F478894

General Info

Members Datasets Scaffolds Average Seq Length
746 374 1492 287

Family's Representative Sequence

Representative Sequence 3300048929|Ga0496126_0289495|Ga0496126_0289495_398_1312
Length 304
Sequence VARIIAGVGSSHVPAIGAALDNGKTEEPYWKRVFSGFEKSQEWMRETKPDVAIVVYNDHASAFSVEMIPTFALGCAAEFPPADEGWGPRPVPVAKGHPALASHIAQSCILDEFDLTICNKMEIDHGMTVPMNLLFGKIAKDGHWPCPVIPLAVNVVMYPPPTGHRCYMLGRAIKKAVESFPDDLRVVIFGTGGLSHQISGPRAGLINSKWDKNFLDNLSQDPIKLTKIPHLDYMREAGAEGIEMVMWLIMRGALDDKVDEVYRFYTVPASNTAVGHIILENRKGKGTAKHKRAAARAKVDRIRS

Samples

Sample ID Description Type Environment
1 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
5 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
57 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
65 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
66 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
67 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
68 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
69 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
70 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
71 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
72 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
73 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
74 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
75 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
76 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
77 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
78 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
81 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
82 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
84 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
85 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
90 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
91 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
97 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
98 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
99 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
100 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
105 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
106 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
107 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
108 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
111 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
112 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
114 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
115 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
116 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
117 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
175 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
178 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
179 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
180 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
184 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
185 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
186 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
187 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
191 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
192 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
195 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
196 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
197 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
198 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
199 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
200 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
201 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
202 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
203 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
204 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
205 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
206 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
207 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
208 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
209 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
210 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
211 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
212 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
214 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
217 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
220 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
221 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
222 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
223 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
224 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
225 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
226 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
227 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
228 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
229 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
230 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
231 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
232 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
233 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
234 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
235 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
236 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
237 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
238 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
239 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
240 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
241 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
242 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
243 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
244 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
245 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
246 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
247 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
248 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
249 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
250 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
251 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
252 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
253 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
254 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
255 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
256 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
257 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
258 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
261 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
262 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
263 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
264 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
265 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
266 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
267 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
268 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
269 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
270 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
271 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
272 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
273 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
274 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
275 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
276 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
279 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
282 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
289 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
290 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
291 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
292 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
293 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
303 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
304 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
305 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
306 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
307 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
324 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
325 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
326 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
328 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
329 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
330 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
336 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
337 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
339 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
340 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
341 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
342 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
343 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
344 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
345 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
346 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
347 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
348 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
349 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
350 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
351 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
352 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
354 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
355 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
356 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
357 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
358 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
359 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
360 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
361 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
362 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
363 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
364 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
365 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
366 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
367 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
368 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
369 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
370 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
371 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
372 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
373 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
374 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.2
Metatranscriptomes 0.67
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.88
Nodule 0
Rhizoplane 6.3
Rhizosphere 89.68
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496126_0289495 3300048929 Bacteria 1355
2 JGI25406J46586_10010740 3300003203 Bacteria 4046
3 JGI25153J46596_10001063 3300003215 Bacteria 16760
4 Ga0055530_10002955 3300003791 Bacteria 10254
5 Ga0055531_10003791 3300003794 Bacteria 9487
6 Ga0065165_1000192 3300005262 Bacteria 106862
7 Ga0070658_10096363 3300005327 Bacteria 2443
8 Ga0070690_100000216 3300005330 Bacteria 30017
9 Ga0070690_100012374 3300005330 Bacteria 5021
10 Ga0070690_100044721 3300005330 Bacteria 2811
11 Ga0070670_100019543 3300005331 Bacteria 5814
12 Ga0070670_100125993 3300005331 Bacteria 2210
13 Ga0070677_10007082 3300005333 Bacteria 3734
14 Ga0068869_100000759 3300005334 Bacteria 18318
15 Ga0068869_100066737 3300005334 Bacteria 2652
16 Ga0070680_100003121 3300005336 Bacteria 12304
17 Ga0070680_100008902 3300005336 Bacteria 7695
18 Ga0070680_100010928 3300005336 Bacteria 7015
19 Ga0070680_100151089 3300005336 Bacteria 1949
20 Ga0068868_100004312 3300005338 Bacteria 9964
21 Ga0070660_100110448 3300005339 Bacteria 2187
22 Ga0070689_100000399 3300005340 Bacteria 25458
23 Ga0070689_100137407 3300005340 Bacteria 1963
24 Ga0070691_10000528 3300005341 Bacteria 14397
25 Ga0070687_100000604 3300005343 Bacteria 11929
26 Ga0070687_100017360 3300005343 Bacteria 3306
27 Ga0070692_10002623 3300005345 Bacteria 7019
28 Ga0070692_10085652 3300005345 Bacteria 1705
29 Ga0070668_100570740 3300005347 Bacteria 987
30 Ga0070669_100131518 3300005353 Bacteria 1920
31 Ga0070669_100165521 3300005353 Bacteria 1721
32 Ga0070675_100094457 3300005354 Bacteria 2509
33 Ga0070675_100192519 3300005354 Bacteria 1768
34 Ga0070675_100232430 3300005354 Bacteria 1609
35 Ga0070671_100054746 3300005355 Bacteria 3317
36 Ga0070671_100061305 3300005355 Bacteria 3133
37 Ga0070671_100138135 3300005355 Bacteria 2055
38 Ga0070674_100000456 3300005356 Bacteria 20586
39 Ga0070688_100011322 3300005365 Bacteria 4955
40 Ga0070703_10000511 3300005406 Bacteria 14979
41 Ga0070703_10047986 3300005406 Bacteria 1355
42 Ga0070709_10055153 3300005434 Bacteria 2508
43 Ga0070713_100029562 3300005436 Bacteria 4341
44 Ga0070713_100166091 3300005436 Bacteria 1974
45 Ga0070713_100367457 3300005436 Bacteria 1338
46 Ga0070710_10008693 3300005437 Bacteria 4950
47 Ga0070710_10098835 3300005437 Bacteria 1734
48 Ga0070701_10000080 3300005438 Bacteria 26531
49 Ga0070711_100023557 3300005439 Bacteria 4006
50 Ga0070705_100000554 3300005440 Bacteria 21689
51 Ga0070705_100001184 3300005440 Bacteria 14231
52 Ga0070700_100000281 3300005441 Bacteria 27271
53 Ga0070700_100023244 3300005441 Bacteria 3624
54 Ga0070700_100153032 3300005441 Bacteria 1579
55 Ga0070694_100000565 3300005444 Bacteria 20475
56 Ga0070694_100015216 3300005444 Bacteria 4826
57 Ga0070663_100266236 3300005455 Bacteria 1361
58 Ga0070678_100035789 3300005456 Bacteria 3470
59 Ga0070662_100149471 3300005457 Bacteria 1817
60 Ga0070662_100270923 3300005457 Bacteria 1371
61 Ga0070662_100326199 3300005457 Bacteria 1253
62 Ga0070681_10001127 3300005458 Bacteria 22938
63 Ga0070681_10008094 3300005458 Bacteria 10285
64 Ga0070681_10118881 3300005458 Bacteria 2579
65 Ga0068867_100000206 3300005459 Bacteria 39309
66 Ga0070685_10011760 3300005466 Bacteria 4588
67 Ga0070685_10075831 3300005466 Bacteria 2004
68 Ga0070707_100093503 3300005468 Bacteria 2911
69 Ga0070707_100171929 3300005468 Bacteria 2111
70 Ga0070707_100327752 3300005468 Bacteria 1488
71 Ga0070698_100003926 3300005471 Bacteria 16349
72 Ga0070699_100000299 3300005518 Bacteria 47843
73 Ga0070699_100061999 3300005518 Bacteria 3240
74 Ga0070699_100069097 3300005518 Bacteria 3069
75 Ga0070679_100026505 3300005530 Bacteria 5695
76 Ga0070679_100074227 3300005530 Bacteria 3392
77 Ga0070672_100005152 3300005543 Bacteria 8633
78 Ga0070686_100000711 3300005544 Bacteria 19359
79 Ga0070686_100076159 3300005544 Bacteria 2209
80 Ga0070695_100000281 3300005545 Bacteria 25630
81 Ga0070695_100007886 3300005545 Bacteria 6304
82 Ga0070696_100001281 3300005546 Bacteria 16375
83 Ga0070696_100004140 3300005546 Bacteria 9667
84 Ga0070693_100000162 3300005547 Bacteria 30827
85 Ga0070665_100433370 3300005548 Bacteria 1324
86 Ga0070665_100539231 3300005548 Bacteria 1179
87 Ga0070704_100010913 3300005549 Bacteria 5540
88 Ga0070704_100039001 3300005549 Bacteria 3258
89 Ga0070704_100072719 3300005549 Bacteria 2502
90 Ga0068855_100382998 3300005563 Bacteria 1544
91 Ga0068857_100007474 3300005577 Bacteria 9407
92 Ga0068857_100259338 3300005577 Bacteria 1595
93 Ga0068857_100306942 3300005577 Bacteria 1463
94 Ga0068854_100341117 3300005578 Bacteria 1224
95 Ga0068856_100186231 3300005614 Bacteria 2090
96 Ga0070702_100000093 3300005615 Bacteria 26493
97 Ga0068859_100003739 3300005617 Bacteria 15512
98 Ga0068864_100019613 3300005618 Bacteria 5657
99 Ga0068864_100047550 3300005618 Bacteria 3686
100 Ga0068864_100143026 3300005618 Bacteria 2160
101 Ga0068866_10000256 3300005718 Bacteria 24958
102 Ga0068861_100000355 3300005719 Bacteria 26109
103 Ga0068861_100043992 3300005719 Bacteria 3355
104 Ga0068861_100290333 3300005719 Bacteria 1412
105 Ga0068863_100003193 3300005841 Bacteria 16207
106 Ga0068863_100490023 3300005841 Bacteria 1210
107 Ga0068858_100003835 3300005842 Bacteria 14866
108 Ga0068860_100002594 3300005843 Bacteria 18905
109 Ga0068860_100004564 3300005843 Bacteria 14129
110 Ga0068860_100166839 3300005843 Bacteria 2126
111 Ga0068862_100000381 3300005844 Bacteria 47919
112 Ga0068862_100006191 3300005844 Bacteria 9965
113 Ga0081455_10005589 3300005937 Bacteria 13745
114 Ga0081455_10070246 3300005937 Bacteria 2909
115 Ga0081538_10000697 3300005981 Bacteria 36894
116 Ga0081540_1001984 3300005983 Bacteria 17080
117 Ga0081540_1002003 3300005983 Bacteria 17000
118 Ga0081540_1011607 3300005983 Bacteria 5877
119 Ga0081539_10002187 3300005985 Bacteria 28690
120 Ga0081539_10036902 3300005985 Bacteria 2917
121 Ga0081539_10057062 3300005985 Bacteria 2163
122 Ga0070717_10187367 3300006028 Bacteria 1806
123 Ga0070717_10364611 3300006028 Bacteria 1294
124 Ga0075363_100013539 3300006048 Bacteria 3957
125 Ga0070715_10000633 3300006163 Bacteria 9317
126 Ga0070715_10086345 3300006163 Bacteria 1434
127 Ga0070716_100006982 3300006173 Bacteria 5536
128 Ga0070716_100013555 3300006173 Bacteria 4157
129 Ga0070712_100110880 3300006175 Bacteria 2047
130 Ga0070712_100159270 3300006175 Bacteria 1742
131 Ga0070712_100176226 3300006175 Bacteria 1663
132 Ga0070712_100239298 3300006175 Bacteria 1445
133 Ga0070712_100277567 3300006175 Bacteria 1348
134 Ga0097621_100000303 3300006237 Bacteria 33347
135 Ga0068871_100000925 3300006358 Bacteria 19583
136 Ga0068871_100101736 3300006358 Bacteria 2408
137 Ga0075428_100000083 3300006844 Bacteria 78689
138 Ga0075428_100246982 3300006844 Bacteria 1924
139 Ga0075430_100000163 3300006846 Bacteria 43947
140 Ga0075430_100366832 3300006846 Bacteria 1189
141 Ga0075431_100225463 3300006847 Bacteria 1911
142 Ga0075433_10105598 3300006852 Bacteria 2496
143 Ga0075433_10401303 3300006852 Bacteria 1209
144 Ga0075434_100250194 3300006871 Bacteria 1791
145 Ga0075429_100001065 3300006880 Bacteria 21974
146 Ga0068865_100000871 3300006881 Bacteria 17104
147 Ga0068865_100158652 3300006881 Bacteria 1723
148 Ga0097620_100003738 3300006931 Bacteria 15512
149 Ga0075435_100001029 3300007076 Bacteria 17685
150 Ga0075435_100047143 3300007076 Bacteria 3459
151 Ga0075435_100198082 3300007076 Bacteria 1701
152 Ga0075435_100281997 3300007076 Bacteria 1418
153 Ga0075435_100358499 3300007076 Bacteria 1251
154 Ga0099794_10040060 3300007265 Bacteria 2226
155 Ga0099794_10040952 3300007265 Bacteria 2205
156 Ga0099794_10097318 3300007265 Bacteria 1466
157 Ga0099794_10133876 3300007265 Bacteria 1253
158 Ga0099795_10006764 3300007788 Bacteria 3149
159 Ga0099795_10010730 3300007788 Bacteria 2710
160 Ga0099795_10071653 3300007788 Bacteria 1309
161 Ga0105240_10090783 3300009093 Bacteria 3733
162 Ga0105240_10366030 3300009093 Bacteria 1632
163 Ga0111539_10490715 3300009094 Bacteria 1431
164 Ga0105245_10076989 3300009098 Bacteria 3040
165 Ga0105247_10032272 3300009101 Bacteria 3182
166 Ga0105247_10079640 3300009101 Bacteria 2062
167 Ga0114129_10000210 3300009147 Bacteria 65476
168 Ga0114129_10058305 3300009147 Bacteria 5401
169 Ga0114129_10297156 3300009147 Bacteria 2154
170 Ga0114129_10700269 3300009147 Bacteria 1302
171 Ga0105243_10386476 3300009148 Bacteria 1296
172 Ga0105243_10423273 3300009148 Bacteria 1243
173 Ga0105248_10215241 3300009177 Bacteria 2164
174 Ga0105248_10409951 3300009177 Bacteria 1526
175 Ga0105248_10804046 3300009177 Bacteria 1061
176 Ga0105237_10382277 3300009545 Bacteria 1413
177 Ga0105237_10569616 3300009545 Bacteria 1139
178 Ga0105238_10189559 3300009551 Bacteria 2033
179 Ga0105238_10265130 3300009551 Bacteria 1698
180 Ga0105238_10330264 3300009551 Bacteria 1512
181 Ga0105238_10342795 3300009551 Bacteria 1483
182 Ga0105249_10023225 3300009553 Bacteria 5563
183 Ga0105249_10296588 3300009553 Bacteria 1620
184 Ga0099796_10000419 3300010159 Bacteria 7045
185 Ga0099796_10038108 3300010159 Bacteria 1611
186 Ga0105239_10002189 3300010375 Bacteria 25136
187 Ga0105246_10217560 3300011119 Bacteria 1495
188 Ga0157370_10013826 3300013104 Bacteria 8291
189 Ga0157369_10002769 3300013105 Bacteria 20942
190 Ga0157369_10237197 3300013105 Bacteria 1905
191 Ga0157369_10264419 3300013105 Bacteria 1794
192 Ga0157374_10116734 3300013296 Bacteria 2572
193 Ga0157378_10111493 3300013297 Bacteria 2508
194 Ga0163162_10015009 3300013306 Bacteria 7566
195 Ga0163162_10033933 3300013306 Bacteria 5074
196 Ga0157372_10109273 3300013307 Bacteria 3166
197 Ga0157372_10588032 3300013307 Bacteria 1298
198 Ga0157375_10020347 3300013308 Bacteria 6060
199 Ga0163163_10016588 3300014325 Bacteria 6850
200 Ga0163163_10054763 3300014325 Bacteria 3941
201 Ga0163163_10212406 3300014325 Bacteria 1984
202 Ga0157380_10043468 3300014326 Bacteria 3518
203 Ga0157380_10086269 3300014326 Bacteria 2579
204 Ga0157380_10096757 3300014326 Bacteria 2448
205 Ga0182008_10056887 3300014497 Bacteria 1932
206 Ga0163161_10039734 3300017792 Bacteria 3379
207 Ga0163161_10205682 3300017792 Bacteria 1519
208 Ga0163161_10348944 3300017792 Bacteria 1176
209 Ga0213872_10009977 3300021361 Bacteria 4533
210 Ga0213876_10019182 3300021384 Bacteria 3611
211 Ga0213876_10026180 3300021384 Bacteria 3076
212 Ga0213876_10128597 3300021384 Bacteria 1346
213 Ga0224712_10018109 3300022467 Bacteria 2348
214 Ga0224572_1004405 3300024225 Bacteria 2446
215 Ga0209758_1000079 3300025297 Bacteria 262874
216 Ga0209758_1000736 3300025297 Bacteria 47860
217 Ga0209050_1000029 3300025298 Bacteria 465801
218 Ga0209257_1000493 3300025304 Bacteria 71002
219 Ga0207653_10000671 3300025885 Bacteria 11767
220 Ga0207653_10008178 3300025885 Bacteria 3261
221 Ga0207682_10000543 3300025893 Bacteria 17394
222 Ga0207682_10063886 3300025893 Bacteria 1546
223 Ga0207692_10213632 3300025898 Bacteria 1140
224 Ga0207642_10164317 3300025899 Bacteria 1195
225 Ga0207685_10004756 3300025905 Bacteria 3495
226 Ga0207685_10074028 3300025905 Bacteria 1389
227 Ga0207699_10011283 3300025906 Bacteria 4507
228 Ga0207699_10029996 3300025906 Bacteria 3039
229 Ga0207645_10025828 3300025907 Bacteria 3799
230 Ga0207705_10068851 3300025909 Bacteria 2563
231 Ga0207705_10095245 3300025909 Bacteria 2184
232 Ga0207684_10011372 3300025910 Bacteria 7790
233 Ga0207707_10006531 3300025912 Bacteria 10178
234 Ga0207707_10010905 3300025912 Bacteria 7903
235 Ga0207707_10052167 3300025912 Bacteria 3562
236 Ga0207707_10116094 3300025912 Bacteria 2339
237 Ga0207707_10158776 3300025912 Bacteria 1977
238 Ga0207695_10101621 3300025913 Bacteria 2869
239 Ga0207695_10160346 3300025913 Bacteria 2181
240 Ga0207695_10523099 3300025913 Bacteria 1068
241 Ga0207671_10251629 3300025914 Bacteria 1389
242 Ga0207693_10022149 3300025915 Bacteria 5051
243 Ga0207693_10236881 3300025915 Bacteria 1433
244 Ga0207693_10284208 3300025915 Bacteria 1296
245 Ga0207663_10007458 3300025916 Bacteria 5673
246 Ga0207663_10020666 3300025916 Bacteria 3732
247 Ga0207663_10420611 3300025916 Bacteria 1026
248 Ga0207660_10003314 3300025917 Bacteria 10518
249 Ga0207660_10005427 3300025917 Bacteria 8273
250 Ga0207660_10163787 3300025917 Bacteria 1718
251 Ga0207662_10000257 3300025918 Bacteria 24677
252 Ga0207657_10175795 3300025919 Bacteria 1732
253 Ga0207652_10054007 3300025921 Bacteria 3453
254 Ga0207652_10091976 3300025921 Bacteria 2668
255 Ga0207652_10111925 3300025921 Bacteria 2421
256 Ga0207652_10160767 3300025921 Bacteria 2014
257 Ga0207652_10242187 3300025921 Bacteria 1626
258 Ga0207646_10141824 3300025922 Bacteria 2164
259 Ga0207681_10272069 3300025923 Bacteria 1330
260 Ga0207694_10137667 3300025924 Bacteria 1962
261 Ga0207694_10182753 3300025924 Bacteria 1701
262 Ga0207694_10374296 3300025924 Bacteria 1181
263 Ga0207650_10000755 3300025925 Bacteria 24847
264 Ga0207650_10033881 3300025925 Bacteria 3702
265 Ga0207650_10038912 3300025925 Bacteria 3475
266 Ga0207659_10153418 3300025926 Bacteria 1801
267 Ga0207687_10002535 3300025927 Bacteria 12403
268 Ga0207700_10073659 3300025928 Bacteria 2638
269 Ga0207700_10076027 3300025928 Bacteria 2604
270 Ga0207664_10024659 3300025929 Bacteria 4521
271 Ga0207664_10309373 3300025929 Bacteria 1392
272 Ga0207644_10031985 3300025931 Bacteria 3669
273 Ga0207690_10198807 3300025932 Bacteria 1521
274 Ga0207706_10139274 3300025933 Bacteria 2134
275 Ga0207706_10260936 3300025933 Bacteria 1512
276 Ga0207706_10292435 3300025933 Bacteria 1420
277 Ga0207686_10014985 3300025934 Bacteria 4327
278 Ga0207686_10189717 3300025934 Bacteria 1464
279 Ga0207709_10000662 3300025935 Bacteria 27921
280 Ga0207670_10000333 3300025936 Bacteria 27980
281 Ga0207670_10019566 3300025936 Bacteria 4137
282 Ga0207670_10020940 3300025936 Bacteria 4025
283 Ga0207669_10008101 3300025937 Bacteria 4914
284 Ga0207669_10131182 3300025937 Bacteria 1722
285 Ga0207704_10000798 3300025938 Bacteria 13929
286 Ga0207665_10016681 3300025939 Bacteria 4824
287 Ga0207665_10037567 3300025939 Bacteria 3224
288 Ga0207665_10047923 3300025939 Bacteria 2866
289 Ga0207691_10000111 3300025940 Bacteria 72961
290 Ga0207711_10046527 3300025941 Bacteria 3708
291 Ga0207711_10055281 3300025941 Bacteria 3408
292 Ga0207711_10341912 3300025941 Bacteria 1385
293 Ga0207689_10001220 3300025942 Bacteria 24704
294 Ga0207689_10058526 3300025942 Bacteria 3170
295 Ga0207661_10180377 3300025944 Bacteria 1844
296 Ga0207679_10022808 3300025945 Bacteria 4268
297 Ga0207667_10011463 3300025949 Bacteria 10301
298 Ga0207712_10005184 3300025961 Bacteria 8246
299 Ga0207712_10048334 3300025961 Bacteria 2959
300 Ga0207712_10189266 3300025961 Bacteria 1623
301 Ga0207712_10424833 3300025961 Bacteria 1122
302 Ga0207668_10010308 3300025972 Bacteria 5644
303 Ga0207640_10004352 3300025981 Bacteria 7673
304 Ga0207677_10007406 3300026023 Bacteria 6070
305 Ga0207677_10110902 3300026023 Bacteria 2043
306 Ga0207703_10012669 3300026035 Bacteria 6575
307 Ga0207639_10039646 3300026041 Bacteria 3511
308 Ga0207678_10212785 3300026067 Bacteria 1654
309 Ga0207708_10026788 3300026075 Bacteria 4364
310 Ga0207708_10185508 3300026075 Bacteria 1653
311 Ga0207641_10009740 3300026088 Bacteria 7915
312 Ga0207641_10554512 3300026088 Bacteria 1121
313 Ga0207648_10001304 3300026089 Bacteria 27765
314 Ga0207648_10051080 3300026089 Bacteria 3613
315 Ga0207676_10013839 3300026095 Bacteria 5791
316 Ga0207676_10029629 3300026095 Bacteria 4100
317 Ga0207676_10093345 3300026095 Bacteria 2477
318 Ga0207676_10120653 3300026095 Bacteria 2210
319 Ga0207676_10150236 3300026095 Bacteria 2005
320 Ga0207676_10155810 3300026095 Bacteria 1973
321 Ga0207676_10652179 3300026095 Bacteria 1016
322 Ga0207674_10002654 3300026116 Bacteria 22335
323 Ga0207674_10427398 3300026116 Bacteria 1280
324 Ga0207675_100000900 3300026118 Bacteria 29714
325 Ga0207675_100126069 3300026118 Bacteria 2425
326 Ga0207675_100166216 3300026118 Bacteria 2107
327 Ga0207683_10124655 3300026121 Bacteria 2314
328 Ga0207698_10142103 3300026142 Bacteria 2070
329 Ga0209981_1009121 3300027378 Bacteria 1354
330 Ga0210000_1003803 3300027462 Bacteria 2183
331 Ga0209995_1005172 3300027471 Bacteria 2097
332 Ga0209179_1018216 3300027512 Bacteria 1339
333 Ga0209999_1000224 3300027543 Bacteria 8056
334 Ga0209971_1003504 3300027682 Bacteria 3717
335 Ga0207428_10000321 3300027907 Bacteria 62664
336 Ga0268266_10579842 3300028379 Bacteria 1076
337 Ga0268265_10005803 3300028380 Bacteria 8422
338 Ga0268265_10022862 3300028380 Bacteria 4400
339 Ga0268265_10151052 3300028380 Bacteria 1959
340 Ga0268264_10002472 3300028381 Bacteria 16244
341 Ga0268264_10010548 3300028381 Bacteria 7640
342 Ga0265337_1001602 3300028556 Bacteria 11051
343 Ga0265334_10000375 3300028573 Bacteria 23930
344 Ga0265318_10041313 3300028577 Bacteria 1753
345 Ga0265338_10017937 3300028800 Bacteria 7601
346 Ga0265338_10350025 3300028800 Bacteria 1063
347 Ga0265763_1003160 3300030763 Bacteria 1298
348 Ga0265773_1000857 3300031018 Bacteria 1434
349 Ga0265760_10000047 3300031090 Bacteria 34356
350 Ga0265760_10015385 3300031090 Bacteria 2192
351 Ga0265332_10001912 3300031238 Bacteria 11032
352 Ga0265325_10082095 3300031241 Bacteria 1600
353 Ga0265329_10034773 3300031242 Bacteria 1627
354 Ga0265340_10074939 3300031247 Bacteria 1599
355 Ga0265340_10097753 3300031247 Bacteria 1367
356 Ga0265339_10094469 3300031249 Bacteria 1563
357 Ga0265331_10001152 3300031250 Bacteria 20139
358 Ga0265331_10050864 3300031250 Bacteria 1985
359 Ga0265327_10008379 3300031251 Bacteria 7711
360 Ga0265316_10011233 3300031344 Bacteria 8096
361 Ga0265316_10086493 3300031344 Bacteria 2396
362 Ga0265316_10159803 3300031344 Bacteria 1685
363 Ga0265316_10196482 3300031344 Bacteria 1497
364 Ga0265313_10022761 3300031595 Bacteria 3391
365 Ga0316575_10069388 3300031665 Bacteria 1415
366 Ga0265314_10052822 3300031711 Bacteria 2822
367 Ga0265342_10034953 3300031712 Bacteria 3080
368 Ga0316583_10005706 3300032133 Bacteria 4476
369 Ga0316583_10010840 3300032133 Bacteria 3283
370 Ga0373948_0049079 3300034817 Bacteria 903
371 Ga0373958_0006089 3300034819 Bacteria 1864
372 Ga0373938_0033690 3300034957 Bacteria 1110
373 Ga0373926_0003071 3300035083 Bacteria 5358
374 Ga0373929_0022841 3300035085 Bacteria 1280
375 Ga0373934_0003290 3300035086 Bacteria 5912
376 Ga0373944_0008921 3300035089 Bacteria 2711
377 Ga0373944_0044245 3300035089 Bacteria 1386
378 Ga0373951_0005912 3300035091 Bacteria 2824
379 Ga0373952_0003713 3300035092 Bacteria 2758
380 Ga0373923_0001304 3300035111 Bacteria 7049
381 Ga0373923_0002059 3300035111 Bacteria 6070
382 Ga0373932_0001983 3300035112 Bacteria 5402
383 Ga0373936_0015532 3300035113 Bacteria 2918
384 Ga0373945_0003484 3300035116 Bacteria 4953
385 Ga0373945_0081580 3300035116 Bacteria 1240
386 Ga0373953_0007096 3300035117 Bacteria 3733
387 Ga0373953_0091230 3300035117 Bacteria 1275
388 Ga0373954_0071290 3300035118 Bacteria 1651
389 Ga0373956_0024074 3300035119 Bacteria 2619
390 Ga0373956_0028579 3300035119 Bacteria 2427
391 Ga0373956_0032496 3300035119 Bacteria 2290
392 Ga0373957_0016394 3300035120 Bacteria 2563
393 Ga0373957_0030278 3300035120 Bacteria 1982
394 Ga0373957_0050234 3300035120 Bacteria 1593
395 Ga0373943_0121335 3300035170 Bacteria 1389
396 Ga0373943_0125620 3300035170 Bacteria 1368
397 Ga0373946_0013656 3300035171 Bacteria 3055
398 Ga0373946_0030201 3300035171 Bacteria 2162
399 Ga0373955_0002912 3300035172 Bacteria 7514
400 Ga0373955_0006619 3300035172 Bacteria 5286
401 Ga0373955_0240434 3300035172 Bacteria 1084
402 Ga0373942_0017709 3300035207 Bacteria 1760
403 Ga0373942_0047035 3300035207 Bacteria 1198
404 Ga0373961_0008257 3300035241 Bacteria 2531
405 Ga0373962_0004129 3300035242 Bacteria 3500
406 Ga0373962_0041455 3300035242 Bacteria 1298
407 Ga0373924_0003392 3300035410 Bacteria 5475
408 Ga0373924_0020013 3300035410 Bacteria 2598
409 Ga0373931_0000134 3300035691 Bacteria 33430
410 Ga0373931_0000527 3300035691 Bacteria 15672
411 Ga0373931_0146300 3300035691 Bacteria 1374
412 Ga0373935_0000023 3300035692 Bacteria 61461
413 Ga0373935_0043610 3300035692 Bacteria 2823
414 Ga0373935_0178833 3300035692 Bacteria 1456
415 Ga0373927_0013020 3300035695 Bacteria 5532
416 Ga0373927_0020220 3300035695 Bacteria 4365
417 Ga0373927_0072642 3300035695 Bacteria 2227
418 Ga0373927_0138116 3300035695 Bacteria 1593
419 Ga0373933_0001503 3300035724 Bacteria 13639
420 Ga0373933_0004140 3300035724 Bacteria 7989
421 Ga0373933_0011490 3300035724 Bacteria 4883
422 Ga0373933_0110468 3300035724 Bacteria 1714
423 Ga0373933_0335369 3300035724 Bacteria 981
424 Ga0373947_0034944 3300035725 Bacteria 2975
425 Ga0373947_0052015 3300035725 Bacteria 2466
426 Ga0373947_0070482 3300035725 Bacteria 2142
427 Ga0373947_0110891 3300035725 Bacteria 1733
428 Ga0373937_0000005 3300036401 Bacteria 199965
429 Ga0373937_0008905 3300036401 Bacteria 8714
430 Ga0373937_0009993 3300036401 Bacteria 8274
431 Ga0373937_0010352 3300036401 Bacteria 8143
432 Ga0373937_0037259 3300036401 Bacteria 4431
433 Ga0373937_0105465 3300036401 Bacteria 2619
434 Ga0373937_0117828 3300036401 Bacteria 2473
435 Ga0373937_0539792 3300036401 Bacteria 1108
436 Ga0373937_0621726 3300036401 Bacteria 1025
437 Ga0373925_0000007 3300037068 Bacteria 257023
438 Ga0373925_0131036 3300037068 Bacteria 1955
439 Ga0373925_0132701 3300037068 Bacteria 1943
440 Ga0395900_0124004 3300037418 Bacteria 2650
441 Ga0395898_0479176 3300037466 Bacteria 1184
442 Ga0436364_0517196 3300037853 Bacteria 5127
443 Ga0436364_0545974 3300037853 Bacteria 1974
444 Ga0436364_0792117 3300037853 Bacteria 3165
445 Ga0436364_1264330 3300037853 Bacteria 2143
446 Ga0395901_0342469 3300038443 Bacteria 1544
447 Ga0436365_0007149 3300039437 Bacteria 2238
448 Ga0436365_0053879 3300039437 Bacteria 2344
449 Ga0436365_0194703 3300039437 Bacteria 20771
450 Ga0436365_1568906 3300039437 Bacteria 1456
451 Ga0436365_1775777 3300039437 Bacteria 17079
452 Ga0436361_0198664 3300039447 Bacteria 51847
453 Ga0436361_1030002 3300039447 Bacteria 2329
454 Ga0436363_1007941 3300039450 Bacteria 1315
455 Ga0436362_0084740 3300039453 Bacteria 2527
456 Ga0436362_0463249 3300039453 Bacteria 4420
457 Ga0439453_0007104 3300041408 Bacteria 1765
458 Ga0451843_1115200 3300041509 Bacteria 1260
459 Ga0439443_001183 3300042003 Bacteria 2779
460 Ga0439462_0061194 3300042015 Bacteria 1019
461 Ga0439434_0000107 3300042435 Bacteria 21642
462 Ga0439435_0000076 3300042436 Bacteria 11878
463 Ga0439459_0022125 3300042438 Bacteria 1228
464 Ga0451577_0000271 3300042876 Bacteria 101284
465 Ga0451577_0100523 3300042876 Bacteria 2583
466 Ga0439440_0009845 3300042993 Bacteria 1986
467 Ga0453683_0044375 3300044673 Bacteria 2790
468 Ga0466963_0016237 3300044694 Bacteria 4628
469 Ga0453684_0000005 3300044712 Bacteria 1431632
470 Ga0453684_0000702 3300044712 Bacteria 118936
471 Ga0466959_0271343 3300045049 Bacteria 1166
472 Ga0451576_0000259 3300045051 Bacteria 129591
473 Ga0451576_0001387 3300045051 Bacteria 41619
474 Ga0451576_0084222 3300045051 Bacteria 3307
475 Ga0451576_0191270 3300045051 Bacteria 2137
476 Ga0466958_0018526 3300045836 Bacteria 4042
477 Ga0466958_0029981 3300045836 Bacteria 3228
478 Ga0466967_0597600 3300045976 Bacteria 1089
479 Ga0466967_0641016 3300045976 Bacteria 1050
480 Ga0495592_0007203 3300046454 Bacteria 8333
481 Ga0495592_0038795 3300046454 Bacteria 3582
482 Ga0495592_0299512 3300046454 Bacteria 1046
483 Ga0495592_0307644 3300046454 Bacteria 1028
484 Ga0495629_0124144 3300046459 Bacteria 1799
485 Ga0495641_0172349 3300046461 Bacteria 968
486 Ga0495651_0007669 3300046462 Bacteria 8251
487 Ga0495651_0021971 3300046462 Bacteria 4962
488 Ga0495651_0131162 3300046462 Bacteria 1829
489 Ga0495651_0143839 3300046462 Bacteria 1726
490 Ga0495653_0000308 3300046463 Bacteria 39628
491 Ga0495653_0037741 3300046463 Bacteria 3793
492 Ga0495580_0058208 3300046472 Bacteria 2718
493 Ga0495582_0070919 3300046473 Bacteria 1928
494 Ga0495639_0026503 3300046475 Bacteria 2562
495 Ga0495639_0074976 3300046475 Bacteria 1568
496 Ga0495662_0067201 3300046476 Bacteria 1734
497 Ga0495662_0110862 3300046476 Bacteria 1345
498 Ga0495664_0000003 3300046477 Bacteria 551602
499 Ga0495608_0000072 3300046511 Bacteria 76887
500 Ga0495608_0040305 3300046511 Bacteria 3129
501 Ga0495608_0164578 3300046511 Bacteria 1409
502 Ga0495618_0000019 3300046514 Bacteria 136770
503 Ga0495628_0000015 3300046516 Bacteria 198912
504 Ga0495630_0086282 3300046517 Bacteria 2370
505 Ga0495630_0201427 3300046517 Bacteria 1519
506 Ga0495663_0057507 3300046525 Bacteria 1217
507 Ga0495652_0000006 3300046529 Bacteria 459709
508 Ga0495652_0039030 3300046529 Bacteria 4107
509 Ga0495652_0150938 3300046529 Bacteria 1816
510 Ga0495652_0277550 3300046529 Bacteria 1229
511 Ga0495665_0008768 3300046531 Bacteria 5490
512 Ga0495640_0000002 3300046533 Bacteria 646434
513 Ga0495640_0007626 3300046533 Bacteria 8505
514 Ga0495640_0041058 3300046533 Bacteria 3235
515 Ga0495640_0063367 3300046533 Bacteria 2504
516 Ga0495586_0001019 3300046535 Bacteria 15828
517 Ga0495587_0000001 3300046536 Bacteria 724132
518 Ga0495587_0021836 3300046536 Bacteria 3948
519 Ga0495598_0009561 3300046537 Bacteria 2296
520 Ga0495621_0067267 3300046539 Bacteria 1312
521 Ga0495645_0002525 3300046543 Bacteria 12424
522 Ga0495645_0034491 3300046543 Bacteria 3691
523 Ga0495667_0000021 3300046559 Bacteria 180625
524 Ga0495667_0002416 3300046559 Bacteria 12473
525 Ga0495667_0015887 3300046559 Bacteria 5090
526 Ga0495667_0163925 3300046559 Bacteria 1429
527 Ga0495656_0011244 3300046615 Bacteria 3283
528 Ga0495634_0000251 3300046642 Bacteria 50728
529 Ga0495634_0031218 3300046642 Bacteria 3671
530 Ga0495634_0039011 3300046642 Bacteria 3236
531 Ga0495635_0000001 3300046663 Bacteria 704901
532 Ga0495635_0224562 3300046663 Bacteria 1270
533 Ga0495588_0158435 3300046674 Bacteria 1197
534 Ga0495657_0000486 3300046675 Bacteria 37325
535 Ga0495657_0013370 3300046675 Bacteria 6060
536 Ga0495657_0057797 3300046675 Bacteria 2578
537 Ga0495599_0000203 3300046678 Bacteria 39491
538 Ga0495599_0008955 3300046678 Bacteria 6096
539 Ga0495623_0000058 3300046679 Bacteria 68197
540 Ga0495623_0014003 3300046679 Bacteria 5197
541 Ga0495646_0000003 3300046680 Bacteria 287773
542 Ga0495646_0086748 3300046680 Bacteria 1814
543 Ga0495647_0002041 3300046681 Bacteria 6316
544 Ga0495658_0021666 3300046683 Bacteria 3391
545 Ga0495658_0036355 3300046683 Bacteria 2716
546 Ga0495658_0153884 3300046683 Bacteria 1414
547 Ga0495613_0097049 3300046689 Bacteria 2131
548 Ga0495613_0105937 3300046689 Bacteria 2029
549 Ga0495624_0019722 3300046690 Bacteria 4495
550 Ga0495600_0000002 3300046809 Bacteria 186597
551 Ga0495581_0018810 3300047315 Bacteria 4010
552 Ga0495604_0000001 3300047317 Bacteria 708627
553 Ga0495674_0000018 3300047319 Bacteria 204024
554 Ga0495674_0069384 3300047319 Bacteria 3048
555 Ga0495674_0127364 3300047319 Bacteria 2147
556 Ga0495672_0153398 3300047320 Bacteria 1192
557 Ga0495676_0053798 3300047321 Bacteria 3205
558 Ga0495680_0010419 3300047322 Bacteria 8294
559 Ga0495680_0153732 3300047322 Bacteria 1675
560 Ga0495680_0212157 3300047322 Bacteria 1386
561 Ga0495675_0004157 3300047444 Bacteria 8756
562 Ga0495685_075953 3300047447 Bacteria 1122
563 Ga0495684_0000010 3300047471 Bacteria 198915
564 Ga0495684_0107449 3300047471 Bacteria 2108
565 Ga0495684_0127497 3300047471 Bacteria 1914
566 Ga0495686_0005805 3300047472 Bacteria 9625
567 Ga0495593_0007996 3300047673 Bacteria 6157
568 Ga0495602_0013088 3300048088 Bacteria 8484
569 Ga0495602_0047037 3300048088 Bacteria 3891
570 Ga0495602_0077381 3300048088 Bacteria 2815
571 Ga0495602_0129015 3300048088 Bacteria 2020
572 Ga0495615_0005053 3300048090 Bacteria 2348
573 Ga0496100_0005463 3300048903 Bacteria 6850
574 Ga0496100_0023107 3300048903 Bacteria 3772
575 Ga0496101_0001025 3300048904 Bacteria 16469
576 Ga0496101_0008677 3300048904 Bacteria 6646
577 Ga0496101_0105891 3300048904 Bacteria 2111
578 Ga0496101_0177833 3300048904 Bacteria 1638
579 Ga0496102_0010694 3300048905 Bacteria 7904
580 Ga0496102_0083681 3300048905 Bacteria 2944
581 Ga0496102_0151094 3300048905 Bacteria 2182
582 Ga0496104_0012586 3300048907 Bacteria 7613
583 Ga0496104_0020110 3300048907 Bacteria 6117
584 Ga0496104_0122893 3300048907 Bacteria 2492
585 Ga0496104_0484046 3300048907 Bacteria 1149
586 Ga0496105_0005567 3300048908 Bacteria 9565
587 Ga0496105_0011176 3300048908 Bacteria 7082
588 Ga0496105_0050257 3300048908 Bacteria 3444
589 Ga0496105_0093951 3300048908 Bacteria 2477
590 Ga0496106_0005238 3300048909 Bacteria 9608
591 Ga0496106_0023192 3300048909 Bacteria 4610
592 Ga0496106_0481803 3300048909 Bacteria 997
593 Ga0496107_0007469 3300048910 Bacteria 7535
594 Ga0496107_0037391 3300048910 Bacteria 3483
595 Ga0496107_0153995 3300048910 Bacteria 1701
596 Ga0496108_0002364 3300048911 Bacteria 15107
597 Ga0496108_0158088 3300048911 Bacteria 1958
598 Ga0496109_0002461 3300048912 Bacteria 15523
599 Ga0496109_0098137 3300048912 Bacteria 2716
600 Ga0496109_0105357 3300048912 Bacteria 2619
601 Ga0496110_0003528 3300048913 Bacteria 12009
602 Ga0496111_0003518 3300048914 Bacteria 9693
603 Ga0496111_0005819 3300048914 Bacteria 7950
604 Ga0496111_0018422 3300048914 Bacteria 4838
605 Ga0496112_0037915 3300048915 Bacteria 4707
606 Ga0496112_0039123 3300048915 Bacteria 4632
607 Ga0496112_0259022 3300048915 Bacteria 1689
608 Ga0496112_0339616 3300048915 Bacteria 1445
609 Ga0496113_0001647 3300048916 Bacteria 12592
610 Ga0496113_0030542 3300048916 Bacteria 3901
611 Ga0496113_0243154 3300048916 Bacteria 1436
612 Ga0496114_0027134 3300048917 Bacteria 4690
613 Ga0496114_0057372 3300048917 Bacteria 3251
614 Ga0496114_0101836 3300048917 Bacteria 2453
615 Ga0496114_0224615 3300048917 Bacteria 1649
616 Ga0496115_0023215 3300048918 Bacteria 4813
617 Ga0496115_0063615 3300048918 Bacteria 2977
618 Ga0496115_0172335 3300048918 Bacteria 1789
619 Ga0496115_0182799 3300048918 Bacteria 1733
620 Ga0501031_0001402 3300049568 Bacteria 14899
621 Ga0501031_0084930 3300049568 Bacteria 2063
622 Ga0501032_0078518 3300049569 Bacteria 2197
623 Ga0501032_0166759 3300049569 Bacteria 1445
624 Ga0501033_0043905 3300049570 Bacteria 3328
625 Ga0501034_0124229 3300049571 Bacteria 2566
626 Ga0501036_0009279 3300049572 Bacteria 8085
627 Ga0501036_0022892 3300049572 Bacteria 5260
628 Ga0501037_0041056 3300049573 Bacteria 3403
629 Ga0501037_0135876 3300049573 Bacteria 1761
630 Ga0501038_0030524 3300049574 Bacteria 4768
631 Ga0501038_0282115 3300049574 Bacteria 1307
632 Ga0501039_0001656 3300049575 Bacteria 16415
633 Ga0501039_0016247 3300049575 Bacteria 5701
634 Ga0501039_0019439 3300049575 Bacteria 5208
635 Ga0501039_0050190 3300049575 Bacteria 3227
636 Ga0501039_0229314 3300049575 Bacteria 1460
637 Ga0501040_0001034 3300049576 Bacteria 17662
638 Ga0501040_0055715 3300049576 Bacteria 2712
639 Ga0501040_0158395 3300049576 Bacteria 1600
640 Ga0501040_0244760 3300049576 Bacteria 1279
641 Ga0501041_0000600 3300049577 Bacteria 18846
642 Ga0501041_0009888 3300049577 Bacteria 5617
643 Ga0501041_0108169 3300049577 Bacteria 1724
644 Ga0501042_0004577 3300049578 Bacteria 8827
645 Ga0501042_0163849 3300049578 Bacteria 1604
646 Ga0501042_0206908 3300049578 Bacteria 1415
647 Ga0501043_0027712 3300049579 Bacteria 4447
648 Ga0501043_0041339 3300049579 Bacteria 3622
649 Ga0501043_0156209 3300049579 Bacteria 1784
650 Ga0501043_0395959 3300049579 Bacteria 1044
651 Ga0501046_0001057 3300049580 Bacteria 26945
652 Ga0501047_0237969 3300049581 Bacteria 1672
653 Ga0501047_0270201 3300049581 Bacteria 1546
654 Ga0501048_0011924 3300049582 Bacteria 6480
655 Ga0501048_0028075 3300049582 Bacteria 4086
656 Ga0501067_0125492 3300049583 Bacteria 1428
657 Ga0501068_0091679 3300049584 Bacteria 1875
658 Ga0501068_0159126 3300049584 Bacteria 1423
659 Ga0501069_0012334 3300049585 Bacteria 4541
660 Ga0501070_0104679 3300049586 Bacteria 2339
661 Ga0501070_0402055 3300049586 Bacteria 1107
662 Ga0501071_0044976 3300049587 Bacteria 3168
663 Ga0501071_0088441 3300049587 Bacteria 2273
664 Ga0501071_0395787 3300049587 Bacteria 1054
665 Ga0501072_0001862 3300049588 Bacteria 15708
666 Ga0501072_0016678 3300049588 Bacteria 5643
667 Ga0501072_0017593 3300049588 Bacteria 5496
668 Ga0501073_0128997 3300049589 Bacteria 1753
669 Ga0501073_0222767 3300049589 Bacteria 1303
670 Ga0501074_0013084 3300049590 Bacteria 6031
671 Ga0501074_0025976 3300049590 Bacteria 4247
672 Ga0501074_0055668 3300049590 Bacteria 2850
673 Ga0501074_0354262 3300049590 Bacteria 1042
674 Ga0501075_0003996 3300049591 Bacteria 9947
675 Ga0501075_0110729 3300049591 Bacteria 2087
676 Ga0501075_0352584 3300049591 Bacteria 1121
677 Ga0501076_0000348 3300049592 Bacteria 28519
678 Ga0501076_0018281 3300049592 Bacteria 5341
679 Ga0501076_0031097 3300049592 Bacteria 4162
680 Ga0501076_0108342 3300049592 Bacteria 2244
681 Ga0501076_0173494 3300049592 Bacteria 1758
682 Ga0501077_0003407 3300049593 Bacteria 9556
683 Ga0501077_0109152 3300049593 Bacteria 1753
684 Ga0501077_0130945 3300049593 Bacteria 1590
685 Ga0501079_0000859 3300049741 Bacteria 20782
686 Ga0501079_0032191 3300049741 Bacteria 4031
687 Ga0501080_0127286 3300049742 Bacteria 2358
688 Ga0501080_0160347 3300049742 Bacteria 2077
689 Ga0501080_0199128 3300049742 Bacteria 1839
690 Ga0501080_0245104 3300049742 Bacteria 1635
691 Ga0501080_0276804 3300049742 Bacteria 1526
692 Ga0501080_0292729 3300049742 Bacteria 1478
693 Ga0501080_0317839 3300049742 Bacteria 1410
694 Ga0501081_0000131 3300049743 Bacteria 33122
695 Ga0501081_0019448 3300049743 Bacteria 4522
696 Ga0501081_0089723 3300049743 Bacteria 2160
697 Ga0501035_0100369 3300049822 Bacteria 2541
698 Ga0501045_0014083 3300049824 Bacteria 5663
699 Ga0501045_0018427 3300049824 Bacteria 4965
700 Ga0501045_0155039 3300049824 Bacteria 1704
701 Ga0501045_0339121 3300049824 Bacteria 1119
702 nmdc:mga0k408_12633_c1 3300050493 Bacteria 4616
703 nmdc:mga05p37_132_c1 3300050507 Bacteria 68371
704 nmdc:mga05p37_609629_c1 3300050507 Bacteria 1231
705 nmdc:mga09592_418_c1 3300050508 Bacteria 31192
706 nmdc:mga0qj67_131227_c1 3300050509 Bacteria 2029
707 nmdc:mga0qj67_160_c1 3300050509 Bacteria 45393
708 nmdc:mga0qj67_540390_c1 3300050509 Bacteria 935
709 nmdc:mga06r32_215226_c1 3300050510 Bacteria 1909
710 nmdc:mga08y16_322332_c1 3300050511 Bacteria 1590
711 nmdc:mga08y16_433706_c1 3300050511 Bacteria 1342
712 nmdc:mga08y16_9476_c1 3300050511 Bacteria 10220
713 nmdc:mga0n895_763344_c1 3300050512 Bacteria 959
714 nmdc:mga0rr50_134505_c1 3300050513 Bacteria 1983
715 nmdc:mga0rr50_7459_c1 3300050513 Bacteria 6749
716 nmdc:mga0a205_195989_c1 3300050515 Bacteria 1911
717 Ga0495601_0000001 3300053077 Bacteria 549454
718 Ga0495601_0000243 3300053077 Bacteria 29083
719 Ga0495601_0022082 3300053077 Bacteria 3905
720 Ga0495612_0000063 3300053078 Bacteria 48104
721 Ga0495612_0044245 3300053078 Bacteria 1821
722 Ga0495612_0117990 3300053078 Bacteria 1140
723 Ga0495595_0002319 3300053084 Bacteria 7421
724 Ga0495595_0025827 3300053084 Bacteria 2605
725 Ga0495595_0073981 3300053084 Bacteria 1614
726 Ga0495619_0000004 3300053085 Bacteria 500068
727 Ga0495619_0008423 3300053085 Bacteria 6518
728 Ga0495619_0016217 3300053085 Bacteria 4715
729 Ga0495619_0086716 3300053085 Bacteria 2116
730 Ga0500643_032714 3300053087 Bacteria 1577
731 Ga0500641_0005553 3300053096 Bacteria 4467
732 Ga0500593_000250 3300053117 Bacteria 22072
733 Ga0500652_035217 3300053131 Bacteria 1988
734 Ga0501084_0003474 3300054114 Bacteria 12800
735 Ga0501084_0064199 3300054114 Bacteria 3073
736 Ga0501084_0071132 3300054114 Bacteria 2913
737 Ga0501084_0209400 3300054114 Bacteria 1645
738 Ga0501082_0000205 3300060353 Bacteria 51540
739 Ga0501082_0002832 3300060353 Bacteria 15112
740 Ga0501082_0008926 3300060353 Bacteria 8651
741 Ga0501082_0025577 3300060353 Bacteria 5087
742 Ga0501082_0112881 3300060353 Bacteria 2353
743 Ga0501082_0376639 3300060353 Bacteria 1238
744 Ga0530510_0000425 3300061734 Bacteria 27205
745 Ga0530510_0064402 3300061734 Bacteria 2655
746 2643999141 2643221598 Bacteria 4578346
747 Ga0496126_0289495
748 JGI25406J46586_10010740
749 JGI25153J46596_10001063
750 Ga0055530_10002955
751 Ga0055531_10003791
752 Ga0065165_1000192
753 Ga0070658_10096363
754 Ga0070690_100000216
755 Ga0070690_100012374
756 Ga0070690_100044721
757 Ga0070670_100019543
758 Ga0070670_100125993
759 Ga0070677_10007082
760 Ga0068869_100000759
761 Ga0068869_100066737
762 Ga0070680_100003121
763 Ga0070680_100008902
764 Ga0070680_100010928
765 Ga0070680_100151089
766 Ga0068868_100004312
767 Ga0070660_100110448
768 Ga0070689_100000399
769 Ga0070689_100137407
770 Ga0070691_10000528
771 Ga0070687_100000604
772 Ga0070687_100017360
773 Ga0070692_10002623
774 Ga0070692_10085652
775 Ga0070668_100570740
776 Ga0070669_100131518
777 Ga0070669_100165521
778 Ga0070675_100094457
779 Ga0070675_100192519
780 Ga0070675_100232430
781 Ga0070671_100054746
782 Ga0070671_100061305
783 Ga0070671_100138135
784 Ga0070674_100000456
785 Ga0070688_100011322
786 Ga0070703_10000511
787 Ga0070703_10047986
788 Ga0070709_10055153
789 Ga0070713_100029562
790 Ga0070713_100166091
791 Ga0070713_100367457
792 Ga0070710_10008693
793 Ga0070710_10098835
794 Ga0070701_10000080
795 Ga0070711_100023557
796 Ga0070705_100000554
797 Ga0070705_100001184
798 Ga0070700_100000281
799 Ga0070700_100023244
800 Ga0070700_100153032
801 Ga0070694_100000565
802 Ga0070694_100015216
803 Ga0070663_100266236
804 Ga0070678_100035789
805 Ga0070662_100149471
806 Ga0070662_100270923
807 Ga0070662_100326199
808 Ga0070681_10001127
809 Ga0070681_10008094
810 Ga0070681_10118881
811 Ga0068867_100000206
812 Ga0070685_10011760
813 Ga0070685_10075831
814 Ga0070707_100093503
815 Ga0070707_100171929
816 Ga0070707_100327752
817 Ga0070698_100003926
818 Ga0070699_100000299
819 Ga0070699_100061999
820 Ga0070699_100069097
821 Ga0070679_100026505
822 Ga0070679_100074227
823 Ga0070672_100005152
824 Ga0070686_100000711
825 Ga0070686_100076159
826 Ga0070695_100000281
827 Ga0070695_100007886
828 Ga0070696_100001281
829 Ga0070696_100004140
830 Ga0070693_100000162
831 Ga0070665_100433370
832 Ga0070665_100539231
833 Ga0070704_100010913
834 Ga0070704_100039001
835 Ga0070704_100072719
836 Ga0068855_100382998
837 Ga0068857_100007474
838 Ga0068857_100259338
839 Ga0068857_100306942
840 Ga0068854_100341117
841 Ga0068856_100186231
842 Ga0070702_100000093
843 Ga0068859_100003739
844 Ga0068864_100019613
845 Ga0068864_100047550
846 Ga0068864_100143026
847 Ga0068866_10000256
848 Ga0068861_100000355
849 Ga0068861_100043992
850 Ga0068861_100290333
851 Ga0068863_100003193
852 Ga0068863_100490023
853 Ga0068858_100003835
854 Ga0068860_100002594
855 Ga0068860_100004564
856 Ga0068860_100166839
857 Ga0068862_100000381
858 Ga0068862_100006191
859 Ga0081455_10005589
860 Ga0081455_10070246
861 Ga0081538_10000697
862 Ga0081540_1001984
863 Ga0081540_1002003
864 Ga0081540_1011607
865 Ga0081539_10002187
866 Ga0081539_10036902
867 Ga0081539_10057062
868 Ga0070717_10187367
869 Ga0070717_10364611
870 Ga0075363_100013539
871 Ga0070715_10000633
872 Ga0070715_10086345
873 Ga0070716_100006982
874 Ga0070716_100013555
875 Ga0070712_100110880
876 Ga0070712_100159270
877 Ga0070712_100176226
878 Ga0070712_100239298
879 Ga0070712_100277567
880 Ga0097621_100000303
881 Ga0068871_100000925
882 Ga0068871_100101736
883 Ga0075428_100000083
884 Ga0075428_100246982
885 Ga0075430_100000163
886 Ga0075430_100366832
887 Ga0075431_100225463
888 Ga0075433_10105598
889 Ga0075433_10401303
890 Ga0075434_100250194
891 Ga0075429_100001065
892 Ga0068865_100000871
893 Ga0068865_100158652
894 Ga0097620_100003738
895 Ga0075435_100001029
896 Ga0075435_100047143
897 Ga0075435_100198082
898 Ga0075435_100281997
899 Ga0075435_100358499
900 Ga0099794_10040060
901 Ga0099794_10040952
902 Ga0099794_10097318
903 Ga0099794_10133876
904 Ga0099795_10006764
905 Ga0099795_10010730
906 Ga0099795_10071653
907 Ga0105240_10090783
908 Ga0105240_10366030
909 Ga0111539_10490715
910 Ga0105245_10076989
911 Ga0105247_10032272
912 Ga0105247_10079640
913 Ga0114129_10000210
914 Ga0114129_10058305
915 Ga0114129_10297156
916 Ga0114129_10700269
917 Ga0105243_10386476
918 Ga0105243_10423273
919 Ga0105248_10215241
920 Ga0105248_10409951
921 Ga0105248_10804046
922 Ga0105237_10382277
923 Ga0105237_10569616
924 Ga0105238_10189559
925 Ga0105238_10265130
926 Ga0105238_10330264
927 Ga0105238_10342795
928 Ga0105249_10023225
929 Ga0105249_10296588
930 Ga0099796_10000419
931 Ga0099796_10038108
932 Ga0105239_10002189
933 Ga0105246_10217560
934 Ga0157370_10013826
935 Ga0157369_10002769
936 Ga0157369_10237197
937 Ga0157369_10264419
938 Ga0157374_10116734
939 Ga0157378_10111493
940 Ga0163162_10015009
941 Ga0163162_10033933
942 Ga0157372_10109273
943 Ga0157372_10588032
944 Ga0157375_10020347
945 Ga0163163_10016588
946 Ga0163163_10054763
947 Ga0163163_10212406
948 Ga0157380_10043468
949 Ga0157380_10086269
950 Ga0157380_10096757
951 Ga0182008_10056887
952 Ga0163161_10039734
953 Ga0163161_10205682
954 Ga0163161_10348944
955 Ga0213872_10009977
956 Ga0213876_10019182
957 Ga0213876_10026180
958 Ga0213876_10128597
959 Ga0224712_10018109
960 Ga0224572_1004405
961 Ga0209758_1000079
962 Ga0209758_1000736
963 Ga0209050_1000029
964 Ga0209257_1000493
965 Ga0207653_10000671
966 Ga0207653_10008178
967 Ga0207682_10000543
968 Ga0207682_10063886
969 Ga0207692_10213632
970 Ga0207642_10164317
971 Ga0207685_10004756
972 Ga0207685_10074028
973 Ga0207699_10011283
974 Ga0207699_10029996
975 Ga0207645_10025828
976 Ga0207705_10068851
977 Ga0207705_10095245
978 Ga0207684_10011372
979 Ga0207707_10006531
980 Ga0207707_10010905
981 Ga0207707_10052167
982 Ga0207707_10116094
983 Ga0207707_10158776
984 Ga0207695_10101621
985 Ga0207695_10160346
986 Ga0207695_10523099
987 Ga0207671_10251629
988 Ga0207693_10022149
989 Ga0207693_10236881
990 Ga0207693_10284208
991 Ga0207663_10007458
992 Ga0207663_10020666
993 Ga0207663_10420611
994 Ga0207660_10003314
995 Ga0207660_10005427
996 Ga0207660_10163787
997 Ga0207662_10000257
998 Ga0207657_10175795
999 Ga0207652_10054007
1000 Ga0207652_10091976
1001 Ga0207652_10111925
1002 Ga0207652_10160767
1003 Ga0207652_10242187
1004 Ga0207646_10141824
1005 Ga0207681_10272069
1006 Ga0207694_10137667
1007 Ga0207694_10182753
1008 Ga0207694_10374296
1009 Ga0207650_10000755
1010 Ga0207650_10033881
1011 Ga0207650_10038912
1012 Ga0207659_10153418
1013 Ga0207687_10002535
1014 Ga0207700_10073659
1015 Ga0207700_10076027
1016 Ga0207664_10024659
1017 Ga0207664_10309373
1018 Ga0207644_10031985
1019 Ga0207690_10198807
1020 Ga0207706_10139274
1021 Ga0207706_10260936
1022 Ga0207706_10292435
1023 Ga0207686_10014985
1024 Ga0207686_10189717
1025 Ga0207709_10000662
1026 Ga0207670_10000333
1027 Ga0207670_10019566
1028 Ga0207670_10020940
1029 Ga0207669_10008101
1030 Ga0207669_10131182
1031 Ga0207704_10000798
1032 Ga0207665_10016681
1033 Ga0207665_10037567
1034 Ga0207665_10047923
1035 Ga0207691_10000111
1036 Ga0207711_10046527
1037 Ga0207711_10055281
1038 Ga0207711_10341912
1039 Ga0207689_10001220
1040 Ga0207689_10058526
1041 Ga0207661_10180377
1042 Ga0207679_10022808
1043 Ga0207667_10011463
1044 Ga0207712_10005184
1045 Ga0207712_10048334
1046 Ga0207712_10189266
1047 Ga0207712_10424833
1048 Ga0207668_10010308
1049 Ga0207640_10004352
1050 Ga0207677_10007406
1051 Ga0207677_10110902
1052 Ga0207703_10012669
1053 Ga0207639_10039646
1054 Ga0207678_10212785
1055 Ga0207708_10026788
1056 Ga0207708_10185508
1057 Ga0207641_10009740
1058 Ga0207641_10554512
1059 Ga0207648_10001304
1060 Ga0207648_10051080
1061 Ga0207676_10013839
1062 Ga0207676_10029629
1063 Ga0207676_10093345
1064 Ga0207676_10120653
1065 Ga0207676_10150236
1066 Ga0207676_10155810
1067 Ga0207676_10652179
1068 Ga0207674_10002654
1069 Ga0207674_10427398
1070 Ga0207675_100000900
1071 Ga0207675_100126069
1072 Ga0207675_100166216
1073 Ga0207683_10124655
1074 Ga0207698_10142103
1075 Ga0209981_1009121
1076 Ga0210000_1003803
1077 Ga0209995_1005172
1078 Ga0209179_1018216
1079 Ga0209999_1000224
1080 Ga0209971_1003504
1081 Ga0207428_10000321
1082 Ga0268266_10579842
1083 Ga0268265_10005803
1084 Ga0268265_10022862
1085 Ga0268265_10151052
1086 Ga0268264_10002472
1087 Ga0268264_10010548
1088 Ga0265337_1001602
1089 Ga0265334_10000375
1090 Ga0265318_10041313
1091 Ga0265338_10017937
1092 Ga0265338_10350025
1093 Ga0265763_1003160
1094 Ga0265773_1000857
1095 Ga0265760_10000047
1096 Ga0265760_10015385
1097 Ga0265332_10001912
1098 Ga0265325_10082095
1099 Ga0265329_10034773
1100 Ga0265340_10074939
1101 Ga0265340_10097753
1102 Ga0265339_10094469
1103 Ga0265331_10001152
1104 Ga0265331_10050864
1105 Ga0265327_10008379
1106 Ga0265316_10011233
1107 Ga0265316_10086493
1108 Ga0265316_10159803
1109 Ga0265316_10196482
1110 Ga0265313_10022761
1111 Ga0316575_10069388
1112 Ga0265314_10052822
1113 Ga0265342_10034953
1114 Ga0316583_10005706
1115 Ga0316583_10010840
1116 Ga0373948_0049079
1117 Ga0373958_0006089
1118 Ga0373938_0033690
1119 Ga0373926_0003071
1120 Ga0373929_0022841
1121 Ga0373934_0003290
1122 Ga0373944_0008921
1123 Ga0373944_0044245
1124 Ga0373951_0005912
1125 Ga0373952_0003713
1126 Ga0373923_0001304
1127 Ga0373923_0002059
1128 Ga0373932_0001983
1129 Ga0373936_0015532
1130 Ga0373945_0003484
1131 Ga0373945_0081580
1132 Ga0373953_0007096
1133 Ga0373953_0091230
1134 Ga0373954_0071290
1135 Ga0373956_0024074
1136 Ga0373956_0028579
1137 Ga0373956_0032496
1138 Ga0373957_0016394
1139 Ga0373957_0030278
1140 Ga0373957_0050234
1141 Ga0373943_0121335
1142 Ga0373943_0125620
1143 Ga0373946_0013656
1144 Ga0373946_0030201
1145 Ga0373955_0002912
1146 Ga0373955_0006619
1147 Ga0373955_0240434
1148 Ga0373942_0017709
1149 Ga0373942_0047035
1150 Ga0373961_0008257
1151 Ga0373962_0004129
1152 Ga0373962_0041455
1153 Ga0373924_0003392
1154 Ga0373924_0020013
1155 Ga0373931_0000134
1156 Ga0373931_0000527
1157 Ga0373931_0146300
1158 Ga0373935_0000023
1159 Ga0373935_0043610
1160 Ga0373935_0178833
1161 Ga0373927_0013020
1162 Ga0373927_0020220
1163 Ga0373927_0072642
1164 Ga0373927_0138116
1165 Ga0373933_0001503
1166 Ga0373933_0004140
1167 Ga0373933_0011490
1168 Ga0373933_0110468
1169 Ga0373933_0335369
1170 Ga0373947_0034944
1171 Ga0373947_0052015
1172 Ga0373947_0070482
1173 Ga0373947_0110891
1174 Ga0373937_0000005
1175 Ga0373937_0008905
1176 Ga0373937_0009993
1177 Ga0373937_0010352
1178 Ga0373937_0037259
1179 Ga0373937_0105465
1180 Ga0373937_0117828
1181 Ga0373937_0539792
1182 Ga0373937_0621726
1183 Ga0373925_0000007
1184 Ga0373925_0131036
1185 Ga0373925_0132701
1186 Ga0395900_0124004
1187 Ga0395898_0479176
1188 Ga0436364_0517196
1189 Ga0436364_0545974
1190 Ga0436364_0792117
1191 Ga0436364_1264330
1192 Ga0395901_0342469
1193 Ga0436365_0007149
1194 Ga0436365_0053879
1195 Ga0436365_0194703
1196 Ga0436365_1568906
1197 Ga0436365_1775777
1198 Ga0436361_0198664
1199 Ga0436361_1030002
1200 Ga0436363_1007941
1201 Ga0436362_0084740
1202 Ga0436362_0463249
1203 Ga0439453_0007104
1204 Ga0451843_1115200
1205 Ga0439443_001183
1206 Ga0439462_0061194
1207 Ga0439434_0000107
1208 Ga0439435_0000076
1209 Ga0439459_0022125
1210 Ga0451577_0000271
1211 Ga0451577_0100523
1212 Ga0439440_0009845
1213 Ga0453683_0044375
1214 Ga0466963_0016237
1215 Ga0453684_0000005
1216 Ga0453684_0000702
1217 Ga0466959_0271343
1218 Ga0451576_0000259
1219 Ga0451576_0001387
1220 Ga0451576_0084222
1221 Ga0451576_0191270
1222 Ga0466958_0018526
1223 Ga0466958_0029981
1224 Ga0466967_0597600
1225 Ga0466967_0641016
1226 Ga0495592_0007203
1227 Ga0495592_0038795
1228 Ga0495592_0299512
1229 Ga0495592_0307644
1230 Ga0495629_0124144
1231 Ga0495641_0172349
1232 Ga0495651_0007669
1233 Ga0495651_0021971
1234 Ga0495651_0131162
1235 Ga0495651_0143839
1236 Ga0495653_0000308
1237 Ga0495653_0037741
1238 Ga0495580_0058208
1239 Ga0495582_0070919
1240 Ga0495639_0026503
1241 Ga0495639_0074976
1242 Ga0495662_0067201
1243 Ga0495662_0110862
1244 Ga0495664_0000003
1245 Ga0495608_0000072
1246 Ga0495608_0040305
1247 Ga0495608_0164578
1248 Ga0495618_0000019
1249 Ga0495628_0000015
1250 Ga0495630_0086282
1251 Ga0495630_0201427
1252 Ga0495663_0057507
1253 Ga0495652_0000006
1254 Ga0495652_0039030
1255 Ga0495652_0150938
1256 Ga0495652_0277550
1257 Ga0495665_0008768
1258 Ga0495640_0000002
1259 Ga0495640_0007626
1260 Ga0495640_0041058
1261 Ga0495640_0063367
1262 Ga0495586_0001019
1263 Ga0495587_0000001
1264 Ga0495587_0021836
1265 Ga0495598_0009561
1266 Ga0495621_0067267
1267 Ga0495645_0002525
1268 Ga0495645_0034491
1269 Ga0495667_0000021
1270 Ga0495667_0002416
1271 Ga0495667_0015887
1272 Ga0495667_0163925
1273 Ga0495656_0011244
1274 Ga0495634_0000251
1275 Ga0495634_0031218
1276 Ga0495634_0039011
1277 Ga0495635_0000001
1278 Ga0495635_0224562
1279 Ga0495588_0158435
1280 Ga0495657_0000486
1281 Ga0495657_0013370
1282 Ga0495657_0057797
1283 Ga0495599_0000203
1284 Ga0495599_0008955
1285 Ga0495623_0000058
1286 Ga0495623_0014003
1287 Ga0495646_0000003
1288 Ga0495646_0086748
1289 Ga0495647_0002041
1290 Ga0495658_0021666
1291 Ga0495658_0036355
1292 Ga0495658_0153884
1293 Ga0495613_0097049
1294 Ga0495613_0105937
1295 Ga0495624_0019722
1296 Ga0495600_0000002
1297 Ga0495581_0018810
1298 Ga0495604_0000001
1299 Ga0495674_0000018
1300 Ga0495674_0069384
1301 Ga0495674_0127364
1302 Ga0495672_0153398
1303 Ga0495676_0053798
1304 Ga0495680_0010419
1305 Ga0495680_0153732
1306 Ga0495680_0212157
1307 Ga0495675_0004157
1308 Ga0495685_075953
1309 Ga0495684_0000010
1310 Ga0495684_0107449
1311 Ga0495684_0127497
1312 Ga0495686_0005805
1313 Ga0495593_0007996
1314 Ga0495602_0013088
1315 Ga0495602_0047037
1316 Ga0495602_0077381
1317 Ga0495602_0129015
1318 Ga0495615_0005053
1319 Ga0496100_0005463
1320 Ga0496100_0023107
1321 Ga0496101_0001025
1322 Ga0496101_0008677
1323 Ga0496101_0105891
1324 Ga0496101_0177833
1325 Ga0496102_0010694
1326 Ga0496102_0083681
1327 Ga0496102_0151094
1328 Ga0496104_0012586
1329 Ga0496104_0020110
1330 Ga0496104_0122893
1331 Ga0496104_0484046
1332 Ga0496105_0005567
1333 Ga0496105_0011176
1334 Ga0496105_0050257
1335 Ga0496105_0093951
1336 Ga0496106_0005238
1337 Ga0496106_0023192
1338 Ga0496106_0481803
1339 Ga0496107_0007469
1340 Ga0496107_0037391
1341 Ga0496107_0153995
1342 Ga0496108_0002364
1343 Ga0496108_0158088
1344 Ga0496109_0002461
1345 Ga0496109_0098137
1346 Ga0496109_0105357
1347 Ga0496110_0003528
1348 Ga0496111_0003518
1349 Ga0496111_0005819
1350 Ga0496111_0018422
1351 Ga0496112_0037915
1352 Ga0496112_0039123
1353 Ga0496112_0259022
1354 Ga0496112_0339616
1355 Ga0496113_0001647
1356 Ga0496113_0030542
1357 Ga0496113_0243154
1358 Ga0496114_0027134
1359 Ga0496114_0057372
1360 Ga0496114_0101836
1361 Ga0496114_0224615
1362 Ga0496115_0023215
1363 Ga0496115_0063615
1364 Ga0496115_0172335
1365 Ga0496115_0182799
1366 Ga0501031_0001402
1367 Ga0501031_0084930
1368 Ga0501032_0078518
1369 Ga0501032_0166759
1370 Ga0501033_0043905
1371 Ga0501034_0124229
1372 Ga0501036_0009279
1373 Ga0501036_0022892
1374 Ga0501037_0041056
1375 Ga0501037_0135876
1376 Ga0501038_0030524
1377 Ga0501038_0282115
1378 Ga0501039_0001656
1379 Ga0501039_0016247
1380 Ga0501039_0019439
1381 Ga0501039_0050190
1382 Ga0501039_0229314
1383 Ga0501040_0001034
1384 Ga0501040_0055715
1385 Ga0501040_0158395
1386 Ga0501040_0244760
1387 Ga0501041_0000600
1388 Ga0501041_0009888
1389 Ga0501041_0108169
1390 Ga0501042_0004577
1391 Ga0501042_0163849
1392 Ga0501042_0206908
1393 Ga0501043_0027712
1394 Ga0501043_0041339
1395 Ga0501043_0156209
1396 Ga0501043_0395959
1397 Ga0501046_0001057
1398 Ga0501047_0237969
1399 Ga0501047_0270201
1400 Ga0501048_0011924
1401 Ga0501048_0028075
1402 Ga0501067_0125492
1403 Ga0501068_0091679
1404 Ga0501068_0159126
1405 Ga0501069_0012334
1406 Ga0501070_0104679
1407 Ga0501070_0402055
1408 Ga0501071_0044976
1409 Ga0501071_0088441
1410 Ga0501071_0395787
1411 Ga0501072_0001862
1412 Ga0501072_0016678
1413 Ga0501072_0017593
1414 Ga0501073_0128997
1415 Ga0501073_0222767
1416 Ga0501074_0013084
1417 Ga0501074_0025976
1418 Ga0501074_0055668
1419 Ga0501074_0354262
1420 Ga0501075_0003996
1421 Ga0501075_0110729
1422 Ga0501075_0352584
1423 Ga0501076_0000348
1424 Ga0501076_0018281
1425 Ga0501076_0031097
1426 Ga0501076_0108342
1427 Ga0501076_0173494
1428 Ga0501077_0003407
1429 Ga0501077_0109152
1430 Ga0501077_0130945
1431 Ga0501079_0000859
1432 Ga0501079_0032191
1433 Ga0501080_0127286
1434 Ga0501080_0160347
1435 Ga0501080_0199128
1436 Ga0501080_0245104
1437 Ga0501080_0276804
1438 Ga0501080_0292729
1439 Ga0501080_0317839
1440 Ga0501081_0000131
1441 Ga0501081_0019448
1442 Ga0501081_0089723
1443 Ga0501035_0100369
1444 Ga0501045_0014083
1445 Ga0501045_0018427
1446 Ga0501045_0155039
1447 Ga0501045_0339121
1448 nmdc:mga0k408_12633_c1
1449 nmdc:mga05p37_132_c1
1450 nmdc:mga05p37_609629_c1
1451 nmdc:mga09592_418_c1
1452 nmdc:mga0qj67_131227_c1
1453 nmdc:mga0qj67_160_c1
1454 nmdc:mga0qj67_540390_c1
1455 nmdc:mga06r32_215226_c1
1456 nmdc:mga08y16_322332_c1
1457 nmdc:mga08y16_433706_c1
1458 nmdc:mga08y16_9476_c1
1459 nmdc:mga0n895_763344_c1
1460 nmdc:mga0rr50_134505_c1
1461 nmdc:mga0rr50_7459_c1
1462 nmdc:mga0a205_195989_c1
1463 Ga0495601_0000001
1464 Ga0495601_0000243
1465 Ga0495601_0022082
1466 Ga0495612_0000063
1467 Ga0495612_0044245
1468 Ga0495612_0117990
1469 Ga0495595_0002319
1470 Ga0495595_0025827
1471 Ga0495595_0073981
1472 Ga0495619_0000004
1473 Ga0495619_0008423
1474 Ga0495619_0016217
1475 Ga0495619_0086716
1476 Ga0500643_032714
1477 Ga0500641_0005553
1478 Ga0500593_000250
1479 Ga0500652_035217
1480 Ga0501084_0003474
1481 Ga0501084_0064199
1482 Ga0501084_0071132
1483 Ga0501084_0209400
1484 Ga0501082_0000205
1485 Ga0501082_0002832
1486 Ga0501082_0008926
1487 Ga0501082_0025577
1488 Ga0501082_0112881
1489 Ga0501082_0376639
1490 Ga0530510_0000425
1491 Ga0530510_0064402
1492 2643999141

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02900

LigB

Catalytic LigB subunit of aromatic ring-opening dioxygenase

6

275

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bou-assembly1.cif.gz_D three-dimensional structure of ligab 0.9852 3 281
3wrc-assembly1.cif.gz_A crystal structure of the anaerobic desb-protocatechuate (pca) complex 0.9475 3 291
3wku-assembly1.cif.gz_B crystal structure of the anaerobic desb-gallate complex 0.9449 3 291
1bou-assembly1.cif.gz_D three-dimensional structure of ligab 0.9417 3 281
3wrb-assembly1.cif.gz_A crystal structure of the anaerobic h124f desb-gallate complex 0.9371 3 291
ID Description Score Start End Superfamily
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9848 3 281 3.40.830.10
3wrcA01 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9475 3 291 3.40.830.10
1bouB00 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.9414 3 281 3.40.830.10
3wrcA01 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8837 3 291 3.40.830.10
af_P0ABR9_4_309_3.40.830.10 Alpha Beta;3-Layer(aba) Sandwich;Protocatechuate 4,5-dioxygenase; Chain B;LigB-like 0.8546 7 274 3.40.830.10
ID Description Score Start End GO Terms
AF-A0A3D0WE34-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9902 1 194 GO:0008198
GO:0051213
AF-A0A258WZS1-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9898 1 183 GO:0008198
GO:0051213
AF-A0A1W6CP41-F1-model_v4 Protocatechuate 4,5-dioxygenase subunit alpha 0.9894 2 278 GO:0008198
GO:0018579
AF-A0A520PGN3-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.988 81 278 GO:0008198
GO:0051213
AF-A0A537VV32-F1-model_v4 Protocatechuate 3,4-dioxygenase 0.9878 1 281 GO:0008198
GO:0051213

Map