019
433 Ga0495664_0007847 3300046477 Bacteria 5939
434 Ga0495664_0047667 3300046477 Bacteria 2543
435 Ga0495594_0000282 3300046499 Bacteria 25010
436 Ga0495594_0046474 3300046499 Bacteria 2384
437 Ga0495594_0050080 3300046499 Bacteria 2297
438 Ga0495594_0055983 3300046499 Bacteria 2175
439 Ga0495594_0079025 3300046499 Bacteria 1836
440 Ga0495606_0004135 3300046507 Bacteria 14728
441 Ga0495608_0007002 3300046511 Bacteria 7981
442 Ga0495608_0145243 3300046511 Bacteria 1513
443 Ga0495616_0014269 3300046513 Bacteria 4454
444 Ga0495618_0090725 3300046514 Bacteria 1953
445 Ga0495618_0094808 3300046514 Bacteria 1908
446 Ga0495628_0044011 3300046516 Bacteria 3553
447 Ga0495628_0062553 3300046516 Bacteria 2917
448 Ga0495628_0078572 3300046516 Bacteria 2566
449 Ga0495628_0331253 3300046516 Bacteria 1122
450 Ga0495630_0017245 3300046517 Bacteria 5288
451 Ga0495630_0030227 3300046517 Bacteria 4029
452 Ga0495630_0111220 3300046517 Bacteria 2075
453 Ga0495631_0018611 3300046518 Bacteria 3267
454 Ga0495643_0074567 3300046522 Bacteria 1776
455 Ga0495648_0037243 3300046524 Bacteria 3128
456 Ga0495666_0014181 3300046526 Bacteria 3971
457 Ga0495666_0019026 3300046526 Bacteria 3411
458 Ga0495652_0033905 3300046529 Bacteria 4452
459 Ga0495652_0043080 3300046529 Bacteria 3890
460 Ga0495652_0085304 3300046529 Bacteria 2595
461 Ga0495652_0133309 3300046529 Bacteria 1963
462 Ga0495652_0141861 3300046529 Bacteria 1888
463 Ga0495665_0002822 3300046531 Bacteria 9369
464 Ga0495665_0049993 3300046531 Bacteria 2216
465 Ga0495665_0090567 3300046531 Bacteria 1607
466 Ga0495640_0003158 3300046533 Bacteria 13271
467 Ga0495640_0005478 3300046533 Bacteria 10098
468 Ga0495640_0007378 3300046533 Bacteria 8652
469 Ga0495640_0062298 3300046533 Bacteria 2530
470 Ga0495586_0017217 3300046535 Bacteria 3841
471 Ga0495586_0029203 3300046535 Bacteria 2951
472 Ga0495587_0007220 3300046536 Bacteria 7208
473 Ga0495587_0024290 3300046536 Bacteria 3716
474 Ga0495587_0063726 3300046536 Bacteria 2155
475 Ga0495587_0073214 3300046536 Bacteria 1990
476 Ga0495609_0025039 3300046538 Bacteria 2736
477 Ga0495597_0023558 3300046542 Bacteria 2847
478 Ga0495645_0033582 3300046543 Bacteria 3743
479 Ga0495622_0052319 3300046557 Bacteria 1894
480 Ga0495633_0010944 3300046558 Bacteria 4926
481 Ga0495667_0006232 3300046559 Bacteria 8083
482 Ga0495667_0022517 3300046559 Bacteria 4244
483 Ga0495667_0042645 3300046559 Bacteria 3009
484 Ga0495668_0019922 3300046616 Bacteria 3859
485 Ga0495634_0005624 3300046642 Bacteria 9602
486 Ga0495634_0016321 3300046642 Bacteria 5312
487 Ga0495634_0039425 3300046642 Bacteria 3216
488 Ga0495634_0042581 3300046642 Bacteria 3079
489 Ga0495634_0107489 3300046642 Bacteria 1797
490 Ga0495625_0031265 3300046660 Bacteria 3962
491 Ga0495625_0042721 3300046660 Bacteria 3291
492 Ga0495625_0061899 3300046660 Bacteria 2646
493 Ga0495635_0019232 3300046663 Bacteria 4764
494 Ga0495635_0048568 3300046663 Bacteria 2925
495 Ga0495661_0029268 3300046665 Bacteria 3518
496 Ga0495588_0000819 3300046674 Bacteria 13858
497 Ga0495588_0133260 3300046674 Bacteria 1311
498 Ga0495657_0007036 3300046675 Bacteria 8725
499 Ga0495657_0010436 3300046675 Bacteria 6989
500 Ga0495657_0018875 3300046675 Bacteria 4983
501 Ga0495657_0031722 3300046675 Bacteria 3690
502 Ga0495657_0034607 3300046675 Bacteria 3507
503 Ga0495599_0023244 3300046678 Bacteria 3874
504 Ga0495599_0047234 3300046678 Bacteria 2698
505 Ga0495599_0125134 3300046678 Bacteria 1598
506 Ga0495623_0008819 3300046679 Bacteria 6544
507 Ga0495623_0068381 3300046679 Bacteria 2215
508 Ga0495623_0073147 3300046679 Bacteria 2131
509 Ga0495646_0008053 3300046680 Bacteria 6699
510 Ga0495646_0008679 3300046680 Bacteria 6460
511 Ga0495658_0017872 3300046683 Bacteria 3675
512 Ga0495658_0040377 3300046683 Bacteria 2594
513 Ga0495613_0000904 3300046689 Bacteria 22821
514 Ga0495613_0004025 3300046689 Bacteria 10998
515 Ga0495613_0019745 3300046689 Bacteria 5022
516 Ga0495613_0021426 3300046689 Bacteria 4817
517 Ga0495613_0038415 3300046689 Bacteria 3548
518 Ga0495613_0052346 3300046689 Bacteria 3007
519 Ga0495613_0053846 3300046689 Bacteria 2959
520 Ga0495624_0023985 3300046690 Bacteria 4019
521 Ga0495624_0161755 3300046690 Bacteria 1367
522 Ga0495649_0044038 3300046694 Bacteria 2436
523 Ga0495589_0054727 3300046794 Bacteria 1967
524 Ga0495600_0024191 3300046809 Bacteria 3908
525 Ga0495600_0064435 3300046809 Bacteria 2395
526 Ga0495600_0125929 3300046809 Bacteria 1666
527 Ga0495660_0065994 3300046810 Bacteria 1930
528 Ga0495581_0013956 3300047315 Bacteria 4659
529 Ga0495581_0022890 3300047315 Bacteria 3619
530 Ga0495581_0060517 3300047315 Bacteria 2188
531 Ga0495604_0002310 3300047317 Bacteria 15280
532 Ga0495604_0004139 3300047317 Bacteria 11518
533 Ga0495604_0009936 3300047317 Bacteria 7534
534 Ga0495604_0044770 3300047317 Bacteria 3455
535 Ga0495604_0072502 3300047317 Bacteria 2602
536 Ga0495636_0007135 3300047318 Bacteria 4398
537 Ga0495636_0022063 3300047318 Bacteria 2573
538 Ga0495636_0070236 3300047318 Bacteria 1493
539 Ga0495674_0034062 3300047319 Bacteria 4607
540 Ga0495674_0034642 3300047319 Bacteria 4563
541 Ga0495674_0154623 3300047319 Bacteria 1922
542 Ga0495674_0327923 3300047319 Bacteria 1246
543 Ga0495676_0011428 3300047321 Bacteria 8015
544 Ga0495676_0015587 3300047321 Bacteria 6762
545 Ga0495676_0052822 3300047321 Bacteria 3241
546 Ga0495676_0103609 3300047321 Bacteria 2100
547 Ga0495680_0006882 3300047322 Bacteria 10495
548 Ga0495680_0028785 3300047322 Bacteria 4553
549 Ga0495680_0267396 3300047322 Bacteria 1208
550 Ga0495683_0068160 3300047323 Bacteria 1750
551 Ga0495687_001601 3300047443 Bacteria 20428
552 Ga0495675_0015948 3300047444 Bacteria 4751
553 Ga0495675_0031290 3300047444 Bacteria 3397
554 Ga0495675_0049850 3300047444 Bacteria 2660
555 Ga0495675_0050288 3300047444 Bacteria 2649
556 Ga0495675_0058530 3300047444 Bacteria 2443
557 Ga0495675_0108669 3300047444 Bacteria 1732
558 Ga0495677_0053781 3300047445 Bacteria 1485
559 Ga0495685_022249 3300047447 Bacteria 2182
560 Ga0495681_0003265 3300047470 Bacteria 11308
561 Ga0495681_0050128 3300047470 Bacteria 1969
562 Ga0495684_0053550 3300047471 Bacteria 3079
563 Ga0495686_0128814 3300047472 Bacteria 1502
564 Ga0495593_0000283 3300047673 Bacteria 27649
565 Ga0495593_0019174 3300047673 Bacteria 3838
566 Ga0495593_0028303 3300047673 Bacteria 3078
567 Ga0495602_0017320 3300048088 Bacteria 7224
568 Ga0495602_0018554 3300048088 Bacteria 6942
569 Ga0495602_0042791 3300048088 Bacteria 4123
570 Ga0495602_0058724 3300048088 Bacteria 3365
571 Ga0495614_0000345 3300048089 Bacteria 18437
572 Ga0495614_0025655 3300048089 Bacteria 2541
573 Ga0495614_0027182 3300048089 Bacteria 2467
574 Ga0496100_0011567 3300048903 Bacteria 5028
575 Ga0496101_0006825 3300048904 Bacteria 7367
576 Ga0496103_0023960 3300048906 Bacteria 3682
577 Ga0496104_0004325 3300048907 Bacteria 12361
578 Ga0496104_0065750 3300048907 Bacteria 3442
579 Ga0496104_0183277 3300048907 Bacteria 2004
580 Ga0496104_0273541 3300048907 Bacteria 1602
581 Ga0496105_0027258 3300048908 Bacteria 4664
582 Ga0496105_0141814 3300048908 Bacteria 1978
583 Ga0496105_0306760 3300048908 Bacteria 1275
584 Ga0496106_0003631 3300048909 Bacteria 11507
585 Ga0496108_0026608 3300048911 Bacteria 4772
586 Ga0496108_0065414 3300048911 Bacteria 3065
587 Ga0496109_0008973 3300048912 Bacteria 8517
588 Ga0496109_0060423 3300048912 Bacteria 3463
589 Ga0496109_0138073 3300048912 Bacteria 2279
590 Ga0496110_0009486 3300048913 Bacteria 7880
591 Ga0496111_0072878 3300048914 Bacteria 2500
592 Ga0496112_0010903 3300048915 Bacteria 8275
593 Ga0496112_0020724 3300048915 Bacteria 6237
594 Ga0496112_0320519 3300048915 Bacteria 1494
595 Ga0496113_0100131 3300048916 Bacteria 2245
596 Ga0496114_0037320 3300048917 Bacteria 4018
597 Ga0496114_0094503 3300048917 Bacteria 2543
598 Ga0496115_0065815 3300048918 Bacteria 2928
599 Ga0501323_000501 3300049539 Bacteria 2935
600 Ga0501031_0019173 3300049568 Bacteria 4454
601 Ga0501031_0023838 3300049568 Bacteria 3990
602 Ga0501032_0021013 3300049569 Bacteria 4541
603 Ga0501033_0007870 3300049570 Bacteria 8259
604 Ga0501033_0022792 3300049570 Bacteria 4721
605 Ga0501034_0002162 3300049571 Bacteria 24379
606 Ga0501036_0001507 3300049572 Bacteria 17961
607 Ga0501036_0003633 3300049572 Bacteria 12334
608 Ga0501036_0016135 3300049572 Bacteria 6242
609 Ga0501036_0022337 3300049572 Bacteria 5321
610 Ga0501037_0034136 3300049573 Bacteria 3755
611 Ga0501037_0069660 3300049573 Bacteria 2560
612 Ga0501038_0053726 3300049574 Bacteria 3467
613 Ga0501038_0060378 3300049574 Bacteria 3245
614 Ga0501039_0003767 3300049575 Bacteria 11397
615 Ga0501042_0161417 3300049578 Bacteria 1617
616 Ga0501043_0002374 3300049579 Bacteria 15938
617 Ga0501043_0005810 3300049579 Bacteria 9924
618 Ga0501043_0198419 3300049579 Bacteria 1558
619 Ga0501047_0000068 3300049581 Bacteria 129241
620 Ga0501047_0010336 3300049581 Bacteria 8827
621 Ga0501048_0009177 3300049582 Bacteria 7435
622 Ga0501068_0171705 3300049584 Bacteria 1369
623 Ga0501069_0067206 3300049585 Bacteria 2005
624 Ga0501070_0004372 3300049586 Bacteria 12143
625 Ga0501242_001153 3300049674 Bacteria 2591
626 Ga0501247_000034 3300049677 Bacteria 7923
627 Ga0501257_002518 3300049686 Bacteria 3866
628 Ga0501258_000911 3300049687 Bacteria 2230
629 Ga0501225_0008530 3300049705 Bacteria 2937
630 Ga0501267_000307 3300049764 Bacteria 3612
631 Ga0501268_000956 3300049765 Bacteria 3413
632 Ga0501270_000164 3300049767 Bacteria 5342
633 Ga0501273_000321 3300049770 Bacteria 3732
634 Ga0501035_0008382 3300049822 Bacteria 9624
635 Ga0501035_0016266 3300049822 Bacteria 6862
636 Ga0501044_0001473 3300049823 Bacteria 27597
637 Ga0501044_0036328 3300049823 Bacteria 5154
638 Ga0501044_0073204 3300049823 Bacteria 3483
639 Ga0501044_0379298 3300049823 Bacteria 1329
640 nmdc:mga03n38_39319_c1 3300050490 Bacteria 2051
641 nmdc:mga06z11_1011_c1 3300050494 Bacteria 10273
642 nmdc:mga04h51_1208_c1 3300050495 Bacteria 4636
643 nmdc:mga06r32_120317_c1 3300050510 Bacteria 2589
644 nmdc:mga08y16_43378_c1 3300050511 Bacteria 4713
645 nmdc:mga0n895_23600_c1 3300050512 Bacteria 5784
646 nmdc:mga0rr50_12614_c1 3300050513 Bacteria 5471
647 nmdc:mga08x19_156167_c1 3300050514 Bacteria 1197
648 nmdc:mga08x19_20996_c1 3300050514 Bacteria 4028
649 nmdc:mga08x19_2566_c1 3300050514 Bacteria 11043
650 nmdc:mga0a205_20389_c1 3300050515 Bacteria 6253
651 Ga0495601_0049833 3300053077 Bacteria 2641
652 Ga0495601_0117163 3300053077 Bacteria 1728
653 Ga0495612_0007880 3300053078 Bacteria 4343
654 Ga0495612_0017663 3300053078 Bacteria 2856
655 Ga0495612_0086781 3300053078 Bacteria 1320
656 Ga0495619_0092619 3300053085 Bacteria 2047
657 Ga0495619_0121996 3300053085 Bacteria 1787
658 Ga0500553_032257 3300053101 Bacteria 2610
659 Ga0500560_035406 3300053107 Bacteria 1536
660 Ga0500573_0128214 3300053140 Bacteria 1407
661 Ga0500600_0074394 3300053149 Bacteria 1854
662 Ga0500600_0097981 3300053149 Bacteria 1552
663 Ga0500634_0100345 3300053161 Bacteria 1450

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300041496 Ga0451839_1355463 Ga0451839_1355463_20_859 256
2 3300046477 Ga0495664_0005397 Ga0495664_0005397_15_962 274
3 3300046689 Ga0495613_0052346 Ga0495613_0052346_15_962 274
4 3300025940 Ga0207691_10089552 Ga0207691_100895521 275
5 3300046454 Ga0495592_0004051 Ga0495592_0004051_2039_3022 286
6 3300046476 Ga0495662_0000592 Ga0495662_0000592_11836_12819 286
7 3300046517 Ga0495630_0017245 Ga0495630_0017245_3605_4588 286
8 3300046526 Ga0495666_0014181 Ga0495666_0014181_961_1944 286
9 3300046529 Ga0495652_0033905 Ga0495652_0033905_757_1740 286
10 3300046531 Ga0495665_0002822 Ga0495665_0002822_3785_4768 286
11 3300046535 Ga0495586_0017217 Ga0495586_0017217_2481_3464 286
12 3300046536 Ga0495587_0024290 Ga0495587_0024290_1247_2230 286
13 3300046642 Ga0495634_0039425 Ga0495634_0039425_352_1335 286
14 3300046663 Ga0495635_0048568 Ga0495635_0048568_982_1965 286
15 3300046680 Ga0495646_0008679 Ga0495646_0008679_3223_4206 286
16 3300047317 Ga0495604_0002310 Ga0495604_0002310_3042_4025 286
17 3300047319 Ga0495674_0034062 Ga0495674_0034062_1242_2225 286
18 3300053078 Ga0495612_0086781 Ga0495612_0086781_96_1079 286
19 3300053085 Ga0495619_0092619 Ga0495619_0092619_1041_2024 286
20 3300046463 Ga0495653_0029384 Ga0495653_0029384_2569_3585 297
21 3300046472 Ga0495580_0052614 Ga0495580_0052614_829_1845 297
22 3300046511 Ga0495608_0007002 Ga0495608_0007002_2423_3439 297
23 3300046514 Ga0495618_0094808 Ga0495618_0094808_308_1324 297
24 3300046533 Ga0495640_0007378 Ga0495640_0007378_319_1335 297
25 3300046559 Ga0495667_0022517 Ga0495667_0022517_2396_3412 297
26 3300046675 Ga0495657_0031722 Ga0495657_0031722_743_1759 297
27 3300046809 Ga0495600_0024191 Ga0495600_0024191_108_1124 297
28 3300047315 Ga0495581_0013956 Ga0495581_0013956_2968_3984 297
29 3300047673 Ga0495593_0019174 Ga0495593_0019174_1276_2292 297
30 3300048088 Ga0495602_0058724 Ga0495602_0058724_961_1977 297
31 3300031507 Ga0307509_10025474 Ga0307509_100254747 301
32 3300005293 Ga0065715_10157574 Ga0065715_101575741 308
33 3300005331 Ga0070670_100009939 Ga0070670_1000099395 308
34 3300044712 Ga0453684_0000045 Ga0453684_0000045_443215_444285 311
35 3300044765 Ga0466970_0041897 Ga0466970_0041897_1190_2251 313
36 3300045049 Ga0466959_0061500 Ga0466959_0061500_188_1249 313
37 3300047319 Ga0495674_0327923 Ga0495674_0327923_190_1224 315
38 3300005435 Ga0070714_100000468 Ga0070714_10000046822 316
39 3300025929 Ga0207664_10004432 Ga0207664_100044322 316
40 3300037466 Ga0395898_0041040 Ga0395898_0041040_1178_2206 316
41 iso_pu_bacteria 2515154155 2515854792 316
42 iso_pu_bacteria 2912757875 2912764013 316
43 iso_pu_bacteria 8025530807 8025533333 316
44 iso_pu_bacteria 2547132111 2547412287 317
45 iso_pu_bacteria 2554235005 2554260764 317
46 iso_pu_bacteria 2582581312 2585296966 317
47 iso_pu_bacteria 2582581313 2585304102 317
48 iso_pu_bacteria 2582581314 2585312095 317
49 iso_pu_bacteria 2616644814 2616698941 317
50 iso_pu_bacteria 2616644941 2616902441 317
51 iso_pu_bacteria 2643221578 2643904114 317
52 iso_pu_bacteria 2643221587 2643947173 317
53 iso_pu_bacteria 2643221601 2644016932 317
54 iso_pu_bacteria 2643221631 2644177760 317
55 iso_pu_bacteria 2643221647 2644263868 317
56 iso_pu_bacteria 2643221673 2644402469 317
57 iso_pu_bacteria 2643221677 2644433356 317
58 iso_pu_bacteria 2643221678 2644440955 317
59 iso_pu_bacteria 2643221714 2644632511 317
60 iso_pu_bacteria 2675903058 2676477308 317
61 iso_pu_bacteria 2784132148 2784591953 317
62 iso_pu_bacteria 2784746763 2785339761 317
63 iso_pu_bacteria 2784746768 2785373185 317
64 iso_pu_bacteria 2786546132 2786674819 317
65 iso_pu_bacteria 2795385470 2795780892 317
66 iso_pu_bacteria 2808606359 2808845322 317
67 iso_pu_bacteria 2808606375 2808915027 317
68 iso_pu_bacteria 2808606448 2809235591 317
69 iso_pu_bacteria 2808606982 2811842942 317
70 iso_pu_bacteria 2811994879 2812354387 317
71 iso_pu_bacteria 2811994917 2812477367 317
72 iso_pu_bacteria 2818991463 2819699551 317
73 iso_pu_bacteria 2818991472 2819746707 317
74 iso_pu_bacteria 2827628540 2827633714 317
75 iso_pu_bacteria 2852635781 2852636009 317
76 iso_pu_bacteria 2862178590 2862184219 317
77 iso_pu_bacteria 2862281513 2862283045 317
78 iso_pu_bacteria 2862290372 2862291841 317
79 iso_pu_bacteria 2862382967 2862384058 317
80 iso_pu_bacteria 2862574272 2862576183 317
81 iso_pu_bacteria 2863067949 2863070766 317
82 iso_pu_bacteria 2863404153 2863410262 317
83 iso_pu_bacteria 2867428634 2867436378 317
84 iso_pu_bacteria 2867475112 2867478734 317
85 iso_pu_bacteria 2873151551 2873152629 317
86 iso_pu_bacteria 2875391855 2875397412 317
87 iso_pu_bacteria 2877676314 2877677716 317
88 iso_pu_bacteria 2912715099 2912716007 317
89 iso_pu_bacteria 2912723979 2912728964 317
90 iso_pu_bacteria 2919468124 2919475175 317
91 iso_pu_bacteria 2935390628 2935393108 317
92 iso_pu_bacteria 2946045630 2946047102 317
93 iso_pu_bacteria 2946064051 2946071316 317
94 iso_pu_bacteria 2946072368 2946079153 317
95 iso_pu_bacteria 2947224130 2947225429 317
96 iso_pu_bacteria 2954002825 2954009643 317
97 iso_pu_bacteria 2954380949 2954382492 317
98 iso_pu_bacteria 2954673503 2954680583 317
99 iso_pu_bacteria 2954682443 2954683570 317
100 iso_pu_bacteria 2954691527 2954693293 317
101 iso_pu_bacteria 2954701450 2954708386 317
102 iso_pu_bacteria 2954711539 2954712970 317
103 iso_pu_bacteria 2954721474 2954722929 317
104 iso_pu_bacteria 2954731030 2954738901 317
105 iso_pu_bacteria 2954740390 2954741838 317
106 iso_pu_bacteria 2954749733 2954757758 317
107 iso_pu_bacteria 2954759201 2954760817 317
108 iso_pu_bacteria 2990059506 2990063377 317
109 iso_pu_bacteria 2995463766 2995465772 317
110 iso_pu_bacteria 2997451912 2997452316 317
111 iso_pu_bacteria 3006393351 3006396996 317
112 iso_pu_bacteria 3006486233 3006488136 317
113 iso_pu_bacteria 3006493962 3006494615 317
114 iso_pu_bacteria 8008558824 8008564258 317
115 iso_pu_bacteria 8008574985 8008575874 317
116 iso_pu_bacteria 8023623736 8023624231 317
117 iso_pu_bacteria 8025478263 8025484344 317
118 iso_pu_bacteria 8054160619 8054162635 317
119 iso_pu_bacteria 8056447290 8056447427 317
120 iso_pu_bacteria 8056829672 8056836106 317
121 3300038725 Ga0400484_42200 Ga0400484_42200_8575_9600 319
122 3300038726 Ga0400490_24841 Ga0400490_24841_601_1626 319
123 3300038741 Ga0400488_31331 Ga0400488_31331_679_1713 319
124 3300039062 Ga0400483_218673 Ga0400483_218673_11095_12120 319
125 3300039110 Ga0400487_05605 Ga0400487_05605_1986_3011 319
126 3300049822 Ga0501035_0008382 Ga0501035_0008382_334_1362 319
127 iso_pu_bacteria 2862507626 2862507641 319
128 iso_pu_bacteria 2918501144 2918501816 319
129 iso_pu_bacteria 8048406513 8048411904 319
130 3300005435 Ga0070714_100000377 Ga0070714_10000037718 320
131 3300005436 Ga0070713_100229447 Ga0070713_1002294472 320
132 3300005937 Ga0081455_10113915 Ga0081455_101139152 320
133 3300012503 Ga0157313_1002337 Ga0157313_10023371 320
134 3300025928 Ga0207700_10233759 Ga0207700_102337592 320
135 3300029957 Ga0265324_10008434 Ga0265324_100084343 320
136 3300037853 Ga0436364_1442308 Ga0436364_1442308_520_1545 320
137 3300038726 Ga0400490_05965 Ga0400490_05965_2270_3307 320
138 3300039110 Ga0400487_27158 Ga0400487_27158_1299_2336 320
139 3300049572 Ga0501036_0003633 Ga0501036_0003633_5202_6230 320
140 3300001990 JGI24737J22298_10012771 JGI24737J22298_100127713 321
141 3300003316 rootH1_10029222 rootH1_100292222 321
142 3300003322 rootL2_10042722 rootL2_100427225 321
143 3300003354 JGI25160J50197_1003960 JGI25160J50197_10039602 321
144 3300003578 Ga0006562J51391_1071585 Ga0006562J51391_10715855 321
145 3300003578 Ga0006562J51391_1071588 Ga0006562J51391_10715882 321
146 3300005327 Ga0070658_10000254 Ga0070658_100002546 321
147 3300005329 Ga0070683_100000609 Ga0070683_10000060924 321
148 3300005329 Ga0070683_100094264 Ga0070683_1000942642 321
149 3300005331 Ga0070670_100123104 Ga0070670_1001231042 321
150 3300005331 Ga0070670_100127535 Ga0070670_1001275352 321
151 3300005334 Ga0068869_100015677 Ga0068869_1000156773 321
152 3300005337 Ga0070682_100106736 Ga0070682_1001067361 321
153 3300005340 Ga0070689_100021197 Ga0070689_1000211973 321
154 3300005341 Ga0070691_10011804 Ga0070691_100118043 321
155 3300005344 Ga0070661_100077066 Ga0070661_1000770662 321
156 3300005354 Ga0070675_100408284 Ga0070675_1004082841 321
157 3300005356 Ga0070674_100159345 Ga0070674_1001593451 321
158 3300005365 Ga0070688_100149419 Ga0070688_1001494191 321
159 3300005435 Ga0070714_100022363 Ga0070714_1000223633 321
160 3300005435 Ga0070714_100026140 Ga0070714_1000261404 321
161 3300005435 Ga0070714_100070095 Ga0070714_1000700952 321
162 3300005436 Ga0070713_100003967 Ga0070713_1000039674 321
163 3300005437 Ga0070710_10000005 Ga0070710_10000005149 321
164 3300005437 Ga0070710_10084391 Ga0070710_100843912 321
165 3300005437 Ga0070710_10086350 Ga0070710_100863502 321
166 3300005439 Ga0070711_100023293 Ga0070711_1000232932 321
167 3300005445 Ga0070708_100021157 Ga0070708_1000211574 321
168 3300005445 Ga0070708_100052316 Ga0070708_1000523163 321
169 3300005445 Ga0070708_100452080 Ga0070708_1004520802 321
170 3300005456 Ga0070678_100008415 Ga0070678_1000084152 321
171 3300005458 Ga0070681_10000034 Ga0070681_1000003422 321
172 3300005458 Ga0070681_10005337 Ga0070681_100053376 321
173 3300005458 Ga0070681_10217262 Ga0070681_102172622 321
174 3300005466 Ga0070685_10244742 Ga0070685_102447421 321
175 3300005467 Ga0070706_100003390 Ga0070706_1000033908 321
176 3300005467 Ga0070706_100013961 Ga0070706_1000139614 321
177 3300005467 Ga0070706_100016021 Ga0070706_1000160211 321
178 3300005467 Ga0070706_100046674 Ga0070706_1000466743 321
179 3300005467 Ga0070706_100087688 Ga0070706_1000876881 321
180 3300005468 Ga0070707_100002696 Ga0070707_1000026968 321
181 3300005468 Ga0070707_100002739 Ga0070707_1000027397 321
182 3300005468 Ga0070707_100005643 Ga0070707_1000056438 321
183 3300005468 Ga0070707_100037090 Ga0070707_1000370902 321
184 3300005468 Ga0070707_100043064 Ga0070707_1000430645 321
185 3300005471 Ga0070698_100005256 Ga0070698_1000052566 321
186 3300005471 Ga0070698_100153898 Ga0070698_1001538982 321
187 3300005518 Ga0070699_100206465 Ga0070699_1002064652 321
188 3300005530 Ga0070679_100000270 Ga0070679_10000027023 321
189 3300005530 Ga0070679_100037284 Ga0070679_1000372843 321
190 3300005530 Ga0070679_100209390 Ga0070679_1002093901 321
191 3300005535 Ga0070684_100000132 Ga0070684_1000001324 321
192 3300005535 Ga0070684_100024493 Ga0070684_1000244933 321
193 3300005535 Ga0070684_100064458 Ga0070684_1000644584 321
194 3300005535 Ga0070684_100134280 Ga0070684_1001342802 321
195 3300005539 Ga0068853_100000551 Ga0068853_1000005512 321
196 3300005539 Ga0068853_100008839 Ga0068853_10000883911 321
197 3300005539 Ga0068853_100197230 Ga0068853_1001972302 321
198 3300005563 Ga0068855_100000414 Ga0068855_10000041419 321
199 3300005563 Ga0068855_100024619 Ga0068855_1000246193 321
200 3300005563 Ga0068855_100140150 Ga0068855_1001401502 321
201 3300005564 Ga0070664_100026447 Ga0070664_1000264473 321
202 3300005564 Ga0070664_100270112 Ga0070664_1002701122 321
203 3300005577 Ga0068857_100000178 Ga0068857_1000001788 321
204 3300005577 Ga0068857_100002576 Ga0068857_10000257610 321
205 3300005578 Ga0068854_100020542 Ga0068854_1000205423 321
206 3300005614 Ga0068856_100000541 Ga0068856_10000054132 321
207 3300005614 Ga0068856_100004114 Ga0068856_1000041148 321
208 3300005614 Ga0068856_100063338 Ga0068856_1000633382 321
209 3300005615 Ga0070702_100005174 Ga0070702_1000051744 321
210 3300005616 Ga0068852_100000641 Ga0068852_10000064115 321
211 3300005616 Ga0068852_100199729 Ga0068852_1001997292 321
212 3300005617 Ga0068859_100050634 Ga0068859_1000506345 321
213 3300005618 Ga0068864_100081054 Ga0068864_1000810542 321
214 3300005618 Ga0068864_100091894 Ga0068864_1000918942 321
215 3300005718 Ga0068866_10008160 Ga0068866_100081604 321
216 3300005842 Ga0068858_100059316 Ga0068858_1000593162 321
217 3300005843 Ga0068860_100023387 Ga0068860_1000233872 321
218 3300006028 Ga0070717_10000001 Ga0070717_10000001340 321
219 3300006028 Ga0070717_10005944 Ga0070717_100059447 321
220 3300006028 Ga0070717_10008670 Ga0070717_100086706 321
221 3300006028 Ga0070717_10018740 Ga0070717_100187404 321
222 3300006042 Ga0075368_10011022 Ga0075368_100110224 321
223 3300006048 Ga0075363_100013598 Ga0075363_1000135984 321
224 3300006163 Ga0070715_10040245 Ga0070715_100402452 321
225 3300006175 Ga0070712_100080623 Ga0070712_1000806232 321
226 3300006175 Ga0070712_100183374 Ga0070712_1001833742 321
227 3300006178 Ga0075367_10000715 Ga0075367_100007156 321
228 3300006237 Ga0097621_100000014 Ga0097621_1000000146 321
229 3300006237 Ga0097621_100004781 Ga0097621_1000047817 321
230 3300006358 Ga0068871_100001973 Ga0068871_1000019735 321
231 3300006852 Ga0075433_10064999 Ga0075433_100649992 321
232 3300006871 Ga0075434_100006102 Ga0075434_1000061029 321
233 3300006914 Ga0075436_100002055 Ga0075436_1000020557 321
234 3300006914 Ga0075436_100004446 Ga0075436_10000444611 321
235 3300006931 Ga0097620_100050643 Ga0097620_1000506435 321
236 3300006931 Ga0097620_100210867 Ga0097620_1002108672 321
237 3300006948 Ga0099826_10110194 Ga0099826_101101942 321
238 3300007076 Ga0075435_100051451 Ga0075435_1000514514 321
239 3300007076 Ga0075435_100065475 Ga0075435_1000654752 321
240 3300007265 Ga0099794_10065577 Ga0099794_100655772 321
241 3300009093 Ga0105240_10090665 Ga0105240_100906654 321
242 3300009093 Ga0105240_10102318 Ga0105240_101023182 321
243 3300009093 Ga0105240_10108702 Ga0105240_101087022 321
244 3300009093 Ga0105240_10131752 Ga0105240_101317522 321
245 3300009093 Ga0105240_10188710 Ga0105240_101887106 321
246 3300009093 Ga0105240_10229568 Ga0105240_102295683 321
247 3300009094 Ga0111539_10052868 Ga0111539_100528682 321
248 3300009098 Ga0105245_10013643 Ga0105245_100136436 321
249 3300009098 Ga0105245_10050134 Ga0105245_100501342 321
250 3300009101 Ga0105247_10019731 Ga0105247_100197314 321
251 3300009147 Ga0114129_10273754 Ga0114129_102737542 321
252 3300009148 Ga0105243_10042551 Ga0105243_100425513 321
253 3300009174 Ga0105241_10003085 Ga0105241_100030852 321
254 3300009174 Ga0105241_10007013 Ga0105241_100070139 321
255 3300009174 Ga0105241_10061137 Ga0105241_100611372 321
256 3300009174 Ga0105241_10268923 Ga0105241_102689232 321
257 3300009176 Ga0105242_10018518 Ga0105242_100185182 321
258 3300009177 Ga0105248_10030353 Ga0105248_100303534 321
259 3300009545 Ga0105237_10011061 Ga0105237_100110619 321
260 3300009545 Ga0105237_10035387 Ga0105237_100353874 321
261 3300009545 Ga0105237_10060977 Ga0105237_100609772 321
262 3300009551 Ga0105238_10000099 Ga0105238_100000994 321
263 3300009551 Ga0105238_10004170 Ga0105238_1000417010 321
264 3300009551 Ga0105238_10064232 Ga0105238_100642323 321
265 3300009553 Ga0105249_10307208 Ga0105249_103072081 321
266 3300010375 Ga0105239_10020990 Ga0105239_100209902 321
267 3300010375 Ga0105239_10050797 Ga0105239_100507973 321
268 3300010375 Ga0105239_10280370 Ga0105239_102803703 321
269 3300013105 Ga0157369_10000042 Ga0157369_1000004278 321
270 3300013105 Ga0157369_10006793 Ga0157369_100067938 321
271 3300013105 Ga0157369_10011777 Ga0157369_100117772 321
272 3300013105 Ga0157369_10022583 Ga0157369_100225833 321
273 3300013105 Ga0157369_10052608 Ga0157369_100526085 321
274 3300013105 Ga0157369_10071211 Ga0157369_100712112 321
275 3300013297 Ga0157378_10003197 Ga0157378_100031975 321
276 3300013297 Ga0157378_10011532 Ga0157378_100115324 321
277 3300013306 Ga0163162_10173466 Ga0163162_101734662 321
278 3300013306 Ga0163162_10208372 Ga0163162_102083722 321
279 3300013307 Ga0157372_10003621 Ga0157372_100036213 321
280 3300013307 Ga0157372_10018475 Ga0157372_100184756 321
281 3300013307 Ga0157372_10053080 Ga0157372_100530803 321
282 3300013307 Ga0157372_10085747 Ga0157372_100857472 321
283 3300013307 Ga0157372_10122034 Ga0157372_101220343 321
284 3300013307 Ga0157372_10149382 Ga0157372_101493822 321
285 3300013307 Ga0157372_10435565 Ga0157372_104355652 321
286 3300013307 Ga0157372_10461069 Ga0157372_104610691 321
287 3300013307 Ga0157372_10629394 Ga0157372_106293941 321
288 3300013308 Ga0157375_10176918 Ga0157375_101769182 321
289 3300013308 Ga0157375_10239914 Ga0157375_102399142 321
290 3300013308 Ga0157375_10440818 Ga0157375_104408182 321
291 3300014326 Ga0157380_10243156 Ga0157380_102431561 321
292 3300014326 Ga0157380_10419080 Ga0157380_104190801 321
293 3300014497 Ga0182008_10004052 Ga0182008_1000405210 321
294 3300014968 Ga0157379_10003200 Ga0157379_1000320012 321
295 3300014969 Ga0157376_10009682 Ga0157376_100096825 321
296 3300014969 Ga0157376_10019952 Ga0157376_100199524 321
297 3300014969 Ga0157376_10067977 Ga0157376_100679772 321
298 3300014969 Ga0157376_10470705 Ga0157376_104707052 321
299 3300015262 Ga0182007_10001956 Ga0182007_100019569 321
300 3300015688 Ga0183367_1001 Ga0183367_1001906 321
301 3300017792 Ga0163161_10001814 Ga0163161_100018143 321
302 3300022467 Ga0224712_10009523 Ga0224712_100095232 321
303 3300022467 Ga0224712_10013952 Ga0224712_100139522 321
304 3300025297 Ga0209758_1006936 Ga0209758_10069367 321
305 3300025302 Ga0207426_1006931 Ga0207426_10069312 321
306 3300025302 Ga0207426_1016694 Ga0207426_10166942 321
307 3300025302 Ga0207426_1023614 Ga0207426_10236142 321
308 3300025898 Ga0207692_10000003 Ga0207692_10000003420 321
309 3300025898 Ga0207692_10032641 Ga0207692_100326412 321
310 3300025899 Ga0207642_10022607 Ga0207642_100226072 321
311 3300025900 Ga0207710_10003720 Ga0207710_100037202 321
312 3300025909 Ga0207705_10035200 Ga0207705_100352003 321
313 3300025910 Ga0207684_10003467 Ga0207684_100034675 321
314 3300025910 Ga0207684_10026271 Ga0207684_100262713 321
315 3300025910 Ga0207684_10073766 Ga0207684_100737662 321
316 3300025910 Ga0207684_10136900 Ga0207684_101369002 321
317 3300025910 Ga0207684_10376186 Ga0207684_103761861 321
318 3300025911 Ga0207654_10000890 Ga0207654_100008902 321
319 3300025911 Ga0207654_10008960 Ga0207654_100089604 321
320 3300025911 Ga0207654_10202920 Ga0207654_102029201 321
321 3300025912 Ga0207707_10000891 Ga0207707_1000089118 321
322 3300025912 Ga0207707_10213260 Ga0207707_102132601 321
323 3300025913 Ga0207695_10001825 Ga0207695_1000182517 321
324 3300025913 Ga0207695_10133720 Ga0207695_101337203 321
325 3300025913 Ga0207695_10159707 Ga0207695_101597072 321
326 3300025914 Ga0207671_10001322 Ga0207671_100013223 321
327 3300025914 Ga0207671_10020313 Ga0207671_100203135 321
328 3300025914 Ga0207671_10244021 Ga0207671_102440211 321
329 3300025916 Ga0207663_10077450 Ga0207663_100774501 321
330 3300025919 Ga0207657_10186137 Ga0207657_101861371 321
331 3300025920 Ga0207649_10010711 Ga0207649_100107112 321
332 3300025921 Ga0207652_10001281 Ga0207652_1000128116 321
333 3300025921 Ga0207652_10284455 Ga0207652_102844552 321
334 3300025921 Ga0207652_10328715 Ga0207652_103287151 321
335 3300025922 Ga0207646_10001004 Ga0207646_1000100432 321
336 3300025922 Ga0207646_10005717 Ga0207646_100057175 321
337 3300025922 Ga0207646_10007233 Ga0207646_100072331 321
338 3300025922 Ga0207646_10071491 Ga0207646_100714912 321
339 3300025922 Ga0207646_10154381 Ga0207646_101543811 321
340 3300025924 Ga0207694_10000745 Ga0207694_100007458 321
341 3300025924 Ga0207694_10000936 Ga0207694_1000093623 321
342 3300025925 Ga0207650_10086270 Ga0207650_100862702 321
343 3300025925 Ga0207650_10087307 Ga0207650_100873072 321
344 3300025925 Ga0207650_10313326 Ga0207650_103133261 321
345 3300025927 Ga0207687_10030070 Ga0207687_100300703 321
346 3300025927 Ga0207687_10047069 Ga0207687_100470692 321
347 3300025928 Ga0207700_10022195 Ga0207700_100221954 321
348 3300025928 Ga0207700_10158681 Ga0207700_101586812 321
349 3300025928 Ga0207700_10165434 Ga0207700_101654341 321
350 3300025929 Ga0207664_10011778 Ga0207664_100117786 321
351 3300025929 Ga0207664_10014836 Ga0207664_100148363 321
352 3300025929 Ga0207664_10025013 Ga0207664_100250134 321
353 3300025929 Ga0207664_10261785 Ga0207664_102617852 321
354 3300025934 Ga0207686_10012449 Ga0207686_100124492 321
355 3300025935 Ga0207709_10031284 Ga0207709_100312842 321
356 3300025936 Ga0207670_10074270 Ga0207670_100742702 321
357 3300025937 Ga0207669_10011581 Ga0207669_100115815 321
358 3300025939 Ga0207665_10017771 Ga0207665_100177712 321
359 3300025944 Ga0207661_10002130 Ga0207661_100021308 321
360 3300025945 Ga0207679_10015776 Ga0207679_100157763 321
361 3300025945 Ga0207679_10048689 Ga0207679_100486893 321
362 3300025945 Ga0207679_10184517 Ga0207679_101845172 321
363 3300025949 Ga0207667_10000535 Ga0207667_1000053523 321
364 3300025949 Ga0207667_10001693 Ga0207667_1000169315 321
365 3300025949 Ga0207667_10147097 Ga0207667_101470973 321
366 3300025961 Ga0207712_10036119 Ga0207712_100361192 321
367 3300025961 Ga0207712_10246497 Ga0207712_102464972 321
368 3300025981 Ga0207640_10004910 Ga0207640_100049105 321
369 3300026023 Ga0207677_10022394 Ga0207677_100223943 321
370 3300026035 Ga0207703_10060165 Ga0207703_100601652 321
371 3300026035 Ga0207703_10268220 Ga0207703_102682202 321
372 3300026041 Ga0207639_10000531 Ga0207639_100005312 321
373 3300026041 Ga0207639_10153390 Ga0207639_101533902 321
374 3300026078 Ga0207702_10001271 Ga0207702_100012718 321
375 3300026078 Ga0207702_10008594 Ga0207702_100085942 321
376 3300026078 Ga0207702_10011794 Ga0207702_100117948 321
377 3300026078 Ga0207702_10083303 Ga0207702_100833033 321
378 3300026088 Ga0207641_10478165 Ga0207641_104781652 321
379 3300026116 Ga0207674_10000157 Ga0207674_1000015771 321
380 3300026118 Ga0207675_100397484 Ga0207675_1003974841 321
381 3300026121 Ga0207683_10000257 Ga0207683_1000025719 321
382 3300026142 Ga0207698_10000319 Ga0207698_1000031914 321
383 3300026142 Ga0207698_10097004 Ga0207698_100970041 321
384 3300027666 Ga0209282_1100217 Ga0209282_11002172 321
385 3300027866 Ga0209813_10013124 Ga0209813_100131242 321
386 3300028381 Ga0268264_10005209 Ga0268264_100052098 321
387 3300028563 Ga0265319_1031551 Ga0265319_10315512 321
388 3300028786 Ga0307517_10025660 Ga0307517_100256608 321
389 3300028794 Ga0307515_10000287 Ga0307515_1000028751 321
390 3300028794 Ga0307515_10028816 Ga0307515_100288167 321
391 3300028794 Ga0307515_10089178 Ga0307515_100891784 321
392 3300028794 Ga0307515_10223615 Ga0307515_102236152 321
393 3300028800 Ga0265338_10035020 Ga0265338_100350204 321
394 3300030521 Ga0307511_10001720 Ga0307511_1000172012 321
395 3300030521 Ga0307511_10026702 Ga0307511_100267025 321
396 3300030521 Ga0307511_10035848 Ga0307511_100358486 321
397 3300030521 Ga0307511_10049182 Ga0307511_100491823 321
398 3300030522 Ga0307512_10005793 Ga0307512_100057939 321
399 3300030522 Ga0307512_10024136 Ga0307512_100241367 321
400 3300031240 Ga0265320_10044366 Ga0265320_100443662 321
401 3300031241 Ga0265325_10017986 Ga0265325_100179863 321
402 3300031247 Ga0265340_10003313 Ga0265340_100033133 321
403 3300031249 Ga0265339_10016133 Ga0265339_100161334 321
404 3300031456 Ga0307513_10028756 Ga0307513_100287562 321
405 3300031456 Ga0307513_10346281 Ga0307513_103462812 321
406 3300031548 Ga0307408_100023575 Ga0307408_1000235755 321
407 3300031616 Ga0307508_10037588 Ga0307508_100375882 321
408 3300031616 Ga0307508_10235180 Ga0307508_102351802 321
409 3300031649 Ga0307514_10012027 Ga0307514_100120272 321
410 3300031712 Ga0265342_10019358 Ga0265342_100193584 321
411 3300031727 Ga0316576_10052009 Ga0316576_100520093 321
412 3300031730 Ga0307516_10032499 Ga0307516_100324995 321
413 3300031730 Ga0307516_10042401 Ga0307516_100424015 321
414 3300031731 Ga0307405_10003908 Ga0307405_100039086 321
415 3300031733 Ga0316577_10060846 Ga0316577_100608461 321
416 3300031733 Ga0316577_10061419 Ga0316577_100614192 321
417 3300031824 Ga0307413_10001470 Ga0307413_100014709 321
418 3300031824 Ga0307413_10013839 Ga0307413_100138395 321
419 3300031838 Ga0307518_10069369 Ga0307518_100693692 321
420 3300031852 Ga0307410_10000352 Ga0307410_1000035210 321
421 3300031852 Ga0307410_10002093 Ga0307410_100020933 321
422 3300031852 Ga0307410_10306656 Ga0307410_103066561 321
423 3300031901 Ga0307406_10072546 Ga0307406_100725462 321
424 3300031901 Ga0307406_10108324 Ga0307406_101083242 321
425 3300031903 Ga0307407_10049140 Ga0307407_100491403 321
426 3300031903 Ga0307407_10088068 Ga0307407_100880682 321
427 3300031911 Ga0307412_10007170 Ga0307412_100071708 321
428 3300031911 Ga0307412_10008106 Ga0307412_100081062 321
429 3300031911 Ga0307412_10017502 Ga0307412_100175023 321
430 3300031995 Ga0307409_100002421 Ga0307409_1000024215 321
431 3300031995 Ga0307409_100003377 Ga0307409_10000337711 321
432 3300031995 Ga0307409_100017832 Ga0307409_1000178321 321
433 3300031995 Ga0307409_100019649 Ga0307409_1000196493 321
434 3300032002 Ga0307416_100015076 Ga0307416_1000150763 321
435 3300032002 Ga0307416_100040667 Ga0307416_1000406672 321
436 3300032002 Ga0307416_100237284 Ga0307416_1002372842 321
437 3300032004 Ga0307414_10025594 Ga0307414_100255944 321
438 3300032004 Ga0307414_10161847 Ga0307414_101618472 321
439 3300032005 Ga0307411_10002733 Ga0307411_100027337 321
440 3300032005 Ga0307411_10014107 Ga0307411_100141073 321
441 3300032005 Ga0307411_10390621 Ga0307411_103906211 321
442 3300032126 Ga0307415_100006574 Ga0307415_1000065743 321
443 3300032126 Ga0307415_100007489 Ga0307415_1000074893 321
444 3300032137 Ga0316585_10028916 Ga0316585_100289162 321
445 3300033179 Ga0307507_10010287 Ga0307507_1001028712 321
446 3300033179 Ga0307507_10019151 Ga0307507_100191519 321
447 3300033180 Ga0307510_10000644 Ga0307510_1000064427 321
448 3300035083 Ga0373926_0001784 Ga0373926_0001784_487_1518 321
449 3300035118 Ga0373954_0039189 Ga0373954_0039189_611_1645 321
450 3300035118 Ga0373954_0042239 Ga0373954_0042239_156_1193 321
451 3300035118 Ga0373954_0042753 Ga0373954_0042753_1057_2088 321
452 3300035119 Ga0373956_0017063 Ga0373956_0017063_1074_2117 321
453 3300035119 Ga0373956_0029030 Ga0373956_0029030_1236_2267 321
454 3300035120 Ga0373957_0081256 Ga0373957_0081256_159_1208 321
455 3300035172 Ga0373955_0009399 Ga0373955_0009399_760_1791 321
456 3300035410 Ga0373924_0004127 Ga0373924_0004127_3953_4996 321
457 3300035410 Ga0373924_0038744 Ga0373924_0038744_850_1881 321
458 3300035692 Ga0373935_0000094 Ga0373935_0000094_4478_5509 321
459 3300035724 Ga0373933_0032693 Ga0373933_0032693_201_1232 321
460 3300035725 Ga0373947_0000011 Ga0373947_0000011_152245_153276 321
461 3300035725 Ga0373947_0183480 Ga0373947_0183480_127_1170 321
462 3300036401 Ga0373937_0020699 Ga0373937_0020699_3461_4522 321
463 3300036401 Ga0373937_0068561 Ga0373937_0068561_852_1895 321
464 3300036401 Ga0373937_0088064 Ga0373937_0088064_1692_2723 321
465 3300036647 Ga0316582_0092835 Ga0316582_0092835_294_1325 321
466 3300036712 Ga0316584_0006850 Ga0316584_0006850_4491_5522 321
467 3300036712 Ga0316584_0056615 Ga0316584_0056615_1832_2872 321
468 3300037418 Ga0395900_0424995 Ga0395900_0424995_201_1229 321
469 3300037466 Ga0395898_0022337 Ga0395898_0022337_4088_5116 321
470 3300037471 Ga0395905_0163487 Ga0395905_0163487_737_1765 321
471 3300038443 Ga0395901_0246940 Ga0395901_0246940_600_1628 321
472 3300041404 Ga0439436_0007626 Ga0439436_0007626_301_1329 321
473 3300041406 Ga0439439_0000566 Ga0439439_0000566_4533_5561 321
474 3300041406 Ga0439439_0006105 Ga0439439_0006105_159_1193 321
475 3300041451 Ga0451791_0161359 Ga0451791_0161359_481_1509 321
476 3300041999 Ga0439433_0001912 Ga0439433_0001912_262_1290 321
477 3300042005 Ga0439448_0010688 Ga0439448_0010688_197_1225 321
478 3300042007 Ga0439449_0000174 Ga0439449_0000174_9791_10819 321
479 3300042007 Ga0439449_0039242 Ga0439449_0039242_38_1066 321
480 3300042012 Ga0439455_0004473 Ga0439455_0004473_370_1398 321
481 3300042014 Ga0439457_001137 Ga0439457_001137_3207_4241 321
482 3300042014 Ga0439457_001725 Ga0439457_001725_2473_3501 321
483 3300042131 Ga0450894_002160 Ga0450894_002160_1200_2228 321
484 3300042133 Ga0450896_000923 Ga0450896_000923_1334_2362 321
485 3300042135 Ga0450899_000712 Ga0450899_000712_2619_3647 321
486 3300042138 Ga0450903_001042 Ga0450903_001042_453_1481 321
487 3300042157 Ga0439458_0001351 Ga0439458_0001351_2842_3870 321
488 3300042876 Ga0451577_0230952 Ga0451577_0230952_49_1080 321
489 3300044656 Ga0466969_0025351 Ga0466969_0025351_1224_2291 321
490 3300044656 Ga0466969_0043086 Ga0466969_0043086_153_1181 321
491 3300044656 Ga0466969_0060287 Ga0466969_0060287_672_1739 321
492 3300044658 Ga0466972_0008641 Ga0466972_0008641_3766_4794 321
493 3300044658 Ga0466972_0083628 Ga0466972_0083628_77_1105 321
494 3300044658 Ga0466972_0098991 Ga0466972_0098991_119_1147 321
495 3300044683 Ga0466965_0174065 Ga0466965_0174065_45_1073 321
496 3300044684 Ga0466966_0053212 Ga0466966_0053212_1117_2184 321
497 3300044684 Ga0466966_0120758 Ga0466966_0120758_335_1402 321
498 3300044693 Ga0466961_0027528 Ga0466961_0027528_1955_3022 321
499 3300044694 Ga0466963_0010310 Ga0466963_0010310_469_1497 321
500 3300044694 Ga0466963_0031124 Ga0466963_0031124_2405_3433 321
501 3300044694 Ga0466963_0112519 Ga0466963_0112519_450_1478 321
502 3300044706 Ga0466964_0013638 Ga0466964_0013638_1580_2608 321
503 3300044765 Ga0466970_0007115 Ga0466970_0007115_2729_3757 321
504 3300044765 Ga0466970_0009315 Ga0466970_0009315_1926_2993 321
505 3300044765 Ga0466970_0109727 Ga0466970_0109727_342_1370 321
506 3300044842 Ga0466957_0161065 Ga0466957_0161065_244_1272 321
507 3300044901 Ga0466960_0008493 Ga0466960_0008493_707_1735 321
508 3300045049 Ga0466959_0002626 Ga0466959_0002626_8622_9689 321
509 3300045049 Ga0466959_0012597 Ga0466959_0012597_4747_5790 321
510 3300045836 Ga0466958_0070297 Ga0466958_0070297_366_1394 321
511 3300045976 Ga0466967_0124248 Ga0466967_0124248_871_1899 321
512 3300045976 Ga0466967_0244556 Ga0466967_0244556_149_1177 321
513 3300046452 Ga0495617_007022 Ga0495617_007022_1188_2216 321
514 3300046453 Ga0495627_033301 Ga0495627_033301_321_1349 321
515 3300046453 Ga0495627_051779 Ga0495627_051779_58_1107 321
516 3300046454 Ga0495592_0022978 Ga0495592_0022978_2831_3865 321
517 3300046454 Ga0495592_0026097 Ga0495592_0026097_2713_3741 321
518 3300046454 Ga0495592_0041037 Ga0495592_0041037_1444_2472 321
519 3300046455 Ga0495603_0014958 Ga0495603_0014958_2827_3855 321
520 3300046455 Ga0495603_0110149 Ga0495603_0110149_521_1549 321
521 3300046459 Ga0495629_0001877 Ga0495629_0001877_570_1598 321
522 3300046459 Ga0495629_0002031 Ga0495629_0002031_333_1361 321
523 3300046459 Ga0495629_0003393 Ga0495629_0003393_5220_6248 321
524 3300046459 Ga0495629_0028925 Ga0495629_0028925_554_1582 321
525 3300046459 Ga0495629_0068281 Ga0495629_0068281_765_1799 321
526 3300046459 Ga0495629_0120839 Ga0495629_0120839_144_1193 321
527 3300046459 Ga0495629_0210073 Ga0495629_0210073_277_1305 321
528 3300046460 Ga0495638_0094084 Ga0495638_0094084_312_1340 321
529 3300046462 Ga0495651_0002330 Ga0495651_0002330_9809_10840 321
530 3300046462 Ga0495651_0003385 Ga0495651_0003385_3170_4204 321
531 3300046462 Ga0495651_0012853 Ga0495651_0012853_3459_4487 321
532 3300046462 Ga0495651_0201905 Ga0495651_0201905_300_1361 321
533 3300046463 Ga0495653_0040822 Ga0495653_0040822_957_1988 321
534 3300046473 Ga0495582_0129856 Ga0495582_0129856_356_1399 321
535 3300046474 Ga0495605_0017442 Ga0495605_0017442_317_1345 321
536 3300046475 Ga0495639_0023359 Ga0495639_0023359_396_1424 321
537 3300046476 Ga0495662_0000436 Ga0495662_0000436_3001_4035 321
538 3300046476 Ga0495662_0007753 Ga0495662_0007753_3352_4380 321
539 3300046476 Ga0495662_0103287 Ga0495662_0103287_18_1046 321
540 3300046476 Ga0495662_0124039 Ga0495662_0124039_201_1244 321
541 3300046477 Ga0495664_0003142 Ga0495664_0003142_3699_4742 321
542 3300046477 Ga0495664_0007847 Ga0495664_0007847_1687_2721 321
543 3300046477 Ga0495664_0047667 Ga0495664_0047667_643_1671 321
544 3300046499 Ga0495594_0000282 Ga0495594_0000282_20563_21591 321
545 3300046499 Ga0495594_0046474 Ga0495594_0046474_1214_2242 321
546 3300046499 Ga0495594_0050080 Ga0495594_0050080_1108_2136 321
547 3300046499 Ga0495594_0055983 Ga0495594_0055983_652_1680 321
548 3300046499 Ga0495594_0079025 Ga0495594_0079025_647_1681 321
549 3300046507 Ga0495606_0004135 Ga0495606_0004135_11668_12696 321
550 3300046511 Ga0495608_0145243 Ga0495608_0145243_471_1499 321
551 3300046513 Ga0495616_0014269 Ga0495616_0014269_1332_2360 321
552 3300046514 Ga0495618_0090725 Ga0495618_0090725_327_1355 321
553 3300046516 Ga0495628_0044011 Ga0495628_0044011_290_1318 321
554 3300046516 Ga0495628_0062553 Ga0495628_0062553_561_1595 321
555 3300046516 Ga0495628_0078572 Ga0495628_0078572_1451_2479 321
556 3300046516 Ga0495628_0331253 Ga0495628_0331253_67_1098 321
557 3300046517 Ga0495630_0030227 Ga0495630_0030227_113_1147 321
558 3300046517 Ga0495630_0111220 Ga0495630_0111220_459_1496 321
559 3300046518 Ga0495631_0018611 Ga0495631_0018611_2221_3249 321
560 3300046522 Ga0495643_0074567 Ga0495643_0074567_217_1245 321
561 3300046524 Ga0495648_0037243 Ga0495648_0037243_1420_2448 321
562 3300046526 Ga0495666_0019026 Ga0495666_0019026_424_1452 321
563 3300046529 Ga0495652_0043080 Ga0495652_0043080_1532_2563 321
564 3300046529 Ga0495652_0085304 Ga0495652_0085304_225_1253 321
565 3300046529 Ga0495652_0133309 Ga0495652_0133309_294_1322 321
566 3300046529 Ga0495652_0141861 Ga0495652_0141861_567_1610 321
567 3300046531 Ga0495665_0049993 Ga0495665_0049993_1066_2109 321
568 3300046531 Ga0495665_0090567 Ga0495665_0090567_355_1383 321
569 3300046533 Ga0495640_0003158 Ga0495640_0003158_10291_11319 321
570 3300046533 Ga0495640_0005478 Ga0495640_0005478_992_2020 321
571 3300046533 Ga0495640_0062298 Ga0495640_0062298_1242_2276 321
572 3300046535 Ga0495586_0029203 Ga0495586_0029203_1758_2801 321
573 3300046536 Ga0495587_0007220 Ga0495587_0007220_680_1714 321
574 3300046536 Ga0495587_0063726 Ga0495587_0063726_312_1343 321
575 3300046536 Ga0495587_0073214 Ga0495587_0073214_381_1424 321
576 3300046538 Ga0495609_0025039 Ga0495609_0025039_219_1247 321
577 3300046542 Ga0495597_0023558 Ga0495597_0023558_388_1416 321
578 3300046543 Ga0495645_0033582 Ga0495645_0033582_523_1551 321
579 3300046557 Ga0495622_0052319 Ga0495622_0052319_30_1058 321
580 3300046558 Ga0495633_0010944 Ga0495633_0010944_2143_3171 321
581 3300046559 Ga0495667_0006232 Ga0495667_0006232_5883_6914 321
582 3300046559 Ga0495667_0042645 Ga0495667_0042645_1372_2400 321
583 3300046616 Ga0495668_0019922 Ga0495668_0019922_1732_2763 321
584 3300046642 Ga0495634_0005624 Ga0495634_0005624_3679_4713 321
585 3300046642 Ga0495634_0016321 Ga0495634_0016321_830_1858 321
586 3300046642 Ga0495634_0042581 Ga0495634_0042581_852_1895 321
587 3300046642 Ga0495634_0107489 Ga0495634_0107489_295_1338 321
588 3300046660 Ga0495625_0031265 Ga0495625_0031265_760_1791 321
589 3300046660 Ga0495625_0042721 Ga0495625_0042721_2033_3061 321
590 3300046660 Ga0495625_0061899 Ga0495625_0061899_1300_2328 321
591 3300046663 Ga0495635_0019232 Ga0495635_0019232_2257_3291 321
592 3300046665 Ga0495661_0029268 Ga0495661_0029268_2428_3456 321
593 3300046674 Ga0495588_0000819 Ga0495588_0000819_1173_2201 321
594 3300046674 Ga0495588_0133260 Ga0495588_0133260_42_1076 321
595 3300046675 Ga0495657_0007036 Ga0495657_0007036_5933_6964 321
596 3300046675 Ga0495657_0010436 Ga0495657_0010436_2038_3066 321
597 3300046675 Ga0495657_0018875 Ga0495657_0018875_2363_3397 321
598 3300046675 Ga0495657_0034607 Ga0495657_0034607_1232_2260 321
599 3300046678 Ga0495599_0023244 Ga0495599_0023244_1958_3001 321
600 3300046678 Ga0495599_0047234 Ga0495599_0047234_223_1254 321
601 3300046678 Ga0495599_0125134 Ga0495599_0125134_249_1277 321
602 3300046679 Ga0495623_0008819 Ga0495623_0008819_1637_2668 321
603 3300046679 Ga0495623_0068381 Ga0495623_0068381_303_1331 321
604 3300046679 Ga0495623_0073147 Ga0495623_0073147_846_1874 321
605 3300046680 Ga0495646_0008053 Ga0495646_0008053_2553_3587 321
606 3300046683 Ga0495658_0017872 Ga0495658_0017872_1134_2168 321
607 3300046683 Ga0495658_0040377 Ga0495658_0040377_738_1781 321
608 3300046689 Ga0495613_0000904 Ga0495613_0000904_20483_21517 321
609 3300046689 Ga0495613_0004025 Ga0495613_0004025_8092_9120 321
610 3300046689 Ga0495613_0019745 Ga0495613_0019745_1355_2383 321
611 3300046689 Ga0495613_0021426 Ga0495613_0021426_594_1622 321
612 3300046689 Ga0495613_0038415 Ga0495613_0038415_594_1622 321
613 3300046689 Ga0495613_0053846 Ga0495613_0053846_951_1979 321
614 3300046690 Ga0495624_0023985 Ga0495624_0023985_618_1646 321
615 3300046690 Ga0495624_0161755 Ga0495624_0161755_135_1178 321
616 3300046694 Ga0495649_0044038 Ga0495649_0044038_765_1793 321
617 3300046794 Ga0495589_0054727 Ga0495589_0054727_519_1547 321
618 3300046809 Ga0495600_0064435 Ga0495600_0064435_680_1714 321
619 3300046809 Ga0495600_0125929 Ga0495600_0125929_598_1626 321
620 3300046810 Ga0495660_0065994 Ga0495660_0065994_872_1900 321
621 3300047315 Ga0495581_0022890 Ga0495581_0022890_760_1794 321
622 3300047315 Ga0495581_0060517 Ga0495581_0060517_979_2022 321
623 3300047317 Ga0495604_0004139 Ga0495604_0004139_2839_3873 321
624 3300047317 Ga0495604_0009936 Ga0495604_0009936_5183_6211 321
625 3300047317 Ga0495604_0044770 Ga0495604_0044770_1180_2208 321
626 3300047317 Ga0495604_0072502 Ga0495604_0072502_1243_2274 321
627 3300047318 Ga0495636_0007135 Ga0495636_0007135_406_1434 321
628 3300047318 Ga0495636_0022063 Ga0495636_0022063_495_1523 321
629 3300047318 Ga0495636_0070236 Ga0495636_0070236_74_1102 321
630 3300047319 Ga0495674_0034642 Ga0495674_0034642_2377_3420 321
631 3300047319 Ga0495674_0154623 Ga0495674_0154623_573_1607 321
632 3300047321 Ga0495676_0011428 Ga0495676_0011428_1786_2814 321
633 3300047321 Ga0495676_0015587 Ga0495676_0015587_3501_4529 321
634 3300047321 Ga0495676_0052822 Ga0495676_0052822_823_1851 321
635 3300047321 Ga0495676_0103609 Ga0495676_0103609_676_1710 321
636 3300047322 Ga0495680_0006882 Ga0495680_0006882_5514_6545 321
637 3300047322 Ga0495680_0028785 Ga0495680_0028785_1446_2489 321
638 3300047322 Ga0495680_0267396 Ga0495680_0267396_106_1134 321
639 3300047323 Ga0495683_0068160 Ga0495683_0068160_524_1552 321
640 3300047443 Ga0495687_001601 Ga0495687_001601_16125_17153 321
641 3300047444 Ga0495675_0015948 Ga0495675_0015948_1105_2133 321
642 3300047444 Ga0495675_0031290 Ga0495675_0031290_2285_3316 321
643 3300047444 Ga0495675_0049850 Ga0495675_0049850_901_1944 321
644 3300047444 Ga0495675_0050288 Ga0495675_0050288_1176_2204 321
645 3300047444 Ga0495675_0058530 Ga0495675_0058530_1146_2174 321
646 3300047444 Ga0495675_0108669 Ga0495675_0108669_11_1039 321
647 3300047445 Ga0495677_0053781 Ga0495677_0053781_395_1423 321
648 3300047447 Ga0495685_022249 Ga0495685_022249_74_1102 321
649 3300047470 Ga0495681_0003265 Ga0495681_0003265_8345_9373 321
650 3300047470 Ga0495681_0050128 Ga0495681_0050128_125_1153 321
651 3300047471 Ga0495684_0053550 Ga0495684_0053550_1637_2668 321
652 3300047472 Ga0495686_0128814 Ga0495686_0128814_391_1419 321
653 3300047673 Ga0495593_0000283 Ga0495593_0000283_1427_2461 321
654 3300047673 Ga0495593_0028303 Ga0495593_0028303_903_1931 321
655 3300048088 Ga0495602_0017320 Ga0495602_0017320_173_1204 321
656 3300048088 Ga0495602_0018554 Ga0495602_0018554_2075_3106 321
657 3300048088 Ga0495602_0042791 Ga0495602_0042791_1017_2051 321
658 3300048089 Ga0495614_0000345 Ga0495614_0000345_4599_5627 321
659 3300048089 Ga0495614_0025655 Ga0495614_0025655_606_1634 321
660 3300048089 Ga0495614_0027182 Ga0495614_0027182_552_1586 321
661 3300048903 Ga0496100_0011567 Ga0496100_0011567_2182_3210 321
662 3300048904 Ga0496101_0006825 Ga0496101_0006825_991_2019 321
663 3300048906 Ga0496103_0023960 Ga0496103_0023960_1724_2752 321
664 3300048907 Ga0496104_0004325 Ga0496104_0004325_10397_11425 321
665 3300048907 Ga0496104_0065750 Ga0496104_0065750_1426_2463 321
666 3300048907 Ga0496104_0183277 Ga0496104_0183277_533_1564 321
667 3300048907 Ga0496104_0273541 Ga0496104_0273541_232_1260 321
668 3300048908 Ga0496105_0027258 Ga0496105_0027258_1787_2815 321
669 3300048908 Ga0496105_0141814 Ga0496105_0141814_599_1630 321
670 3300048908 Ga0496105_0306760 Ga0496105_0306760_173_1201 321
671 3300048909 Ga0496106_0003631 Ga0496106_0003631_1785_2813 321
672 3300048911 Ga0496108_0026608 Ga0496108_0026608_1170_2201 321
673 3300048911 Ga0496108_0065414 Ga0496108_0065414_145_1173 321
674 3300048912 Ga0496109_0008973 Ga0496109_0008973_5485_6516 321
675 3300048912 Ga0496109_0060423 Ga0496109_0060423_694_1722 321
676 3300048912 Ga0496109_0138073 Ga0496109_0138073_1192_2226 321
677 3300048913 Ga0496110_0009486 Ga0496110_0009486_3021_4052 321
678 3300048914 Ga0496111_0072878 Ga0496111_0072878_145_1182 321
679 3300048915 Ga0496112_0010903 Ga0496112_0010903_377_1405 321
680 3300048915 Ga0496112_0020724 Ga0496112_0020724_38_1069 321
681 3300048915 Ga0496112_0320519 Ga0496112_0320519_153_1181 321
682 3300048916 Ga0496113_0100131 Ga0496113_0100131_472_1503 321
683 3300048917 Ga0496114_0037320 Ga0496114_0037320_1165_2193 321
684 3300048917 Ga0496114_0094503 Ga0496114_0094503_430_1464 321
685 3300048918 Ga0496115_0065815 Ga0496115_0065815_329_1357 321
686 3300049539 Ga0501323_000501 Ga0501323_000501_70_1098 321
687 3300049568 Ga0501031_0019173 Ga0501031_0019173_2269_3297 321
688 3300049568 Ga0501031_0023838 Ga0501031_0023838_629_1657 321
689 3300049569 Ga0501032_0021013 Ga0501032_0021013_2304_3332 321
690 3300049570 Ga0501033_0007870 Ga0501033_0007870_424_1452 321
691 3300049570 Ga0501033_0022792 Ga0501033_0022792_1444_2472 321
692 3300049571 Ga0501034_0002162 Ga0501034_0002162_22171_23199 321
693 3300049572 Ga0501036_0001507 Ga0501036_0001507_9071_10099 321
694 3300049572 Ga0501036_0016135 Ga0501036_0016135_4921_5949 321
695 3300049572 Ga0501036_0022337 Ga0501036_0022337_1431_2459 321
696 3300049573 Ga0501037_0034136 Ga0501037_0034136_2614_3642 321
697 3300049573 Ga0501037_0069660 Ga0501037_0069660_747_1775 321
698 3300049574 Ga0501038_0053726 Ga0501038_0053726_2045_3073 321
699 3300049574 Ga0501038_0060378 Ga0501038_0060378_1279_2307 321
700 3300049575 Ga0501039_0003767 Ga0501039_0003767_9922_10950 321
701 3300049578 Ga0501042_0161417 Ga0501042_0161417_238_1266 321
702 3300049579 Ga0501043_0002374 Ga0501043_0002374_12492_13520 321
703 3300049579 Ga0501043_0005810 Ga0501043_0005810_6003_7031 321
704 3300049579 Ga0501043_0198419 Ga0501043_0198419_120_1148 321
705 3300049581 Ga0501047_0000068 Ga0501047_0000068_26582_27610 321
706 3300049581 Ga0501047_0010336 Ga0501047_0010336_2452_3480 321
707 3300049582 Ga0501048_0009177 Ga0501048_0009177_1401_2429 321
708 3300049584 Ga0501068_0171705 Ga0501068_0171705_308_1336 321
709 3300049585 Ga0501069_0067206 Ga0501069_0067206_159_1190 321
710 3300049586 Ga0501070_0004372 Ga0501070_0004372_8461_9489 321
711 3300049674 Ga0501242_001153 Ga0501242_001153_1043_2074 321
712 3300049677 Ga0501247_000034 Ga0501247_000034_2382_3413 321
713 3300049686 Ga0501257_002518 Ga0501257_002518_2213_3244 321
714 3300049687 Ga0501258_000911 Ga0501258_000911_606_1637 321
715 3300049705 Ga0501225_0008530 Ga0501225_0008530_1085_2116 321
716 3300049764 Ga0501267_000307 Ga0501267_000307_1605_2636 321
717 3300049765 Ga0501268_000956 Ga0501268_000956_1687_2718 321
718 3300049767 Ga0501270_000164 Ga0501270_000164_3271_4302 321
719 3300049770 Ga0501273_000321 Ga0501273_000321_2234_3265 321
720 3300049822 Ga0501035_0016266 Ga0501035_0016266_2655_3683 321
721 3300049823 Ga0501044_0001473 Ga0501044_0001473_16068_17096 321
722 3300049823 Ga0501044_0036328 Ga0501044_0036328_2325_3353 321
723 3300049823 Ga0501044_0073204 Ga0501044_0073204_2009_3037 321
724 3300049823 Ga0501044_0379298 Ga0501044_0379298_176_1204 321
725 3300050490 nmdc:mga03n38_39319_c1 nmdc:mga03n38_39319_c1_130_1272 321
726 3300050494 nmdc:mga06z11_1011_c1 nmdc:mga06z11_1011_c1_7970_8998 321
727 3300050495 nmdc:mga04h51_1208_c1 nmdc:mga04h51_1208_c1_2630_3658 321
728 3300050510 nmdc:mga06r32_120317_c1 nmdc:mga06r32_120317_c1_623_1678 321
729 3300050511 nmdc:mga08y16_43378_c1 nmdc:mga08y16_43378_c1_2772_3803 321
730 3300050512 nmdc:mga0n895_23600_c1 nmdc:mga0n895_23600_c1_1346_2389 321
731 3300050513 nmdc:mga0rr50_12614_c1 nmdc:mga0rr50_12614_c1_3474_4517 321
732 3300050514 nmdc:mga08x19_156167_c1 nmdc:mga08x19_156167_c1_128_1156 321
733 3300050514 nmdc:mga08x19_20996_c1 nmdc:mga08x19_20996_c1_2377_3408 321
734 3300050514 nmdc:mga08x19_2566_c1 nmdc:mga08x19_2566_c1_4418_5446 321
735 3300050515 nmdc:mga0a205_20389_c1 nmdc:mga0a205_20389_c1_2189_3232 321
736 3300053077 Ga0495601_0049833 Ga0495601_0049833_278_1321 321
737 3300053077 Ga0495601_0117163 Ga0495601_0117163_290_1333 321
738 3300053078 Ga0495612_0007880 Ga0495612_0007880_1821_2864 321
739 3300053078 Ga0495612_0017663 Ga0495612_0017663_1367_2410 321
740 3300053085 Ga0495619_0121996 Ga0495619_0121996_319_1353 321
741 3300053101 Ga0500553_032257 Ga0500553_032257_1295_2329 321
742 3300053107 Ga0500560_035406 Ga0500560_035406_331_1359 321
743 3300053140 Ga0500573_0128214 Ga0500573_0128214_223_1257 321
744 3300053149 Ga0500600_0074394 Ga0500600_0074394_185_1213 321
745 3300053149 Ga0500600_0097981 Ga0500600_0097981_294_1325 321
746 3300053161 Ga0500634_0100345 Ga0500634_0100345_50_1078 321
747 iso_pu_bacteria 2558860280 2559427499 321
748 iso_pu_bacteria 2643221548 2643761820 321
749 iso_pu_bacteria 2643221682 2644460753 321
750 iso_pu_bacteria 2966598605 2966600126 321

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

226

356

0.92

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

76

189

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5kia-assembly1.cif.gz_A-2 crystal structure of l-threonine 3-dehydrogenase from burkholderia thailandensis 0.9452 2 319
2dfv-assembly3.cif.gz_C hyperthermophilic threonine dehydrogenase from pyrococcus horikoshii 0.9421 2 318
2dq4-assembly1.cif.gz_A crystal structure of threonine 3-dehydrogenase 0.939 1 321
3gfb-assembly1.cif.gz_C l-threonine dehydrogenase (tktdh) from the hyperthermophilic archaeon thermococcus kodakaraensis 0.9371 2 318
2dq4-assembly1.cif.gz_A crystal structure of threonine 3-dehydrogenase 0.9362 1 321
ID Description Score Start End Superfamily
af_P07913_2_151_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9717 2 150 3.90.180.10
5kiaA01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9693 2 319 3.90.180.10
af_P07913_2_151_3.90.180.10 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.959 2 150 3.90.180.10
5kiaA01 Alpha Beta;Alpha-Beta Complex;Quinone Oxidoreductase; Chain A, domain 1;Medium-chain alcohol dehydrogenases, catalytic domain 0.9509 2 319 3.90.180.10
af_A0A0R4IGI3_166_529_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9458 162 198 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A527J3A8-F1-model_v4 L-threonine 3-dehydrogenase (EC 1.1.1.103) 0.9806 14 123 GO:0008270
GO:0008743
AF-A0A527J3A8-F1-model_v4 L-threonine 3-dehydrogenase (EC 1.1.1.103) 0.9719 14 123 GO:0008270
GO:0008743
AF-A0A3D1R0P5-F1-model_v4 L-threonine 3-dehydrogenase (EC 1.1.1.103) 0.971 1 169 GO:0008270
GO:0008743
AF-A0A3N6GBZ0-F1-model_v4 L-threonine 3-dehydrogenase (TDH) (EC 1.1.1.103) 0.9673 2 321 GO:0005737
GO:0008270
GO:0008743
GO:0019518
AF-A0A527CUV2-F1-model_v4 L-threonine 3-dehydrogenase (EC 1.1.1.103) 0.9673 25 117 GO:0008270
GO:0008743

Feature Viewer

pLDDT pTM Quality
93.45 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map