F478876

General Info

Members Datasets Scaffolds Average Seq Length
746 310 746 276

Family's Representative Sequence

Representative Sequence 3300035692|Ga0373935_0142744|Ga0373935_0142744_402_1295
Length 297
Sequence VVRGLPVDFAGNFISILLGGLSAGTVLFIVSVGLSVTMGLMGFVNLAHGAFAMFGGYVIVLAMNRAHIGFGPALALGFFATAALSAVLERLFYRRLYRAGELDQVLFTIGLIFIFIAGITITVGPESQPFELPPALGGQLNLGFLRYRTYSVFLIGVGLVIVLGIWLAFERTRIGAQIRATVDNRRMAESLGINVDRLFTITFAFGSGMAALGGGLGAEFLGLDPQYALKYLVYFLIVVSVGGLGSVVGVYYASLLLGVLDFVLKLYLPKGGTIFIYALTILLLLWRPRGLFGRKET

Samples

Sample ID Description Type Environment
1 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
21 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
28 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
29 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
30 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
31 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
35 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
36 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
37 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
38 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
39 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
50 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
51 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
74 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
75 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
76 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
81 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
82 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
83 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
90 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
93 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
141 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
145 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
146 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
149 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
150 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
151 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
152 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
153 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
154 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
155 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
156 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
157 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
158 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
159 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
160 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
161 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
162 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
163 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
164 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
165 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
166 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
167 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
168 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
169 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
170 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
171 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
172 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
173 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
174 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
175 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
176 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
177 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
178 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
179 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
180 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
181 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
182 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
183 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
184 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
185 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
186 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
187 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
188 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
189 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
190 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
191 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
192 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
193 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
194 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
195 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
196 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
197 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
198 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
199 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
200 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
201 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
202 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
203 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
204 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
205 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
206 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
207 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
208 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
209 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
210 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
211 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
212 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
213 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
214 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
215 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
216 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
217 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
218 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
219 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
220 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
221 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
222 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
223 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
224 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
225 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
226 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
227 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
228 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
229 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
230 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
233 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
234 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
235 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
236 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
237 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
238 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
239 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
240 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
241 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
242 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
243 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
244 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
245 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
246 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
247 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
248 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
249 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
256 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
260 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
267 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
268 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
271 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
272 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
273 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
274 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
275 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
276 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
277 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
278 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
279 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
280 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
281 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
282 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
283 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
284 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
285 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
286 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
287 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
290 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
291 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
292 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
293 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
294 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
295 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
296 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
297 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
298 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
301 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
302 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
303 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
304 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
305 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
306 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
307 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
308 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
309 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
310 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.94
Nodule 0
Rhizoplane 0.94
Rhizosphere 97.45
Stem 0
Stem Tuber 0
Unclassified 0.67

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10027630 3300003203 Bacteria 2172
2 rootH2_10025714 3300003320 Bacteria 2328
3 Ga0065707_10002051 3300005295 Bacteria 5089
4 Ga0065707_10111808 3300005295 Bacteria 2365
5 Ga0070690_100000653 3300005330 Bacteria 17691
6 Ga0070670_100026073 3300005331 Bacteria 5030
7 Ga0068869_100001162 3300005334 Bacteria 15404
8 Ga0068869_100066505 3300005334 Bacteria 2656
9 Ga0070680_100000316 3300005336 Bacteria 32375
10 Ga0070680_100160762 3300005336 Bacteria 1887
11 Ga0070680_100207651 3300005336 Bacteria 1652
12 Ga0070680_100412018 3300005336 Bacteria 1153
13 Ga0070680_100427051 3300005336 Bacteria 1131
14 Ga0070682_100004386 3300005337 Bacteria 7828
15 Ga0070682_100341576 3300005337 Bacteria 1113
16 Ga0068868_100010897 3300005338 Bacteria 6599
17 Ga0070689_100000894 3300005340 Bacteria 18602
18 Ga0070689_100008707 3300005340 Bacteria 7161
19 Ga0070691_10000398 3300005341 Bacteria 15821
20 Ga0070691_10221389 3300005341 Bacteria 1003
21 Ga0070687_100000276 3300005343 Bacteria 17428
22 Ga0070687_100073859 3300005343 Bacteria 1839
23 Ga0070661_100109888 3300005344 Bacteria 2058
24 Ga0070692_10002206 3300005345 Bacteria 7459
25 Ga0070668_100285025 3300005347 Bacteria 1381
26 Ga0070669_100067077 3300005353 Bacteria 2646
27 Ga0070669_100459059 3300005353 Bacteria 1051
28 Ga0070675_100026546 3300005354 Bacteria 4649
29 Ga0070673_100094834 3300005364 Bacteria 2447
30 Ga0070673_100162262 3300005364 Bacteria 1901
31 Ga0070659_100435103 3300005366 Bacteria 1111
32 Ga0070713_100039482 3300005436 Bacteria 3831
33 Ga0070713_100201362 3300005436 Bacteria 1798
34 Ga0070701_10001480 3300005438 Bacteria 8702
35 Ga0070701_10040690 3300005438 Bacteria 2364
36 Ga0070711_100076959 3300005439 Bacteria 2366
37 Ga0070705_100004348 3300005440 Bacteria 6897
38 Ga0070705_100198031 3300005440 Bacteria 1375
39 Ga0070700_100007422 3300005441 Bacteria 5919
40 Ga0070700_100103454 3300005441 Bacteria 1880
41 Ga0070700_100242256 3300005441 Bacteria 1289
42 Ga0070694_100006857 3300005444 Bacteria 6922
43 Ga0070694_100054318 3300005444 Bacteria 2713
44 Ga0070694_100093076 3300005444 Bacteria 2118
45 Ga0070694_100144062 3300005444 Bacteria 1734
46 Ga0070708_100011239 3300005445 Bacteria 7281
47 Ga0070708_100025847 3300005445 Bacteria 5021
48 Ga0070708_100386375 3300005445 Bacteria 1320
49 Ga0070663_100003060 3300005455 Bacteria 9564
50 Ga0070663_100149820 3300005455 Unclassified 1788
51 Ga0070678_100041474 3300005456 Bacteria 3263
52 Ga0070678_100060922 3300005456 Bacteria 2780
53 Ga0070662_100441647 3300005457 Bacteria 1079
54 Ga0070681_10008315 3300005458 Bacteria 10163
55 Ga0070681_10021340 3300005458 Bacteria 6493
56 Ga0070681_10036856 3300005458 Bacteria 4910
57 Ga0070681_10045917 3300005458 Bacteria 4368
58 Ga0070681_10125831 3300005458 Bacteria 2495
59 Ga0068867_100001833 3300005459 Bacteria 14816
60 Ga0068867_100115501 3300005459 Bacteria 2067
61 Ga0070707_100017423 3300005468 Bacteria 6753
62 Ga0070707_100039291 3300005468 Bacteria 4521
63 Ga0070707_100094384 3300005468 Bacteria 2897
64 Ga0070707_100227657 3300005468 Bacteria 1815
65 Ga0070698_100250777 3300005471 Bacteria 1703
66 Ga0070698_100600196 3300005471 Bacteria 1041
67 Ga0070699_100017254 3300005518 Bacteria 6199
68 Ga0070699_100077753 3300005518 Bacteria 2889
69 Ga0070699_100162339 3300005518 Bacteria 1978
70 Ga0070679_100120679 3300005530 Bacteria 2607
71 Ga0070684_100314114 3300005535 Bacteria 1439
72 Ga0070697_100012815 3300005536 Bacteria 6567
73 Ga0070697_100070159 3300005536 Bacteria 2872
74 Ga0070686_100003380 3300005544 Bacteria 8744
75 Ga0070686_100004094 3300005544 Bacteria 8022
76 Ga0070686_100180674 3300005544 Bacteria 1499
77 Ga0070686_100218212 3300005544 Bacteria 1377
78 Ga0070695_100000250 3300005545 Bacteria 26956
79 Ga0070695_100052646 3300005545 Bacteria 2616
80 Ga0070695_100086410 3300005545 Bacteria 2084
81 Ga0070695_100146414 3300005545 Bacteria 1644
82 Ga0070695_100331997 3300005545 Bacteria 1134
83 Ga0070696_100000358 3300005546 Bacteria 27825
84 Ga0070696_100013575 3300005546 Bacteria 5468
85 Ga0070696_100014903 3300005546 Bacteria 5220
86 Ga0070696_100062314 3300005546 Bacteria 2610
87 Ga0070696_100263188 3300005546 Bacteria 1308
88 Ga0070693_100000395 3300005547 Bacteria 19874
89 Ga0070693_100043723 3300005547 Bacteria 2531
90 Ga0070665_100040455 3300005548 Bacteria 4686
91 Ga0070704_100000203 3300005549 Bacteria 24666
92 Ga0070704_100006684 3300005549 Bacteria 6818
93 Ga0070704_100011525 3300005549 Bacteria 5423
94 Ga0070704_100034318 3300005549 Bacteria 3439
95 Ga0070704_100095595 3300005549 Bacteria 2226
96 Ga0070704_100232428 3300005549 Bacteria 1505
97 Ga0068855_100001461 3300005563 Bacteria 29501
98 Ga0070664_100556784 3300005564 Bacteria 1060
99 Ga0068856_100007042 3300005614 Bacteria 10984
100 Ga0070702_100000049 3300005615 Bacteria 33090
101 Ga0070702_100048738 3300005615 Bacteria 2412
102 Ga0068859_100007613 3300005617 Bacteria 11007
103 Ga0068859_100070873 3300005617 Bacteria 3521
104 Ga0068859_100268948 3300005617 Bacteria 1796
105 Ga0068864_100020028 3300005618 Bacteria 5594
106 Ga0068864_100320476 3300005618 Bacteria 1456
107 Ga0068866_10001779 3300005718 Bacteria 9074
108 Ga0068861_100000724 3300005719 Bacteria 19764
109 Ga0068861_100064383 3300005719 Bacteria 2820
110 Ga0068863_100109611 3300005841 Bacteria 2628
111 Ga0068863_100430284 3300005841 Bacteria 1294
112 Ga0068858_100001186 3300005842 Bacteria 26972
113 Ga0068858_100175512 3300005842 Bacteria 2022
114 Ga0068858_100295868 3300005842 Bacteria 1544
115 Ga0068860_100011480 3300005843 Bacteria 8729
116 Ga0068860_100121194 3300005843 Bacteria 2504
117 Ga0068862_100001819 3300005844 Bacteria 19319
118 Ga0068862_100015881 3300005844 Bacteria 6257
119 Ga0068862_100067372 3300005844 Bacteria 3086
120 Ga0068862_100118360 3300005844 Bacteria 2332
121 Ga0081455_10019376 3300005937 Bacteria 6439
122 Ga0081538_10029612 3300005981 Bacteria 3737
123 Ga0081539_10002942 3300005985 Bacteria 22406
124 Ga0070717_10014290 3300006028 Bacteria 6106
125 Ga0070717_10458375 3300006028 Bacteria 1149
126 Ga0070712_100003673 3300006175 Bacteria 9460
127 Ga0070712_100014383 3300006175 Bacteria 5080
128 Ga0070712_100069108 3300006175 Bacteria 2519
129 Ga0097621_100000594 3300006237 Bacteria 25505
130 Ga0097621_100001811 3300006237 Bacteria 14680
131 Ga0068871_100000636 3300006358 Bacteria 24113
132 Ga0068871_100006653 3300006358 Bacteria 8198
133 Ga0075428_100005156 3300006844 Bacteria 14525
134 Ga0075428_100023200 3300006844 Bacteria 6863
135 Ga0075428_100023887 3300006844 Bacteria 6765
136 Ga0075428_100055884 3300006844 Bacteria 4324
137 Ga0075428_100548290 3300006844 Bacteria 1236
138 Ga0075430_100007795 3300006846 Bacteria 9046
139 Ga0075430_100009297 3300006846 Bacteria 8307
140 Ga0075430_100371793 3300006846 Bacteria 1180
141 Ga0075430_100438819 3300006846 Bacteria 1078
142 Ga0075431_100012271 3300006847 Bacteria 8647
143 Ga0075431_100062084 3300006847 Bacteria 3856
144 Ga0075431_100206942 3300006847 Bacteria 2006
145 Ga0075431_100329387 3300006847 Bacteria 1538
146 Ga0075433_10001970 3300006852 Bacteria 15441
147 Ga0075433_10209650 3300006852 Bacteria 1732
148 Ga0075434_100000363 3300006871 Bacteria 32902
149 Ga0075434_100001019 3300006871 Bacteria 22804
150 Ga0075434_100006687 3300006871 Bacteria 10587
151 Ga0075434_100030615 3300006871 Bacteria 5301
152 Ga0075434_100411398 3300006871 Bacteria 1374
153 Ga0075429_100012195 3300006880 Bacteria 7451
154 Ga0075429_100026172 3300006880 Bacteria 5063
155 Ga0075429_100029269 3300006880 Bacteria 4784
156 Ga0075429_100043503 3300006880 Bacteria 3908
157 Ga0075429_100095932 3300006880 Bacteria 2586
158 Ga0075429_100327184 3300006880 Bacteria 1341
159 Ga0075429_100366528 3300006880 Bacteria 1261
160 Ga0068865_100000086 3300006881 Bacteria 49762
161 Ga0068865_100076690 3300006881 Bacteria 2386
162 Ga0075436_100003384 3300006914 Bacteria 10925
163 Ga0097620_100007612 3300006931 Bacteria 11007
164 Ga0097620_100070873 3300006931 Bacteria 3521
165 Ga0097620_100268929 3300006931 Bacteria 1796
166 Ga0075435_100002255 3300007076 Bacteria 12730
167 Ga0075435_100004201 3300007076 Bacteria 9880
168 Ga0075435_100008212 3300007076 Bacteria 7476
169 Ga0075435_100021842 3300007076 Bacteria 4930
170 Ga0075435_100456166 3300007076 Bacteria 1102
171 Ga0075435_100563858 3300007076 Bacteria 987
172 Ga0099794_10027033 3300007265 Bacteria 2657
173 Ga0099795_10014013 3300007788 Bacteria 2475
174 Ga0099795_10065966 3300007788 Bacteria 1354
175 Ga0105240_10495475 3300009093 Bacteria 1359
176 Ga0111539_10012911 3300009094 Bacteria 10452
177 Ga0111539_10016090 3300009094 Bacteria 9283
178 Ga0111539_10035931 3300009094 Bacteria 5997
179 Ga0111539_10111614 3300009094 Bacteria 3208
180 Ga0111539_10125703 3300009094 Bacteria 3005
181 Ga0111539_10254995 3300009094 Bacteria 2043
182 Ga0105245_10016415 3300009098 Bacteria 6458
183 Ga0114129_10004560 3300009147 Bacteria 19550
184 Ga0114129_10007276 3300009147 Bacteria 15756
185 Ga0114129_10273023 3300009147 Bacteria 2261
186 Ga0114129_10480300 3300009147 Bacteria 1626
187 Ga0105243_10002776 3300009148 Bacteria 14554
188 Ga0105243_10007856 3300009148 Bacteria 8198
189 Ga0105242_10002839 3300009176 Bacteria 13572
190 Ga0105242_10025315 3300009176 Bacteria 4695
191 Ga0105248_10015963 3300009177 Bacteria 8269
192 Ga0105248_10384125 3300009177 Bacteria 1581
193 Ga0105237_10087014 3300009545 Bacteria 3114
194 Ga0105237_10864467 3300009545 Bacteria 911
195 Ga0105238_10212104 3300009551 Bacteria 1912
196 Ga0105249_10014761 3300009553 Bacteria 6905
197 Ga0105249_10085032 3300009553 Bacteria 2947
198 Ga0105249_10159566 3300009553 Bacteria 2178
199 Ga0099796_10065582 3300010159 Unclassified 1298
200 Ga0105239_10049635 3300010375 Bacteria 4601
201 Ga0105239_10314128 3300010375 Bacteria 1766
202 Ga0157370_10069750 3300013104 Bacteria 3319
203 Ga0157369_10004736 3300013105 Bacteria 15983
204 Ga0157369_10327045 3300013105 Bacteria 1593
205 Ga0157378_10006675 3300013297 Bacteria 10080
206 Ga0163162_10086241 3300013306 Bacteria 3217
207 Ga0163162_10124295 3300013306 Bacteria 2686
208 Ga0157380_10090078 3300014326 Bacteria 2529
209 Ga0157380_10182156 3300014326 Bacteria 1847
210 Ga0157380_10255331 3300014326 Bacteria 1589
211 Ga0182008_10058954 3300014497 Bacteria 1894
212 Ga0157379_10026398 3300014968 Bacteria 5171
213 Ga0157376_10010862 3300014969 Bacteria 6685
214 Ga0207682_10124555 3300025893 Bacteria 1146
215 Ga0207692_10083868 3300025898 Bacteria 1711
216 Ga0207642_10002590 3300025899 Bacteria 5636
217 Ga0207685_10053098 3300025905 Bacteria 1573
218 Ga0207643_10013812 3300025908 Bacteria 4380
219 Ga0207684_10327467 3300025910 Bacteria 1320
220 Ga0207654_10013691 3300025911 Bacteria 4176
221 Ga0207654_10200616 3300025911 Bacteria 1313
222 Ga0207707_10007157 3300025912 Bacteria 9714
223 Ga0207707_10040112 3300025912 Bacteria 4091
224 Ga0207707_10043000 3300025912 Bacteria 3942
225 Ga0207707_10101383 3300025912 Bacteria 2516
226 Ga0207707_10338416 3300025912 Bacteria 1298
227 Ga0207693_10009873 3300025915 Bacteria 7764
228 Ga0207693_10020441 3300025915 Bacteria 5267
229 Ga0207693_10135052 3300025915 Bacteria 1939
230 Ga0207660_10260030 3300025917 Bacteria 1372
231 Ga0207660_10401908 3300025917 Bacteria 1103
232 Ga0207662_10005091 3300025918 Bacteria 6969
233 Ga0207652_10003435 3300025921 Bacteria 13073
234 Ga0207652_10088992 3300025921 Unclassified 2710
235 Ga0207652_10121522 3300025921 Bacteria 2324
236 Ga0207652_10267953 3300025921 Bacteria 1540
237 Ga0207646_10021399 3300025922 Bacteria 5977
238 Ga0207646_10038158 3300025922 Bacteria 4328
239 Ga0207646_10053131 3300025922 Bacteria 3624
240 Ga0207646_10179073 3300025922 Bacteria 1914
241 Ga0207681_10057877 3300025923 Bacteria 2651
242 Ga0207650_10244761 3300025925 Bacteria 1450
243 Ga0207659_10059815 3300025926 Bacteria 2740
244 Ga0207659_10066397 3300025926 Bacteria 2618
245 Ga0207687_10001793 3300025927 Bacteria 14780
246 Ga0207700_10029533 3300025928 Bacteria 3870
247 Ga0207700_10032214 3300025928 Bacteria 3736
248 Ga0207664_10059683 3300025929 Bacteria 3039
249 Ga0207706_10276872 3300025933 Bacteria 1464
250 Ga0207686_10001108 3300025934 Bacteria 15680
251 Ga0207686_10011236 3300025934 Bacteria 4897
252 Ga0207709_10000686 3300025935 Bacteria 27320
253 Ga0207670_10000865 3300025936 Bacteria 15917
254 Ga0207670_10004310 3300025936 Bacteria 7639
255 Ga0207670_10038240 3300025936 Bacteria 3133
256 Ga0207670_10080826 3300025936 Bacteria 2273
257 Ga0207704_10005370 3300025938 Bacteria 5905
258 Ga0207665_10211219 3300025939 Bacteria 1418
259 Ga0207691_10070970 3300025940 Bacteria 3144
260 Ga0207711_10014863 3300025941 Bacteria 6468
261 Ga0207711_10183546 3300025941 Bacteria 1903
262 Ga0207689_10000217 3300025942 Bacteria 51018
263 Ga0207689_10288909 3300025942 Bacteria 1358
264 Ga0207667_10007910 3300025949 Bacteria 12695
265 Ga0207651_10034267 3300025960 Bacteria 3286
266 Ga0207651_10082682 3300025960 Bacteria 2319
267 Ga0207712_10001713 3300025961 Bacteria 14726
268 Ga0207712_10065861 3300025961 Bacteria 2588
269 Ga0207712_10082894 3300025961 Bacteria 2339
270 Ga0207668_10015384 3300025972 Bacteria 4753
271 Ga0207677_10000917 3300026023 Bacteria 16496
272 Ga0207703_10002068 3300026035 Bacteria 17657
273 Ga0207703_10192367 3300026035 Bacteria 1808
274 Ga0207678_10051638 3300026067 Bacteria 3549
275 Ga0207678_10226784 3300026067 Bacteria 1599
276 Ga0207708_10006688 3300026075 Bacteria 8526
277 Ga0207708_10012751 3300026075 Bacteria 6268
278 Ga0207708_10094154 3300026075 Bacteria 2312
279 Ga0207702_10309683 3300026078 Bacteria 1501
280 Ga0207641_10045374 3300026088 Bacteria 3701
281 Ga0207648_10000217 3300026089 Bacteria 62158
282 Ga0207676_10013938 3300026095 Bacteria 5771
283 Ga0207674_10274278 3300026116 Bacteria 1634
284 Ga0207675_100000310 3300026118 Bacteria 46701
285 Ga0207675_100120855 3300026118 Bacteria 2478
286 Ga0209968_1005950 3300027526 Bacteria 1836
287 Ga0209968_1009412 3300027526 Bacteria 1495
288 Ga0209588_1008197 3300027671 Bacteria 3091
289 Ga0209588_1022947 3300027671 Bacteria 1965
290 Ga0209971_1022747 3300027682 Bacteria 1494
291 Ga0207428_10023439 3300027907 Bacteria 5191
292 Ga0207428_10024453 3300027907 Bacteria 5071
293 Ga0207428_10092501 3300027907 Bacteria 2347
294 Ga0268265_10037206 3300028380 Bacteria 3570
295 Ga0268265_10037771 3300028380 Bacteria 3546
296 Ga0268264_10002238 3300028381 Bacteria 17153
297 Ga0265338_10002492 3300028800 Bacteria 27463
298 Ga0265330_10075726 3300031235 Unclassified 1453
299 Ga0265320_10012678 3300031240 Bacteria 4889
300 Ga0265339_10012730 3300031249 Bacteria 5120
301 Ga0265331_10040004 3300031250 Unclassified 2283
302 Ga0307408_100145006 3300031548 Bacteria 1868
303 Ga0307405_10083056 3300031731 Bacteria 2099
304 Ga0307411_10140217 3300032005 Bacteria 1782
305 Ga0373930_0035979 3300034816 Bacteria 1037
306 Ga0373948_0015745 3300034817 Bacteria 1391
307 Ga0373950_0020867 3300034818 Bacteria 1155
308 Ga0373926_0001567 3300035083 Bacteria 7023
309 Ga0373926_0028169 3300035083 Bacteria 1971
310 Ga0373929_0019371 3300035085 Bacteria 1362
311 Ga0373934_0000157 3300035086 Bacteria 24724
312 Ga0373934_0006830 3300035086 Bacteria 4237
313 Ga0373940_0039834 3300035088 Bacteria 1287
314 Ga0373944_0002135 3300035089 Bacteria 5023
315 Ga0373944_0003108 3300035089 Bacteria 4273
316 Ga0373949_0013774 3300035090 Bacteria 1796
317 Ga0373951_0060492 3300035091 Bacteria 947
318 Ga0373923_0033757 3300035111 Bacteria 2073
319 Ga0373923_0039845 3300035111 Bacteria 1931
320 Ga0373932_0000678 3300035112 Bacteria 10295
321 Ga0373932_0064472 3300035112 Bacteria 1122
322 Ga0373936_0001836 3300035113 Bacteria 7815
323 Ga0373936_0003130 3300035113 Bacteria 6194
324 Ga0373936_0030376 3300035113 Bacteria 2130
325 Ga0373945_0011926 3300035116 Bacteria 2880
326 Ga0373945_0053500 3300035116 Bacteria 1490
327 Ga0373945_0166402 3300035116 Unclassified 901
328 Ga0373953_0055872 3300035117 Bacteria 1604
329 Ga0373953_0206265 3300035117 Bacteria 850
330 Ga0373954_0000008 3300035118 Bacteria 79963
331 Ga0373954_0010081 3300035118 Bacteria 4162
332 Ga0373954_0034191 3300035118 Bacteria 2353
333 Ga0373956_0000583 3300035119 Bacteria 14961
334 Ga0373956_0005070 3300035119 Bacteria 5271
335 Ga0373957_0005040 3300035120 Bacteria 4075
336 Ga0373957_0088953 3300035120 Bacteria 1225
337 Ga0373943_0000424 3300035170 Bacteria 17836
338 Ga0373943_0001830 3300035170 Bacteria 9615
339 Ga0373943_0003842 3300035170 Bacteria 6826
340 Ga0373946_0001859 3300035171 Bacteria 7373
341 Ga0373946_0006846 3300035171 Bacteria 4147
342 Ga0373946_0024318 3300035171 Bacteria 2373
343 Ga0373946_0028021 3300035171 Bacteria 2231
344 Ga0373955_0011974 3300035172 Bacteria 4156
345 Ga0373955_0028955 3300035172 Bacteria 2876
346 Ga0373955_0130705 3300035172 Bacteria 1465
347 Ga0373961_0008867 3300035241 Bacteria 2452
348 Ga0373961_0016204 3300035241 Bacteria 1918
349 Ga0373924_0000770 3300035410 Bacteria 9948
350 Ga0373924_0020915 3300035410 Bacteria 2548
351 Ga0373931_0024925 3300035691 Bacteria 3035
352 Ga0373931_0052045 3300035691 Bacteria 2182
353 Ga0373931_0053438 3300035691 Bacteria 2155
354 Ga0373931_0108977 3300035691 Bacteria 1568
355 Ga0373935_0000882 3300035692 Bacteria 16207
356 Ga0373935_0015092 3300035692 Bacteria 4664
357 Ga0373935_0015655 3300035692 Bacteria 4587
358 Ga0373935_0142744 3300035692 Bacteria 1619
359 Ga0373927_0000414 3300035695 Bacteria 32784
360 Ga0373927_0013439 3300035695 Bacteria 5441
361 Ga0373927_0015438 3300035695 Bacteria 5046
362 Ga0373933_0000480 3300035724 Bacteria 24930
363 Ga0373933_0001883 3300035724 Bacteria 12112
364 Ga0373933_0005143 3300035724 Bacteria 7137
365 Ga0373933_0027572 3300035724 Bacteria 3272
366 Ga0373933_0124057 3300035724 Bacteria 1619
367 Ga0373933_0171041 3300035724 Bacteria 1382
368 Ga0373947_0000275 3300035725 Bacteria 29242
369 Ga0373947_0003710 3300035725 Bacteria 9022
370 Ga0373947_0005057 3300035725 Bacteria 7723
371 Ga0373947_0058886 3300035725 Bacteria 2328
372 Ga0373947_0209665 3300035725 Bacteria 1278
373 Ga0373937_0000096 3300036401 Bacteria 81963
374 Ga0373937_0002785 3300036401 Bacteria 14599
375 Ga0373937_0008812 3300036401 Bacteria 8751
376 Ga0373937_0031700 3300036401 Bacteria 4791
377 Ga0373937_0190577 3300036401 Bacteria 1927
378 Ga0373937_0206013 3300036401 Bacteria 1850
379 Ga0373937_0318852 3300036401 Bacteria 1470
380 Ga0373925_0001290 3300037068 Bacteria 22022
381 Ga0373925_0005781 3300037068 Bacteria 9192
382 Ga0373925_0038766 3300037068 Bacteria 3524
383 Ga0373925_0053537 3300037068 Bacteria 3017
384 Ga0373925_0209329 3300037068 Unclassified 1553
385 Ga0395900_0016876 3300037418 Bacteria 7452
386 Ga0395900_0134190 3300037418 Bacteria 2536
387 Ga0395898_0013811 3300037466 Bacteria 8302
388 Ga0436364_1453265 3300037853 Bacteria 1023
389 Ga0395901_0001758 3300038443 Bacteria 22356
390 Ga0436362_0558861 3300039453 Bacteria 1225
391 Ga0451807_0878204 3300041486 Bacteria 2217
392 Ga0439443_001092 3300042003 Bacteria 2849
393 Ga0439435_0001580 3300042436 Bacteria 4265
394 Ga0439444_0014971 3300042437 Bacteria 1303
395 Ga0439460_0000144 3300042461 Bacteria 12838
396 Ga0439460_0029990 3300042461 Bacteria 1543
397 Ga0451577_0084711 3300042876 Bacteria 2828
398 Ga0451577_0165536 3300042876 Bacteria 1992
399 Ga0453683_0110500 3300044673 Bacteria 1729
400 Ga0466966_0071360 3300044684 Bacteria 2176
401 Ga0466966_0090757 3300044684 Bacteria 1897
402 Ga0466963_0011482 3300044694 Bacteria 5395
403 Ga0466963_0067816 3300044694 Bacteria 2395
404 Ga0466957_0171984 3300044842 Bacteria 1411
405 Ga0466957_0227552 3300044842 Bacteria 1233
406 Ga0466959_0432353 3300045049 Bacteria 893
407 Ga0451576_0000360 3300045051 Bacteria 109145
408 Ga0451576_0023021 3300045051 Bacteria 6751
409 Ga0451576_0344447 3300045051 Bacteria 1560
410 Ga0466958_0104697 3300045836 Bacteria 1762
411 Ga0466967_0186236 3300045976 Bacteria 1960
412 Ga0466967_0369068 3300045976 Bacteria 1392
413 Ga0466967_0925340 3300045976 Bacteria 867
414 Ga0495592_0020888 3300046454 Bacteria 4981
415 Ga0495592_0105245 3300046454 Bacteria 2004
416 Ga0495592_0112846 3300046454 Bacteria 1921
417 Ga0495592_0121564 3300046454 Bacteria 1836
418 Ga0495603_0000866 3300046455 Bacteria 17337
419 Ga0495651_0007473 3300046462 Bacteria 8356
420 Ga0495651_0246068 3300046462 Bacteria 1224
421 Ga0495653_0049761 3300046463 Bacteria 3226
422 Ga0495653_0164500 3300046463 Unclassified 1537
423 Ga0495653_0229995 3300046463 Bacteria 1241
424 Ga0495580_0003166 3300046472 Bacteria 14111
425 Ga0495580_0004091 3300046472 Bacteria 12296
426 Ga0495580_0069635 3300046472 Bacteria 2458
427 Ga0495580_0159317 3300046472 Bacteria 1562
428 Ga0495582_0036704 3300046473 Bacteria 2696
429 Ga0495582_0043162 3300046473 Bacteria 2483
430 Ga0495582_0052475 3300046473 Bacteria 2249
431 Ga0495639_0002543 3300046475 Bacteria 7956
432 Ga0495639_0017987 3300046475 Bacteria 3073
433 Ga0495662_0000261 3300046476 Bacteria 22323
434 Ga0495662_0010319 3300046476 Bacteria 4577
435 Ga0495662_0019341 3300046476 Bacteria 3293
436 Ga0495662_0191790 3300046476 Bacteria 1007
437 Ga0495664_0000736 3300046477 Bacteria 16729
438 Ga0495664_0051378 3300046477 Bacteria 2447
439 Ga0495584_0009947 3300046491 Bacteria 4887
440 Ga0495594_0155114 3300046499 Bacteria 1300
441 Ga0495608_0062105 3300046511 Bacteria 2455
442 Ga0495608_0362279 3300046511 Bacteria 891
443 Ga0495618_0009180 3300046514 Bacteria 5972
444 Ga0495618_0042587 3300046514 Bacteria 2862
445 Ga0495618_0209425 3300046514 Bacteria 1232
446 Ga0495628_0003204 3300046516 Bacteria 14671
447 Ga0495628_0010344 3300046516 Bacteria 7931
448 Ga0495628_0017152 3300046516 Bacteria 6032
449 Ga0495628_0253702 3300046516 Bacteria 1312
450 Ga0495630_0012216 3300046517 Bacteria 6230
451 Ga0495630_0013180 3300046517 Bacteria 6010
452 Ga0495630_0024458 3300046517 Bacteria 4465
453 Ga0495630_0038940 3300046517 Bacteria 3556
454 Ga0495630_0318686 3300046517 Bacteria 1188
455 Ga0495666_0023659 3300046526 Bacteria 3038
456 Ga0495666_0029459 3300046526 Bacteria 2701
457 Ga0495666_0103159 3300046526 Bacteria 1343
458 Ga0495652_0015892 3300046529 Bacteria 6737
459 Ga0495652_0061368 3300046529 Bacteria 3174
460 Ga0495652_0141803 3300046529 Bacteria 1889
461 Ga0495665_0008610 3300046531 Bacteria 5536
462 Ga0495665_0024309 3300046531 Bacteria 3254
463 Ga0495665_0030263 3300046531 Bacteria 2897
464 Ga0495665_0037998 3300046531 Bacteria 2568
465 Ga0495640_0002964 3300046533 Bacteria 13677
466 Ga0495640_0012112 3300046533 Bacteria 6604
467 Ga0495640_0030067 3300046533 Bacteria 3892
468 Ga0495640_0033135 3300046533 Bacteria 3672
469 Ga0495640_0101691 3300046533 Unclassified 1886
470 Ga0495586_0001814 3300046535 Bacteria 11645
471 Ga0495586_0006063 3300046535 Bacteria 6462
472 Ga0495587_0007969 3300046536 Bacteria 6844
473 Ga0495587_0009492 3300046536 Bacteria 6234
474 Ga0495587_0024154 3300046536 Bacteria 3729
475 Ga0495645_0001264 3300046543 Bacteria 17213
476 Ga0495645_0035117 3300046543 Bacteria 3656
477 Ga0495645_0105969 3300046543 Bacteria 1994
478 Ga0495667_0032581 3300046559 Bacteria 3492
479 Ga0495667_0196905 3300046559 Bacteria 1290
480 Ga0495667_0247899 3300046559 Bacteria 1134
481 Ga0495656_0032256 3300046615 Bacteria 2130
482 Ga0495656_0238836 3300046615 Bacteria 914
483 Ga0495634_0016009 3300046642 Bacteria 5371
484 Ga0495634_0026698 3300046642 Bacteria 4028
485 Ga0495634_0058277 3300046642 Bacteria 2574
486 Ga0495634_0080186 3300046642 Bacteria 2136
487 Ga0495635_0000438 3300046663 Bacteria 26330
488 Ga0495635_0324376 3300046663 Bacteria 1030
489 Ga0495659_0105319 3300046664 Bacteria 1096
490 Ga0495657_0027929 3300046675 Bacteria 3973
491 Ga0495657_0040852 3300046675 Bacteria 3178
492 Ga0495599_0006728 3300046678 Bacteria 6944
493 Ga0495599_0008944 3300046678 Bacteria 6098
494 Ga0495599_0017728 3300046678 Bacteria 4430
495 Ga0495599_0026184 3300046678 Bacteria 3655
496 Ga0495599_0154806 3300046678 Unclassified 1418
497 Ga0495623_0028239 3300046679 Bacteria 3609
498 Ga0495646_0017519 3300046680 Bacteria 4544
499 Ga0495646_0147122 3300046680 Bacteria 1313
500 Ga0495647_0000101 3300046681 Bacteria 21366
501 Ga0495647_0001930 3300046681 Bacteria 6459
502 Ga0495647_0039187 3300046681 Unclassified 1795
503 Ga0495658_0009776 3300046683 Bacteria 4782
504 Ga0495658_0012211 3300046683 Bacteria 4342
505 Ga0495658_0044647 3300046683 Bacteria 2484
506 Ga0495658_0046432 3300046683 Bacteria 2441
507 Ga0495658_0117579 3300046683 Bacteria 1605
508 Ga0495669_0063550 3300046684 Bacteria 1674
509 Ga0495613_0009665 3300046689 Bacteria 7165
510 Ga0495613_0057435 3300046689 Bacteria 2857
511 Ga0495613_0164918 3300046689 Unclassified 1574
512 Ga0495624_0001570 3300046690 Bacteria 17622
513 Ga0495624_0018484 3300046690 Bacteria 4662
514 Ga0495600_0012434 3300046809 Bacteria 5322
515 Ga0495600_0084717 3300046809 Bacteria 2068
516 Ga0495581_0010385 3300047315 Bacteria 5387
517 Ga0495581_0018895 3300047315 Bacteria 4000
518 Ga0495581_0329079 3300047315 Bacteria 892
519 Ga0495604_0023995 3300047317 Bacteria 4868
520 Ga0495604_0025707 3300047317 Bacteria 4689
521 Ga0495604_0025979 3300047317 Bacteria 4664
522 Ga0495636_0079992 3300047318 Bacteria 1406
523 Ga0495636_0126187 3300047318 Archaea 1135
524 Ga0495674_0000209 3300047319 Bacteria 48240
525 Ga0495674_0011630 3300047319 Bacteria 8298
526 Ga0495674_0158641 3300047319 Bacteria 1894
527 Ga0495672_0065717 3300047320 Bacteria 2072
528 Ga0495672_0234509 3300047320 Unclassified 899
529 Ga0495676_0043019 3300047321 Bacteria 3701
530 Ga0495676_0047052 3300047321 Bacteria 3493
531 Ga0495680_0012588 3300047322 Bacteria 7434
532 Ga0495680_0026033 3300047322 Bacteria 4831
533 Ga0495680_0095038 3300047322 Bacteria 2229
534 Ga0495675_0007134 3300047444 Bacteria 6877
535 Ga0495675_0198541 3300047444 Bacteria 1222
536 Ga0495684_0001766 3300047471 Bacteria 17346
537 Ga0495684_0003044 3300047471 Bacteria 13189
538 Ga0495684_0008625 3300047471 Bacteria 7888
539 Ga0495684_0044577 3300047471 Bacteria 3395
540 Ga0495684_0296647 3300047471 Bacteria 1162
541 Ga0495686_0093332 3300047472 Bacteria 1825
542 Ga0495593_0010564 3300047673 Bacteria 5326
543 Ga0495593_0090611 3300047673 Bacteria 1575
544 Ga0495602_0442032 3300048088 Bacteria 919
545 Ga0496104_0139247 3300048907 Bacteria 2332
546 Ga0496106_0144828 3300048909 Bacteria 1871
547 Ga0496109_0076942 3300048912 Bacteria 3070
548 Ga0496110_0158039 3300048913 Bacteria 2054
549 Ga0496111_0053903 3300048914 Bacteria 2906
550 Ga0496113_0061909 3300048916 Bacteria 2825
551 Ga0496121_0000125 3300048924 Bacteria 169274
552 Ga0496121_0060857 3300048924 Bacteria 3103
553 Ga0496126_0005275 3300048929 Bacteria 14845
554 Ga0501031_0025569 3300049568 Bacteria 3850
555 Ga0501031_0106966 3300049568 Bacteria 1826
556 Ga0501032_0050393 3300049569 Bacteria 2808
557 Ga0501032_0131739 3300049569 Bacteria 1650
558 Ga0501033_0007016 3300049570 Bacteria 8797
559 Ga0501034_0406678 3300049571 Bacteria 1283
560 Ga0501036_0000330 3300049572 Bacteria 33079
561 Ga0501036_0054630 3300049572 Bacteria 3383
562 Ga0501036_0392816 3300049572 Bacteria 1157
563 Ga0501037_0008587 3300049573 Bacteria 7494
564 Ga0501038_0000267 3300049574 Bacteria 44085
565 Ga0501038_0079708 3300049574 Unclassified 2760
566 Ga0501038_0168045 3300049574 Bacteria 1778
567 Ga0501039_0004592 3300049575 Bacteria 10444
568 Ga0501039_0011612 3300049575 Bacteria 6707
569 Ga0501039_0012899 3300049575 Bacteria 6390
570 Ga0501039_0129281 3300049575 Bacteria 1982
571 Ga0501039_0148536 3300049575 Bacteria 1842
572 Ga0501040_0000312 3300049576 Bacteria 28486
573 Ga0501040_0007409 3300049576 Bacteria 7106
574 Ga0501040_0016304 3300049576 Bacteria 4916
575 Ga0501040_0019632 3300049576 Bacteria 4498
576 Ga0501040_0024732 3300049576 Bacteria 4033
577 Ga0501041_0002294 3300049577 Bacteria 10830
578 Ga0501041_0002566 3300049577 Bacteria 10353
579 Ga0501041_0007160 3300049577 Bacteria 6543
580 Ga0501042_0001125 3300049578 Bacteria 15408
581 Ga0501042_0002202 3300049578 Bacteria 11888
582 Ga0501043_0080782 3300049579 Bacteria 2555
583 Ga0501043_0097616 3300049579 Bacteria 2310
584 Ga0501046_0000428 3300049580 Bacteria 42116
585 Ga0501046_0440932 3300049580 Bacteria 937
586 Ga0501047_0042491 3300049581 Bacteria 4393
587 Ga0501047_0062431 3300049581 Bacteria 3594
588 Ga0501048_0000612 3300049582 Bacteria 25409
589 Ga0501048_0014025 3300049582 Bacteria 5942
590 Ga0501048_0023699 3300049582 Bacteria 4483
591 Ga0501048_0050821 3300049582 Bacteria 2952
592 Ga0501048_0109043 3300049582 Bacteria 1955
593 Ga0501067_0085179 3300049583 Bacteria 1754
594 Ga0501068_0109969 3300049584 Bacteria 1713
595 Ga0501068_0245641 3300049584 Unclassified 1140
596 Ga0501068_0366685 3300049584 Bacteria 926
597 Ga0501069_0246131 3300049585 Unclassified 1043
598 Ga0501070_0039266 3300049586 Bacteria 3949
599 Ga0501070_0104095 3300049586 Bacteria 2347
600 Ga0501070_0467474 3300049586 Bacteria 1016
601 Ga0501070_0700261 3300049586 Bacteria 801
602 Ga0501071_0001340 3300049587 Bacteria 14070
603 Ga0501071_0002057 3300049587 Bacteria 12041
604 Ga0501071_0224644 3300049587 Bacteria 1414
605 Ga0501071_0470462 3300049587 Bacteria 963
606 Ga0501072_0000789 3300049588 Bacteria 23259
607 Ga0501072_0054892 3300049588 Bacteria 3140
608 Ga0501072_0095649 3300049588 Bacteria 2361
609 Ga0501072_0119298 3300049588 Bacteria 2102
610 Ga0501072_0158686 3300049588 Bacteria 1804
611 Ga0501072_0186564 3300049588 Bacteria 1654
612 Ga0501072_0237488 3300049588 Bacteria 1451
613 Ga0501073_0051234 3300049589 Bacteria 2892
614 Ga0501073_0136088 3300049589 Bacteria 1703
615 Ga0501073_0235442 3300049589 Bacteria 1265
616 Ga0501074_0026349 3300049590 Bacteria 4215
617 Ga0501074_0061092 3300049590 Bacteria 2715
618 Ga0501074_0093014 3300049590 Bacteria 2159
619 Ga0501074_0210664 3300049590 Bacteria 1385
620 Ga0501074_0272415 3300049590 Bacteria 1203
621 Ga0501075_0002917 3300049591 Bacteria 11473
622 Ga0501075_0011260 3300049591 Bacteria 6327
623 Ga0501075_0040806 3300049591 Bacteria 3477
624 Ga0501075_0041825 3300049591 Bacteria 3435
625 Ga0501075_0047788 3300049591 Bacteria 3216
626 Ga0501075_0128179 3300049591 Bacteria 1932
627 Ga0501075_0176539 3300049591 Bacteria 1630
628 Ga0501076_0000118 3300049592 Bacteria 43658
629 Ga0501076_0001261 3300049592 Bacteria 16863
630 Ga0501076_0002101 3300049592 Bacteria 13659
631 Ga0501076_0018795 3300049592 Bacteria 5274
632 Ga0501076_0081684 3300049592 Bacteria 2594
633 Ga0501077_0003691 3300049593 Bacteria 9204
634 Ga0501077_0044071 3300049593 Bacteria 2835
635 Ga0501077_0071254 3300049593 Bacteria 2203
636 Ga0501077_0205748 3300049593 Bacteria 1250
637 Ga0501079_0000397 3300049741 Bacteria 28020
638 Ga0501079_0000442 3300049741 Bacteria 26958
639 Ga0501079_0022627 3300049741 Bacteria 4821
640 Ga0501079_0065677 3300049741 Bacteria 2799
641 Ga0501079_0367567 3300049741 Bacteria 1127
642 Ga0501080_0005112 3300049742 Bacteria 11689
643 Ga0501080_0021829 3300049742 Bacteria 5931
644 Ga0501081_0001609 3300049743 Bacteria 13933
645 Ga0501081_0005183 3300049743 Bacteria 8388
646 Ga0501081_0035019 3300049743 Bacteria 3418
647 Ga0501081_0099755 3300049743 Bacteria 2052
648 Ga0501081_0148815 3300049743 Bacteria 1681
649 Ga0501083_0008847 3300049744 Bacteria 7109
650 Ga0501083_0022417 3300049744 Bacteria 4384
651 Ga0501035_0010209 3300049822 Bacteria 8714
652 Ga0501044_0038670 3300049823 Bacteria 4982
653 Ga0501044_0142213 3300049823 Bacteria 2387
654 Ga0501045_0000264 3300049824 Bacteria 30492
655 Ga0501045_0007250 3300049824 Bacteria 7698
656 Ga0501045_0016595 3300049824 Bacteria 5232
657 Ga0501045_0177378 3300049824 Bacteria 1587
658 Ga0501045_0196732 3300049824 Bacteria 1502
659 Ga0501045_0274643 3300049824 Bacteria 1255
660 nmdc:mga0k408_336542_c1 3300050493 Bacteria 900
661 nmdc:mga05p37_174307_c1 3300050507 Bacteria 2621
662 nmdc:mga05p37_18630_c1 3300050507 Bacteria 8388
663 nmdc:mga05p37_277670_c1 3300050507 Bacteria 1999
664 nmdc:mga05p37_593775_c1 3300050507 Bacteria 1251
665 nmdc:mga09592_16926_c1 3300050508 Bacteria 5966
666 nmdc:mga09592_323046_c1 3300050508 Bacteria 1337
667 nmdc:mga09592_39020_c1 3300050508 Bacteria 3988
668 nmdc:mga09592_416578_c1 3300050508 Bacteria 1161
669 nmdc:mga0qj67_16395_c1 3300050509 Bacteria 5619
670 nmdc:mga0qj67_295401_c1 3300050509 Bacteria 1313
671 nmdc:mga0qj67_382814_c1 3300050509 Bacteria 1136
672 nmdc:mga0qj67_485939_c1 3300050509 Bacteria 993
673 nmdc:mga06r32_430552_c1 3300050510 Bacteria 1300
674 nmdc:mga08y16_19349_c1 3300050511 Bacteria 7178
675 nmdc:mga08y16_22266_c1 3300050511 Bacteria 6687
676 nmdc:mga08y16_241269_c1 3300050511 Bacteria 1868
677 nmdc:mga08y16_28582_c1 3300050511 Bacteria 5878
678 nmdc:mga08y16_488327_c1 3300050511 Bacteria 1253
679 nmdc:mga08y16_65008_c1 3300050511 Bacteria 3808
680 nmdc:mga08y16_8030_c1 3300050511 Bacteria 11040
681 nmdc:mga08y16_939721_c1 3300050511 Bacteria 848
682 nmdc:mga0n895_186252_c1 3300050512 Bacteria 2107
683 nmdc:mga0n895_24452_c1 3300050512 Bacteria 5693
684 nmdc:mga0n895_328945_c1 3300050512 Bacteria 1548
685 nmdc:mga0n895_398267_c1 3300050512 Bacteria 1392
686 nmdc:mga0n895_404152_c1 3300050512 Bacteria 1381
687 nmdc:mga0n895_86363_c1 3300050512 Bacteria 3134
688 nmdc:mga0n895_88_c1 3300050512 Bacteria 53153
689 nmdc:mga0rr50_1095_c1 3300050513 Bacteria 14709
690 nmdc:mga0rr50_11839_c1 3300050513 Bacteria 5603
691 nmdc:mga0rr50_38539_c1 3300050513 Bacteria 3460
692 nmdc:mga0rr50_5178_c1 3300050513 Bacteria 7746
693 nmdc:mga0rr50_9234_c1 3300050513 Bacteria 6187
694 nmdc:mga08x19_10214_c1 3300050514 Bacteria 5632
695 nmdc:mga08x19_1086_c1 3300050514 Bacteria 16965
696 nmdc:mga08x19_15159_c1 3300050514 Bacteria 4685
697 nmdc:mga08x19_369_c2 3300050514 Bacteria 10005
698 nmdc:mga08x19_4376_c1 3300050514 Bacteria 8376
699 nmdc:mga08x19_59734_c1 3300050514 Bacteria 2469
700 nmdc:mga0a205_126559_c1 3300050515 Bacteria 2455
701 nmdc:mga0a205_144309_c1 3300050515 Bacteria 2280
702 nmdc:mga0a205_1767_c1 3300050515 Bacteria 18718
703 nmdc:mga0a205_34133_c1 3300050515 Bacteria 4881
704 Ga0495601_0001991 3300053077 Bacteria 11444
705 Ga0495601_0005391 3300053077 Bacteria 7449
706 Ga0495601_0015469 3300053077 Bacteria 4611
707 Ga0495601_0175455 3300053077 Bacteria 1401
708 Ga0495601_0189318 3300053077 Bacteria 1345
709 Ga0495601_0213778 3300053077 Bacteria 1259
710 Ga0495612_0000353 3300053078 Bacteria 18580
711 Ga0495612_0026111 3300053078 Bacteria 2348
712 Ga0495612_0077952 3300053078 Bacteria 1389
713 Ga0495595_0007988 3300053084 Bacteria 4333
714 Ga0495595_0017855 3300053084 Bacteria 3056
715 Ga0495595_0053748 3300053084 Bacteria 1872
716 Ga0495595_0084487 3300053084 Unclassified 1517
717 Ga0495619_0011558 3300053085 Bacteria 5563
718 Ga0495619_0011605 3300053085 Bacteria 5551
719 Ga0495619_0332526 3300053085 Bacteria 1052
720 Ga0495619_0421070 3300053085 Bacteria 921
721 Ga0495619_0470680 3300053085 Bacteria 865
722 Ga0500595_005351 3300053119 Bacteria 5614
723 Ga0500568_0044301 3300053139 Bacteria 1775
724 Ga0500616_0010041 3300053153 Bacteria 5689
725 Ga0500616_0013642 3300053153 Bacteria 4708
726 Ga0500616_0016281 3300053153 Bacteria 4235
727 Ga0500637_0080876 3300053178 Bacteria 1877
728 Ga0501084_0000553 3300054114 Bacteria 28542
729 Ga0501084_0003157 3300054114 Bacteria 13329
730 Ga0501084_0009985 3300054114 Bacteria 7846
731 Ga0501084_0034987 3300054114 Bacteria 4200
732 Ga0501084_0195663 3300054114 Unclassified 1706
733 Ga0501084_0299317 3300054114 Bacteria 1359
734 Ga0501082_0007857 3300060353 Bacteria 9202
735 Ga0501082_0014006 3300060353 Bacteria 6897
736 Ga0501082_0015525 3300060353 Bacteria 6557
737 Ga0501082_0016744 3300060353 Bacteria 6312
738 Ga0501082_0090056 3300060353 Bacteria 2649
739 Ga0501082_0294876 3300060353 Bacteria 1412
740 Ga0530510_0000026 3300061734 Bacteria 67071
741 Ga0530510_0000858 3300061734 Bacteria 20038
742 Ga0530510_0026321 3300061734 Bacteria 4163
743 Ga0530510_0050025 3300061734 Bacteria 3019
744 Ga0530510_0101938 3300061734 Bacteria 2099
745 Ga0530510_0114058 3300061734 Bacteria 1981
746 Ga0530510_0178720 3300061734 Unclassified 1573

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049586 Ga0501070_0700261 Ga0501070_0700261_53_787 224
2 3300005844 Ga0068862_100015881 Ga0068862_1000158815 230
3 3300006847 Ga0075431_100329387 Ga0075431_1003293872 230
4 3300009094 Ga0111539_10111614 Ga0111539_101116142 230
5 3300050511 nmdc:mga08y16_22266_c1 nmdc:mga08y16_22266_c1_3524_4342 230
6 3300005615 Ga0070702_100048738 Ga0070702_1000487382 231
7 3300049585 Ga0501069_0246131 Ga0501069_0246131_29_766 231
8 3300005343 Ga0070687_100073859 Ga0070687_1000738591 232
9 3300035083 Ga0373926_0028169 Ga0373926_0028169_288_1106 233
10 3300035113 Ga0373936_0030376 Ga0373936_0030376_308_1126 233
11 3300035116 Ga0373945_0053500 Ga0373945_0053500_622_1440 233
12 3300035170 Ga0373943_0003842 Ga0373943_0003842_4673_5491 233
13 3300035171 Ga0373946_0028021 Ga0373946_0028021_774_1592 233
14 3300035692 Ga0373935_0015655 Ga0373935_0015655_1662_2480 233
15 3300035725 Ga0373947_0005057 Ga0373947_0005057_4746_5564 233
16 3300037068 Ga0373925_0038766 Ga0373925_0038766_402_1220 233
17 3300047318 Ga0495636_0079992 Ga0495636_0079992_546_1364 233
18 3300049580 Ga0501046_0440932 Ga0501046_0440932_17_721 234
19 3300005545 Ga0070695_100146414 Ga0070695_1001464142 239
20 3300039453 Ga0436362_0558861 Ga0436362_0558861_10_741 243
21 3300031548 Ga0307408_100145006 Ga0307408_1001450062 244
22 3300046462 Ga0495651_0246068 Ga0495651_0246068_20_757 244
23 3300046529 Ga0495652_0141803 Ga0495652_0141803_1133_1867 244
24 3300049593 Ga0501077_0071254 Ga0501077_0071254_83_874 244
25 3300053085 Ga0495619_0332526 Ga0495619_0332526_289_1023 244
26 3300006847 Ga0075431_100062084 Ga0075431_1000620842 245
27 3300006880 Ga0075429_100026172 Ga0075429_1000261723 245
28 3300049568 Ga0501031_0025569 Ga0501031_0025569_1146_1961 245
29 3300049569 Ga0501032_0050393 Ga0501032_0050393_647_1462 245
30 3300049570 Ga0501033_0007016 Ga0501033_0007016_4841_5656 245
31 3300049572 Ga0501036_0000330 Ga0501036_0000330_28246_29061 245
32 3300049573 Ga0501037_0008587 Ga0501037_0008587_1339_2154 245
33 3300049574 Ga0501038_0000267 Ga0501038_0000267_3320_4135 245
34 3300049575 Ga0501039_0012899 Ga0501039_0012899_3426_4241 245
35 3300049576 Ga0501040_0000312 Ga0501040_0000312_3413_4228 245
36 3300049577 Ga0501041_0002566 Ga0501041_0002566_6112_6927 245
37 3300049578 Ga0501042_0002202 Ga0501042_0002202_3416_4231 245
38 3300049579 Ga0501043_0080782 Ga0501043_0080782_1499_2314 245
39 3300049580 Ga0501046_0000428 Ga0501046_0000428_1815_2630 245
40 3300049582 Ga0501048_0000612 Ga0501048_0000612_20345_21160 245
41 3300049584 Ga0501068_0366685 Ga0501068_0366685_83_898 245
42 3300049586 Ga0501070_0104095 Ga0501070_0104095_106_921 245
43 3300049587 Ga0501071_0002057 Ga0501071_0002057_7808_8623 245
44 3300049588 Ga0501072_0000789 Ga0501072_0000789_19032_19847 245
45 3300049590 Ga0501074_0026349 Ga0501074_0026349_262_1077 245
46 3300049591 Ga0501075_0011260 Ga0501075_0011260_4250_5065 245
47 3300049592 Ga0501076_0000118 Ga0501076_0000118_22585_23400 245
48 3300049593 Ga0501077_0003691 Ga0501077_0003691_466_1281 245
49 3300049741 Ga0501079_0000397 Ga0501079_0000397_3397_4212 245
50 3300049742 Ga0501080_0021829 Ga0501080_0021829_2384_3199 245
51 3300049743 Ga0501081_0005183 Ga0501081_0005183_4019_4834 245
52 3300049822 Ga0501035_0010209 Ga0501035_0010209_5249_6064 245
53 3300049823 Ga0501044_0038670 Ga0501044_0038670_1613_2428 245
54 3300049824 Ga0501045_0000264 Ga0501045_0000264_3398_4213 245
55 3300050510 nmdc:mga06r32_430552_c1 nmdc:mga06r32_430552_c1_192_1115 245
56 3300054114 Ga0501084_0000553 Ga0501084_0000553_4386_5201 245
57 3300060353 Ga0501082_0014006 Ga0501082_0014006_4019_4834 245
58 3300061734 Ga0530510_0000026 Ga0530510_0000026_3415_4230 245
59 3300047320 Ga0495672_0234509 Ga0495672_0234509_99_884 246
60 3300005546 Ga0070696_100014903 Ga0070696_1000149033 249
61 3300007076 Ga0075435_100008212 Ga0075435_1000082129 249
62 3300007788 Ga0099795_10014013 Ga0099795_100140132 249
63 3300050513 nmdc:mga0rr50_11839_c1 nmdc:mga0rr50_11839_c1_619_1437 249
64 3300050515 nmdc:mga0a205_34133_c1 nmdc:mga0a205_34133_c1_1390_2208 249
65 3300049572 Ga0501036_0054630 Ga0501036_0054630_2057_2932 252
66 3300049575 Ga0501039_0011612 Ga0501039_0011612_2199_3074 252
67 3300049576 Ga0501040_0016304 Ga0501040_0016304_1555_2430 252
68 3300049577 Ga0501041_0002294 Ga0501041_0002294_8807_9682 252
69 3300049578 Ga0501042_0001125 Ga0501042_0001125_8359_9234 252
70 3300049579 Ga0501043_0097616 Ga0501043_0097616_978_1853 252
71 3300049582 Ga0501048_0023699 Ga0501048_0023699_2749_3624 252
72 3300049582 Ga0501048_0109043 Ga0501048_0109043_548_1423 252
73 3300049587 Ga0501071_0001340 Ga0501071_0001340_9624_10499 252
74 3300049589 Ga0501073_0051234 Ga0501073_0051234_1020_1895 252
75 3300049590 Ga0501074_0061092 Ga0501074_0061092_1291_2166 252
76 3300049591 Ga0501075_0002917 Ga0501075_0002917_6949_7824 252
77 3300049591 Ga0501075_0041825 Ga0501075_0041825_1625_2500 252
78 3300049592 Ga0501076_0001261 Ga0501076_0001261_13841_14716 252
79 3300049741 Ga0501079_0022627 Ga0501079_0022627_3040_3915 252
80 3300049824 Ga0501045_0007250 Ga0501045_0007250_3536_4411 252
81 3300049824 Ga0501045_0196732 Ga0501045_0196732_386_1261 252
82 3300054114 Ga0501084_0009985 Ga0501084_0009985_4356_5231 252
83 3300060353 Ga0501082_0007857 Ga0501082_0007857_5879_6754 252
84 3300060353 Ga0501082_0294876 Ga0501082_0294876_270_1145 252
85 3300061734 Ga0530510_0000858 Ga0530510_0000858_14686_15561 252
86 3300005353 Ga0070669_100067077 Ga0070669_1000670772 253
87 3300005441 Ga0070700_100103454 Ga0070700_1001034542 253
88 3300005456 Ga0070678_100041474 Ga0070678_1000414744 253
89 3300005459 Ga0068867_100115501 Ga0068867_1001155012 253
90 3300005719 Ga0068861_100064383 Ga0068861_1000643832 253
91 3300005844 Ga0068862_100067372 Ga0068862_1000673723 253
92 3300006881 Ga0068865_100076690 Ga0068865_1000766902 253
93 3300009148 Ga0105243_10007856 Ga0105243_100078566 253
94 3300009553 Ga0105249_10085032 Ga0105249_100850322 253
95 3300014326 Ga0157380_10090078 Ga0157380_100900782 253
96 3300025893 Ga0207682_10124555 Ga0207682_101245551 253
97 3300025908 Ga0207643_10013812 Ga0207643_100138123 253
98 3300025910 Ga0207684_10327467 Ga0207684_103274672 253
99 3300025923 Ga0207681_10057877 Ga0207681_100578772 253
100 3300025925 Ga0207650_10244761 Ga0207650_102447612 253
101 3300025926 Ga0207659_10059815 Ga0207659_100598153 253
102 3300025936 Ga0207670_10038240 Ga0207670_100382403 253
103 3300025936 Ga0207670_10080826 Ga0207670_100808262 253
104 3300025961 Ga0207712_10082894 Ga0207712_100828942 253
105 3300025972 Ga0207668_10015384 Ga0207668_100153842 253
106 3300026075 Ga0207708_10006688 Ga0207708_100066889 253
107 3300005336 Ga0070680_100160762 Ga0070680_1001607621 254
108 3300006880 Ga0075429_100327184 Ga0075429_1003271842 254
109 3300025940 Ga0207691_10070970 Ga0207691_100709704 254
110 3300050508 nmdc:mga09592_323046_c1 nmdc:mga09592_323046_c1_480_1298 254
111 3300005458 Ga0070681_10036856 Ga0070681_100368564 255
112 3300025912 Ga0207707_10043000 Ga0207707_100430003 255
113 3300035112 Ga0373932_0064472 Ga0373932_0064472_43_906 255
114 3300006871 Ga0075434_100000363 Ga0075434_10000036339 256
115 3300007076 Ga0075435_100021842 Ga0075435_1000218422 256
116 3300007265 Ga0099794_10027033 Ga0099794_100270332 256
117 3300027526 Ga0209968_1009412 Ga0209968_10094122 256
118 3300050512 nmdc:mga0n895_88_c1 nmdc:mga0n895_88_c1_18877_19695 256
119 3300050513 nmdc:mga0rr50_1095_c1 nmdc:mga0rr50_1095_c1_13447_14265 256
120 3300050514 nmdc:mga08x19_10214_c1 nmdc:mga08x19_10214_c1_4599_5417 256
121 3300050515 nmdc:mga0a205_144309_c1 nmdc:mga0a205_144309_c1_978_1796 256
122 3300003320 rootH2_10025714 rootH2_100257142 257
123 3300027671 Ga0209588_1022947 Ga0209588_10229472 257
124 3300049574 Ga0501038_0079708 Ga0501038_0079708_212_1081 257
125 3300049591 Ga0501075_0047788 Ga0501075_0047788_790_1665 257
126 3300049743 Ga0501081_0035019 Ga0501081_0035019_1193_2068 257
127 3300050514 nmdc:mga08x19_4376_c1 nmdc:mga08x19_4376_c1_1117_1992 257
128 3300061734 Ga0530510_0101938 Ga0530510_0101938_337_1212 257
129 3300005536 Ga0070697_100012815 Ga0070697_1000128156 258
130 3300006844 Ga0075428_100023200 Ga0075428_1000232003 258
131 3300006880 Ga0075429_100366528 Ga0075429_1003665282 258
132 3300010159 Ga0099796_10065582 Ga0099796_100655822 258
133 3300027526 Ga0209968_1005950 Ga0209968_10059502 258
134 3300027682 Ga0209971_1022747 Ga0209971_10227472 258
135 3300042003 Ga0439443_001092 Ga0439443_001092_491_1309 258
136 3300042461 Ga0439460_0029990 Ga0439460_0029990_616_1434 258
137 3300044673 Ga0453683_0110500 Ga0453683_0110500_144_1019 258
138 3300045049 Ga0466959_0432353 Ga0466959_0432353_16_792 258
139 3300049581 Ga0501047_0062431 Ga0501047_0062431_600_1472 258
140 3300005455 Ga0070663_100003060 Ga0070663_1000030602 259
141 3300005981 Ga0081538_10029612 Ga0081538_100296123 259
142 3300026067 Ga0207678_10051638 Ga0207678_100516384 259
143 3300034816 Ga0373930_0035979 Ga0373930_0035979_13_795 259
144 3300035116 Ga0373945_0166402 Ga0373945_0166402_26_805 259
145 3300042436 Ga0439435_0001580 Ga0439435_0001580_129_947 259
146 3300042437 Ga0439444_0014971 Ga0439444_0014971_129_947 259
147 3300042461 Ga0439460_0000144 Ga0439460_0000144_1760_2578 259
148 3300046531 Ga0495665_0037998 Ga0495665_0037998_1777_2556 259
149 3300046559 Ga0495667_0247899 Ga0495667_0247899_22_804 259
150 3300046663 Ga0495635_0324376 Ga0495635_0324376_227_1006 259
151 3300046683 Ga0495658_0117579 Ga0495658_0117579_17_799 259
152 3300049584 Ga0501068_0245641 Ga0501068_0245641_55_924 259
153 3300049823 Ga0501044_0142213 Ga0501044_0142213_141_1010 259
154 3300049824 Ga0501045_0274643 Ga0501045_0274643_304_1173 259
155 3300050493 nmdc:mga0k408_336542_c1 nmdc:mga0k408_336542_c1_98_880 259
156 3300050511 nmdc:mga08y16_939721_c1 nmdc:mga08y16_939721_c1_16_795 259
157 3300053085 Ga0495619_0470680 Ga0495619_0470680_20_802 259
158 3300053119 Ga0500595_005351 Ga0500595_005351_399_1235 259
159 3300005440 Ga0070705_100198031 Ga0070705_1001980312 262
160 3300005445 Ga0070708_100011239 Ga0070708_1000112397 262
161 3300005518 Ga0070699_100077753 Ga0070699_1000777532 262
162 3300005536 Ga0070697_100070159 Ga0070697_1000701592 262
163 3300048924 Ga0496121_0000125 Ga0496121_0000125_20644_21480 262
164 3300049575 Ga0501039_0148536 Ga0501039_0148536_290_1108 262
165 3300049587 Ga0501071_0470462 Ga0501071_0470462_122_940 262
166 3300049588 Ga0501072_0158686 Ga0501072_0158686_280_1098 262
167 3300049591 Ga0501075_0128179 Ga0501075_0128179_283_1101 262
168 3300049593 Ga0501077_0205748 Ga0501077_0205748_54_872 262
169 3300005336 Ga0070680_100207651 Ga0070680_1002076512 263
170 3300005337 Ga0070682_100341576 Ga0070682_1003415762 263
171 3300005341 Ga0070691_10221389 Ga0070691_102213891 263
172 3300005366 Ga0070659_100435103 Ga0070659_1004351032 263
173 3300005458 Ga0070681_10125831 Ga0070681_101258312 263
174 3300006175 Ga0070712_100003673 Ga0070712_1000036736 263
175 3300009093 Ga0105240_10495475 Ga0105240_104954752 263
176 3300013104 Ga0157370_10069750 Ga0157370_100697502 263
177 3300013105 Ga0157369_10004736 Ga0157369_100047365 263
178 3300025912 Ga0207707_10101383 Ga0207707_101013832 263
179 3300025915 Ga0207693_10009873 Ga0207693_100098736 263
180 3300025921 Ga0207652_10267953 Ga0207652_102679532 263
181 3300025939 Ga0207665_10211219 Ga0207665_102112192 263
182 3300045976 Ga0466967_0925340 Ga0466967_0925340_29_844 263
183 3300047318 Ga0495636_0126187 Ga0495636_0126187_203_1078 263
184 3300053077 Ga0495601_0175455 Ga0495601_0175455_419_1297 263
185 3300053078 Ga0495612_0026111 Ga0495612_0026111_171_1049 263
186 3300005468 Ga0070707_100039291 Ga0070707_1000392913 264
187 3300005544 Ga0070686_100180674 Ga0070686_1001806742 264
188 3300006847 Ga0075431_100206942 Ga0075431_1002069422 264
189 3300025922 Ga0207646_10021399 Ga0207646_100213995 264
190 3300049586 Ga0501070_0039266 Ga0501070_0039266_2107_3021 264
191 3300054114 Ga0501084_0299317 Ga0501084_0299317_24_899 264
192 3300031731 Ga0307405_10083056 Ga0307405_100830563 265
193 3300035117 Ga0373953_0206265 Ga0373953_0206265_35_832 265
194 3300035118 Ga0373954_0010081 Ga0373954_0010081_1148_2023 265
195 3300046454 Ga0495592_0121564 Ga0495592_0121564_674_1549 265
196 3300050512 nmdc:mga0n895_404152_c1 nmdc:mga0n895_404152_c1_14_838 265
197 3300006844 Ga0075428_100023887 Ga0075428_1000238876 266
198 3300006846 Ga0075430_100009297 Ga0075430_1000092979 266
199 3300006847 Ga0075431_100012271 Ga0075431_1000122714 266
200 3300009094 Ga0111539_10035931 Ga0111539_100359313 266
201 3300027907 Ga0207428_10092501 Ga0207428_100925012 266
202 3300049588 Ga0501072_0186564 Ga0501072_0186564_726_1544 266
203 3300050508 nmdc:mga09592_416578_c1 nmdc:mga09592_416578_c1_271_1146 266
204 3300050511 nmdc:mga08y16_28582_c1 nmdc:mga08y16_28582_c1_2558_3433 266
205 3300053153 Ga0500616_0016281 Ga0500616_0016281_1375_2304 266
206 3300049589 Ga0501073_0136088 Ga0501073_0136088_608_1471 267
207 3300005441 Ga0070700_100242256 Ga0070700_1002422562 271
208 3300005455 Ga0070663_100149820 Ga0070663_1001498202 271
209 3300005458 Ga0070681_10008315 Ga0070681_100083154 271
210 3300005549 Ga0070704_100232428 Ga0070704_1002324282 271
211 3300007788 Ga0099795_10065966 Ga0099795_100659661 271
212 3300014497 Ga0182008_10058954 Ga0182008_100589542 271
213 3300025912 Ga0207707_10040112 Ga0207707_100401125 271
214 3300025921 Ga0207652_10088992 Ga0207652_100889922 271
215 3300028800 Ga0265338_10002492 Ga0265338_1000249226 271
216 3300031235 Ga0265330_10075726 Ga0265330_100757262 271
217 3300031240 Ga0265320_10012678 Ga0265320_100126782 271
218 3300031249 Ga0265339_10012730 Ga0265339_100127306 271
219 3300031250 Ga0265331_10040004 Ga0265331_100400042 271
220 3300035695 Ga0373927_0013439 Ga0373927_0013439_4052_4927 271
221 3300037418 Ga0395900_0134190 Ga0395900_0134190_1301_2164 271
222 3300044684 Ga0466966_0071360 Ga0466966_0071360_1140_2000 271
223 3300044694 Ga0466963_0011482 Ga0466963_0011482_4271_5131 271
224 3300044842 Ga0466957_0171984 Ga0466957_0171984_159_1019 271
225 3300045051 Ga0451576_0023021 Ga0451576_0023021_3032_3889 271
226 3300045976 Ga0466967_0186236 Ga0466967_0186236_659_1531 271
227 3300047320 Ga0495672_0065717 Ga0495672_0065717_620_1492 271
228 3300047472 Ga0495686_0093332 Ga0495686_0093332_578_1414 271
229 3300048924 Ga0496121_0060857 Ga0496121_0060857_1494_2366 271
230 3300048929 Ga0496126_0005275 Ga0496126_0005275_12905_13777 271
231 3300049568 Ga0501031_0106966 Ga0501031_0106966_161_1027 271
232 3300049569 Ga0501032_0131739 Ga0501032_0131739_480_1346 271
233 3300049571 Ga0501034_0406678 Ga0501034_0406678_46_912 271
234 3300049574 Ga0501038_0168045 Ga0501038_0168045_452_1318 271
235 3300049575 Ga0501039_0004592 Ga0501039_0004592_2373_3248 271
236 3300049575 Ga0501039_0129281 Ga0501039_0129281_16_882 271
237 3300049581 Ga0501047_0042491 Ga0501047_0042491_3088_3954 271
238 3300049582 Ga0501048_0050821 Ga0501048_0050821_815_1690 271
239 3300049590 Ga0501074_0210664 Ga0501074_0210664_151_1017 271
240 3300049590 Ga0501074_0272415 Ga0501074_0272415_289_1164 271
241 3300049591 Ga0501075_0040806 Ga0501075_0040806_2334_3209 271
242 3300049592 Ga0501076_0002101 Ga0501076_0002101_9775_10650 271
243 3300049741 Ga0501079_0000442 Ga0501079_0000442_2621_3496 271
244 3300049742 Ga0501080_0005112 Ga0501080_0005112_6526_7401 271
245 3300049743 Ga0501081_0001609 Ga0501081_0001609_4059_4934 271
246 3300049744 Ga0501083_0008847 Ga0501083_0008847_1774_2640 271
247 3300049744 Ga0501083_0022417 Ga0501083_0022417_1533_2408 271
248 3300049824 Ga0501045_0016595 Ga0501045_0016595_2499_3374 271
249 3300053084 Ga0495595_0053748 Ga0495595_0053748_102_962 271
250 3300053139 Ga0500568_0044301 Ga0500568_0044301_297_1133 271
251 3300053153 Ga0500616_0013642 Ga0500616_0013642_726_1610 271
252 3300053178 Ga0500637_0080876 Ga0500637_0080876_234_1106 271
253 3300054114 Ga0501084_0034987 Ga0501084_0034987_2949_3824 271
254 3300060353 Ga0501082_0015525 Ga0501082_0015525_2870_3736 271
255 3300060353 Ga0501082_0016744 Ga0501082_0016744_2475_3350 271
256 3300003203 JGI25406J46586_10027630 JGI25406J46586_100276302 272
257 3300005295 Ga0065707_10002051 Ga0065707_100020515 272
258 3300005295 Ga0065707_10111808 Ga0065707_101118082 272
259 3300005330 Ga0070690_100000653 Ga0070690_1000006538 272
260 3300005331 Ga0070670_100026073 Ga0070670_1000260733 272
261 3300005334 Ga0068869_100001162 Ga0068869_10000116217 272
262 3300005334 Ga0068869_100066505 Ga0068869_1000665052 272
263 3300005336 Ga0070680_100000316 Ga0070680_10000031630 272
264 3300005336 Ga0070680_100412018 Ga0070680_1004120182 272
265 3300005336 Ga0070680_100427051 Ga0070680_1004270511 272
266 3300005337 Ga0070682_100004386 Ga0070682_1000043866 272
267 3300005338 Ga0068868_100010897 Ga0068868_1000108979 272
268 3300005340 Ga0070689_100000894 Ga0070689_10000089419 272
269 3300005340 Ga0070689_100008707 Ga0070689_1000087076 272
270 3300005341 Ga0070691_10000398 Ga0070691_100003988 272
271 3300005343 Ga0070687_100000276 Ga0070687_10000027617 272
272 3300005344 Ga0070661_100109888 Ga0070661_1001098882 272
273 3300005345 Ga0070692_10002206 Ga0070692_100022069 272
274 3300005347 Ga0070668_100285025 Ga0070668_1002850251 272
275 3300005353 Ga0070669_100459059 Ga0070669_1004590592 272
276 3300005354 Ga0070675_100026546 Ga0070675_1000265462 272
277 3300005364 Ga0070673_100094834 Ga0070673_1000948342 272
278 3300005364 Ga0070673_100162262 Ga0070673_1001622622 272
279 3300005436 Ga0070713_100039482 Ga0070713_1000394822 272
280 3300005436 Ga0070713_100201362 Ga0070713_1002013622 272
281 3300005438 Ga0070701_10001480 Ga0070701_1000148011 272
282 3300005438 Ga0070701_10040690 Ga0070701_100406902 272
283 3300005439 Ga0070711_100076959 Ga0070711_1000769592 272
284 3300005440 Ga0070705_100004348 Ga0070705_1000043489 272
285 3300005441 Ga0070700_100007422 Ga0070700_1000074228 272
286 3300005444 Ga0070694_100006857 Ga0070694_1000068579 272
287 3300005444 Ga0070694_100054318 Ga0070694_1000543182 272
288 3300005444 Ga0070694_100093076 Ga0070694_1000930762 272
289 3300005444 Ga0070694_100144062 Ga0070694_1001440622 272
290 3300005445 Ga0070708_100025847 Ga0070708_1000258472 272
291 3300005445 Ga0070708_100386375 Ga0070708_1003863752 272
292 3300005456 Ga0070678_100060922 Ga0070678_1000609223 272
293 3300005457 Ga0070662_100441647 Ga0070662_1004416471 272
294 3300005458 Ga0070681_10021340 Ga0070681_100213408 272
295 3300005458 Ga0070681_10045917 Ga0070681_100459172 272
296 3300005459 Ga0068867_100001833 Ga0068867_1000018338 272
297 3300005468 Ga0070707_100017423 Ga0070707_1000174235 272
298 3300005468 Ga0070707_100094384 Ga0070707_1000943842 272
299 3300005468 Ga0070707_100227657 Ga0070707_1002276572 272
300 3300005471 Ga0070698_100250777 Ga0070698_1002507771 272
301 3300005471 Ga0070698_100600196 Ga0070698_1006001961 272
302 3300005518 Ga0070699_100017254 Ga0070699_1000172544 272
303 3300005518 Ga0070699_100162339 Ga0070699_1001623392 272
304 3300005530 Ga0070679_100120679 Ga0070679_1001206792 272
305 3300005535 Ga0070684_100314114 Ga0070684_1003141142 272
306 3300005544 Ga0070686_100003380 Ga0070686_10000338012 272
307 3300005544 Ga0070686_100004094 Ga0070686_1000040946 272
308 3300005544 Ga0070686_100218212 Ga0070686_1002182122 272
309 3300005545 Ga0070695_100000250 Ga0070695_1000002505 272
310 3300005545 Ga0070695_100052646 Ga0070695_1000526462 272
311 3300005545 Ga0070695_100086410 Ga0070695_1000864102 272
312 3300005545 Ga0070695_100331997 Ga0070695_1003319972 272
313 3300005546 Ga0070696_100000358 Ga0070696_1000003587 272
314 3300005546 Ga0070696_100013575 Ga0070696_1000135753 272
315 3300005546 Ga0070696_100062314 Ga0070696_1000623142 272
316 3300005546 Ga0070696_100263188 Ga0070696_1002631881 272
317 3300005547 Ga0070693_100000395 Ga0070693_10000039520 272
318 3300005547 Ga0070693_100043723 Ga0070693_1000437232 272
319 3300005548 Ga0070665_100040455 Ga0070665_1000404553 272
320 3300005549 Ga0070704_100000203 Ga0070704_10000020311 272
321 3300005549 Ga0070704_100006684 Ga0070704_1000066842 272
322 3300005549 Ga0070704_100011525 Ga0070704_1000115254 272
323 3300005549 Ga0070704_100034318 Ga0070704_1000343182 272
324 3300005549 Ga0070704_100095595 Ga0070704_1000955952 272
325 3300005563 Ga0068855_100001461 Ga0068855_10000146110 272
326 3300005564 Ga0070664_100556784 Ga0070664_1005567841 272
327 3300005614 Ga0068856_100007042 Ga0068856_1000070422 272
328 3300005615 Ga0070702_100000049 Ga0070702_10000004918 272
329 3300005617 Ga0068859_100007613 Ga0068859_10000761310 272
330 3300005617 Ga0068859_100070873 Ga0068859_1000708733 272
331 3300005617 Ga0068859_100268948 Ga0068859_1002689482 272
332 3300005618 Ga0068864_100020028 Ga0068864_1000200287 272
333 3300005618 Ga0068864_100320476 Ga0068864_1003204761 272
334 3300005718 Ga0068866_10001779 Ga0068866_100017795 272
335 3300005719 Ga0068861_100000724 Ga0068861_10000072410 272
336 3300005841 Ga0068863_100109611 Ga0068863_1001096112 272
337 3300005841 Ga0068863_100430284 Ga0068863_1004302842 272
338 3300005842 Ga0068858_100001186 Ga0068858_10000118626 272
339 3300005842 Ga0068858_100175512 Ga0068858_1001755122 272
340 3300005842 Ga0068858_100295868 Ga0068858_1002958682 272
341 3300005843 Ga0068860_100011480 Ga0068860_10001148013 272
342 3300005843 Ga0068860_100121194 Ga0068860_1001211942 272
343 3300005844 Ga0068862_100001819 Ga0068862_1000018199 272
344 3300005844 Ga0068862_100118360 Ga0068862_1001183602 272
345 3300005937 Ga0081455_10019376 Ga0081455_100193763 272
346 3300005985 Ga0081539_10002942 Ga0081539_1000294222 272
347 3300006028 Ga0070717_10014290 Ga0070717_100142906 272
348 3300006028 Ga0070717_10458375 Ga0070717_104583751 272
349 3300006175 Ga0070712_100014383 Ga0070712_1000143832 272
350 3300006175 Ga0070712_100069108 Ga0070712_1000691082 272
351 3300006237 Ga0097621_100000594 Ga0097621_10000059410 272
352 3300006237 Ga0097621_100001811 Ga0097621_10000181116 272
353 3300006358 Ga0068871_100000636 Ga0068871_10000063629 272
354 3300006358 Ga0068871_100006653 Ga0068871_1000066534 272
355 3300006844 Ga0075428_100005156 Ga0075428_1000051562 272
356 3300006844 Ga0075428_100055884 Ga0075428_1000558843 272
357 3300006844 Ga0075428_100548290 Ga0075428_1005482901 272
358 3300006846 Ga0075430_100007795 Ga0075430_1000077957 272
359 3300006846 Ga0075430_100371793 Ga0075430_1003717932 272
360 3300006846 Ga0075430_100438819 Ga0075430_1004388192 272
361 3300006852 Ga0075433_10001970 Ga0075433_1000197015 272
362 3300006852 Ga0075433_10209650 Ga0075433_102096502 272
363 3300006871 Ga0075434_100001019 Ga0075434_10000101923 272
364 3300006871 Ga0075434_100006687 Ga0075434_1000066877 272
365 3300006871 Ga0075434_100030615 Ga0075434_1000306157 272
366 3300006871 Ga0075434_100411398 Ga0075434_1004113981 272
367 3300006880 Ga0075429_100012195 Ga0075429_1000121953 272
368 3300006880 Ga0075429_100029269 Ga0075429_1000292697 272
369 3300006880 Ga0075429_100043503 Ga0075429_1000435035 272
370 3300006880 Ga0075429_100095932 Ga0075429_1000959323 272
371 3300006881 Ga0068865_100000086 Ga0068865_10000008631 272
372 3300006914 Ga0075436_100003384 Ga0075436_1000033844 272
373 3300006931 Ga0097620_100007612 Ga0097620_1000076127 272
374 3300006931 Ga0097620_100070873 Ga0097620_1000708733 272
375 3300006931 Ga0097620_100268929 Ga0097620_1002689292 272
376 3300007076 Ga0075435_100002255 Ga0075435_1000022553 272
377 3300007076 Ga0075435_100004201 Ga0075435_10000420112 272
378 3300007076 Ga0075435_100456166 Ga0075435_1004561661 272
379 3300007076 Ga0075435_100563858 Ga0075435_1005638581 272
380 3300009094 Ga0111539_10012911 Ga0111539_100129116 272
381 3300009094 Ga0111539_10016090 Ga0111539_1001609012 272
382 3300009094 Ga0111539_10125703 Ga0111539_101257032 272
383 3300009094 Ga0111539_10254995 Ga0111539_102549952 272
384 3300009098 Ga0105245_10016415 Ga0105245_100164158 272
385 3300009147 Ga0114129_10004560 Ga0114129_1000456014 272
386 3300009147 Ga0114129_10007276 Ga0114129_100072767 272
387 3300009147 Ga0114129_10273023 Ga0114129_102730231 272
388 3300009147 Ga0114129_10480300 Ga0114129_104803002 272
389 3300009148 Ga0105243_10002776 Ga0105243_100027765 272
390 3300009176 Ga0105242_10002839 Ga0105242_1000283910 272
391 3300009176 Ga0105242_10025315 Ga0105242_100253155 272
392 3300009177 Ga0105248_10015963 Ga0105248_100159634 272
393 3300009177 Ga0105248_10384125 Ga0105248_103841252 272
394 3300009545 Ga0105237_10087014 Ga0105237_100870142 272
395 3300009545 Ga0105237_10864467 Ga0105237_108644671 272
396 3300009551 Ga0105238_10212104 Ga0105238_102121042 272
397 3300009553 Ga0105249_10014761 Ga0105249_100147612 272
398 3300009553 Ga0105249_10159566 Ga0105249_101595662 272
399 3300010375 Ga0105239_10049635 Ga0105239_100496355 272
400 3300010375 Ga0105239_10314128 Ga0105239_103141282 272
401 3300013105 Ga0157369_10327045 Ga0157369_103270452 272
402 3300013297 Ga0157378_10006675 Ga0157378_100066752 272
403 3300013306 Ga0163162_10086241 Ga0163162_100862412 272
404 3300013306 Ga0163162_10124295 Ga0163162_101242953 272
405 3300014326 Ga0157380_10182156 Ga0157380_101821562 272
406 3300014326 Ga0157380_10255331 Ga0157380_102553312 272
407 3300014968 Ga0157379_10026398 Ga0157379_100263985 272
408 3300014969 Ga0157376_10010862 Ga0157376_100108622 272
409 3300025898 Ga0207692_10083868 Ga0207692_100838682 272
410 3300025899 Ga0207642_10002590 Ga0207642_100025905 272
411 3300025905 Ga0207685_10053098 Ga0207685_100530982 272
412 3300025911 Ga0207654_10013691 Ga0207654_100136913 272
413 3300025911 Ga0207654_10200616 Ga0207654_102006161 272
414 3300025912 Ga0207707_10007157 Ga0207707_1000715710 272
415 3300025912 Ga0207707_10338416 Ga0207707_103384162 272
416 3300025915 Ga0207693_10020441 Ga0207693_100204412 272
417 3300025915 Ga0207693_10135052 Ga0207693_101350522 272
418 3300025917 Ga0207660_10260030 Ga0207660_102600302 272
419 3300025917 Ga0207660_10401908 Ga0207660_104019082 272
420 3300025918 Ga0207662_10005091 Ga0207662_100050912 272
421 3300025921 Ga0207652_10003435 Ga0207652_100034353 272
422 3300025921 Ga0207652_10121522 Ga0207652_101215223 272
423 3300025922 Ga0207646_10038158 Ga0207646_100381584 272
424 3300025922 Ga0207646_10053131 Ga0207646_100531312 272
425 3300025922 Ga0207646_10179073 Ga0207646_101790732 272
426 3300025926 Ga0207659_10066397 Ga0207659_100663973 272
427 3300025927 Ga0207687_10001793 Ga0207687_100017932 272
428 3300025928 Ga0207700_10029533 Ga0207700_100295332 272
429 3300025928 Ga0207700_10032214 Ga0207700_100322142 272
430 3300025929 Ga0207664_10059683 Ga0207664_100596834 272
431 3300025933 Ga0207706_10276872 Ga0207706_102768722 272
432 3300025934 Ga0207686_10001108 Ga0207686_100011083 272
433 3300025934 Ga0207686_10011236 Ga0207686_100112365 272
434 3300025935 Ga0207709_10000686 Ga0207709_1000068629 272
435 3300025936 Ga0207670_10000865 Ga0207670_1000086515 272
436 3300025936 Ga0207670_10004310 Ga0207670_100043103 272
437 3300025938 Ga0207704_10005370 Ga0207704_100053708 272
438 3300025941 Ga0207711_10014863 Ga0207711_100148636 272
439 3300025941 Ga0207711_10183546 Ga0207711_101835462 272
440 3300025942 Ga0207689_10000217 Ga0207689_1000021729 272
441 3300025942 Ga0207689_10288909 Ga0207689_102889091 272
442 3300025949 Ga0207667_10007910 Ga0207667_100079103 272
443 3300025960 Ga0207651_10034267 Ga0207651_100342672 272
444 3300025960 Ga0207651_10082682 Ga0207651_100826822 272
445 3300025961 Ga0207712_10001713 Ga0207712_1000171317 272
446 3300025961 Ga0207712_10065861 Ga0207712_100658612 272
447 3300026023 Ga0207677_10000917 Ga0207677_1000091711 272
448 3300026035 Ga0207703_10002068 Ga0207703_100020689 272
449 3300026035 Ga0207703_10192367 Ga0207703_101923672 272
450 3300026067 Ga0207678_10226784 Ga0207678_102267842 272
451 3300026075 Ga0207708_10012751 Ga0207708_100127517 272
452 3300026075 Ga0207708_10094154 Ga0207708_100941543 272
453 3300026078 Ga0207702_10309683 Ga0207702_103096832 272
454 3300026088 Ga0207641_10045374 Ga0207641_100453742 272
455 3300026089 Ga0207648_10000217 Ga0207648_1000021733 272
456 3300026095 Ga0207676_10013938 Ga0207676_100139383 272
457 3300026116 Ga0207674_10274278 Ga0207674_102742782 272
458 3300026118 Ga0207675_100000310 Ga0207675_10000031040 272
459 3300026118 Ga0207675_100120855 Ga0207675_1001208552 272
460 3300027671 Ga0209588_1008197 Ga0209588_10081972 272
461 3300027907 Ga0207428_10023439 Ga0207428_100234392 272
462 3300027907 Ga0207428_10024453 Ga0207428_100244532 272
463 3300028380 Ga0268265_10037206 Ga0268265_100372062 272
464 3300028380 Ga0268265_10037771 Ga0268265_100377712 272
465 3300028381 Ga0268264_10002238 Ga0268264_100022387 272
466 3300032005 Ga0307411_10140217 Ga0307411_101402172 272
467 3300034817 Ga0373948_0015745 Ga0373948_0015745_302_1120 272
468 3300034818 Ga0373950_0020867 Ga0373950_0020867_84_902 272
469 3300035083 Ga0373926_0001567 Ga0373926_0001567_5551_6369 272
470 3300035085 Ga0373929_0019371 Ga0373929_0019371_99_917 272
471 3300035086 Ga0373934_0000157 Ga0373934_0000157_7734_8609 272
472 3300035086 Ga0373934_0006830 Ga0373934_0006830_686_1561 272
473 3300035088 Ga0373940_0039834 Ga0373940_0039834_164_982 272
474 3300035089 Ga0373944_0002135 Ga0373944_0002135_2388_3263 272
475 3300035089 Ga0373944_0003108 Ga0373944_0003108_2052_2870 272
476 3300035090 Ga0373949_0013774 Ga0373949_0013774_921_1739 272
477 3300035091 Ga0373951_0060492 Ga0373951_0060492_42_902 272
478 3300035111 Ga0373923_0033757 Ga0373923_0033757_661_1536 272
479 3300035111 Ga0373923_0039845 Ga0373923_0039845_899_1774 272
480 3300035112 Ga0373932_0000678 Ga0373932_0000678_8393_9211 272
481 3300035113 Ga0373936_0001836 Ga0373936_0001836_5415_6233 272
482 3300035113 Ga0373936_0003130 Ga0373936_0003130_1234_2109 272
483 3300035116 Ga0373945_0011926 Ga0373945_0011926_1535_2410 272
484 3300035117 Ga0373953_0055872 Ga0373953_0055872_535_1410 272
485 3300035118 Ga0373954_0000008 Ga0373954_0000008_29495_30313 272
486 3300035118 Ga0373954_0034191 Ga0373954_0034191_361_1236 272
487 3300035119 Ga0373956_0000583 Ga0373956_0000583_9302_10177 272
488 3300035119 Ga0373956_0005070 Ga0373956_0005070_295_1170 272
489 3300035120 Ga0373957_0005040 Ga0373957_0005040_1864_2739 272
490 3300035120 Ga0373957_0088953 Ga0373957_0088953_314_1132 272
491 3300035170 Ga0373943_0000424 Ga0373943_0000424_10188_11063 272
492 3300035170 Ga0373943_0001830 Ga0373943_0001830_1364_2182 272
493 3300035171 Ga0373946_0001859 Ga0373946_0001859_2472_3347 272
494 3300035171 Ga0373946_0006846 Ga0373946_0006846_1317_2135 272
495 3300035171 Ga0373946_0024318 Ga0373946_0024318_1337_2212 272
496 3300035172 Ga0373955_0011974 Ga0373955_0011974_3207_4082 272
497 3300035172 Ga0373955_0028955 Ga0373955_0028955_1096_1971 272
498 3300035172 Ga0373955_0130705 Ga0373955_0130705_226_1044 272
499 3300035241 Ga0373961_0008867 Ga0373961_0008867_562_1380 272
500 3300035241 Ga0373961_0016204 Ga0373961_0016204_1043_1861 272
501 3300035410 Ga0373924_0000770 Ga0373924_0000770_1221_2096 272
502 3300035410 Ga0373924_0020915 Ga0373924_0020915_1041_1916 272
503 3300035691 Ga0373931_0024925 Ga0373931_0024925_1016_1834 272
504 3300035691 Ga0373931_0052045 Ga0373931_0052045_837_1655 272
505 3300035691 Ga0373931_0053438 Ga0373931_0053438_626_1444 272
506 3300035691 Ga0373931_0108977 Ga0373931_0108977_200_1018 272
507 3300035692 Ga0373935_0000882 Ga0373935_0000882_5290_6165 272
508 3300035692 Ga0373935_0015092 Ga0373935_0015092_1316_2134 272
509 3300035692 Ga0373935_0142744 Ga0373935_0142744_402_1295 272
510 3300035695 Ga0373927_0000414 Ga0373927_0000414_26897_27772 272
511 3300035695 Ga0373927_0015438 Ga0373927_0015438_1951_2769 272
512 3300035724 Ga0373933_0000480 Ga0373933_0000480_23952_24827 272
513 3300035724 Ga0373933_0001883 Ga0373933_0001883_9966_10784 272
514 3300035724 Ga0373933_0005143 Ga0373933_0005143_4690_5508 272
515 3300035724 Ga0373933_0027572 Ga0373933_0027572_312_1187 272
516 3300035724 Ga0373933_0124057 Ga0373933_0124057_79_954 272
517 3300035724 Ga0373933_0171041 Ga0373933_0171041_442_1317 272
518 3300035725 Ga0373947_0000275 Ga0373947_0000275_24423_25298 272
519 3300035725 Ga0373947_0003710 Ga0373947_0003710_5387_6205 272
520 3300035725 Ga0373947_0058886 Ga0373947_0058886_399_1274 272
521 3300035725 Ga0373947_0209665 Ga0373947_0209665_270_1145 272
522 3300036401 Ga0373937_0000096 Ga0373937_0000096_76311_77186 272
523 3300036401 Ga0373937_0002785 Ga0373937_0002785_11806_12624 272
524 3300036401 Ga0373937_0008812 Ga0373937_0008812_7547_8365 272
525 3300036401 Ga0373937_0031700 Ga0373937_0031700_3763_4581 272
526 3300036401 Ga0373937_0190577 Ga0373937_0190577_86_940 272
527 3300036401 Ga0373937_0206013 Ga0373937_0206013_169_1032 272
528 3300036401 Ga0373937_0318852 Ga0373937_0318852_57_950 272
529 3300037068 Ga0373925_0001290 Ga0373925_0001290_17281_18156 272
530 3300037068 Ga0373925_0005781 Ga0373925_0005781_2843_3661 272
531 3300037068 Ga0373925_0053537 Ga0373925_0053537_1338_2213 272
532 3300037068 Ga0373925_0209329 Ga0373925_0209329_281_1156 272
533 3300037418 Ga0395900_0016876 Ga0395900_0016876_682_1557 272
534 3300037466 Ga0395898_0013811 Ga0395898_0013811_2145_3020 272
535 3300037853 Ga0436364_1453265 Ga0436364_1453265_15_890 272
536 3300038443 Ga0395901_0001758 Ga0395901_0001758_12396_13271 272
537 3300041486 Ga0451807_0878204 Ga0451807_0878204_696_1514 272
538 3300042876 Ga0451577_0084711 Ga0451577_0084711_1403_2221 272
539 3300042876 Ga0451577_0165536 Ga0451577_0165536_677_1495 272
540 3300044684 Ga0466966_0090757 Ga0466966_0090757_897_1772 272
541 3300044694 Ga0466963_0067816 Ga0466963_0067816_1217_2092 272
542 3300044842 Ga0466957_0227552 Ga0466957_0227552_185_1060 272
543 3300045051 Ga0451576_0000360 Ga0451576_0000360_2382_3200 272
544 3300045051 Ga0451576_0344447 Ga0451576_0344447_132_950 272
545 3300045836 Ga0466958_0104697 Ga0466958_0104697_15_890 272
546 3300045976 Ga0466967_0369068 Ga0466967_0369068_84_959 272
547 3300046454 Ga0495592_0020888 Ga0495592_0020888_1832_2707 272
548 3300046454 Ga0495592_0105245 Ga0495592_0105245_234_1109 272
549 3300046454 Ga0495592_0112846 Ga0495592_0112846_938_1813 272
550 3300046455 Ga0495603_0000866 Ga0495603_0000866_5139_5957 272
551 3300046462 Ga0495651_0007473 Ga0495651_0007473_700_1575 272
552 3300046463 Ga0495653_0049761 Ga0495653_0049761_1924_2799 272
553 3300046463 Ga0495653_0164500 Ga0495653_0164500_489_1364 272
554 3300046463 Ga0495653_0229995 Ga0495653_0229995_322_1215 272
555 3300046472 Ga0495580_0003166 Ga0495580_0003166_12721_13596 272
556 3300046472 Ga0495580_0004091 Ga0495580_0004091_7072_7890 272
557 3300046472 Ga0495580_0069635 Ga0495580_0069635_843_1718 272
558 3300046472 Ga0495580_0159317 Ga0495580_0159317_660_1535 272
559 3300046473 Ga0495582_0036704 Ga0495582_0036704_896_1714 272
560 3300046473 Ga0495582_0043162 Ga0495582_0043162_1354_2229 272
561 3300046473 Ga0495582_0052475 Ga0495582_0052475_547_1365 272
562 3300046475 Ga0495639_0002543 Ga0495639_0002543_5302_6177 272
563 3300046475 Ga0495639_0017987 Ga0495639_0017987_527_1345 272
564 3300046476 Ga0495662_0000261 Ga0495662_0000261_1848_2723 272
565 3300046476 Ga0495662_0010319 Ga0495662_0010319_1008_1826 272
566 3300046476 Ga0495662_0019341 Ga0495662_0019341_2404_3222 272
567 3300046476 Ga0495662_0191790 Ga0495662_0191790_60_935 272
568 3300046477 Ga0495664_0000736 Ga0495664_0000736_387_1262 272
569 3300046477 Ga0495664_0051378 Ga0495664_0051378_79_954 272
570 3300046491 Ga0495584_0009947 Ga0495584_0009947_376_1251 272
571 3300046499 Ga0495594_0155114 Ga0495594_0155114_47_922 272
572 3300046511 Ga0495608_0062105 Ga0495608_0062105_1319_2137 272
573 3300046511 Ga0495608_0362279 Ga0495608_0362279_48_866 272
574 3300046514 Ga0495618_0009180 Ga0495618_0009180_387_1262 272
575 3300046514 Ga0495618_0042587 Ga0495618_0042587_1142_1960 272
576 3300046514 Ga0495618_0209425 Ga0495618_0209425_166_1041 272
577 3300046516 Ga0495628_0003204 Ga0495628_0003204_13378_14253 272
578 3300046516 Ga0495628_0010344 Ga0495628_0010344_3675_4550 272
579 3300046516 Ga0495628_0017152 Ga0495628_0017152_3445_4320 272
580 3300046516 Ga0495628_0253702 Ga0495628_0253702_278_1153 272
581 3300046517 Ga0495630_0012216 Ga0495630_0012216_2535_3410 272
582 3300046517 Ga0495630_0013180 Ga0495630_0013180_4720_5595 272
583 3300046517 Ga0495630_0024458 Ga0495630_0024458_3349_4224 272
584 3300046517 Ga0495630_0038940 Ga0495630_0038940_2672_3526 272
585 3300046517 Ga0495630_0318686 Ga0495630_0318686_119_937 272
586 3300046526 Ga0495666_0023659 Ga0495666_0023659_199_1074 272
587 3300046526 Ga0495666_0029459 Ga0495666_0029459_1602_2420 272
588 3300046526 Ga0495666_0103159 Ga0495666_0103159_57_875 272
589 3300046529 Ga0495652_0015892 Ga0495652_0015892_4169_5044 272
590 3300046529 Ga0495652_0061368 Ga0495652_0061368_1145_2020 272
591 3300046531 Ga0495665_0008610 Ga0495665_0008610_3088_3963 272
592 3300046531 Ga0495665_0024309 Ga0495665_0024309_2149_3024 272
593 3300046531 Ga0495665_0030263 Ga0495665_0030263_1610_2485 272
594 3300046533 Ga0495640_0002964 Ga0495640_0002964_9995_10870 272
595 3300046533 Ga0495640_0012112 Ga0495640_0012112_5452_6270 272
596 3300046533 Ga0495640_0030067 Ga0495640_0030067_469_1344 272
597 3300046533 Ga0495640_0033135 Ga0495640_0033135_2569_3444 272
598 3300046533 Ga0495640_0101691 Ga0495640_0101691_248_1123 272
599 3300046535 Ga0495586_0001814 Ga0495586_0001814_229_1104 272
600 3300046535 Ga0495586_0006063 Ga0495586_0006063_3244_4062 272
601 3300046536 Ga0495587_0007969 Ga0495587_0007969_44_862 272
602 3300046536 Ga0495587_0009492 Ga0495587_0009492_2883_3758 272
603 3300046536 Ga0495587_0024154 Ga0495587_0024154_564_1439 272
604 3300046543 Ga0495645_0001264 Ga0495645_0001264_9250_10125 272
605 3300046543 Ga0495645_0035117 Ga0495645_0035117_690_1565 272
606 3300046543 Ga0495645_0105969 Ga0495645_0105969_150_1025 272
607 3300046559 Ga0495667_0032581 Ga0495667_0032581_159_977 272
608 3300046559 Ga0495667_0196905 Ga0495667_0196905_261_1136 272
609 3300046615 Ga0495656_0032256 Ga0495656_0032256_1096_1914 272
610 3300046615 Ga0495656_0238836 Ga0495656_0238836_66_887 272
611 3300046642 Ga0495634_0016009 Ga0495634_0016009_786_1604 272
612 3300046642 Ga0495634_0026698 Ga0495634_0026698_2185_3060 272
613 3300046642 Ga0495634_0058277 Ga0495634_0058277_1338_2213 272
614 3300046642 Ga0495634_0080186 Ga0495634_0080186_559_1434 272
615 3300046663 Ga0495635_0000438 Ga0495635_0000438_18267_19142 272
616 3300046664 Ga0495659_0105319 Ga0495659_0105319_215_1033 272
617 3300046675 Ga0495657_0027929 Ga0495657_0027929_27_902 272
618 3300046675 Ga0495657_0040852 Ga0495657_0040852_969_1844 272
619 3300046678 Ga0495599_0006728 Ga0495599_0006728_273_1091 272
620 3300046678 Ga0495599_0008944 Ga0495599_0008944_3590_4465 272
621 3300046678 Ga0495599_0017728 Ga0495599_0017728_3127_4002 272
622 3300046678 Ga0495599_0026184 Ga0495599_0026184_2761_3636 272
623 3300046678 Ga0495599_0154806 Ga0495599_0154806_227_1102 272
624 3300046679 Ga0495623_0028239 Ga0495623_0028239_232_1107 272
625 3300046680 Ga0495646_0017519 Ga0495646_0017519_1528_2403 272
626 3300046680 Ga0495646_0147122 Ga0495646_0147122_314_1189 272
627 3300046681 Ga0495647_0000101 Ga0495647_0000101_15025_15843 272
628 3300046681 Ga0495647_0001930 Ga0495647_0001930_5538_6413 272
629 3300046681 Ga0495647_0039187 Ga0495647_0039187_660_1535 272
630 3300046683 Ga0495658_0009776 Ga0495658_0009776_50_868 272
631 3300046683 Ga0495658_0012211 Ga0495658_0012211_1050_1868 272
632 3300046683 Ga0495658_0044647 Ga0495658_0044647_695_1570 272
633 3300046683 Ga0495658_0046432 Ga0495658_0046432_561_1436 272
634 3300046684 Ga0495669_0063550 Ga0495669_0063550_573_1391 272
635 3300046689 Ga0495613_0009665 Ga0495613_0009665_554_1372 272
636 3300046689 Ga0495613_0057435 Ga0495613_0057435_458_1333 272
637 3300046689 Ga0495613_0164918 Ga0495613_0164918_258_1133 272
638 3300046690 Ga0495624_0001570 Ga0495624_0001570_3333_4208 272
639 3300046690 Ga0495624_0018484 Ga0495624_0018484_2698_3516 272
640 3300046809 Ga0495600_0012434 Ga0495600_0012434_4214_5089 272
641 3300046809 Ga0495600_0084717 Ga0495600_0084717_462_1337 272
642 3300047315 Ga0495581_0010385 Ga0495581_0010385_4336_5211 272
643 3300047315 Ga0495581_0018895 Ga0495581_0018895_524_1342 272
644 3300047315 Ga0495581_0329079 Ga0495581_0329079_25_843 272
645 3300047317 Ga0495604_0023995 Ga0495604_0023995_23_898 272
646 3300047317 Ga0495604_0025707 Ga0495604_0025707_164_982 272
647 3300047317 Ga0495604_0025979 Ga0495604_0025979_1262_2155 272
648 3300047319 Ga0495674_0000209 Ga0495674_0000209_38966_39841 272
649 3300047319 Ga0495674_0011630 Ga0495674_0011630_3826_4701 272
650 3300047319 Ga0495674_0158641 Ga0495674_0158641_879_1697 272
651 3300047321 Ga0495676_0043019 Ga0495676_0043019_2521_3396 272
652 3300047321 Ga0495676_0047052 Ga0495676_0047052_1442_2317 272
653 3300047322 Ga0495680_0012588 Ga0495680_0012588_825_1643 272
654 3300047322 Ga0495680_0026033 Ga0495680_0026033_3723_4598 272
655 3300047322 Ga0495680_0095038 Ga0495680_0095038_872_1690 272
656 3300047444 Ga0495675_0007134 Ga0495675_0007134_814_1689 272
657 3300047444 Ga0495675_0198541 Ga0495675_0198541_252_1070 272
658 3300047471 Ga0495684_0001766 Ga0495684_0001766_14379_15254 272
659 3300047471 Ga0495684_0003044 Ga0495684_0003044_327_1202 272
660 3300047471 Ga0495684_0008625 Ga0495684_0008625_327_1202 272
661 3300047471 Ga0495684_0044577 Ga0495684_0044577_2086_2961 272
662 3300047471 Ga0495684_0296647 Ga0495684_0296647_294_1112 272
663 3300047673 Ga0495593_0010564 Ga0495593_0010564_3869_4744 272
664 3300047673 Ga0495593_0090611 Ga0495593_0090611_175_1050 272
665 3300048088 Ga0495602_0442032 Ga0495602_0442032_28_846 272
666 3300048907 Ga0496104_0139247 Ga0496104_0139247_35_910 272
667 3300048909 Ga0496106_0144828 Ga0496106_0144828_863_1738 272
668 3300048912 Ga0496109_0076942 Ga0496109_0076942_1180_2055 272
669 3300048913 Ga0496110_0158039 Ga0496110_0158039_923_1798 272
670 3300048914 Ga0496111_0053903 Ga0496111_0053903_537_1412 272
671 3300048916 Ga0496113_0061909 Ga0496113_0061909_1050_1925 272
672 3300049572 Ga0501036_0392816 Ga0501036_0392816_267_1145 272
673 3300049576 Ga0501040_0007409 Ga0501040_0007409_3039_3857 272
674 3300049576 Ga0501040_0019632 Ga0501040_0019632_1198_2016 272
675 3300049576 Ga0501040_0024732 Ga0501040_0024732_398_1216 272
676 3300049577 Ga0501041_0007160 Ga0501041_0007160_1010_1828 272
677 3300049582 Ga0501048_0014025 Ga0501048_0014025_2547_3365 272
678 3300049583 Ga0501067_0085179 Ga0501067_0085179_557_1375 272
679 3300049584 Ga0501068_0109969 Ga0501068_0109969_124_942 272
680 3300049586 Ga0501070_0467474 Ga0501070_0467474_81_956 272
681 3300049587 Ga0501071_0224644 Ga0501071_0224644_428_1306 272
682 3300049588 Ga0501072_0054892 Ga0501072_0054892_1108_1926 272
683 3300049588 Ga0501072_0095649 Ga0501072_0095649_150_1025 272
684 3300049588 Ga0501072_0119298 Ga0501072_0119298_421_1239 272
685 3300049588 Ga0501072_0237488 Ga0501072_0237488_304_1182 272
686 3300049589 Ga0501073_0235442 Ga0501073_0235442_189_1010 272
687 3300049590 Ga0501074_0093014 Ga0501074_0093014_841_1659 272
688 3300049591 Ga0501075_0176539 Ga0501075_0176539_396_1214 272
689 3300049592 Ga0501076_0018795 Ga0501076_0018795_4166_5041 272
690 3300049592 Ga0501076_0081684 Ga0501076_0081684_1317_2135 272
691 3300049593 Ga0501077_0044071 Ga0501077_0044071_1722_2597 272
692 3300049741 Ga0501079_0065677 Ga0501079_0065677_972_1847 272
693 3300049741 Ga0501079_0367567 Ga0501079_0367567_201_1019 272
694 3300049743 Ga0501081_0099755 Ga0501081_0099755_884_1762 272
695 3300049743 Ga0501081_0148815 Ga0501081_0148815_694_1512 272
696 3300049824 Ga0501045_0177378 Ga0501045_0177378_253_1071 272
697 3300050507 nmdc:mga05p37_174307_c1 nmdc:mga05p37_174307_c1_368_1240 272
698 3300050507 nmdc:mga05p37_18630_c1 nmdc:mga05p37_18630_c1_5201_6049 272
699 3300050507 nmdc:mga05p37_277670_c1 nmdc:mga05p37_277670_c1_1147_1965 272
700 3300050507 nmdc:mga05p37_593775_c1 nmdc:mga05p37_593775_c1_159_977 272
701 3300050508 nmdc:mga09592_16926_c1 nmdc:mga09592_16926_c1_4863_5738 272
702 3300050508 nmdc:mga09592_39020_c1 nmdc:mga09592_39020_c1_915_1733 272
703 3300050509 nmdc:mga0qj67_16395_c1 nmdc:mga0qj67_16395_c1_2837_3700 272
704 3300050509 nmdc:mga0qj67_295401_c1 nmdc:mga0qj67_295401_c1_181_1059 272
705 3300050509 nmdc:mga0qj67_382814_c1 nmdc:mga0qj67_382814_c1_264_1082 272
706 3300050509 nmdc:mga0qj67_485939_c1 nmdc:mga0qj67_485939_c1_83_901 272
707 3300050511 nmdc:mga08y16_19349_c1 nmdc:mga08y16_19349_c1_4022_4897 272
708 3300050511 nmdc:mga08y16_241269_c1 nmdc:mga08y16_241269_c1_37_912 272
709 3300050511 nmdc:mga08y16_488327_c1 nmdc:mga08y16_488327_c1_97_915 272
710 3300050511 nmdc:mga08y16_65008_c1 nmdc:mga08y16_65008_c1_318_1136 272
711 3300050511 nmdc:mga08y16_8030_c1 nmdc:mga08y16_8030_c1_2590_3408 272
712 3300050512 nmdc:mga0n895_186252_c1 nmdc:mga0n895_186252_c1_18_836 272
713 3300050512 nmdc:mga0n895_24452_c1 nmdc:mga0n895_24452_c1_3952_4770 272
714 3300050512 nmdc:mga0n895_328945_c1 nmdc:mga0n895_328945_c1_264_1082 272
715 3300050512 nmdc:mga0n895_398267_c1 nmdc:mga0n895_398267_c1_74_949 272
716 3300050512 nmdc:mga0n895_86363_c1 nmdc:mga0n895_86363_c1_1903_2721 272
717 3300050513 nmdc:mga0rr50_38539_c1 nmdc:mga0rr50_38539_c1_1466_2284 272
718 3300050513 nmdc:mga0rr50_5178_c1 nmdc:mga0rr50_5178_c1_1436_2254 272
719 3300050513 nmdc:mga0rr50_9234_c1 nmdc:mga0rr50_9234_c1_3633_4451 272
720 3300050514 nmdc:mga08x19_1086_c1 nmdc:mga08x19_1086_c1_7879_8697 272
721 3300050514 nmdc:mga08x19_15159_c1 nmdc:mga08x19_15159_c1_3201_4019 272
722 3300050514 nmdc:mga08x19_369_c2 nmdc:mga08x19_369_c2_4997_5815 272
723 3300050514 nmdc:mga08x19_59734_c1 nmdc:mga08x19_59734_c1_1498_2316 272
724 3300050515 nmdc:mga0a205_126559_c1 nmdc:mga0a205_126559_c1_323_1141 272
725 3300050515 nmdc:mga0a205_1767_c1 nmdc:mga0a205_1767_c1_10519_11337 272
726 3300053077 Ga0495601_0001991 Ga0495601_0001991_3166_4041 272
727 3300053077 Ga0495601_0005391 Ga0495601_0005391_4476_5351 272
728 3300053077 Ga0495601_0015469 Ga0495601_0015469_3610_4428 272
729 3300053077 Ga0495601_0189318 Ga0495601_0189318_403_1221 272
730 3300053077 Ga0495601_0213778 Ga0495601_0213778_143_1036 272
731 3300053078 Ga0495612_0000353 Ga0495612_0000353_16039_16914 272
732 3300053078 Ga0495612_0077952 Ga0495612_0077952_193_1068 272
733 3300053084 Ga0495595_0007988 Ga0495595_0007988_3412_4287 272
734 3300053084 Ga0495595_0017855 Ga0495595_0017855_540_1415 272
735 3300053084 Ga0495595_0084487 Ga0495595_0084487_431_1306 272
736 3300053085 Ga0495619_0011558 Ga0495619_0011558_1868_2743 272
737 3300053085 Ga0495619_0011605 Ga0495619_0011605_2000_2875 272
738 3300053085 Ga0495619_0421070 Ga0495619_0421070_90_908 272
739 3300053153 Ga0500616_0010041 Ga0500616_0010041_4740_5597 272
740 3300054114 Ga0501084_0003157 Ga0501084_0003157_2254_3072 272
741 3300054114 Ga0501084_0195663 Ga0501084_0195663_345_1220 272
742 3300060353 Ga0501082_0090056 Ga0501082_0090056_1152_1970 272
743 3300061734 Ga0530510_0026321 Ga0530510_0026321_1461_2339 272
744 3300061734 Ga0530510_0050025 Ga0530510_0050025_921_1739 272
745 3300061734 Ga0530510_0114058 Ga0530510_0114058_844_1719 272
746 3300061734 Ga0530510_0178720 Ga0530510_0178720_601_1476 272

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02653

BPD_transp_2

Branched-chain amino acid transport system / permease component

16

284

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5316 2 261
7kyo-assembly1.cif.gz_C-2 psabc from streptococcus pneumoniae in complex with fab 0.5006 2 261
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4945 3 271
4dbl-assembly1.cif.gz_B crystal structure of e159q mutant of btucdf 0.4849 2 263
7kyp-assembly4.cif.gz_N psabc from streptococcus pneumoniae in complex with fab 0.4696 3 271
ID Description Score Start End Superfamily
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8708 2 259 1.10.3470.10
af_P0AEX7_11_292_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8261 2 259 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.8067 2 261 1.10.3470.10
af_P0AFS1_34_305_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7741 2 259 1.10.3470.10
af_Q58665_14_295_1.10.3470.10 Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC 0.7718 2 261 1.10.3470.10
ID Description Score Start End GO Terms
AF-A0A3S0FD86-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9701 2 192 GO:0005886
GO:0006865
GO:0022857
AF-A0A4P7YWF2-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9586 2 212 GO:0005886
GO:0006865
GO:0022857
AF-A0A382KPH0-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9578 3 184 GO:0005886
GO:0006865
GO:0022857
AF-A0A1I5Y358-F1-model_v4 Branched-chain amino acid transport system / permease component 0.9519 2 190 GO:0005886
GO:0006865
GO:0022857
AF-A0A537CK55-F1-model_v4 Branched-chain amino acid ABC transporter permease 0.9508 3 187 GO:0005886
GO:0006865
GO:0022857

Feature Viewer

pLDDT pTM Quality
81.51 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map