F478876
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 746 | 310 | 746 | 276 |
Family's Representative Sequence
| Representative Sequence | 3300035692|Ga0373935_0142744|Ga0373935_0142744_402_1295 |
| Length | 297 |
| Sequence | VVRGLPVDFAGNFISILLGGLSAGTVLFIVSVGLSVTMGLMGFVNLAHGAFAMFGGYVIVLAMNRAHIGFGPALALGFFATAALSAVLERLFYRRLYRAGELDQVLFTIGLIFIFIAGITITVGPESQPFELPPALGGQLNLGFLRYRTYSVFLIGVGLVIVLGIWLAFERTRIGAQIRATVDNRRMAESLGINVDRLFTITFAFGSGMAALGGGLGAEFLGLDPQYALKYLVYFLIVVSVGGLGSVVGVYYASLLLGVLDFVLKLYLPKGGTIFIYALTILLLLWRPRGLFGRKET |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 2 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 3 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 4 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 5 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 6 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 7 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 8 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 15 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 39 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 44 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 45 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 49 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 53 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 54 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 55 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 56 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 63 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 64 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 65 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 66 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 67 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 68 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 69 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 70 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 71 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 73 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 74 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 75 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 93 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 141 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 145 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 146 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 147 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 148 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 149 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 150 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 151 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 152 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 153 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 154 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 155 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 156 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 157 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 158 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 159 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 160 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 161 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 162 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 163 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 164 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 165 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 166 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 167 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 168 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 169 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 170 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 171 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 172 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 173 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 174 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 175 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 176 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 177 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 178 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 179 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 180 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 181 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 182 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 183 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 184 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 185 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 186 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 187 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 188 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 189 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 190 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 191 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 192 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 193 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 194 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 195 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 196 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 197 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 198 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 199 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 200 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 212 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 213 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 214 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 215 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 216 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 250 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 251 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 253 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 254 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 255 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 256 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 257 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 259 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 260 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 267 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 268 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 269 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 272 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 273 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 276 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 277 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 278 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 283 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 287 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 289 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 290 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 291 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 292 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 293 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 305 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 306 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 307 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 308 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 309 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 310 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.94 |
| Nodule | 0 |
| Rhizoplane | 0.94 |
| Rhizosphere | 97.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.67 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10027630 | 3300003203 | Bacteria | 2172 |
| 2 | rootH2_10025714 | 3300003320 | Bacteria | 2328 |
| 3 | Ga0065707_10002051 | 3300005295 | Bacteria | 5089 |
| 4 | Ga0065707_10111808 | 3300005295 | Bacteria | 2365 |
| 5 | Ga0070690_100000653 | 3300005330 | Bacteria | 17691 |
| 6 | Ga0070670_100026073 | 3300005331 | Bacteria | 5030 |
| 7 | Ga0068869_100001162 | 3300005334 | Bacteria | 15404 |
| 8 | Ga0068869_100066505 | 3300005334 | Bacteria | 2656 |
| 9 | Ga0070680_100000316 | 3300005336 | Bacteria | 32375 |
| 10 | Ga0070680_100160762 | 3300005336 | Bacteria | 1887 |
| 11 | Ga0070680_100207651 | 3300005336 | Bacteria | 1652 |
| 12 | Ga0070680_100412018 | 3300005336 | Bacteria | 1153 |
| 13 | Ga0070680_100427051 | 3300005336 | Bacteria | 1131 |
| 14 | Ga0070682_100004386 | 3300005337 | Bacteria | 7828 |
| 15 | Ga0070682_100341576 | 3300005337 | Bacteria | 1113 |
| 16 | Ga0068868_100010897 | 3300005338 | Bacteria | 6599 |
| 17 | Ga0070689_100000894 | 3300005340 | Bacteria | 18602 |
| 18 | Ga0070689_100008707 | 3300005340 | Bacteria | 7161 |
| 19 | Ga0070691_10000398 | 3300005341 | Bacteria | 15821 |
| 20 | Ga0070691_10221389 | 3300005341 | Bacteria | 1003 |
| 21 | Ga0070687_100000276 | 3300005343 | Bacteria | 17428 |
| 22 | Ga0070687_100073859 | 3300005343 | Bacteria | 1839 |
| 23 | Ga0070661_100109888 | 3300005344 | Bacteria | 2058 |
| 24 | Ga0070692_10002206 | 3300005345 | Bacteria | 7459 |
| 25 | Ga0070668_100285025 | 3300005347 | Bacteria | 1381 |
| 26 | Ga0070669_100067077 | 3300005353 | Bacteria | 2646 |
| 27 | Ga0070669_100459059 | 3300005353 | Bacteria | 1051 |
| 28 | Ga0070675_100026546 | 3300005354 | Bacteria | 4649 |
| 29 | Ga0070673_100094834 | 3300005364 | Bacteria | 2447 |
| 30 | Ga0070673_100162262 | 3300005364 | Bacteria | 1901 |
| 31 | Ga0070659_100435103 | 3300005366 | Bacteria | 1111 |
| 32 | Ga0070713_100039482 | 3300005436 | Bacteria | 3831 |
| 33 | Ga0070713_100201362 | 3300005436 | Bacteria | 1798 |
| 34 | Ga0070701_10001480 | 3300005438 | Bacteria | 8702 |
| 35 | Ga0070701_10040690 | 3300005438 | Bacteria | 2364 |
| 36 | Ga0070711_100076959 | 3300005439 | Bacteria | 2366 |
| 37 | Ga0070705_100004348 | 3300005440 | Bacteria | 6897 |
| 38 | Ga0070705_100198031 | 3300005440 | Bacteria | 1375 |
| 39 | Ga0070700_100007422 | 3300005441 | Bacteria | 5919 |
| 40 | Ga0070700_100103454 | 3300005441 | Bacteria | 1880 |
| 41 | Ga0070700_100242256 | 3300005441 | Bacteria | 1289 |
| 42 | Ga0070694_100006857 | 3300005444 | Bacteria | 6922 |
| 43 | Ga0070694_100054318 | 3300005444 | Bacteria | 2713 |
| 44 | Ga0070694_100093076 | 3300005444 | Bacteria | 2118 |
| 45 | Ga0070694_100144062 | 3300005444 | Bacteria | 1734 |
| 46 | Ga0070708_100011239 | 3300005445 | Bacteria | 7281 |
| 47 | Ga0070708_100025847 | 3300005445 | Bacteria | 5021 |
| 48 | Ga0070708_100386375 | 3300005445 | Bacteria | 1320 |
| 49 | Ga0070663_100003060 | 3300005455 | Bacteria | 9564 |
| 50 | Ga0070663_100149820 | 3300005455 | Unclassified | 1788 |
| 51 | Ga0070678_100041474 | 3300005456 | Bacteria | 3263 |
| 52 | Ga0070678_100060922 | 3300005456 | Bacteria | 2780 |
| 53 | Ga0070662_100441647 | 3300005457 | Bacteria | 1079 |
| 54 | Ga0070681_10008315 | 3300005458 | Bacteria | 10163 |
| 55 | Ga0070681_10021340 | 3300005458 | Bacteria | 6493 |
| 56 | Ga0070681_10036856 | 3300005458 | Bacteria | 4910 |
| 57 | Ga0070681_10045917 | 3300005458 | Bacteria | 4368 |
| 58 | Ga0070681_10125831 | 3300005458 | Bacteria | 2495 |
| 59 | Ga0068867_100001833 | 3300005459 | Bacteria | 14816 |
| 60 | Ga0068867_100115501 | 3300005459 | Bacteria | 2067 |
| 61 | Ga0070707_100017423 | 3300005468 | Bacteria | 6753 |
| 62 | Ga0070707_100039291 | 3300005468 | Bacteria | 4521 |
| 63 | Ga0070707_100094384 | 3300005468 | Bacteria | 2897 |
| 64 | Ga0070707_100227657 | 3300005468 | Bacteria | 1815 |
| 65 | Ga0070698_100250777 | 3300005471 | Bacteria | 1703 |
| 66 | Ga0070698_100600196 | 3300005471 | Bacteria | 1041 |
| 67 | Ga0070699_100017254 | 3300005518 | Bacteria | 6199 |
| 68 | Ga0070699_100077753 | 3300005518 | Bacteria | 2889 |
| 69 | Ga0070699_100162339 | 3300005518 | Bacteria | 1978 |
| 70 | Ga0070679_100120679 | 3300005530 | Bacteria | 2607 |
| 71 | Ga0070684_100314114 | 3300005535 | Bacteria | 1439 |
| 72 | Ga0070697_100012815 | 3300005536 | Bacteria | 6567 |
| 73 | Ga0070697_100070159 | 3300005536 | Bacteria | 2872 |
| 74 | Ga0070686_100003380 | 3300005544 | Bacteria | 8744 |
| 75 | Ga0070686_100004094 | 3300005544 | Bacteria | 8022 |
| 76 | Ga0070686_100180674 | 3300005544 | Bacteria | 1499 |
| 77 | Ga0070686_100218212 | 3300005544 | Bacteria | 1377 |
| 78 | Ga0070695_100000250 | 3300005545 | Bacteria | 26956 |
| 79 | Ga0070695_100052646 | 3300005545 | Bacteria | 2616 |
| 80 | Ga0070695_100086410 | 3300005545 | Bacteria | 2084 |
| 81 | Ga0070695_100146414 | 3300005545 | Bacteria | 1644 |
| 82 | Ga0070695_100331997 | 3300005545 | Bacteria | 1134 |
| 83 | Ga0070696_100000358 | 3300005546 | Bacteria | 27825 |
| 84 | Ga0070696_100013575 | 3300005546 | Bacteria | 5468 |
| 85 | Ga0070696_100014903 | 3300005546 | Bacteria | 5220 |
| 86 | Ga0070696_100062314 | 3300005546 | Bacteria | 2610 |
| 87 | Ga0070696_100263188 | 3300005546 | Bacteria | 1308 |
| 88 | Ga0070693_100000395 | 3300005547 | Bacteria | 19874 |
| 89 | Ga0070693_100043723 | 3300005547 | Bacteria | 2531 |
| 90 | Ga0070665_100040455 | 3300005548 | Bacteria | 4686 |
| 91 | Ga0070704_100000203 | 3300005549 | Bacteria | 24666 |
| 92 | Ga0070704_100006684 | 3300005549 | Bacteria | 6818 |
| 93 | Ga0070704_100011525 | 3300005549 | Bacteria | 5423 |
| 94 | Ga0070704_100034318 | 3300005549 | Bacteria | 3439 |
| 95 | Ga0070704_100095595 | 3300005549 | Bacteria | 2226 |
| 96 | Ga0070704_100232428 | 3300005549 | Bacteria | 1505 |
| 97 | Ga0068855_100001461 | 3300005563 | Bacteria | 29501 |
| 98 | Ga0070664_100556784 | 3300005564 | Bacteria | 1060 |
| 99 | Ga0068856_100007042 | 3300005614 | Bacteria | 10984 |
| 100 | Ga0070702_100000049 | 3300005615 | Bacteria | 33090 |
| 101 | Ga0070702_100048738 | 3300005615 | Bacteria | 2412 |
| 102 | Ga0068859_100007613 | 3300005617 | Bacteria | 11007 |
| 103 | Ga0068859_100070873 | 3300005617 | Bacteria | 3521 |
| 104 | Ga0068859_100268948 | 3300005617 | Bacteria | 1796 |
| 105 | Ga0068864_100020028 | 3300005618 | Bacteria | 5594 |
| 106 | Ga0068864_100320476 | 3300005618 | Bacteria | 1456 |
| 107 | Ga0068866_10001779 | 3300005718 | Bacteria | 9074 |
| 108 | Ga0068861_100000724 | 3300005719 | Bacteria | 19764 |
| 109 | Ga0068861_100064383 | 3300005719 | Bacteria | 2820 |
| 110 | Ga0068863_100109611 | 3300005841 | Bacteria | 2628 |
| 111 | Ga0068863_100430284 | 3300005841 | Bacteria | 1294 |
| 112 | Ga0068858_100001186 | 3300005842 | Bacteria | 26972 |
| 113 | Ga0068858_100175512 | 3300005842 | Bacteria | 2022 |
| 114 | Ga0068858_100295868 | 3300005842 | Bacteria | 1544 |
| 115 | Ga0068860_100011480 | 3300005843 | Bacteria | 8729 |
| 116 | Ga0068860_100121194 | 3300005843 | Bacteria | 2504 |
| 117 | Ga0068862_100001819 | 3300005844 | Bacteria | 19319 |
| 118 | Ga0068862_100015881 | 3300005844 | Bacteria | 6257 |
| 119 | Ga0068862_100067372 | 3300005844 | Bacteria | 3086 |
| 120 | Ga0068862_100118360 | 3300005844 | Bacteria | 2332 |
| 121 | Ga0081455_10019376 | 3300005937 | Bacteria | 6439 |
| 122 | Ga0081538_10029612 | 3300005981 | Bacteria | 3737 |
| 123 | Ga0081539_10002942 | 3300005985 | Bacteria | 22406 |
| 124 | Ga0070717_10014290 | 3300006028 | Bacteria | 6106 |
| 125 | Ga0070717_10458375 | 3300006028 | Bacteria | 1149 |
| 126 | Ga0070712_100003673 | 3300006175 | Bacteria | 9460 |
| 127 | Ga0070712_100014383 | 3300006175 | Bacteria | 5080 |
| 128 | Ga0070712_100069108 | 3300006175 | Bacteria | 2519 |
| 129 | Ga0097621_100000594 | 3300006237 | Bacteria | 25505 |
| 130 | Ga0097621_100001811 | 3300006237 | Bacteria | 14680 |
| 131 | Ga0068871_100000636 | 3300006358 | Bacteria | 24113 |
| 132 | Ga0068871_100006653 | 3300006358 | Bacteria | 8198 |
| 133 | Ga0075428_100005156 | 3300006844 | Bacteria | 14525 |
| 134 | Ga0075428_100023200 | 3300006844 | Bacteria | 6863 |
| 135 | Ga0075428_100023887 | 3300006844 | Bacteria | 6765 |
| 136 | Ga0075428_100055884 | 3300006844 | Bacteria | 4324 |
| 137 | Ga0075428_100548290 | 3300006844 | Bacteria | 1236 |
| 138 | Ga0075430_100007795 | 3300006846 | Bacteria | 9046 |
| 139 | Ga0075430_100009297 | 3300006846 | Bacteria | 8307 |
| 140 | Ga0075430_100371793 | 3300006846 | Bacteria | 1180 |
| 141 | Ga0075430_100438819 | 3300006846 | Bacteria | 1078 |
| 142 | Ga0075431_100012271 | 3300006847 | Bacteria | 8647 |
| 143 | Ga0075431_100062084 | 3300006847 | Bacteria | 3856 |
| 144 | Ga0075431_100206942 | 3300006847 | Bacteria | 2006 |
| 145 | Ga0075431_100329387 | 3300006847 | Bacteria | 1538 |
| 146 | Ga0075433_10001970 | 3300006852 | Bacteria | 15441 |
| 147 | Ga0075433_10209650 | 3300006852 | Bacteria | 1732 |
| 148 | Ga0075434_100000363 | 3300006871 | Bacteria | 32902 |
| 149 | Ga0075434_100001019 | 3300006871 | Bacteria | 22804 |
| 150 | Ga0075434_100006687 | 3300006871 | Bacteria | 10587 |
| 151 | Ga0075434_100030615 | 3300006871 | Bacteria | 5301 |
| 152 | Ga0075434_100411398 | 3300006871 | Bacteria | 1374 |
| 153 | Ga0075429_100012195 | 3300006880 | Bacteria | 7451 |
| 154 | Ga0075429_100026172 | 3300006880 | Bacteria | 5063 |
| 155 | Ga0075429_100029269 | 3300006880 | Bacteria | 4784 |
| 156 | Ga0075429_100043503 | 3300006880 | Bacteria | 3908 |
| 157 | Ga0075429_100095932 | 3300006880 | Bacteria | 2586 |
| 158 | Ga0075429_100327184 | 3300006880 | Bacteria | 1341 |
| 159 | Ga0075429_100366528 | 3300006880 | Bacteria | 1261 |
| 160 | Ga0068865_100000086 | 3300006881 | Bacteria | 49762 |
| 161 | Ga0068865_100076690 | 3300006881 | Bacteria | 2386 |
| 162 | Ga0075436_100003384 | 3300006914 | Bacteria | 10925 |
| 163 | Ga0097620_100007612 | 3300006931 | Bacteria | 11007 |
| 164 | Ga0097620_100070873 | 3300006931 | Bacteria | 3521 |
| 165 | Ga0097620_100268929 | 3300006931 | Bacteria | 1796 |
| 166 | Ga0075435_100002255 | 3300007076 | Bacteria | 12730 |
| 167 | Ga0075435_100004201 | 3300007076 | Bacteria | 9880 |
| 168 | Ga0075435_100008212 | 3300007076 | Bacteria | 7476 |
| 169 | Ga0075435_100021842 | 3300007076 | Bacteria | 4930 |
| 170 | Ga0075435_100456166 | 3300007076 | Bacteria | 1102 |
| 171 | Ga0075435_100563858 | 3300007076 | Bacteria | 987 |
| 172 | Ga0099794_10027033 | 3300007265 | Bacteria | 2657 |
| 173 | Ga0099795_10014013 | 3300007788 | Bacteria | 2475 |
| 174 | Ga0099795_10065966 | 3300007788 | Bacteria | 1354 |
| 175 | Ga0105240_10495475 | 3300009093 | Bacteria | 1359 |
| 176 | Ga0111539_10012911 | 3300009094 | Bacteria | 10452 |
| 177 | Ga0111539_10016090 | 3300009094 | Bacteria | 9283 |
| 178 | Ga0111539_10035931 | 3300009094 | Bacteria | 5997 |
| 179 | Ga0111539_10111614 | 3300009094 | Bacteria | 3208 |
| 180 | Ga0111539_10125703 | 3300009094 | Bacteria | 3005 |
| 181 | Ga0111539_10254995 | 3300009094 | Bacteria | 2043 |
| 182 | Ga0105245_10016415 | 3300009098 | Bacteria | 6458 |
| 183 | Ga0114129_10004560 | 3300009147 | Bacteria | 19550 |
| 184 | Ga0114129_10007276 | 3300009147 | Bacteria | 15756 |
| 185 | Ga0114129_10273023 | 3300009147 | Bacteria | 2261 |
| 186 | Ga0114129_10480300 | 3300009147 | Bacteria | 1626 |
| 187 | Ga0105243_10002776 | 3300009148 | Bacteria | 14554 |
| 188 | Ga0105243_10007856 | 3300009148 | Bacteria | 8198 |
| 189 | Ga0105242_10002839 | 3300009176 | Bacteria | 13572 |
| 190 | Ga0105242_10025315 | 3300009176 | Bacteria | 4695 |
| 191 | Ga0105248_10015963 | 3300009177 | Bacteria | 8269 |
| 192 | Ga0105248_10384125 | 3300009177 | Bacteria | 1581 |
| 193 | Ga0105237_10087014 | 3300009545 | Bacteria | 3114 |
| 194 | Ga0105237_10864467 | 3300009545 | Bacteria | 911 |
| 195 | Ga0105238_10212104 | 3300009551 | Bacteria | 1912 |
| 196 | Ga0105249_10014761 | 3300009553 | Bacteria | 6905 |
| 197 | Ga0105249_10085032 | 3300009553 | Bacteria | 2947 |
| 198 | Ga0105249_10159566 | 3300009553 | Bacteria | 2178 |
| 199 | Ga0099796_10065582 | 3300010159 | Unclassified | 1298 |
| 200 | Ga0105239_10049635 | 3300010375 | Bacteria | 4601 |
| 201 | Ga0105239_10314128 | 3300010375 | Bacteria | 1766 |
| 202 | Ga0157370_10069750 | 3300013104 | Bacteria | 3319 |
| 203 | Ga0157369_10004736 | 3300013105 | Bacteria | 15983 |
| 204 | Ga0157369_10327045 | 3300013105 | Bacteria | 1593 |
| 205 | Ga0157378_10006675 | 3300013297 | Bacteria | 10080 |
| 206 | Ga0163162_10086241 | 3300013306 | Bacteria | 3217 |
| 207 | Ga0163162_10124295 | 3300013306 | Bacteria | 2686 |
| 208 | Ga0157380_10090078 | 3300014326 | Bacteria | 2529 |
| 209 | Ga0157380_10182156 | 3300014326 | Bacteria | 1847 |
| 210 | Ga0157380_10255331 | 3300014326 | Bacteria | 1589 |
| 211 | Ga0182008_10058954 | 3300014497 | Bacteria | 1894 |
| 212 | Ga0157379_10026398 | 3300014968 | Bacteria | 5171 |
| 213 | Ga0157376_10010862 | 3300014969 | Bacteria | 6685 |
| 214 | Ga0207682_10124555 | 3300025893 | Bacteria | 1146 |
| 215 | Ga0207692_10083868 | 3300025898 | Bacteria | 1711 |
| 216 | Ga0207642_10002590 | 3300025899 | Bacteria | 5636 |
| 217 | Ga0207685_10053098 | 3300025905 | Bacteria | 1573 |
| 218 | Ga0207643_10013812 | 3300025908 | Bacteria | 4380 |
| 219 | Ga0207684_10327467 | 3300025910 | Bacteria | 1320 |
| 220 | Ga0207654_10013691 | 3300025911 | Bacteria | 4176 |
| 221 | Ga0207654_10200616 | 3300025911 | Bacteria | 1313 |
| 222 | Ga0207707_10007157 | 3300025912 | Bacteria | 9714 |
| 223 | Ga0207707_10040112 | 3300025912 | Bacteria | 4091 |
| 224 | Ga0207707_10043000 | 3300025912 | Bacteria | 3942 |
| 225 | Ga0207707_10101383 | 3300025912 | Bacteria | 2516 |
| 226 | Ga0207707_10338416 | 3300025912 | Bacteria | 1298 |
| 227 | Ga0207693_10009873 | 3300025915 | Bacteria | 7764 |
| 228 | Ga0207693_10020441 | 3300025915 | Bacteria | 5267 |
| 229 | Ga0207693_10135052 | 3300025915 | Bacteria | 1939 |
| 230 | Ga0207660_10260030 | 3300025917 | Bacteria | 1372 |
| 231 | Ga0207660_10401908 | 3300025917 | Bacteria | 1103 |
| 232 | Ga0207662_10005091 | 3300025918 | Bacteria | 6969 |
| 233 | Ga0207652_10003435 | 3300025921 | Bacteria | 13073 |
| 234 | Ga0207652_10088992 | 3300025921 | Unclassified | 2710 |
| 235 | Ga0207652_10121522 | 3300025921 | Bacteria | 2324 |
| 236 | Ga0207652_10267953 | 3300025921 | Bacteria | 1540 |
| 237 | Ga0207646_10021399 | 3300025922 | Bacteria | 5977 |
| 238 | Ga0207646_10038158 | 3300025922 | Bacteria | 4328 |
| 239 | Ga0207646_10053131 | 3300025922 | Bacteria | 3624 |
| 240 | Ga0207646_10179073 | 3300025922 | Bacteria | 1914 |
| 241 | Ga0207681_10057877 | 3300025923 | Bacteria | 2651 |
| 242 | Ga0207650_10244761 | 3300025925 | Bacteria | 1450 |
| 243 | Ga0207659_10059815 | 3300025926 | Bacteria | 2740 |
| 244 | Ga0207659_10066397 | 3300025926 | Bacteria | 2618 |
| 245 | Ga0207687_10001793 | 3300025927 | Bacteria | 14780 |
| 246 | Ga0207700_10029533 | 3300025928 | Bacteria | 3870 |
| 247 | Ga0207700_10032214 | 3300025928 | Bacteria | 3736 |
| 248 | Ga0207664_10059683 | 3300025929 | Bacteria | 3039 |
| 249 | Ga0207706_10276872 | 3300025933 | Bacteria | 1464 |
| 250 | Ga0207686_10001108 | 3300025934 | Bacteria | 15680 |
| 251 | Ga0207686_10011236 | 3300025934 | Bacteria | 4897 |
| 252 | Ga0207709_10000686 | 3300025935 | Bacteria | 27320 |
| 253 | Ga0207670_10000865 | 3300025936 | Bacteria | 15917 |
| 254 | Ga0207670_10004310 | 3300025936 | Bacteria | 7639 |
| 255 | Ga0207670_10038240 | 3300025936 | Bacteria | 3133 |
| 256 | Ga0207670_10080826 | 3300025936 | Bacteria | 2273 |
| 257 | Ga0207704_10005370 | 3300025938 | Bacteria | 5905 |
| 258 | Ga0207665_10211219 | 3300025939 | Bacteria | 1418 |
| 259 | Ga0207691_10070970 | 3300025940 | Bacteria | 3144 |
| 260 | Ga0207711_10014863 | 3300025941 | Bacteria | 6468 |
| 261 | Ga0207711_10183546 | 3300025941 | Bacteria | 1903 |
| 262 | Ga0207689_10000217 | 3300025942 | Bacteria | 51018 |
| 263 | Ga0207689_10288909 | 3300025942 | Bacteria | 1358 |
| 264 | Ga0207667_10007910 | 3300025949 | Bacteria | 12695 |
| 265 | Ga0207651_10034267 | 3300025960 | Bacteria | 3286 |
| 266 | Ga0207651_10082682 | 3300025960 | Bacteria | 2319 |
| 267 | Ga0207712_10001713 | 3300025961 | Bacteria | 14726 |
| 268 | Ga0207712_10065861 | 3300025961 | Bacteria | 2588 |
| 269 | Ga0207712_10082894 | 3300025961 | Bacteria | 2339 |
| 270 | Ga0207668_10015384 | 3300025972 | Bacteria | 4753 |
| 271 | Ga0207677_10000917 | 3300026023 | Bacteria | 16496 |
| 272 | Ga0207703_10002068 | 3300026035 | Bacteria | 17657 |
| 273 | Ga0207703_10192367 | 3300026035 | Bacteria | 1808 |
| 274 | Ga0207678_10051638 | 3300026067 | Bacteria | 3549 |
| 275 | Ga0207678_10226784 | 3300026067 | Bacteria | 1599 |
| 276 | Ga0207708_10006688 | 3300026075 | Bacteria | 8526 |
| 277 | Ga0207708_10012751 | 3300026075 | Bacteria | 6268 |
| 278 | Ga0207708_10094154 | 3300026075 | Bacteria | 2312 |
| 279 | Ga0207702_10309683 | 3300026078 | Bacteria | 1501 |
| 280 | Ga0207641_10045374 | 3300026088 | Bacteria | 3701 |
| 281 | Ga0207648_10000217 | 3300026089 | Bacteria | 62158 |
| 282 | Ga0207676_10013938 | 3300026095 | Bacteria | 5771 |
| 283 | Ga0207674_10274278 | 3300026116 | Bacteria | 1634 |
| 284 | Ga0207675_100000310 | 3300026118 | Bacteria | 46701 |
| 285 | Ga0207675_100120855 | 3300026118 | Bacteria | 2478 |
| 286 | Ga0209968_1005950 | 3300027526 | Bacteria | 1836 |
| 287 | Ga0209968_1009412 | 3300027526 | Bacteria | 1495 |
| 288 | Ga0209588_1008197 | 3300027671 | Bacteria | 3091 |
| 289 | Ga0209588_1022947 | 3300027671 | Bacteria | 1965 |
| 290 | Ga0209971_1022747 | 3300027682 | Bacteria | 1494 |
| 291 | Ga0207428_10023439 | 3300027907 | Bacteria | 5191 |
| 292 | Ga0207428_10024453 | 3300027907 | Bacteria | 5071 |
| 293 | Ga0207428_10092501 | 3300027907 | Bacteria | 2347 |
| 294 | Ga0268265_10037206 | 3300028380 | Bacteria | 3570 |
| 295 | Ga0268265_10037771 | 3300028380 | Bacteria | 3546 |
| 296 | Ga0268264_10002238 | 3300028381 | Bacteria | 17153 |
| 297 | Ga0265338_10002492 | 3300028800 | Bacteria | 27463 |
| 298 | Ga0265330_10075726 | 3300031235 | Unclassified | 1453 |
| 299 | Ga0265320_10012678 | 3300031240 | Bacteria | 4889 |
| 300 | Ga0265339_10012730 | 3300031249 | Bacteria | 5120 |
| 301 | Ga0265331_10040004 | 3300031250 | Unclassified | 2283 |
| 302 | Ga0307408_100145006 | 3300031548 | Bacteria | 1868 |
| 303 | Ga0307405_10083056 | 3300031731 | Bacteria | 2099 |
| 304 | Ga0307411_10140217 | 3300032005 | Bacteria | 1782 |
| 305 | Ga0373930_0035979 | 3300034816 | Bacteria | 1037 |
| 306 | Ga0373948_0015745 | 3300034817 | Bacteria | 1391 |
| 307 | Ga0373950_0020867 | 3300034818 | Bacteria | 1155 |
| 308 | Ga0373926_0001567 | 3300035083 | Bacteria | 7023 |
| 309 | Ga0373926_0028169 | 3300035083 | Bacteria | 1971 |
| 310 | Ga0373929_0019371 | 3300035085 | Bacteria | 1362 |
| 311 | Ga0373934_0000157 | 3300035086 | Bacteria | 24724 |
| 312 | Ga0373934_0006830 | 3300035086 | Bacteria | 4237 |
| 313 | Ga0373940_0039834 | 3300035088 | Bacteria | 1287 |
| 314 | Ga0373944_0002135 | 3300035089 | Bacteria | 5023 |
| 315 | Ga0373944_0003108 | 3300035089 | Bacteria | 4273 |
| 316 | Ga0373949_0013774 | 3300035090 | Bacteria | 1796 |
| 317 | Ga0373951_0060492 | 3300035091 | Bacteria | 947 |
| 318 | Ga0373923_0033757 | 3300035111 | Bacteria | 2073 |
| 319 | Ga0373923_0039845 | 3300035111 | Bacteria | 1931 |
| 320 | Ga0373932_0000678 | 3300035112 | Bacteria | 10295 |
| 321 | Ga0373932_0064472 | 3300035112 | Bacteria | 1122 |
| 322 | Ga0373936_0001836 | 3300035113 | Bacteria | 7815 |
| 323 | Ga0373936_0003130 | 3300035113 | Bacteria | 6194 |
| 324 | Ga0373936_0030376 | 3300035113 | Bacteria | 2130 |
| 325 | Ga0373945_0011926 | 3300035116 | Bacteria | 2880 |
| 326 | Ga0373945_0053500 | 3300035116 | Bacteria | 1490 |
| 327 | Ga0373945_0166402 | 3300035116 | Unclassified | 901 |
| 328 | Ga0373953_0055872 | 3300035117 | Bacteria | 1604 |
| 329 | Ga0373953_0206265 | 3300035117 | Bacteria | 850 |
| 330 | Ga0373954_0000008 | 3300035118 | Bacteria | 79963 |
| 331 | Ga0373954_0010081 | 3300035118 | Bacteria | 4162 |
| 332 | Ga0373954_0034191 | 3300035118 | Bacteria | 2353 |
| 333 | Ga0373956_0000583 | 3300035119 | Bacteria | 14961 |
| 334 | Ga0373956_0005070 | 3300035119 | Bacteria | 5271 |
| 335 | Ga0373957_0005040 | 3300035120 | Bacteria | 4075 |
| 336 | Ga0373957_0088953 | 3300035120 | Bacteria | 1225 |
| 337 | Ga0373943_0000424 | 3300035170 | Bacteria | 17836 |
| 338 | Ga0373943_0001830 | 3300035170 | Bacteria | 9615 |
| 339 | Ga0373943_0003842 | 3300035170 | Bacteria | 6826 |
| 340 | Ga0373946_0001859 | 3300035171 | Bacteria | 7373 |
| 341 | Ga0373946_0006846 | 3300035171 | Bacteria | 4147 |
| 342 | Ga0373946_0024318 | 3300035171 | Bacteria | 2373 |
| 343 | Ga0373946_0028021 | 3300035171 | Bacteria | 2231 |
| 344 | Ga0373955_0011974 | 3300035172 | Bacteria | 4156 |
| 345 | Ga0373955_0028955 | 3300035172 | Bacteria | 2876 |
| 346 | Ga0373955_0130705 | 3300035172 | Bacteria | 1465 |
| 347 | Ga0373961_0008867 | 3300035241 | Bacteria | 2452 |
| 348 | Ga0373961_0016204 | 3300035241 | Bacteria | 1918 |
| 349 | Ga0373924_0000770 | 3300035410 | Bacteria | 9948 |
| 350 | Ga0373924_0020915 | 3300035410 | Bacteria | 2548 |
| 351 | Ga0373931_0024925 | 3300035691 | Bacteria | 3035 |
| 352 | Ga0373931_0052045 | 3300035691 | Bacteria | 2182 |
| 353 | Ga0373931_0053438 | 3300035691 | Bacteria | 2155 |
| 354 | Ga0373931_0108977 | 3300035691 | Bacteria | 1568 |
| 355 | Ga0373935_0000882 | 3300035692 | Bacteria | 16207 |
| 356 | Ga0373935_0015092 | 3300035692 | Bacteria | 4664 |
| 357 | Ga0373935_0015655 | 3300035692 | Bacteria | 4587 |
| 358 | Ga0373935_0142744 | 3300035692 | Bacteria | 1619 |
| 359 | Ga0373927_0000414 | 3300035695 | Bacteria | 32784 |
| 360 | Ga0373927_0013439 | 3300035695 | Bacteria | 5441 |
| 361 | Ga0373927_0015438 | 3300035695 | Bacteria | 5046 |
| 362 | Ga0373933_0000480 | 3300035724 | Bacteria | 24930 |
| 363 | Ga0373933_0001883 | 3300035724 | Bacteria | 12112 |
| 364 | Ga0373933_0005143 | 3300035724 | Bacteria | 7137 |
| 365 | Ga0373933_0027572 | 3300035724 | Bacteria | 3272 |
| 366 | Ga0373933_0124057 | 3300035724 | Bacteria | 1619 |
| 367 | Ga0373933_0171041 | 3300035724 | Bacteria | 1382 |
| 368 | Ga0373947_0000275 | 3300035725 | Bacteria | 29242 |
| 369 | Ga0373947_0003710 | 3300035725 | Bacteria | 9022 |
| 370 | Ga0373947_0005057 | 3300035725 | Bacteria | 7723 |
| 371 | Ga0373947_0058886 | 3300035725 | Bacteria | 2328 |
| 372 | Ga0373947_0209665 | 3300035725 | Bacteria | 1278 |
| 373 | Ga0373937_0000096 | 3300036401 | Bacteria | 81963 |
| 374 | Ga0373937_0002785 | 3300036401 | Bacteria | 14599 |
| 375 | Ga0373937_0008812 | 3300036401 | Bacteria | 8751 |
| 376 | Ga0373937_0031700 | 3300036401 | Bacteria | 4791 |
| 377 | Ga0373937_0190577 | 3300036401 | Bacteria | 1927 |
| 378 | Ga0373937_0206013 | 3300036401 | Bacteria | 1850 |
| 379 | Ga0373937_0318852 | 3300036401 | Bacteria | 1470 |
| 380 | Ga0373925_0001290 | 3300037068 | Bacteria | 22022 |
| 381 | Ga0373925_0005781 | 3300037068 | Bacteria | 9192 |
| 382 | Ga0373925_0038766 | 3300037068 | Bacteria | 3524 |
| 383 | Ga0373925_0053537 | 3300037068 | Bacteria | 3017 |
| 384 | Ga0373925_0209329 | 3300037068 | Unclassified | 1553 |
| 385 | Ga0395900_0016876 | 3300037418 | Bacteria | 7452 |
| 386 | Ga0395900_0134190 | 3300037418 | Bacteria | 2536 |
| 387 | Ga0395898_0013811 | 3300037466 | Bacteria | 8302 |
| 388 | Ga0436364_1453265 | 3300037853 | Bacteria | 1023 |
| 389 | Ga0395901_0001758 | 3300038443 | Bacteria | 22356 |
| 390 | Ga0436362_0558861 | 3300039453 | Bacteria | 1225 |
| 391 | Ga0451807_0878204 | 3300041486 | Bacteria | 2217 |
| 392 | Ga0439443_001092 | 3300042003 | Bacteria | 2849 |
| 393 | Ga0439435_0001580 | 3300042436 | Bacteria | 4265 |
| 394 | Ga0439444_0014971 | 3300042437 | Bacteria | 1303 |
| 395 | Ga0439460_0000144 | 3300042461 | Bacteria | 12838 |
| 396 | Ga0439460_0029990 | 3300042461 | Bacteria | 1543 |
| 397 | Ga0451577_0084711 | 3300042876 | Bacteria | 2828 |
| 398 | Ga0451577_0165536 | 3300042876 | Bacteria | 1992 |
| 399 | Ga0453683_0110500 | 3300044673 | Bacteria | 1729 |
| 400 | Ga0466966_0071360 | 3300044684 | Bacteria | 2176 |
| 401 | Ga0466966_0090757 | 3300044684 | Bacteria | 1897 |
| 402 | Ga0466963_0011482 | 3300044694 | Bacteria | 5395 |
| 403 | Ga0466963_0067816 | 3300044694 | Bacteria | 2395 |
| 404 | Ga0466957_0171984 | 3300044842 | Bacteria | 1411 |
| 405 | Ga0466957_0227552 | 3300044842 | Bacteria | 1233 |
| 406 | Ga0466959_0432353 | 3300045049 | Bacteria | 893 |
| 407 | Ga0451576_0000360 | 3300045051 | Bacteria | 109145 |
| 408 | Ga0451576_0023021 | 3300045051 | Bacteria | 6751 |
| 409 | Ga0451576_0344447 | 3300045051 | Bacteria | 1560 |
| 410 | Ga0466958_0104697 | 3300045836 | Bacteria | 1762 |
| 411 | Ga0466967_0186236 | 3300045976 | Bacteria | 1960 |
| 412 | Ga0466967_0369068 | 3300045976 | Bacteria | 1392 |
| 413 | Ga0466967_0925340 | 3300045976 | Bacteria | 867 |
| 414 | Ga0495592_0020888 | 3300046454 | Bacteria | 4981 |
| 415 | Ga0495592_0105245 | 3300046454 | Bacteria | 2004 |
| 416 | Ga0495592_0112846 | 3300046454 | Bacteria | 1921 |
| 417 | Ga0495592_0121564 | 3300046454 | Bacteria | 1836 |
| 418 | Ga0495603_0000866 | 3300046455 | Bacteria | 17337 |
| 419 | Ga0495651_0007473 | 3300046462 | Bacteria | 8356 |
| 420 | Ga0495651_0246068 | 3300046462 | Bacteria | 1224 |
| 421 | Ga0495653_0049761 | 3300046463 | Bacteria | 3226 |
| 422 | Ga0495653_0164500 | 3300046463 | Unclassified | 1537 |
| 423 | Ga0495653_0229995 | 3300046463 | Bacteria | 1241 |
| 424 | Ga0495580_0003166 | 3300046472 | Bacteria | 14111 |
| 425 | Ga0495580_0004091 | 3300046472 | Bacteria | 12296 |
| 426 | Ga0495580_0069635 | 3300046472 | Bacteria | 2458 |
| 427 | Ga0495580_0159317 | 3300046472 | Bacteria | 1562 |
| 428 | Ga0495582_0036704 | 3300046473 | Bacteria | 2696 |
| 429 | Ga0495582_0043162 | 3300046473 | Bacteria | 2483 |
| 430 | Ga0495582_0052475 | 3300046473 | Bacteria | 2249 |
| 431 | Ga0495639_0002543 | 3300046475 | Bacteria | 7956 |
| 432 | Ga0495639_0017987 | 3300046475 | Bacteria | 3073 |
| 433 | Ga0495662_0000261 | 3300046476 | Bacteria | 22323 |
| 434 | Ga0495662_0010319 | 3300046476 | Bacteria | 4577 |
| 435 | Ga0495662_0019341 | 3300046476 | Bacteria | 3293 |
| 436 | Ga0495662_0191790 | 3300046476 | Bacteria | 1007 |
| 437 | Ga0495664_0000736 | 3300046477 | Bacteria | 16729 |
| 438 | Ga0495664_0051378 | 3300046477 | Bacteria | 2447 |
| 439 | Ga0495584_0009947 | 3300046491 | Bacteria | 4887 |
| 440 | Ga0495594_0155114 | 3300046499 | Bacteria | 1300 |
| 441 | Ga0495608_0062105 | 3300046511 | Bacteria | 2455 |
| 442 | Ga0495608_0362279 | 3300046511 | Bacteria | 891 |
| 443 | Ga0495618_0009180 | 3300046514 | Bacteria | 5972 |
| 444 | Ga0495618_0042587 | 3300046514 | Bacteria | 2862 |
| 445 | Ga0495618_0209425 | 3300046514 | Bacteria | 1232 |
| 446 | Ga0495628_0003204 | 3300046516 | Bacteria | 14671 |
| 447 | Ga0495628_0010344 | 3300046516 | Bacteria | 7931 |
| 448 | Ga0495628_0017152 | 3300046516 | Bacteria | 6032 |
| 449 | Ga0495628_0253702 | 3300046516 | Bacteria | 1312 |
| 450 | Ga0495630_0012216 | 3300046517 | Bacteria | 6230 |
| 451 | Ga0495630_0013180 | 3300046517 | Bacteria | 6010 |
| 452 | Ga0495630_0024458 | 3300046517 | Bacteria | 4465 |
| 453 | Ga0495630_0038940 | 3300046517 | Bacteria | 3556 |
| 454 | Ga0495630_0318686 | 3300046517 | Bacteria | 1188 |
| 455 | Ga0495666_0023659 | 3300046526 | Bacteria | 3038 |
| 456 | Ga0495666_0029459 | 3300046526 | Bacteria | 2701 |
| 457 | Ga0495666_0103159 | 3300046526 | Bacteria | 1343 |
| 458 | Ga0495652_0015892 | 3300046529 | Bacteria | 6737 |
| 459 | Ga0495652_0061368 | 3300046529 | Bacteria | 3174 |
| 460 | Ga0495652_0141803 | 3300046529 | Bacteria | 1889 |
| 461 | Ga0495665_0008610 | 3300046531 | Bacteria | 5536 |
| 462 | Ga0495665_0024309 | 3300046531 | Bacteria | 3254 |
| 463 | Ga0495665_0030263 | 3300046531 | Bacteria | 2897 |
| 464 | Ga0495665_0037998 | 3300046531 | Bacteria | 2568 |
| 465 | Ga0495640_0002964 | 3300046533 | Bacteria | 13677 |
| 466 | Ga0495640_0012112 | 3300046533 | Bacteria | 6604 |
| 467 | Ga0495640_0030067 | 3300046533 | Bacteria | 3892 |
| 468 | Ga0495640_0033135 | 3300046533 | Bacteria | 3672 |
| 469 | Ga0495640_0101691 | 3300046533 | Unclassified | 1886 |
| 470 | Ga0495586_0001814 | 3300046535 | Bacteria | 11645 |
| 471 | Ga0495586_0006063 | 3300046535 | Bacteria | 6462 |
| 472 | Ga0495587_0007969 | 3300046536 | Bacteria | 6844 |
| 473 | Ga0495587_0009492 | 3300046536 | Bacteria | 6234 |
| 474 | Ga0495587_0024154 | 3300046536 | Bacteria | 3729 |
| 475 | Ga0495645_0001264 | 3300046543 | Bacteria | 17213 |
| 476 | Ga0495645_0035117 | 3300046543 | Bacteria | 3656 |
| 477 | Ga0495645_0105969 | 3300046543 | Bacteria | 1994 |
| 478 | Ga0495667_0032581 | 3300046559 | Bacteria | 3492 |
| 479 | Ga0495667_0196905 | 3300046559 | Bacteria | 1290 |
| 480 | Ga0495667_0247899 | 3300046559 | Bacteria | 1134 |
| 481 | Ga0495656_0032256 | 3300046615 | Bacteria | 2130 |
| 482 | Ga0495656_0238836 | 3300046615 | Bacteria | 914 |
| 483 | Ga0495634_0016009 | 3300046642 | Bacteria | 5371 |
| 484 | Ga0495634_0026698 | 3300046642 | Bacteria | 4028 |
| 485 | Ga0495634_0058277 | 3300046642 | Bacteria | 2574 |
| 486 | Ga0495634_0080186 | 3300046642 | Bacteria | 2136 |
| 487 | Ga0495635_0000438 | 3300046663 | Bacteria | 26330 |
| 488 | Ga0495635_0324376 | 3300046663 | Bacteria | 1030 |
| 489 | Ga0495659_0105319 | 3300046664 | Bacteria | 1096 |
| 490 | Ga0495657_0027929 | 3300046675 | Bacteria | 3973 |
| 491 | Ga0495657_0040852 | 3300046675 | Bacteria | 3178 |
| 492 | Ga0495599_0006728 | 3300046678 | Bacteria | 6944 |
| 493 | Ga0495599_0008944 | 3300046678 | Bacteria | 6098 |
| 494 | Ga0495599_0017728 | 3300046678 | Bacteria | 4430 |
| 495 | Ga0495599_0026184 | 3300046678 | Bacteria | 3655 |
| 496 | Ga0495599_0154806 | 3300046678 | Unclassified | 1418 |
| 497 | Ga0495623_0028239 | 3300046679 | Bacteria | 3609 |
| 498 | Ga0495646_0017519 | 3300046680 | Bacteria | 4544 |
| 499 | Ga0495646_0147122 | 3300046680 | Bacteria | 1313 |
| 500 | Ga0495647_0000101 | 3300046681 | Bacteria | 21366 |
| 501 | Ga0495647_0001930 | 3300046681 | Bacteria | 6459 |
| 502 | Ga0495647_0039187 | 3300046681 | Unclassified | 1795 |
| 503 | Ga0495658_0009776 | 3300046683 | Bacteria | 4782 |
| 504 | Ga0495658_0012211 | 3300046683 | Bacteria | 4342 |
| 505 | Ga0495658_0044647 | 3300046683 | Bacteria | 2484 |
| 506 | Ga0495658_0046432 | 3300046683 | Bacteria | 2441 |
| 507 | Ga0495658_0117579 | 3300046683 | Bacteria | 1605 |
| 508 | Ga0495669_0063550 | 3300046684 | Bacteria | 1674 |
| 509 | Ga0495613_0009665 | 3300046689 | Bacteria | 7165 |
| 510 | Ga0495613_0057435 | 3300046689 | Bacteria | 2857 |
| 511 | Ga0495613_0164918 | 3300046689 | Unclassified | 1574 |
| 512 | Ga0495624_0001570 | 3300046690 | Bacteria | 17622 |
| 513 | Ga0495624_0018484 | 3300046690 | Bacteria | 4662 |
| 514 | Ga0495600_0012434 | 3300046809 | Bacteria | 5322 |
| 515 | Ga0495600_0084717 | 3300046809 | Bacteria | 2068 |
| 516 | Ga0495581_0010385 | 3300047315 | Bacteria | 5387 |
| 517 | Ga0495581_0018895 | 3300047315 | Bacteria | 4000 |
| 518 | Ga0495581_0329079 | 3300047315 | Bacteria | 892 |
| 519 | Ga0495604_0023995 | 3300047317 | Bacteria | 4868 |
| 520 | Ga0495604_0025707 | 3300047317 | Bacteria | 4689 |
| 521 | Ga0495604_0025979 | 3300047317 | Bacteria | 4664 |
| 522 | Ga0495636_0079992 | 3300047318 | Bacteria | 1406 |
| 523 | Ga0495636_0126187 | 3300047318 | Archaea | 1135 |
| 524 | Ga0495674_0000209 | 3300047319 | Bacteria | 48240 |
| 525 | Ga0495674_0011630 | 3300047319 | Bacteria | 8298 |
| 526 | Ga0495674_0158641 | 3300047319 | Bacteria | 1894 |
| 527 | Ga0495672_0065717 | 3300047320 | Bacteria | 2072 |
| 528 | Ga0495672_0234509 | 3300047320 | Unclassified | 899 |
| 529 | Ga0495676_0043019 | 3300047321 | Bacteria | 3701 |
| 530 | Ga0495676_0047052 | 3300047321 | Bacteria | 3493 |
| 531 | Ga0495680_0012588 | 3300047322 | Bacteria | 7434 |
| 532 | Ga0495680_0026033 | 3300047322 | Bacteria | 4831 |
| 533 | Ga0495680_0095038 | 3300047322 | Bacteria | 2229 |
| 534 | Ga0495675_0007134 | 3300047444 | Bacteria | 6877 |
| 535 | Ga0495675_0198541 | 3300047444 | Bacteria | 1222 |
| 536 | Ga0495684_0001766 | 3300047471 | Bacteria | 17346 |
| 537 | Ga0495684_0003044 | 3300047471 | Bacteria | 13189 |
| 538 | Ga0495684_0008625 | 3300047471 | Bacteria | 7888 |
| 539 | Ga0495684_0044577 | 3300047471 | Bacteria | 3395 |
| 540 | Ga0495684_0296647 | 3300047471 | Bacteria | 1162 |
| 541 | Ga0495686_0093332 | 3300047472 | Bacteria | 1825 |
| 542 | Ga0495593_0010564 | 3300047673 | Bacteria | 5326 |
| 543 | Ga0495593_0090611 | 3300047673 | Bacteria | 1575 |
| 544 | Ga0495602_0442032 | 3300048088 | Bacteria | 919 |
| 545 | Ga0496104_0139247 | 3300048907 | Bacteria | 2332 |
| 546 | Ga0496106_0144828 | 3300048909 | Bacteria | 1871 |
| 547 | Ga0496109_0076942 | 3300048912 | Bacteria | 3070 |
| 548 | Ga0496110_0158039 | 3300048913 | Bacteria | 2054 |
| 549 | Ga0496111_0053903 | 3300048914 | Bacteria | 2906 |
| 550 | Ga0496113_0061909 | 3300048916 | Bacteria | 2825 |
| 551 | Ga0496121_0000125 | 3300048924 | Bacteria | 169274 |
| 552 | Ga0496121_0060857 | 3300048924 | Bacteria | 3103 |
| 553 | Ga0496126_0005275 | 3300048929 | Bacteria | 14845 |
| 554 | Ga0501031_0025569 | 3300049568 | Bacteria | 3850 |
| 555 | Ga0501031_0106966 | 3300049568 | Bacteria | 1826 |
| 556 | Ga0501032_0050393 | 3300049569 | Bacteria | 2808 |
| 557 | Ga0501032_0131739 | 3300049569 | Bacteria | 1650 |
| 558 | Ga0501033_0007016 | 3300049570 | Bacteria | 8797 |
| 559 | Ga0501034_0406678 | 3300049571 | Bacteria | 1283 |
| 560 | Ga0501036_0000330 | 3300049572 | Bacteria | 33079 |
| 561 | Ga0501036_0054630 | 3300049572 | Bacteria | 3383 |
| 562 | Ga0501036_0392816 | 3300049572 | Bacteria | 1157 |
| 563 | Ga0501037_0008587 | 3300049573 | Bacteria | 7494 |
| 564 | Ga0501038_0000267 | 3300049574 | Bacteria | 44085 |
| 565 | Ga0501038_0079708 | 3300049574 | Unclassified | 2760 |
| 566 | Ga0501038_0168045 | 3300049574 | Bacteria | 1778 |
| 567 | Ga0501039_0004592 | 3300049575 | Bacteria | 10444 |
| 568 | Ga0501039_0011612 | 3300049575 | Bacteria | 6707 |
| 569 | Ga0501039_0012899 | 3300049575 | Bacteria | 6390 |
| 570 | Ga0501039_0129281 | 3300049575 | Bacteria | 1982 |
| 571 | Ga0501039_0148536 | 3300049575 | Bacteria | 1842 |
| 572 | Ga0501040_0000312 | 3300049576 | Bacteria | 28486 |
| 573 | Ga0501040_0007409 | 3300049576 | Bacteria | 7106 |
| 574 | Ga0501040_0016304 | 3300049576 | Bacteria | 4916 |
| 575 | Ga0501040_0019632 | 3300049576 | Bacteria | 4498 |
| 576 | Ga0501040_0024732 | 3300049576 | Bacteria | 4033 |
| 577 | Ga0501041_0002294 | 3300049577 | Bacteria | 10830 |
| 578 | Ga0501041_0002566 | 3300049577 | Bacteria | 10353 |
| 579 | Ga0501041_0007160 | 3300049577 | Bacteria | 6543 |
| 580 | Ga0501042_0001125 | 3300049578 | Bacteria | 15408 |
| 581 | Ga0501042_0002202 | 3300049578 | Bacteria | 11888 |
| 582 | Ga0501043_0080782 | 3300049579 | Bacteria | 2555 |
| 583 | Ga0501043_0097616 | 3300049579 | Bacteria | 2310 |
| 584 | Ga0501046_0000428 | 3300049580 | Bacteria | 42116 |
| 585 | Ga0501046_0440932 | 3300049580 | Bacteria | 937 |
| 586 | Ga0501047_0042491 | 3300049581 | Bacteria | 4393 |
| 587 | Ga0501047_0062431 | 3300049581 | Bacteria | 3594 |
| 588 | Ga0501048_0000612 | 3300049582 | Bacteria | 25409 |
| 589 | Ga0501048_0014025 | 3300049582 | Bacteria | 5942 |
| 590 | Ga0501048_0023699 | 3300049582 | Bacteria | 4483 |
| 591 | Ga0501048_0050821 | 3300049582 | Bacteria | 2952 |
| 592 | Ga0501048_0109043 | 3300049582 | Bacteria | 1955 |
| 593 | Ga0501067_0085179 | 3300049583 | Bacteria | 1754 |
| 594 | Ga0501068_0109969 | 3300049584 | Bacteria | 1713 |
| 595 | Ga0501068_0245641 | 3300049584 | Unclassified | 1140 |
| 596 | Ga0501068_0366685 | 3300049584 | Bacteria | 926 |
| 597 | Ga0501069_0246131 | 3300049585 | Unclassified | 1043 |
| 598 | Ga0501070_0039266 | 3300049586 | Bacteria | 3949 |
| 599 | Ga0501070_0104095 | 3300049586 | Bacteria | 2347 |
| 600 | Ga0501070_0467474 | 3300049586 | Bacteria | 1016 |
| 601 | Ga0501070_0700261 | 3300049586 | Bacteria | 801 |
| 602 | Ga0501071_0001340 | 3300049587 | Bacteria | 14070 |
| 603 | Ga0501071_0002057 | 3300049587 | Bacteria | 12041 |
| 604 | Ga0501071_0224644 | 3300049587 | Bacteria | 1414 |
| 605 | Ga0501071_0470462 | 3300049587 | Bacteria | 963 |
| 606 | Ga0501072_0000789 | 3300049588 | Bacteria | 23259 |
| 607 | Ga0501072_0054892 | 3300049588 | Bacteria | 3140 |
| 608 | Ga0501072_0095649 | 3300049588 | Bacteria | 2361 |
| 609 | Ga0501072_0119298 | 3300049588 | Bacteria | 2102 |
| 610 | Ga0501072_0158686 | 3300049588 | Bacteria | 1804 |
| 611 | Ga0501072_0186564 | 3300049588 | Bacteria | 1654 |
| 612 | Ga0501072_0237488 | 3300049588 | Bacteria | 1451 |
| 613 | Ga0501073_0051234 | 3300049589 | Bacteria | 2892 |
| 614 | Ga0501073_0136088 | 3300049589 | Bacteria | 1703 |
| 615 | Ga0501073_0235442 | 3300049589 | Bacteria | 1265 |
| 616 | Ga0501074_0026349 | 3300049590 | Bacteria | 4215 |
| 617 | Ga0501074_0061092 | 3300049590 | Bacteria | 2715 |
| 618 | Ga0501074_0093014 | 3300049590 | Bacteria | 2159 |
| 619 | Ga0501074_0210664 | 3300049590 | Bacteria | 1385 |
| 620 | Ga0501074_0272415 | 3300049590 | Bacteria | 1203 |
| 621 | Ga0501075_0002917 | 3300049591 | Bacteria | 11473 |
| 622 | Ga0501075_0011260 | 3300049591 | Bacteria | 6327 |
| 623 | Ga0501075_0040806 | 3300049591 | Bacteria | 3477 |
| 624 | Ga0501075_0041825 | 3300049591 | Bacteria | 3435 |
| 625 | Ga0501075_0047788 | 3300049591 | Bacteria | 3216 |
| 626 | Ga0501075_0128179 | 3300049591 | Bacteria | 1932 |
| 627 | Ga0501075_0176539 | 3300049591 | Bacteria | 1630 |
| 628 | Ga0501076_0000118 | 3300049592 | Bacteria | 43658 |
| 629 | Ga0501076_0001261 | 3300049592 | Bacteria | 16863 |
| 630 | Ga0501076_0002101 | 3300049592 | Bacteria | 13659 |
| 631 | Ga0501076_0018795 | 3300049592 | Bacteria | 5274 |
| 632 | Ga0501076_0081684 | 3300049592 | Bacteria | 2594 |
| 633 | Ga0501077_0003691 | 3300049593 | Bacteria | 9204 |
| 634 | Ga0501077_0044071 | 3300049593 | Bacteria | 2835 |
| 635 | Ga0501077_0071254 | 3300049593 | Bacteria | 2203 |
| 636 | Ga0501077_0205748 | 3300049593 | Bacteria | 1250 |
| 637 | Ga0501079_0000397 | 3300049741 | Bacteria | 28020 |
| 638 | Ga0501079_0000442 | 3300049741 | Bacteria | 26958 |
| 639 | Ga0501079_0022627 | 3300049741 | Bacteria | 4821 |
| 640 | Ga0501079_0065677 | 3300049741 | Bacteria | 2799 |
| 641 | Ga0501079_0367567 | 3300049741 | Bacteria | 1127 |
| 642 | Ga0501080_0005112 | 3300049742 | Bacteria | 11689 |
| 643 | Ga0501080_0021829 | 3300049742 | Bacteria | 5931 |
| 644 | Ga0501081_0001609 | 3300049743 | Bacteria | 13933 |
| 645 | Ga0501081_0005183 | 3300049743 | Bacteria | 8388 |
| 646 | Ga0501081_0035019 | 3300049743 | Bacteria | 3418 |
| 647 | Ga0501081_0099755 | 3300049743 | Bacteria | 2052 |
| 648 | Ga0501081_0148815 | 3300049743 | Bacteria | 1681 |
| 649 | Ga0501083_0008847 | 3300049744 | Bacteria | 7109 |
| 650 | Ga0501083_0022417 | 3300049744 | Bacteria | 4384 |
| 651 | Ga0501035_0010209 | 3300049822 | Bacteria | 8714 |
| 652 | Ga0501044_0038670 | 3300049823 | Bacteria | 4982 |
| 653 | Ga0501044_0142213 | 3300049823 | Bacteria | 2387 |
| 654 | Ga0501045_0000264 | 3300049824 | Bacteria | 30492 |
| 655 | Ga0501045_0007250 | 3300049824 | Bacteria | 7698 |
| 656 | Ga0501045_0016595 | 3300049824 | Bacteria | 5232 |
| 657 | Ga0501045_0177378 | 3300049824 | Bacteria | 1587 |
| 658 | Ga0501045_0196732 | 3300049824 | Bacteria | 1502 |
| 659 | Ga0501045_0274643 | 3300049824 | Bacteria | 1255 |
| 660 | nmdc:mga0k408_336542_c1 | 3300050493 | Bacteria | 900 |
| 661 | nmdc:mga05p37_174307_c1 | 3300050507 | Bacteria | 2621 |
| 662 | nmdc:mga05p37_18630_c1 | 3300050507 | Bacteria | 8388 |
| 663 | nmdc:mga05p37_277670_c1 | 3300050507 | Bacteria | 1999 |
| 664 | nmdc:mga05p37_593775_c1 | 3300050507 | Bacteria | 1251 |
| 665 | nmdc:mga09592_16926_c1 | 3300050508 | Bacteria | 5966 |
| 666 | nmdc:mga09592_323046_c1 | 3300050508 | Bacteria | 1337 |
| 667 | nmdc:mga09592_39020_c1 | 3300050508 | Bacteria | 3988 |
| 668 | nmdc:mga09592_416578_c1 | 3300050508 | Bacteria | 1161 |
| 669 | nmdc:mga0qj67_16395_c1 | 3300050509 | Bacteria | 5619 |
| 670 | nmdc:mga0qj67_295401_c1 | 3300050509 | Bacteria | 1313 |
| 671 | nmdc:mga0qj67_382814_c1 | 3300050509 | Bacteria | 1136 |
| 672 | nmdc:mga0qj67_485939_c1 | 3300050509 | Bacteria | 993 |
| 673 | nmdc:mga06r32_430552_c1 | 3300050510 | Bacteria | 1300 |
| 674 | nmdc:mga08y16_19349_c1 | 3300050511 | Bacteria | 7178 |
| 675 | nmdc:mga08y16_22266_c1 | 3300050511 | Bacteria | 6687 |
| 676 | nmdc:mga08y16_241269_c1 | 3300050511 | Bacteria | 1868 |
| 677 | nmdc:mga08y16_28582_c1 | 3300050511 | Bacteria | 5878 |
| 678 | nmdc:mga08y16_488327_c1 | 3300050511 | Bacteria | 1253 |
| 679 | nmdc:mga08y16_65008_c1 | 3300050511 | Bacteria | 3808 |
| 680 | nmdc:mga08y16_8030_c1 | 3300050511 | Bacteria | 11040 |
| 681 | nmdc:mga08y16_939721_c1 | 3300050511 | Bacteria | 848 |
| 682 | nmdc:mga0n895_186252_c1 | 3300050512 | Bacteria | 2107 |
| 683 | nmdc:mga0n895_24452_c1 | 3300050512 | Bacteria | 5693 |
| 684 | nmdc:mga0n895_328945_c1 | 3300050512 | Bacteria | 1548 |
| 685 | nmdc:mga0n895_398267_c1 | 3300050512 | Bacteria | 1392 |
| 686 | nmdc:mga0n895_404152_c1 | 3300050512 | Bacteria | 1381 |
| 687 | nmdc:mga0n895_86363_c1 | 3300050512 | Bacteria | 3134 |
| 688 | nmdc:mga0n895_88_c1 | 3300050512 | Bacteria | 53153 |
| 689 | nmdc:mga0rr50_1095_c1 | 3300050513 | Bacteria | 14709 |
| 690 | nmdc:mga0rr50_11839_c1 | 3300050513 | Bacteria | 5603 |
| 691 | nmdc:mga0rr50_38539_c1 | 3300050513 | Bacteria | 3460 |
| 692 | nmdc:mga0rr50_5178_c1 | 3300050513 | Bacteria | 7746 |
| 693 | nmdc:mga0rr50_9234_c1 | 3300050513 | Bacteria | 6187 |
| 694 | nmdc:mga08x19_10214_c1 | 3300050514 | Bacteria | 5632 |
| 695 | nmdc:mga08x19_1086_c1 | 3300050514 | Bacteria | 16965 |
| 696 | nmdc:mga08x19_15159_c1 | 3300050514 | Bacteria | 4685 |
| 697 | nmdc:mga08x19_369_c2 | 3300050514 | Bacteria | 10005 |
| 698 | nmdc:mga08x19_4376_c1 | 3300050514 | Bacteria | 8376 |
| 699 | nmdc:mga08x19_59734_c1 | 3300050514 | Bacteria | 2469 |
| 700 | nmdc:mga0a205_126559_c1 | 3300050515 | Bacteria | 2455 |
| 701 | nmdc:mga0a205_144309_c1 | 3300050515 | Bacteria | 2280 |
| 702 | nmdc:mga0a205_1767_c1 | 3300050515 | Bacteria | 18718 |
| 703 | nmdc:mga0a205_34133_c1 | 3300050515 | Bacteria | 4881 |
| 704 | Ga0495601_0001991 | 3300053077 | Bacteria | 11444 |
| 705 | Ga0495601_0005391 | 3300053077 | Bacteria | 7449 |
| 706 | Ga0495601_0015469 | 3300053077 | Bacteria | 4611 |
| 707 | Ga0495601_0175455 | 3300053077 | Bacteria | 1401 |
| 708 | Ga0495601_0189318 | 3300053077 | Bacteria | 1345 |
| 709 | Ga0495601_0213778 | 3300053077 | Bacteria | 1259 |
| 710 | Ga0495612_0000353 | 3300053078 | Bacteria | 18580 |
| 711 | Ga0495612_0026111 | 3300053078 | Bacteria | 2348 |
| 712 | Ga0495612_0077952 | 3300053078 | Bacteria | 1389 |
| 713 | Ga0495595_0007988 | 3300053084 | Bacteria | 4333 |
| 714 | Ga0495595_0017855 | 3300053084 | Bacteria | 3056 |
| 715 | Ga0495595_0053748 | 3300053084 | Bacteria | 1872 |
| 716 | Ga0495595_0084487 | 3300053084 | Unclassified | 1517 |
| 717 | Ga0495619_0011558 | 3300053085 | Bacteria | 5563 |
| 718 | Ga0495619_0011605 | 3300053085 | Bacteria | 5551 |
| 719 | Ga0495619_0332526 | 3300053085 | Bacteria | 1052 |
| 720 | Ga0495619_0421070 | 3300053085 | Bacteria | 921 |
| 721 | Ga0495619_0470680 | 3300053085 | Bacteria | 865 |
| 722 | Ga0500595_005351 | 3300053119 | Bacteria | 5614 |
| 723 | Ga0500568_0044301 | 3300053139 | Bacteria | 1775 |
| 724 | Ga0500616_0010041 | 3300053153 | Bacteria | 5689 |
| 725 | Ga0500616_0013642 | 3300053153 | Bacteria | 4708 |
| 726 | Ga0500616_0016281 | 3300053153 | Bacteria | 4235 |
| 727 | Ga0500637_0080876 | 3300053178 | Bacteria | 1877 |
| 728 | Ga0501084_0000553 | 3300054114 | Bacteria | 28542 |
| 729 | Ga0501084_0003157 | 3300054114 | Bacteria | 13329 |
| 730 | Ga0501084_0009985 | 3300054114 | Bacteria | 7846 |
| 731 | Ga0501084_0034987 | 3300054114 | Bacteria | 4200 |
| 732 | Ga0501084_0195663 | 3300054114 | Unclassified | 1706 |
| 733 | Ga0501084_0299317 | 3300054114 | Bacteria | 1359 |
| 734 | Ga0501082_0007857 | 3300060353 | Bacteria | 9202 |
| 735 | Ga0501082_0014006 | 3300060353 | Bacteria | 6897 |
| 736 | Ga0501082_0015525 | 3300060353 | Bacteria | 6557 |
| 737 | Ga0501082_0016744 | 3300060353 | Bacteria | 6312 |
| 738 | Ga0501082_0090056 | 3300060353 | Bacteria | 2649 |
| 739 | Ga0501082_0294876 | 3300060353 | Bacteria | 1412 |
| 740 | Ga0530510_0000026 | 3300061734 | Bacteria | 67071 |
| 741 | Ga0530510_0000858 | 3300061734 | Bacteria | 20038 |
| 742 | Ga0530510_0026321 | 3300061734 | Bacteria | 4163 |
| 743 | Ga0530510_0050025 | 3300061734 | Bacteria | 3019 |
| 744 | Ga0530510_0101938 | 3300061734 | Bacteria | 2099 |
| 745 | Ga0530510_0114058 | 3300061734 | Bacteria | 1981 |
| 746 | Ga0530510_0178720 | 3300061734 | Unclassified | 1573 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049586 | Ga0501070_0700261 | Ga0501070_0700261_53_787 | 224 |
| 2 | 3300005844 | Ga0068862_100015881 | Ga0068862_1000158815 | 230 |
| 3 | 3300006847 | Ga0075431_100329387 | Ga0075431_1003293872 | 230 |
| 4 | 3300009094 | Ga0111539_10111614 | Ga0111539_101116142 | 230 |
| 5 | 3300050511 | nmdc:mga08y16_22266_c1 | nmdc:mga08y16_22266_c1_3524_4342 | 230 |
| 6 | 3300005615 | Ga0070702_100048738 | Ga0070702_1000487382 | 231 |
| 7 | 3300049585 | Ga0501069_0246131 | Ga0501069_0246131_29_766 | 231 |
| 8 | 3300005343 | Ga0070687_100073859 | Ga0070687_1000738591 | 232 |
| 9 | 3300035083 | Ga0373926_0028169 | Ga0373926_0028169_288_1106 | 233 |
| 10 | 3300035113 | Ga0373936_0030376 | Ga0373936_0030376_308_1126 | 233 |
| 11 | 3300035116 | Ga0373945_0053500 | Ga0373945_0053500_622_1440 | 233 |
| 12 | 3300035170 | Ga0373943_0003842 | Ga0373943_0003842_4673_5491 | 233 |
| 13 | 3300035171 | Ga0373946_0028021 | Ga0373946_0028021_774_1592 | 233 |
| 14 | 3300035692 | Ga0373935_0015655 | Ga0373935_0015655_1662_2480 | 233 |
| 15 | 3300035725 | Ga0373947_0005057 | Ga0373947_0005057_4746_5564 | 233 |
| 16 | 3300037068 | Ga0373925_0038766 | Ga0373925_0038766_402_1220 | 233 |
| 17 | 3300047318 | Ga0495636_0079992 | Ga0495636_0079992_546_1364 | 233 |
| 18 | 3300049580 | Ga0501046_0440932 | Ga0501046_0440932_17_721 | 234 |
| 19 | 3300005545 | Ga0070695_100146414 | Ga0070695_1001464142 | 239 |
| 20 | 3300039453 | Ga0436362_0558861 | Ga0436362_0558861_10_741 | 243 |
| 21 | 3300031548 | Ga0307408_100145006 | Ga0307408_1001450062 | 244 |
| 22 | 3300046462 | Ga0495651_0246068 | Ga0495651_0246068_20_757 | 244 |
| 23 | 3300046529 | Ga0495652_0141803 | Ga0495652_0141803_1133_1867 | 244 |
| 24 | 3300049593 | Ga0501077_0071254 | Ga0501077_0071254_83_874 | 244 |
| 25 | 3300053085 | Ga0495619_0332526 | Ga0495619_0332526_289_1023 | 244 |
| 26 | 3300006847 | Ga0075431_100062084 | Ga0075431_1000620842 | 245 |
| 27 | 3300006880 | Ga0075429_100026172 | Ga0075429_1000261723 | 245 |
| 28 | 3300049568 | Ga0501031_0025569 | Ga0501031_0025569_1146_1961 | 245 |
| 29 | 3300049569 | Ga0501032_0050393 | Ga0501032_0050393_647_1462 | 245 |
| 30 | 3300049570 | Ga0501033_0007016 | Ga0501033_0007016_4841_5656 | 245 |
| 31 | 3300049572 | Ga0501036_0000330 | Ga0501036_0000330_28246_29061 | 245 |
| 32 | 3300049573 | Ga0501037_0008587 | Ga0501037_0008587_1339_2154 | 245 |
| 33 | 3300049574 | Ga0501038_0000267 | Ga0501038_0000267_3320_4135 | 245 |
| 34 | 3300049575 | Ga0501039_0012899 | Ga0501039_0012899_3426_4241 | 245 |
| 35 | 3300049576 | Ga0501040_0000312 | Ga0501040_0000312_3413_4228 | 245 |
| 36 | 3300049577 | Ga0501041_0002566 | Ga0501041_0002566_6112_6927 | 245 |
| 37 | 3300049578 | Ga0501042_0002202 | Ga0501042_0002202_3416_4231 | 245 |
| 38 | 3300049579 | Ga0501043_0080782 | Ga0501043_0080782_1499_2314 | 245 |
| 39 | 3300049580 | Ga0501046_0000428 | Ga0501046_0000428_1815_2630 | 245 |
| 40 | 3300049582 | Ga0501048_0000612 | Ga0501048_0000612_20345_21160 | 245 |
| 41 | 3300049584 | Ga0501068_0366685 | Ga0501068_0366685_83_898 | 245 |
| 42 | 3300049586 | Ga0501070_0104095 | Ga0501070_0104095_106_921 | 245 |
| 43 | 3300049587 | Ga0501071_0002057 | Ga0501071_0002057_7808_8623 | 245 |
| 44 | 3300049588 | Ga0501072_0000789 | Ga0501072_0000789_19032_19847 | 245 |
| 45 | 3300049590 | Ga0501074_0026349 | Ga0501074_0026349_262_1077 | 245 |
| 46 | 3300049591 | Ga0501075_0011260 | Ga0501075_0011260_4250_5065 | 245 |
| 47 | 3300049592 | Ga0501076_0000118 | Ga0501076_0000118_22585_23400 | 245 |
| 48 | 3300049593 | Ga0501077_0003691 | Ga0501077_0003691_466_1281 | 245 |
| 49 | 3300049741 | Ga0501079_0000397 | Ga0501079_0000397_3397_4212 | 245 |
| 50 | 3300049742 | Ga0501080_0021829 | Ga0501080_0021829_2384_3199 | 245 |
| 51 | 3300049743 | Ga0501081_0005183 | Ga0501081_0005183_4019_4834 | 245 |
| 52 | 3300049822 | Ga0501035_0010209 | Ga0501035_0010209_5249_6064 | 245 |
| 53 | 3300049823 | Ga0501044_0038670 | Ga0501044_0038670_1613_2428 | 245 |
| 54 | 3300049824 | Ga0501045_0000264 | Ga0501045_0000264_3398_4213 | 245 |
| 55 | 3300050510 | nmdc:mga06r32_430552_c1 | nmdc:mga06r32_430552_c1_192_1115 | 245 |
| 56 | 3300054114 | Ga0501084_0000553 | Ga0501084_0000553_4386_5201 | 245 |
| 57 | 3300060353 | Ga0501082_0014006 | Ga0501082_0014006_4019_4834 | 245 |
| 58 | 3300061734 | Ga0530510_0000026 | Ga0530510_0000026_3415_4230 | 245 |
| 59 | 3300047320 | Ga0495672_0234509 | Ga0495672_0234509_99_884 | 246 |
| 60 | 3300005546 | Ga0070696_100014903 | Ga0070696_1000149033 | 249 |
| 61 | 3300007076 | Ga0075435_100008212 | Ga0075435_1000082129 | 249 |
| 62 | 3300007788 | Ga0099795_10014013 | Ga0099795_100140132 | 249 |
| 63 | 3300050513 | nmdc:mga0rr50_11839_c1 | nmdc:mga0rr50_11839_c1_619_1437 | 249 |
| 64 | 3300050515 | nmdc:mga0a205_34133_c1 | nmdc:mga0a205_34133_c1_1390_2208 | 249 |
| 65 | 3300049572 | Ga0501036_0054630 | Ga0501036_0054630_2057_2932 | 252 |
| 66 | 3300049575 | Ga0501039_0011612 | Ga0501039_0011612_2199_3074 | 252 |
| 67 | 3300049576 | Ga0501040_0016304 | Ga0501040_0016304_1555_2430 | 252 |
| 68 | 3300049577 | Ga0501041_0002294 | Ga0501041_0002294_8807_9682 | 252 |
| 69 | 3300049578 | Ga0501042_0001125 | Ga0501042_0001125_8359_9234 | 252 |
| 70 | 3300049579 | Ga0501043_0097616 | Ga0501043_0097616_978_1853 | 252 |
| 71 | 3300049582 | Ga0501048_0023699 | Ga0501048_0023699_2749_3624 | 252 |
| 72 | 3300049582 | Ga0501048_0109043 | Ga0501048_0109043_548_1423 | 252 |
| 73 | 3300049587 | Ga0501071_0001340 | Ga0501071_0001340_9624_10499 | 252 |
| 74 | 3300049589 | Ga0501073_0051234 | Ga0501073_0051234_1020_1895 | 252 |
| 75 | 3300049590 | Ga0501074_0061092 | Ga0501074_0061092_1291_2166 | 252 |
| 76 | 3300049591 | Ga0501075_0002917 | Ga0501075_0002917_6949_7824 | 252 |
| 77 | 3300049591 | Ga0501075_0041825 | Ga0501075_0041825_1625_2500 | 252 |
| 78 | 3300049592 | Ga0501076_0001261 | Ga0501076_0001261_13841_14716 | 252 |
| 79 | 3300049741 | Ga0501079_0022627 | Ga0501079_0022627_3040_3915 | 252 |
| 80 | 3300049824 | Ga0501045_0007250 | Ga0501045_0007250_3536_4411 | 252 |
| 81 | 3300049824 | Ga0501045_0196732 | Ga0501045_0196732_386_1261 | 252 |
| 82 | 3300054114 | Ga0501084_0009985 | Ga0501084_0009985_4356_5231 | 252 |
| 83 | 3300060353 | Ga0501082_0007857 | Ga0501082_0007857_5879_6754 | 252 |
| 84 | 3300060353 | Ga0501082_0294876 | Ga0501082_0294876_270_1145 | 252 |
| 85 | 3300061734 | Ga0530510_0000858 | Ga0530510_0000858_14686_15561 | 252 |
| 86 | 3300005353 | Ga0070669_100067077 | Ga0070669_1000670772 | 253 |
| 87 | 3300005441 | Ga0070700_100103454 | Ga0070700_1001034542 | 253 |
| 88 | 3300005456 | Ga0070678_100041474 | Ga0070678_1000414744 | 253 |
| 89 | 3300005459 | Ga0068867_100115501 | Ga0068867_1001155012 | 253 |
| 90 | 3300005719 | Ga0068861_100064383 | Ga0068861_1000643832 | 253 |
| 91 | 3300005844 | Ga0068862_100067372 | Ga0068862_1000673723 | 253 |
| 92 | 3300006881 | Ga0068865_100076690 | Ga0068865_1000766902 | 253 |
| 93 | 3300009148 | Ga0105243_10007856 | Ga0105243_100078566 | 253 |
| 94 | 3300009553 | Ga0105249_10085032 | Ga0105249_100850322 | 253 |
| 95 | 3300014326 | Ga0157380_10090078 | Ga0157380_100900782 | 253 |
| 96 | 3300025893 | Ga0207682_10124555 | Ga0207682_101245551 | 253 |
| 97 | 3300025908 | Ga0207643_10013812 | Ga0207643_100138123 | 253 |
| 98 | 3300025910 | Ga0207684_10327467 | Ga0207684_103274672 | 253 |
| 99 | 3300025923 | Ga0207681_10057877 | Ga0207681_100578772 | 253 |
| 100 | 3300025925 | Ga0207650_10244761 | Ga0207650_102447612 | 253 |
| 101 | 3300025926 | Ga0207659_10059815 | Ga0207659_100598153 | 253 |
| 102 | 3300025936 | Ga0207670_10038240 | Ga0207670_100382403 | 253 |
| 103 | 3300025936 | Ga0207670_10080826 | Ga0207670_100808262 | 253 |
| 104 | 3300025961 | Ga0207712_10082894 | Ga0207712_100828942 | 253 |
| 105 | 3300025972 | Ga0207668_10015384 | Ga0207668_100153842 | 253 |
| 106 | 3300026075 | Ga0207708_10006688 | Ga0207708_100066889 | 253 |
| 107 | 3300005336 | Ga0070680_100160762 | Ga0070680_1001607621 | 254 |
| 108 | 3300006880 | Ga0075429_100327184 | Ga0075429_1003271842 | 254 |
| 109 | 3300025940 | Ga0207691_10070970 | Ga0207691_100709704 | 254 |
| 110 | 3300050508 | nmdc:mga09592_323046_c1 | nmdc:mga09592_323046_c1_480_1298 | 254 |
| 111 | 3300005458 | Ga0070681_10036856 | Ga0070681_100368564 | 255 |
| 112 | 3300025912 | Ga0207707_10043000 | Ga0207707_100430003 | 255 |
| 113 | 3300035112 | Ga0373932_0064472 | Ga0373932_0064472_43_906 | 255 |
| 114 | 3300006871 | Ga0075434_100000363 | Ga0075434_10000036339 | 256 |
| 115 | 3300007076 | Ga0075435_100021842 | Ga0075435_1000218422 | 256 |
| 116 | 3300007265 | Ga0099794_10027033 | Ga0099794_100270332 | 256 |
| 117 | 3300027526 | Ga0209968_1009412 | Ga0209968_10094122 | 256 |
| 118 | 3300050512 | nmdc:mga0n895_88_c1 | nmdc:mga0n895_88_c1_18877_19695 | 256 |
| 119 | 3300050513 | nmdc:mga0rr50_1095_c1 | nmdc:mga0rr50_1095_c1_13447_14265 | 256 |
| 120 | 3300050514 | nmdc:mga08x19_10214_c1 | nmdc:mga08x19_10214_c1_4599_5417 | 256 |
| 121 | 3300050515 | nmdc:mga0a205_144309_c1 | nmdc:mga0a205_144309_c1_978_1796 | 256 |
| 122 | 3300003320 | rootH2_10025714 | rootH2_100257142 | 257 |
| 123 | 3300027671 | Ga0209588_1022947 | Ga0209588_10229472 | 257 |
| 124 | 3300049574 | Ga0501038_0079708 | Ga0501038_0079708_212_1081 | 257 |
| 125 | 3300049591 | Ga0501075_0047788 | Ga0501075_0047788_790_1665 | 257 |
| 126 | 3300049743 | Ga0501081_0035019 | Ga0501081_0035019_1193_2068 | 257 |
| 127 | 3300050514 | nmdc:mga08x19_4376_c1 | nmdc:mga08x19_4376_c1_1117_1992 | 257 |
| 128 | 3300061734 | Ga0530510_0101938 | Ga0530510_0101938_337_1212 | 257 |
| 129 | 3300005536 | Ga0070697_100012815 | Ga0070697_1000128156 | 258 |
| 130 | 3300006844 | Ga0075428_100023200 | Ga0075428_1000232003 | 258 |
| 131 | 3300006880 | Ga0075429_100366528 | Ga0075429_1003665282 | 258 |
| 132 | 3300010159 | Ga0099796_10065582 | Ga0099796_100655822 | 258 |
| 133 | 3300027526 | Ga0209968_1005950 | Ga0209968_10059502 | 258 |
| 134 | 3300027682 | Ga0209971_1022747 | Ga0209971_10227472 | 258 |
| 135 | 3300042003 | Ga0439443_001092 | Ga0439443_001092_491_1309 | 258 |
| 136 | 3300042461 | Ga0439460_0029990 | Ga0439460_0029990_616_1434 | 258 |
| 137 | 3300044673 | Ga0453683_0110500 | Ga0453683_0110500_144_1019 | 258 |
| 138 | 3300045049 | Ga0466959_0432353 | Ga0466959_0432353_16_792 | 258 |
| 139 | 3300049581 | Ga0501047_0062431 | Ga0501047_0062431_600_1472 | 258 |
| 140 | 3300005455 | Ga0070663_100003060 | Ga0070663_1000030602 | 259 |
| 141 | 3300005981 | Ga0081538_10029612 | Ga0081538_100296123 | 259 |
| 142 | 3300026067 | Ga0207678_10051638 | Ga0207678_100516384 | 259 |
| 143 | 3300034816 | Ga0373930_0035979 | Ga0373930_0035979_13_795 | 259 |
| 144 | 3300035116 | Ga0373945_0166402 | Ga0373945_0166402_26_805 | 259 |
| 145 | 3300042436 | Ga0439435_0001580 | Ga0439435_0001580_129_947 | 259 |
| 146 | 3300042437 | Ga0439444_0014971 | Ga0439444_0014971_129_947 | 259 |
| 147 | 3300042461 | Ga0439460_0000144 | Ga0439460_0000144_1760_2578 | 259 |
| 148 | 3300046531 | Ga0495665_0037998 | Ga0495665_0037998_1777_2556 | 259 |
| 149 | 3300046559 | Ga0495667_0247899 | Ga0495667_0247899_22_804 | 259 |
| 150 | 3300046663 | Ga0495635_0324376 | Ga0495635_0324376_227_1006 | 259 |
| 151 | 3300046683 | Ga0495658_0117579 | Ga0495658_0117579_17_799 | 259 |
| 152 | 3300049584 | Ga0501068_0245641 | Ga0501068_0245641_55_924 | 259 |
| 153 | 3300049823 | Ga0501044_0142213 | Ga0501044_0142213_141_1010 | 259 |
| 154 | 3300049824 | Ga0501045_0274643 | Ga0501045_0274643_304_1173 | 259 |
| 155 | 3300050493 | nmdc:mga0k408_336542_c1 | nmdc:mga0k408_336542_c1_98_880 | 259 |
| 156 | 3300050511 | nmdc:mga08y16_939721_c1 | nmdc:mga08y16_939721_c1_16_795 | 259 |
| 157 | 3300053085 | Ga0495619_0470680 | Ga0495619_0470680_20_802 | 259 |
| 158 | 3300053119 | Ga0500595_005351 | Ga0500595_005351_399_1235 | 259 |
| 159 | 3300005440 | Ga0070705_100198031 | Ga0070705_1001980312 | 262 |
| 160 | 3300005445 | Ga0070708_100011239 | Ga0070708_1000112397 | 262 |
| 161 | 3300005518 | Ga0070699_100077753 | Ga0070699_1000777532 | 262 |
| 162 | 3300005536 | Ga0070697_100070159 | Ga0070697_1000701592 | 262 |
| 163 | 3300048924 | Ga0496121_0000125 | Ga0496121_0000125_20644_21480 | 262 |
| 164 | 3300049575 | Ga0501039_0148536 | Ga0501039_0148536_290_1108 | 262 |
| 165 | 3300049587 | Ga0501071_0470462 | Ga0501071_0470462_122_940 | 262 |
| 166 | 3300049588 | Ga0501072_0158686 | Ga0501072_0158686_280_1098 | 262 |
| 167 | 3300049591 | Ga0501075_0128179 | Ga0501075_0128179_283_1101 | 262 |
| 168 | 3300049593 | Ga0501077_0205748 | Ga0501077_0205748_54_872 | 262 |
| 169 | 3300005336 | Ga0070680_100207651 | Ga0070680_1002076512 | 263 |
| 170 | 3300005337 | Ga0070682_100341576 | Ga0070682_1003415762 | 263 |
| 171 | 3300005341 | Ga0070691_10221389 | Ga0070691_102213891 | 263 |
| 172 | 3300005366 | Ga0070659_100435103 | Ga0070659_1004351032 | 263 |
| 173 | 3300005458 | Ga0070681_10125831 | Ga0070681_101258312 | 263 |
| 174 | 3300006175 | Ga0070712_100003673 | Ga0070712_1000036736 | 263 |
| 175 | 3300009093 | Ga0105240_10495475 | Ga0105240_104954752 | 263 |
| 176 | 3300013104 | Ga0157370_10069750 | Ga0157370_100697502 | 263 |
| 177 | 3300013105 | Ga0157369_10004736 | Ga0157369_100047365 | 263 |
| 178 | 3300025912 | Ga0207707_10101383 | Ga0207707_101013832 | 263 |
| 179 | 3300025915 | Ga0207693_10009873 | Ga0207693_100098736 | 263 |
| 180 | 3300025921 | Ga0207652_10267953 | Ga0207652_102679532 | 263 |
| 181 | 3300025939 | Ga0207665_10211219 | Ga0207665_102112192 | 263 |
| 182 | 3300045976 | Ga0466967_0925340 | Ga0466967_0925340_29_844 | 263 |
| 183 | 3300047318 | Ga0495636_0126187 | Ga0495636_0126187_203_1078 | 263 |
| 184 | 3300053077 | Ga0495601_0175455 | Ga0495601_0175455_419_1297 | 263 |
| 185 | 3300053078 | Ga0495612_0026111 | Ga0495612_0026111_171_1049 | 263 |
| 186 | 3300005468 | Ga0070707_100039291 | Ga0070707_1000392913 | 264 |
| 187 | 3300005544 | Ga0070686_100180674 | Ga0070686_1001806742 | 264 |
| 188 | 3300006847 | Ga0075431_100206942 | Ga0075431_1002069422 | 264 |
| 189 | 3300025922 | Ga0207646_10021399 | Ga0207646_100213995 | 264 |
| 190 | 3300049586 | Ga0501070_0039266 | Ga0501070_0039266_2107_3021 | 264 |
| 191 | 3300054114 | Ga0501084_0299317 | Ga0501084_0299317_24_899 | 264 |
| 192 | 3300031731 | Ga0307405_10083056 | Ga0307405_100830563 | 265 |
| 193 | 3300035117 | Ga0373953_0206265 | Ga0373953_0206265_35_832 | 265 |
| 194 | 3300035118 | Ga0373954_0010081 | Ga0373954_0010081_1148_2023 | 265 |
| 195 | 3300046454 | Ga0495592_0121564 | Ga0495592_0121564_674_1549 | 265 |
| 196 | 3300050512 | nmdc:mga0n895_404152_c1 | nmdc:mga0n895_404152_c1_14_838 | 265 |
| 197 | 3300006844 | Ga0075428_100023887 | Ga0075428_1000238876 | 266 |
| 198 | 3300006846 | Ga0075430_100009297 | Ga0075430_1000092979 | 266 |
| 199 | 3300006847 | Ga0075431_100012271 | Ga0075431_1000122714 | 266 |
| 200 | 3300009094 | Ga0111539_10035931 | Ga0111539_100359313 | 266 |
| 201 | 3300027907 | Ga0207428_10092501 | Ga0207428_100925012 | 266 |
| 202 | 3300049588 | Ga0501072_0186564 | Ga0501072_0186564_726_1544 | 266 |
| 203 | 3300050508 | nmdc:mga09592_416578_c1 | nmdc:mga09592_416578_c1_271_1146 | 266 |
| 204 | 3300050511 | nmdc:mga08y16_28582_c1 | nmdc:mga08y16_28582_c1_2558_3433 | 266 |
| 205 | 3300053153 | Ga0500616_0016281 | Ga0500616_0016281_1375_2304 | 266 |
| 206 | 3300049589 | Ga0501073_0136088 | Ga0501073_0136088_608_1471 | 267 |
| 207 | 3300005441 | Ga0070700_100242256 | Ga0070700_1002422562 | 271 |
| 208 | 3300005455 | Ga0070663_100149820 | Ga0070663_1001498202 | 271 |
| 209 | 3300005458 | Ga0070681_10008315 | Ga0070681_100083154 | 271 |
| 210 | 3300005549 | Ga0070704_100232428 | Ga0070704_1002324282 | 271 |
| 211 | 3300007788 | Ga0099795_10065966 | Ga0099795_100659661 | 271 |
| 212 | 3300014497 | Ga0182008_10058954 | Ga0182008_100589542 | 271 |
| 213 | 3300025912 | Ga0207707_10040112 | Ga0207707_100401125 | 271 |
| 214 | 3300025921 | Ga0207652_10088992 | Ga0207652_100889922 | 271 |
| 215 | 3300028800 | Ga0265338_10002492 | Ga0265338_1000249226 | 271 |
| 216 | 3300031235 | Ga0265330_10075726 | Ga0265330_100757262 | 271 |
| 217 | 3300031240 | Ga0265320_10012678 | Ga0265320_100126782 | 271 |
| 218 | 3300031249 | Ga0265339_10012730 | Ga0265339_100127306 | 271 |
| 219 | 3300031250 | Ga0265331_10040004 | Ga0265331_100400042 | 271 |
| 220 | 3300035695 | Ga0373927_0013439 | Ga0373927_0013439_4052_4927 | 271 |
| 221 | 3300037418 | Ga0395900_0134190 | Ga0395900_0134190_1301_2164 | 271 |
| 222 | 3300044684 | Ga0466966_0071360 | Ga0466966_0071360_1140_2000 | 271 |
| 223 | 3300044694 | Ga0466963_0011482 | Ga0466963_0011482_4271_5131 | 271 |
| 224 | 3300044842 | Ga0466957_0171984 | Ga0466957_0171984_159_1019 | 271 |
| 225 | 3300045051 | Ga0451576_0023021 | Ga0451576_0023021_3032_3889 | 271 |
| 226 | 3300045976 | Ga0466967_0186236 | Ga0466967_0186236_659_1531 | 271 |
| 227 | 3300047320 | Ga0495672_0065717 | Ga0495672_0065717_620_1492 | 271 |
| 228 | 3300047472 | Ga0495686_0093332 | Ga0495686_0093332_578_1414 | 271 |
| 229 | 3300048924 | Ga0496121_0060857 | Ga0496121_0060857_1494_2366 | 271 |
| 230 | 3300048929 | Ga0496126_0005275 | Ga0496126_0005275_12905_13777 | 271 |
| 231 | 3300049568 | Ga0501031_0106966 | Ga0501031_0106966_161_1027 | 271 |
| 232 | 3300049569 | Ga0501032_0131739 | Ga0501032_0131739_480_1346 | 271 |
| 233 | 3300049571 | Ga0501034_0406678 | Ga0501034_0406678_46_912 | 271 |
| 234 | 3300049574 | Ga0501038_0168045 | Ga0501038_0168045_452_1318 | 271 |
| 235 | 3300049575 | Ga0501039_0004592 | Ga0501039_0004592_2373_3248 | 271 |
| 236 | 3300049575 | Ga0501039_0129281 | Ga0501039_0129281_16_882 | 271 |
| 237 | 3300049581 | Ga0501047_0042491 | Ga0501047_0042491_3088_3954 | 271 |
| 238 | 3300049582 | Ga0501048_0050821 | Ga0501048_0050821_815_1690 | 271 |
| 239 | 3300049590 | Ga0501074_0210664 | Ga0501074_0210664_151_1017 | 271 |
| 240 | 3300049590 | Ga0501074_0272415 | Ga0501074_0272415_289_1164 | 271 |
| 241 | 3300049591 | Ga0501075_0040806 | Ga0501075_0040806_2334_3209 | 271 |
| 242 | 3300049592 | Ga0501076_0002101 | Ga0501076_0002101_9775_10650 | 271 |
| 243 | 3300049741 | Ga0501079_0000442 | Ga0501079_0000442_2621_3496 | 271 |
| 244 | 3300049742 | Ga0501080_0005112 | Ga0501080_0005112_6526_7401 | 271 |
| 245 | 3300049743 | Ga0501081_0001609 | Ga0501081_0001609_4059_4934 | 271 |
| 246 | 3300049744 | Ga0501083_0008847 | Ga0501083_0008847_1774_2640 | 271 |
| 247 | 3300049744 | Ga0501083_0022417 | Ga0501083_0022417_1533_2408 | 271 |
| 248 | 3300049824 | Ga0501045_0016595 | Ga0501045_0016595_2499_3374 | 271 |
| 249 | 3300053084 | Ga0495595_0053748 | Ga0495595_0053748_102_962 | 271 |
| 250 | 3300053139 | Ga0500568_0044301 | Ga0500568_0044301_297_1133 | 271 |
| 251 | 3300053153 | Ga0500616_0013642 | Ga0500616_0013642_726_1610 | 271 |
| 252 | 3300053178 | Ga0500637_0080876 | Ga0500637_0080876_234_1106 | 271 |
| 253 | 3300054114 | Ga0501084_0034987 | Ga0501084_0034987_2949_3824 | 271 |
| 254 | 3300060353 | Ga0501082_0015525 | Ga0501082_0015525_2870_3736 | 271 |
| 255 | 3300060353 | Ga0501082_0016744 | Ga0501082_0016744_2475_3350 | 271 |
| 256 | 3300003203 | JGI25406J46586_10027630 | JGI25406J46586_100276302 | 272 |
| 257 | 3300005295 | Ga0065707_10002051 | Ga0065707_100020515 | 272 |
| 258 | 3300005295 | Ga0065707_10111808 | Ga0065707_101118082 | 272 |
| 259 | 3300005330 | Ga0070690_100000653 | Ga0070690_1000006538 | 272 |
| 260 | 3300005331 | Ga0070670_100026073 | Ga0070670_1000260733 | 272 |
| 261 | 3300005334 | Ga0068869_100001162 | Ga0068869_10000116217 | 272 |
| 262 | 3300005334 | Ga0068869_100066505 | Ga0068869_1000665052 | 272 |
| 263 | 3300005336 | Ga0070680_100000316 | Ga0070680_10000031630 | 272 |
| 264 | 3300005336 | Ga0070680_100412018 | Ga0070680_1004120182 | 272 |
| 265 | 3300005336 | Ga0070680_100427051 | Ga0070680_1004270511 | 272 |
| 266 | 3300005337 | Ga0070682_100004386 | Ga0070682_1000043866 | 272 |
| 267 | 3300005338 | Ga0068868_100010897 | Ga0068868_1000108979 | 272 |
| 268 | 3300005340 | Ga0070689_100000894 | Ga0070689_10000089419 | 272 |
| 269 | 3300005340 | Ga0070689_100008707 | Ga0070689_1000087076 | 272 |
| 270 | 3300005341 | Ga0070691_10000398 | Ga0070691_100003988 | 272 |
| 271 | 3300005343 | Ga0070687_100000276 | Ga0070687_10000027617 | 272 |
| 272 | 3300005344 | Ga0070661_100109888 | Ga0070661_1001098882 | 272 |
| 273 | 3300005345 | Ga0070692_10002206 | Ga0070692_100022069 | 272 |
| 274 | 3300005347 | Ga0070668_100285025 | Ga0070668_1002850251 | 272 |
| 275 | 3300005353 | Ga0070669_100459059 | Ga0070669_1004590592 | 272 |
| 276 | 3300005354 | Ga0070675_100026546 | Ga0070675_1000265462 | 272 |
| 277 | 3300005364 | Ga0070673_100094834 | Ga0070673_1000948342 | 272 |
| 278 | 3300005364 | Ga0070673_100162262 | Ga0070673_1001622622 | 272 |
| 279 | 3300005436 | Ga0070713_100039482 | Ga0070713_1000394822 | 272 |
| 280 | 3300005436 | Ga0070713_100201362 | Ga0070713_1002013622 | 272 |
| 281 | 3300005438 | Ga0070701_10001480 | Ga0070701_1000148011 | 272 |
| 282 | 3300005438 | Ga0070701_10040690 | Ga0070701_100406902 | 272 |
| 283 | 3300005439 | Ga0070711_100076959 | Ga0070711_1000769592 | 272 |
| 284 | 3300005440 | Ga0070705_100004348 | Ga0070705_1000043489 | 272 |
| 285 | 3300005441 | Ga0070700_100007422 | Ga0070700_1000074228 | 272 |
| 286 | 3300005444 | Ga0070694_100006857 | Ga0070694_1000068579 | 272 |
| 287 | 3300005444 | Ga0070694_100054318 | Ga0070694_1000543182 | 272 |
| 288 | 3300005444 | Ga0070694_100093076 | Ga0070694_1000930762 | 272 |
| 289 | 3300005444 | Ga0070694_100144062 | Ga0070694_1001440622 | 272 |
| 290 | 3300005445 | Ga0070708_100025847 | Ga0070708_1000258472 | 272 |
| 291 | 3300005445 | Ga0070708_100386375 | Ga0070708_1003863752 | 272 |
| 292 | 3300005456 | Ga0070678_100060922 | Ga0070678_1000609223 | 272 |
| 293 | 3300005457 | Ga0070662_100441647 | Ga0070662_1004416471 | 272 |
| 294 | 3300005458 | Ga0070681_10021340 | Ga0070681_100213408 | 272 |
| 295 | 3300005458 | Ga0070681_10045917 | Ga0070681_100459172 | 272 |
| 296 | 3300005459 | Ga0068867_100001833 | Ga0068867_1000018338 | 272 |
| 297 | 3300005468 | Ga0070707_100017423 | Ga0070707_1000174235 | 272 |
| 298 | 3300005468 | Ga0070707_100094384 | Ga0070707_1000943842 | 272 |
| 299 | 3300005468 | Ga0070707_100227657 | Ga0070707_1002276572 | 272 |
| 300 | 3300005471 | Ga0070698_100250777 | Ga0070698_1002507771 | 272 |
| 301 | 3300005471 | Ga0070698_100600196 | Ga0070698_1006001961 | 272 |
| 302 | 3300005518 | Ga0070699_100017254 | Ga0070699_1000172544 | 272 |
| 303 | 3300005518 | Ga0070699_100162339 | Ga0070699_1001623392 | 272 |
| 304 | 3300005530 | Ga0070679_100120679 | Ga0070679_1001206792 | 272 |
| 305 | 3300005535 | Ga0070684_100314114 | Ga0070684_1003141142 | 272 |
| 306 | 3300005544 | Ga0070686_100003380 | Ga0070686_10000338012 | 272 |
| 307 | 3300005544 | Ga0070686_100004094 | Ga0070686_1000040946 | 272 |
| 308 | 3300005544 | Ga0070686_100218212 | Ga0070686_1002182122 | 272 |
| 309 | 3300005545 | Ga0070695_100000250 | Ga0070695_1000002505 | 272 |
| 310 | 3300005545 | Ga0070695_100052646 | Ga0070695_1000526462 | 272 |
| 311 | 3300005545 | Ga0070695_100086410 | Ga0070695_1000864102 | 272 |
| 312 | 3300005545 | Ga0070695_100331997 | Ga0070695_1003319972 | 272 |
| 313 | 3300005546 | Ga0070696_100000358 | Ga0070696_1000003587 | 272 |
| 314 | 3300005546 | Ga0070696_100013575 | Ga0070696_1000135753 | 272 |
| 315 | 3300005546 | Ga0070696_100062314 | Ga0070696_1000623142 | 272 |
| 316 | 3300005546 | Ga0070696_100263188 | Ga0070696_1002631881 | 272 |
| 317 | 3300005547 | Ga0070693_100000395 | Ga0070693_10000039520 | 272 |
| 318 | 3300005547 | Ga0070693_100043723 | Ga0070693_1000437232 | 272 |
| 319 | 3300005548 | Ga0070665_100040455 | Ga0070665_1000404553 | 272 |
| 320 | 3300005549 | Ga0070704_100000203 | Ga0070704_10000020311 | 272 |
| 321 | 3300005549 | Ga0070704_100006684 | Ga0070704_1000066842 | 272 |
| 322 | 3300005549 | Ga0070704_100011525 | Ga0070704_1000115254 | 272 |
| 323 | 3300005549 | Ga0070704_100034318 | Ga0070704_1000343182 | 272 |
| 324 | 3300005549 | Ga0070704_100095595 | Ga0070704_1000955952 | 272 |
| 325 | 3300005563 | Ga0068855_100001461 | Ga0068855_10000146110 | 272 |
| 326 | 3300005564 | Ga0070664_100556784 | Ga0070664_1005567841 | 272 |
| 327 | 3300005614 | Ga0068856_100007042 | Ga0068856_1000070422 | 272 |
| 328 | 3300005615 | Ga0070702_100000049 | Ga0070702_10000004918 | 272 |
| 329 | 3300005617 | Ga0068859_100007613 | Ga0068859_10000761310 | 272 |
| 330 | 3300005617 | Ga0068859_100070873 | Ga0068859_1000708733 | 272 |
| 331 | 3300005617 | Ga0068859_100268948 | Ga0068859_1002689482 | 272 |
| 332 | 3300005618 | Ga0068864_100020028 | Ga0068864_1000200287 | 272 |
| 333 | 3300005618 | Ga0068864_100320476 | Ga0068864_1003204761 | 272 |
| 334 | 3300005718 | Ga0068866_10001779 | Ga0068866_100017795 | 272 |
| 335 | 3300005719 | Ga0068861_100000724 | Ga0068861_10000072410 | 272 |
| 336 | 3300005841 | Ga0068863_100109611 | Ga0068863_1001096112 | 272 |
| 337 | 3300005841 | Ga0068863_100430284 | Ga0068863_1004302842 | 272 |
| 338 | 3300005842 | Ga0068858_100001186 | Ga0068858_10000118626 | 272 |
| 339 | 3300005842 | Ga0068858_100175512 | Ga0068858_1001755122 | 272 |
| 340 | 3300005842 | Ga0068858_100295868 | Ga0068858_1002958682 | 272 |
| 341 | 3300005843 | Ga0068860_100011480 | Ga0068860_10001148013 | 272 |
| 342 | 3300005843 | Ga0068860_100121194 | Ga0068860_1001211942 | 272 |
| 343 | 3300005844 | Ga0068862_100001819 | Ga0068862_1000018199 | 272 |
| 344 | 3300005844 | Ga0068862_100118360 | Ga0068862_1001183602 | 272 |
| 345 | 3300005937 | Ga0081455_10019376 | Ga0081455_100193763 | 272 |
| 346 | 3300005985 | Ga0081539_10002942 | Ga0081539_1000294222 | 272 |
| 347 | 3300006028 | Ga0070717_10014290 | Ga0070717_100142906 | 272 |
| 348 | 3300006028 | Ga0070717_10458375 | Ga0070717_104583751 | 272 |
| 349 | 3300006175 | Ga0070712_100014383 | Ga0070712_1000143832 | 272 |
| 350 | 3300006175 | Ga0070712_100069108 | Ga0070712_1000691082 | 272 |
| 351 | 3300006237 | Ga0097621_100000594 | Ga0097621_10000059410 | 272 |
| 352 | 3300006237 | Ga0097621_100001811 | Ga0097621_10000181116 | 272 |
| 353 | 3300006358 | Ga0068871_100000636 | Ga0068871_10000063629 | 272 |
| 354 | 3300006358 | Ga0068871_100006653 | Ga0068871_1000066534 | 272 |
| 355 | 3300006844 | Ga0075428_100005156 | Ga0075428_1000051562 | 272 |
| 356 | 3300006844 | Ga0075428_100055884 | Ga0075428_1000558843 | 272 |
| 357 | 3300006844 | Ga0075428_100548290 | Ga0075428_1005482901 | 272 |
| 358 | 3300006846 | Ga0075430_100007795 | Ga0075430_1000077957 | 272 |
| 359 | 3300006846 | Ga0075430_100371793 | Ga0075430_1003717932 | 272 |
| 360 | 3300006846 | Ga0075430_100438819 | Ga0075430_1004388192 | 272 |
| 361 | 3300006852 | Ga0075433_10001970 | Ga0075433_1000197015 | 272 |
| 362 | 3300006852 | Ga0075433_10209650 | Ga0075433_102096502 | 272 |
| 363 | 3300006871 | Ga0075434_100001019 | Ga0075434_10000101923 | 272 |
| 364 | 3300006871 | Ga0075434_100006687 | Ga0075434_1000066877 | 272 |
| 365 | 3300006871 | Ga0075434_100030615 | Ga0075434_1000306157 | 272 |
| 366 | 3300006871 | Ga0075434_100411398 | Ga0075434_1004113981 | 272 |
| 367 | 3300006880 | Ga0075429_100012195 | Ga0075429_1000121953 | 272 |
| 368 | 3300006880 | Ga0075429_100029269 | Ga0075429_1000292697 | 272 |
| 369 | 3300006880 | Ga0075429_100043503 | Ga0075429_1000435035 | 272 |
| 370 | 3300006880 | Ga0075429_100095932 | Ga0075429_1000959323 | 272 |
| 371 | 3300006881 | Ga0068865_100000086 | Ga0068865_10000008631 | 272 |
| 372 | 3300006914 | Ga0075436_100003384 | Ga0075436_1000033844 | 272 |
| 373 | 3300006931 | Ga0097620_100007612 | Ga0097620_1000076127 | 272 |
| 374 | 3300006931 | Ga0097620_100070873 | Ga0097620_1000708733 | 272 |
| 375 | 3300006931 | Ga0097620_100268929 | Ga0097620_1002689292 | 272 |
| 376 | 3300007076 | Ga0075435_100002255 | Ga0075435_1000022553 | 272 |
| 377 | 3300007076 | Ga0075435_100004201 | Ga0075435_10000420112 | 272 |
| 378 | 3300007076 | Ga0075435_100456166 | Ga0075435_1004561661 | 272 |
| 379 | 3300007076 | Ga0075435_100563858 | Ga0075435_1005638581 | 272 |
| 380 | 3300009094 | Ga0111539_10012911 | Ga0111539_100129116 | 272 |
| 381 | 3300009094 | Ga0111539_10016090 | Ga0111539_1001609012 | 272 |
| 382 | 3300009094 | Ga0111539_10125703 | Ga0111539_101257032 | 272 |
| 383 | 3300009094 | Ga0111539_10254995 | Ga0111539_102549952 | 272 |
| 384 | 3300009098 | Ga0105245_10016415 | Ga0105245_100164158 | 272 |
| 385 | 3300009147 | Ga0114129_10004560 | Ga0114129_1000456014 | 272 |
| 386 | 3300009147 | Ga0114129_10007276 | Ga0114129_100072767 | 272 |
| 387 | 3300009147 | Ga0114129_10273023 | Ga0114129_102730231 | 272 |
| 388 | 3300009147 | Ga0114129_10480300 | Ga0114129_104803002 | 272 |
| 389 | 3300009148 | Ga0105243_10002776 | Ga0105243_100027765 | 272 |
| 390 | 3300009176 | Ga0105242_10002839 | Ga0105242_1000283910 | 272 |
| 391 | 3300009176 | Ga0105242_10025315 | Ga0105242_100253155 | 272 |
| 392 | 3300009177 | Ga0105248_10015963 | Ga0105248_100159634 | 272 |
| 393 | 3300009177 | Ga0105248_10384125 | Ga0105248_103841252 | 272 |
| 394 | 3300009545 | Ga0105237_10087014 | Ga0105237_100870142 | 272 |
| 395 | 3300009545 | Ga0105237_10864467 | Ga0105237_108644671 | 272 |
| 396 | 3300009551 | Ga0105238_10212104 | Ga0105238_102121042 | 272 |
| 397 | 3300009553 | Ga0105249_10014761 | Ga0105249_100147612 | 272 |
| 398 | 3300009553 | Ga0105249_10159566 | Ga0105249_101595662 | 272 |
| 399 | 3300010375 | Ga0105239_10049635 | Ga0105239_100496355 | 272 |
| 400 | 3300010375 | Ga0105239_10314128 | Ga0105239_103141282 | 272 |
| 401 | 3300013105 | Ga0157369_10327045 | Ga0157369_103270452 | 272 |
| 402 | 3300013297 | Ga0157378_10006675 | Ga0157378_100066752 | 272 |
| 403 | 3300013306 | Ga0163162_10086241 | Ga0163162_100862412 | 272 |
| 404 | 3300013306 | Ga0163162_10124295 | Ga0163162_101242953 | 272 |
| 405 | 3300014326 | Ga0157380_10182156 | Ga0157380_101821562 | 272 |
| 406 | 3300014326 | Ga0157380_10255331 | Ga0157380_102553312 | 272 |
| 407 | 3300014968 | Ga0157379_10026398 | Ga0157379_100263985 | 272 |
| 408 | 3300014969 | Ga0157376_10010862 | Ga0157376_100108622 | 272 |
| 409 | 3300025898 | Ga0207692_10083868 | Ga0207692_100838682 | 272 |
| 410 | 3300025899 | Ga0207642_10002590 | Ga0207642_100025905 | 272 |
| 411 | 3300025905 | Ga0207685_10053098 | Ga0207685_100530982 | 272 |
| 412 | 3300025911 | Ga0207654_10013691 | Ga0207654_100136913 | 272 |
| 413 | 3300025911 | Ga0207654_10200616 | Ga0207654_102006161 | 272 |
| 414 | 3300025912 | Ga0207707_10007157 | Ga0207707_1000715710 | 272 |
| 415 | 3300025912 | Ga0207707_10338416 | Ga0207707_103384162 | 272 |
| 416 | 3300025915 | Ga0207693_10020441 | Ga0207693_100204412 | 272 |
| 417 | 3300025915 | Ga0207693_10135052 | Ga0207693_101350522 | 272 |
| 418 | 3300025917 | Ga0207660_10260030 | Ga0207660_102600302 | 272 |
| 419 | 3300025917 | Ga0207660_10401908 | Ga0207660_104019082 | 272 |
| 420 | 3300025918 | Ga0207662_10005091 | Ga0207662_100050912 | 272 |
| 421 | 3300025921 | Ga0207652_10003435 | Ga0207652_100034353 | 272 |
| 422 | 3300025921 | Ga0207652_10121522 | Ga0207652_101215223 | 272 |
| 423 | 3300025922 | Ga0207646_10038158 | Ga0207646_100381584 | 272 |
| 424 | 3300025922 | Ga0207646_10053131 | Ga0207646_100531312 | 272 |
| 425 | 3300025922 | Ga0207646_10179073 | Ga0207646_101790732 | 272 |
| 426 | 3300025926 | Ga0207659_10066397 | Ga0207659_100663973 | 272 |
| 427 | 3300025927 | Ga0207687_10001793 | Ga0207687_100017932 | 272 |
| 428 | 3300025928 | Ga0207700_10029533 | Ga0207700_100295332 | 272 |
| 429 | 3300025928 | Ga0207700_10032214 | Ga0207700_100322142 | 272 |
| 430 | 3300025929 | Ga0207664_10059683 | Ga0207664_100596834 | 272 |
| 431 | 3300025933 | Ga0207706_10276872 | Ga0207706_102768722 | 272 |
| 432 | 3300025934 | Ga0207686_10001108 | Ga0207686_100011083 | 272 |
| 433 | 3300025934 | Ga0207686_10011236 | Ga0207686_100112365 | 272 |
| 434 | 3300025935 | Ga0207709_10000686 | Ga0207709_1000068629 | 272 |
| 435 | 3300025936 | Ga0207670_10000865 | Ga0207670_1000086515 | 272 |
| 436 | 3300025936 | Ga0207670_10004310 | Ga0207670_100043103 | 272 |
| 437 | 3300025938 | Ga0207704_10005370 | Ga0207704_100053708 | 272 |
| 438 | 3300025941 | Ga0207711_10014863 | Ga0207711_100148636 | 272 |
| 439 | 3300025941 | Ga0207711_10183546 | Ga0207711_101835462 | 272 |
| 440 | 3300025942 | Ga0207689_10000217 | Ga0207689_1000021729 | 272 |
| 441 | 3300025942 | Ga0207689_10288909 | Ga0207689_102889091 | 272 |
| 442 | 3300025949 | Ga0207667_10007910 | Ga0207667_100079103 | 272 |
| 443 | 3300025960 | Ga0207651_10034267 | Ga0207651_100342672 | 272 |
| 444 | 3300025960 | Ga0207651_10082682 | Ga0207651_100826822 | 272 |
| 445 | 3300025961 | Ga0207712_10001713 | Ga0207712_1000171317 | 272 |
| 446 | 3300025961 | Ga0207712_10065861 | Ga0207712_100658612 | 272 |
| 447 | 3300026023 | Ga0207677_10000917 | Ga0207677_1000091711 | 272 |
| 448 | 3300026035 | Ga0207703_10002068 | Ga0207703_100020689 | 272 |
| 449 | 3300026035 | Ga0207703_10192367 | Ga0207703_101923672 | 272 |
| 450 | 3300026067 | Ga0207678_10226784 | Ga0207678_102267842 | 272 |
| 451 | 3300026075 | Ga0207708_10012751 | Ga0207708_100127517 | 272 |
| 452 | 3300026075 | Ga0207708_10094154 | Ga0207708_100941543 | 272 |
| 453 | 3300026078 | Ga0207702_10309683 | Ga0207702_103096832 | 272 |
| 454 | 3300026088 | Ga0207641_10045374 | Ga0207641_100453742 | 272 |
| 455 | 3300026089 | Ga0207648_10000217 | Ga0207648_1000021733 | 272 |
| 456 | 3300026095 | Ga0207676_10013938 | Ga0207676_100139383 | 272 |
| 457 | 3300026116 | Ga0207674_10274278 | Ga0207674_102742782 | 272 |
| 458 | 3300026118 | Ga0207675_100000310 | Ga0207675_10000031040 | 272 |
| 459 | 3300026118 | Ga0207675_100120855 | Ga0207675_1001208552 | 272 |
| 460 | 3300027671 | Ga0209588_1008197 | Ga0209588_10081972 | 272 |
| 461 | 3300027907 | Ga0207428_10023439 | Ga0207428_100234392 | 272 |
| 462 | 3300027907 | Ga0207428_10024453 | Ga0207428_100244532 | 272 |
| 463 | 3300028380 | Ga0268265_10037206 | Ga0268265_100372062 | 272 |
| 464 | 3300028380 | Ga0268265_10037771 | Ga0268265_100377712 | 272 |
| 465 | 3300028381 | Ga0268264_10002238 | Ga0268264_100022387 | 272 |
| 466 | 3300032005 | Ga0307411_10140217 | Ga0307411_101402172 | 272 |
| 467 | 3300034817 | Ga0373948_0015745 | Ga0373948_0015745_302_1120 | 272 |
| 468 | 3300034818 | Ga0373950_0020867 | Ga0373950_0020867_84_902 | 272 |
| 469 | 3300035083 | Ga0373926_0001567 | Ga0373926_0001567_5551_6369 | 272 |
| 470 | 3300035085 | Ga0373929_0019371 | Ga0373929_0019371_99_917 | 272 |
| 471 | 3300035086 | Ga0373934_0000157 | Ga0373934_0000157_7734_8609 | 272 |
| 472 | 3300035086 | Ga0373934_0006830 | Ga0373934_0006830_686_1561 | 272 |
| 473 | 3300035088 | Ga0373940_0039834 | Ga0373940_0039834_164_982 | 272 |
| 474 | 3300035089 | Ga0373944_0002135 | Ga0373944_0002135_2388_3263 | 272 |
| 475 | 3300035089 | Ga0373944_0003108 | Ga0373944_0003108_2052_2870 | 272 |
| 476 | 3300035090 | Ga0373949_0013774 | Ga0373949_0013774_921_1739 | 272 |
| 477 | 3300035091 | Ga0373951_0060492 | Ga0373951_0060492_42_902 | 272 |
| 478 | 3300035111 | Ga0373923_0033757 | Ga0373923_0033757_661_1536 | 272 |
| 479 | 3300035111 | Ga0373923_0039845 | Ga0373923_0039845_899_1774 | 272 |
| 480 | 3300035112 | Ga0373932_0000678 | Ga0373932_0000678_8393_9211 | 272 |
| 481 | 3300035113 | Ga0373936_0001836 | Ga0373936_0001836_5415_6233 | 272 |
| 482 | 3300035113 | Ga0373936_0003130 | Ga0373936_0003130_1234_2109 | 272 |
| 483 | 3300035116 | Ga0373945_0011926 | Ga0373945_0011926_1535_2410 | 272 |
| 484 | 3300035117 | Ga0373953_0055872 | Ga0373953_0055872_535_1410 | 272 |
| 485 | 3300035118 | Ga0373954_0000008 | Ga0373954_0000008_29495_30313 | 272 |
| 486 | 3300035118 | Ga0373954_0034191 | Ga0373954_0034191_361_1236 | 272 |
| 487 | 3300035119 | Ga0373956_0000583 | Ga0373956_0000583_9302_10177 | 272 |
| 488 | 3300035119 | Ga0373956_0005070 | Ga0373956_0005070_295_1170 | 272 |
| 489 | 3300035120 | Ga0373957_0005040 | Ga0373957_0005040_1864_2739 | 272 |
| 490 | 3300035120 | Ga0373957_0088953 | Ga0373957_0088953_314_1132 | 272 |
| 491 | 3300035170 | Ga0373943_0000424 | Ga0373943_0000424_10188_11063 | 272 |
| 492 | 3300035170 | Ga0373943_0001830 | Ga0373943_0001830_1364_2182 | 272 |
| 493 | 3300035171 | Ga0373946_0001859 | Ga0373946_0001859_2472_3347 | 272 |
| 494 | 3300035171 | Ga0373946_0006846 | Ga0373946_0006846_1317_2135 | 272 |
| 495 | 3300035171 | Ga0373946_0024318 | Ga0373946_0024318_1337_2212 | 272 |
| 496 | 3300035172 | Ga0373955_0011974 | Ga0373955_0011974_3207_4082 | 272 |
| 497 | 3300035172 | Ga0373955_0028955 | Ga0373955_0028955_1096_1971 | 272 |
| 498 | 3300035172 | Ga0373955_0130705 | Ga0373955_0130705_226_1044 | 272 |
| 499 | 3300035241 | Ga0373961_0008867 | Ga0373961_0008867_562_1380 | 272 |
| 500 | 3300035241 | Ga0373961_0016204 | Ga0373961_0016204_1043_1861 | 272 |
| 501 | 3300035410 | Ga0373924_0000770 | Ga0373924_0000770_1221_2096 | 272 |
| 502 | 3300035410 | Ga0373924_0020915 | Ga0373924_0020915_1041_1916 | 272 |
| 503 | 3300035691 | Ga0373931_0024925 | Ga0373931_0024925_1016_1834 | 272 |
| 504 | 3300035691 | Ga0373931_0052045 | Ga0373931_0052045_837_1655 | 272 |
| 505 | 3300035691 | Ga0373931_0053438 | Ga0373931_0053438_626_1444 | 272 |
| 506 | 3300035691 | Ga0373931_0108977 | Ga0373931_0108977_200_1018 | 272 |
| 507 | 3300035692 | Ga0373935_0000882 | Ga0373935_0000882_5290_6165 | 272 |
| 508 | 3300035692 | Ga0373935_0015092 | Ga0373935_0015092_1316_2134 | 272 |
| 509 | 3300035692 | Ga0373935_0142744 | Ga0373935_0142744_402_1295 | 272 |
| 510 | 3300035695 | Ga0373927_0000414 | Ga0373927_0000414_26897_27772 | 272 |
| 511 | 3300035695 | Ga0373927_0015438 | Ga0373927_0015438_1951_2769 | 272 |
| 512 | 3300035724 | Ga0373933_0000480 | Ga0373933_0000480_23952_24827 | 272 |
| 513 | 3300035724 | Ga0373933_0001883 | Ga0373933_0001883_9966_10784 | 272 |
| 514 | 3300035724 | Ga0373933_0005143 | Ga0373933_0005143_4690_5508 | 272 |
| 515 | 3300035724 | Ga0373933_0027572 | Ga0373933_0027572_312_1187 | 272 |
| 516 | 3300035724 | Ga0373933_0124057 | Ga0373933_0124057_79_954 | 272 |
| 517 | 3300035724 | Ga0373933_0171041 | Ga0373933_0171041_442_1317 | 272 |
| 518 | 3300035725 | Ga0373947_0000275 | Ga0373947_0000275_24423_25298 | 272 |
| 519 | 3300035725 | Ga0373947_0003710 | Ga0373947_0003710_5387_6205 | 272 |
| 520 | 3300035725 | Ga0373947_0058886 | Ga0373947_0058886_399_1274 | 272 |
| 521 | 3300035725 | Ga0373947_0209665 | Ga0373947_0209665_270_1145 | 272 |
| 522 | 3300036401 | Ga0373937_0000096 | Ga0373937_0000096_76311_77186 | 272 |
| 523 | 3300036401 | Ga0373937_0002785 | Ga0373937_0002785_11806_12624 | 272 |
| 524 | 3300036401 | Ga0373937_0008812 | Ga0373937_0008812_7547_8365 | 272 |
| 525 | 3300036401 | Ga0373937_0031700 | Ga0373937_0031700_3763_4581 | 272 |
| 526 | 3300036401 | Ga0373937_0190577 | Ga0373937_0190577_86_940 | 272 |
| 527 | 3300036401 | Ga0373937_0206013 | Ga0373937_0206013_169_1032 | 272 |
| 528 | 3300036401 | Ga0373937_0318852 | Ga0373937_0318852_57_950 | 272 |
| 529 | 3300037068 | Ga0373925_0001290 | Ga0373925_0001290_17281_18156 | 272 |
| 530 | 3300037068 | Ga0373925_0005781 | Ga0373925_0005781_2843_3661 | 272 |
| 531 | 3300037068 | Ga0373925_0053537 | Ga0373925_0053537_1338_2213 | 272 |
| 532 | 3300037068 | Ga0373925_0209329 | Ga0373925_0209329_281_1156 | 272 |
| 533 | 3300037418 | Ga0395900_0016876 | Ga0395900_0016876_682_1557 | 272 |
| 534 | 3300037466 | Ga0395898_0013811 | Ga0395898_0013811_2145_3020 | 272 |
| 535 | 3300037853 | Ga0436364_1453265 | Ga0436364_1453265_15_890 | 272 |
| 536 | 3300038443 | Ga0395901_0001758 | Ga0395901_0001758_12396_13271 | 272 |
| 537 | 3300041486 | Ga0451807_0878204 | Ga0451807_0878204_696_1514 | 272 |
| 538 | 3300042876 | Ga0451577_0084711 | Ga0451577_0084711_1403_2221 | 272 |
| 539 | 3300042876 | Ga0451577_0165536 | Ga0451577_0165536_677_1495 | 272 |
| 540 | 3300044684 | Ga0466966_0090757 | Ga0466966_0090757_897_1772 | 272 |
| 541 | 3300044694 | Ga0466963_0067816 | Ga0466963_0067816_1217_2092 | 272 |
| 542 | 3300044842 | Ga0466957_0227552 | Ga0466957_0227552_185_1060 | 272 |
| 543 | 3300045051 | Ga0451576_0000360 | Ga0451576_0000360_2382_3200 | 272 |
| 544 | 3300045051 | Ga0451576_0344447 | Ga0451576_0344447_132_950 | 272 |
| 545 | 3300045836 | Ga0466958_0104697 | Ga0466958_0104697_15_890 | 272 |
| 546 | 3300045976 | Ga0466967_0369068 | Ga0466967_0369068_84_959 | 272 |
| 547 | 3300046454 | Ga0495592_0020888 | Ga0495592_0020888_1832_2707 | 272 |
| 548 | 3300046454 | Ga0495592_0105245 | Ga0495592_0105245_234_1109 | 272 |
| 549 | 3300046454 | Ga0495592_0112846 | Ga0495592_0112846_938_1813 | 272 |
| 550 | 3300046455 | Ga0495603_0000866 | Ga0495603_0000866_5139_5957 | 272 |
| 551 | 3300046462 | Ga0495651_0007473 | Ga0495651_0007473_700_1575 | 272 |
| 552 | 3300046463 | Ga0495653_0049761 | Ga0495653_0049761_1924_2799 | 272 |
| 553 | 3300046463 | Ga0495653_0164500 | Ga0495653_0164500_489_1364 | 272 |
| 554 | 3300046463 | Ga0495653_0229995 | Ga0495653_0229995_322_1215 | 272 |
| 555 | 3300046472 | Ga0495580_0003166 | Ga0495580_0003166_12721_13596 | 272 |
| 556 | 3300046472 | Ga0495580_0004091 | Ga0495580_0004091_7072_7890 | 272 |
| 557 | 3300046472 | Ga0495580_0069635 | Ga0495580_0069635_843_1718 | 272 |
| 558 | 3300046472 | Ga0495580_0159317 | Ga0495580_0159317_660_1535 | 272 |
| 559 | 3300046473 | Ga0495582_0036704 | Ga0495582_0036704_896_1714 | 272 |
| 560 | 3300046473 | Ga0495582_0043162 | Ga0495582_0043162_1354_2229 | 272 |
| 561 | 3300046473 | Ga0495582_0052475 | Ga0495582_0052475_547_1365 | 272 |
| 562 | 3300046475 | Ga0495639_0002543 | Ga0495639_0002543_5302_6177 | 272 |
| 563 | 3300046475 | Ga0495639_0017987 | Ga0495639_0017987_527_1345 | 272 |
| 564 | 3300046476 | Ga0495662_0000261 | Ga0495662_0000261_1848_2723 | 272 |
| 565 | 3300046476 | Ga0495662_0010319 | Ga0495662_0010319_1008_1826 | 272 |
| 566 | 3300046476 | Ga0495662_0019341 | Ga0495662_0019341_2404_3222 | 272 |
| 567 | 3300046476 | Ga0495662_0191790 | Ga0495662_0191790_60_935 | 272 |
| 568 | 3300046477 | Ga0495664_0000736 | Ga0495664_0000736_387_1262 | 272 |
| 569 | 3300046477 | Ga0495664_0051378 | Ga0495664_0051378_79_954 | 272 |
| 570 | 3300046491 | Ga0495584_0009947 | Ga0495584_0009947_376_1251 | 272 |
| 571 | 3300046499 | Ga0495594_0155114 | Ga0495594_0155114_47_922 | 272 |
| 572 | 3300046511 | Ga0495608_0062105 | Ga0495608_0062105_1319_2137 | 272 |
| 573 | 3300046511 | Ga0495608_0362279 | Ga0495608_0362279_48_866 | 272 |
| 574 | 3300046514 | Ga0495618_0009180 | Ga0495618_0009180_387_1262 | 272 |
| 575 | 3300046514 | Ga0495618_0042587 | Ga0495618_0042587_1142_1960 | 272 |
| 576 | 3300046514 | Ga0495618_0209425 | Ga0495618_0209425_166_1041 | 272 |
| 577 | 3300046516 | Ga0495628_0003204 | Ga0495628_0003204_13378_14253 | 272 |
| 578 | 3300046516 | Ga0495628_0010344 | Ga0495628_0010344_3675_4550 | 272 |
| 579 | 3300046516 | Ga0495628_0017152 | Ga0495628_0017152_3445_4320 | 272 |
| 580 | 3300046516 | Ga0495628_0253702 | Ga0495628_0253702_278_1153 | 272 |
| 581 | 3300046517 | Ga0495630_0012216 | Ga0495630_0012216_2535_3410 | 272 |
| 582 | 3300046517 | Ga0495630_0013180 | Ga0495630_0013180_4720_5595 | 272 |
| 583 | 3300046517 | Ga0495630_0024458 | Ga0495630_0024458_3349_4224 | 272 |
| 584 | 3300046517 | Ga0495630_0038940 | Ga0495630_0038940_2672_3526 | 272 |
| 585 | 3300046517 | Ga0495630_0318686 | Ga0495630_0318686_119_937 | 272 |
| 586 | 3300046526 | Ga0495666_0023659 | Ga0495666_0023659_199_1074 | 272 |
| 587 | 3300046526 | Ga0495666_0029459 | Ga0495666_0029459_1602_2420 | 272 |
| 588 | 3300046526 | Ga0495666_0103159 | Ga0495666_0103159_57_875 | 272 |
| 589 | 3300046529 | Ga0495652_0015892 | Ga0495652_0015892_4169_5044 | 272 |
| 590 | 3300046529 | Ga0495652_0061368 | Ga0495652_0061368_1145_2020 | 272 |
| 591 | 3300046531 | Ga0495665_0008610 | Ga0495665_0008610_3088_3963 | 272 |
| 592 | 3300046531 | Ga0495665_0024309 | Ga0495665_0024309_2149_3024 | 272 |
| 593 | 3300046531 | Ga0495665_0030263 | Ga0495665_0030263_1610_2485 | 272 |
| 594 | 3300046533 | Ga0495640_0002964 | Ga0495640_0002964_9995_10870 | 272 |
| 595 | 3300046533 | Ga0495640_0012112 | Ga0495640_0012112_5452_6270 | 272 |
| 596 | 3300046533 | Ga0495640_0030067 | Ga0495640_0030067_469_1344 | 272 |
| 597 | 3300046533 | Ga0495640_0033135 | Ga0495640_0033135_2569_3444 | 272 |
| 598 | 3300046533 | Ga0495640_0101691 | Ga0495640_0101691_248_1123 | 272 |
| 599 | 3300046535 | Ga0495586_0001814 | Ga0495586_0001814_229_1104 | 272 |
| 600 | 3300046535 | Ga0495586_0006063 | Ga0495586_0006063_3244_4062 | 272 |
| 601 | 3300046536 | Ga0495587_0007969 | Ga0495587_0007969_44_862 | 272 |
| 602 | 3300046536 | Ga0495587_0009492 | Ga0495587_0009492_2883_3758 | 272 |
| 603 | 3300046536 | Ga0495587_0024154 | Ga0495587_0024154_564_1439 | 272 |
| 604 | 3300046543 | Ga0495645_0001264 | Ga0495645_0001264_9250_10125 | 272 |
| 605 | 3300046543 | Ga0495645_0035117 | Ga0495645_0035117_690_1565 | 272 |
| 606 | 3300046543 | Ga0495645_0105969 | Ga0495645_0105969_150_1025 | 272 |
| 607 | 3300046559 | Ga0495667_0032581 | Ga0495667_0032581_159_977 | 272 |
| 608 | 3300046559 | Ga0495667_0196905 | Ga0495667_0196905_261_1136 | 272 |
| 609 | 3300046615 | Ga0495656_0032256 | Ga0495656_0032256_1096_1914 | 272 |
| 610 | 3300046615 | Ga0495656_0238836 | Ga0495656_0238836_66_887 | 272 |
| 611 | 3300046642 | Ga0495634_0016009 | Ga0495634_0016009_786_1604 | 272 |
| 612 | 3300046642 | Ga0495634_0026698 | Ga0495634_0026698_2185_3060 | 272 |
| 613 | 3300046642 | Ga0495634_0058277 | Ga0495634_0058277_1338_2213 | 272 |
| 614 | 3300046642 | Ga0495634_0080186 | Ga0495634_0080186_559_1434 | 272 |
| 615 | 3300046663 | Ga0495635_0000438 | Ga0495635_0000438_18267_19142 | 272 |
| 616 | 3300046664 | Ga0495659_0105319 | Ga0495659_0105319_215_1033 | 272 |
| 617 | 3300046675 | Ga0495657_0027929 | Ga0495657_0027929_27_902 | 272 |
| 618 | 3300046675 | Ga0495657_0040852 | Ga0495657_0040852_969_1844 | 272 |
| 619 | 3300046678 | Ga0495599_0006728 | Ga0495599_0006728_273_1091 | 272 |
| 620 | 3300046678 | Ga0495599_0008944 | Ga0495599_0008944_3590_4465 | 272 |
| 621 | 3300046678 | Ga0495599_0017728 | Ga0495599_0017728_3127_4002 | 272 |
| 622 | 3300046678 | Ga0495599_0026184 | Ga0495599_0026184_2761_3636 | 272 |
| 623 | 3300046678 | Ga0495599_0154806 | Ga0495599_0154806_227_1102 | 272 |
| 624 | 3300046679 | Ga0495623_0028239 | Ga0495623_0028239_232_1107 | 272 |
| 625 | 3300046680 | Ga0495646_0017519 | Ga0495646_0017519_1528_2403 | 272 |
| 626 | 3300046680 | Ga0495646_0147122 | Ga0495646_0147122_314_1189 | 272 |
| 627 | 3300046681 | Ga0495647_0000101 | Ga0495647_0000101_15025_15843 | 272 |
| 628 | 3300046681 | Ga0495647_0001930 | Ga0495647_0001930_5538_6413 | 272 |
| 629 | 3300046681 | Ga0495647_0039187 | Ga0495647_0039187_660_1535 | 272 |
| 630 | 3300046683 | Ga0495658_0009776 | Ga0495658_0009776_50_868 | 272 |
| 631 | 3300046683 | Ga0495658_0012211 | Ga0495658_0012211_1050_1868 | 272 |
| 632 | 3300046683 | Ga0495658_0044647 | Ga0495658_0044647_695_1570 | 272 |
| 633 | 3300046683 | Ga0495658_0046432 | Ga0495658_0046432_561_1436 | 272 |
| 634 | 3300046684 | Ga0495669_0063550 | Ga0495669_0063550_573_1391 | 272 |
| 635 | 3300046689 | Ga0495613_0009665 | Ga0495613_0009665_554_1372 | 272 |
| 636 | 3300046689 | Ga0495613_0057435 | Ga0495613_0057435_458_1333 | 272 |
| 637 | 3300046689 | Ga0495613_0164918 | Ga0495613_0164918_258_1133 | 272 |
| 638 | 3300046690 | Ga0495624_0001570 | Ga0495624_0001570_3333_4208 | 272 |
| 639 | 3300046690 | Ga0495624_0018484 | Ga0495624_0018484_2698_3516 | 272 |
| 640 | 3300046809 | Ga0495600_0012434 | Ga0495600_0012434_4214_5089 | 272 |
| 641 | 3300046809 | Ga0495600_0084717 | Ga0495600_0084717_462_1337 | 272 |
| 642 | 3300047315 | Ga0495581_0010385 | Ga0495581_0010385_4336_5211 | 272 |
| 643 | 3300047315 | Ga0495581_0018895 | Ga0495581_0018895_524_1342 | 272 |
| 644 | 3300047315 | Ga0495581_0329079 | Ga0495581_0329079_25_843 | 272 |
| 645 | 3300047317 | Ga0495604_0023995 | Ga0495604_0023995_23_898 | 272 |
| 646 | 3300047317 | Ga0495604_0025707 | Ga0495604_0025707_164_982 | 272 |
| 647 | 3300047317 | Ga0495604_0025979 | Ga0495604_0025979_1262_2155 | 272 |
| 648 | 3300047319 | Ga0495674_0000209 | Ga0495674_0000209_38966_39841 | 272 |
| 649 | 3300047319 | Ga0495674_0011630 | Ga0495674_0011630_3826_4701 | 272 |
| 650 | 3300047319 | Ga0495674_0158641 | Ga0495674_0158641_879_1697 | 272 |
| 651 | 3300047321 | Ga0495676_0043019 | Ga0495676_0043019_2521_3396 | 272 |
| 652 | 3300047321 | Ga0495676_0047052 | Ga0495676_0047052_1442_2317 | 272 |
| 653 | 3300047322 | Ga0495680_0012588 | Ga0495680_0012588_825_1643 | 272 |
| 654 | 3300047322 | Ga0495680_0026033 | Ga0495680_0026033_3723_4598 | 272 |
| 655 | 3300047322 | Ga0495680_0095038 | Ga0495680_0095038_872_1690 | 272 |
| 656 | 3300047444 | Ga0495675_0007134 | Ga0495675_0007134_814_1689 | 272 |
| 657 | 3300047444 | Ga0495675_0198541 | Ga0495675_0198541_252_1070 | 272 |
| 658 | 3300047471 | Ga0495684_0001766 | Ga0495684_0001766_14379_15254 | 272 |
| 659 | 3300047471 | Ga0495684_0003044 | Ga0495684_0003044_327_1202 | 272 |
| 660 | 3300047471 | Ga0495684_0008625 | Ga0495684_0008625_327_1202 | 272 |
| 661 | 3300047471 | Ga0495684_0044577 | Ga0495684_0044577_2086_2961 | 272 |
| 662 | 3300047471 | Ga0495684_0296647 | Ga0495684_0296647_294_1112 | 272 |
| 663 | 3300047673 | Ga0495593_0010564 | Ga0495593_0010564_3869_4744 | 272 |
| 664 | 3300047673 | Ga0495593_0090611 | Ga0495593_0090611_175_1050 | 272 |
| 665 | 3300048088 | Ga0495602_0442032 | Ga0495602_0442032_28_846 | 272 |
| 666 | 3300048907 | Ga0496104_0139247 | Ga0496104_0139247_35_910 | 272 |
| 667 | 3300048909 | Ga0496106_0144828 | Ga0496106_0144828_863_1738 | 272 |
| 668 | 3300048912 | Ga0496109_0076942 | Ga0496109_0076942_1180_2055 | 272 |
| 669 | 3300048913 | Ga0496110_0158039 | Ga0496110_0158039_923_1798 | 272 |
| 670 | 3300048914 | Ga0496111_0053903 | Ga0496111_0053903_537_1412 | 272 |
| 671 | 3300048916 | Ga0496113_0061909 | Ga0496113_0061909_1050_1925 | 272 |
| 672 | 3300049572 | Ga0501036_0392816 | Ga0501036_0392816_267_1145 | 272 |
| 673 | 3300049576 | Ga0501040_0007409 | Ga0501040_0007409_3039_3857 | 272 |
| 674 | 3300049576 | Ga0501040_0019632 | Ga0501040_0019632_1198_2016 | 272 |
| 675 | 3300049576 | Ga0501040_0024732 | Ga0501040_0024732_398_1216 | 272 |
| 676 | 3300049577 | Ga0501041_0007160 | Ga0501041_0007160_1010_1828 | 272 |
| 677 | 3300049582 | Ga0501048_0014025 | Ga0501048_0014025_2547_3365 | 272 |
| 678 | 3300049583 | Ga0501067_0085179 | Ga0501067_0085179_557_1375 | 272 |
| 679 | 3300049584 | Ga0501068_0109969 | Ga0501068_0109969_124_942 | 272 |
| 680 | 3300049586 | Ga0501070_0467474 | Ga0501070_0467474_81_956 | 272 |
| 681 | 3300049587 | Ga0501071_0224644 | Ga0501071_0224644_428_1306 | 272 |
| 682 | 3300049588 | Ga0501072_0054892 | Ga0501072_0054892_1108_1926 | 272 |
| 683 | 3300049588 | Ga0501072_0095649 | Ga0501072_0095649_150_1025 | 272 |
| 684 | 3300049588 | Ga0501072_0119298 | Ga0501072_0119298_421_1239 | 272 |
| 685 | 3300049588 | Ga0501072_0237488 | Ga0501072_0237488_304_1182 | 272 |
| 686 | 3300049589 | Ga0501073_0235442 | Ga0501073_0235442_189_1010 | 272 |
| 687 | 3300049590 | Ga0501074_0093014 | Ga0501074_0093014_841_1659 | 272 |
| 688 | 3300049591 | Ga0501075_0176539 | Ga0501075_0176539_396_1214 | 272 |
| 689 | 3300049592 | Ga0501076_0018795 | Ga0501076_0018795_4166_5041 | 272 |
| 690 | 3300049592 | Ga0501076_0081684 | Ga0501076_0081684_1317_2135 | 272 |
| 691 | 3300049593 | Ga0501077_0044071 | Ga0501077_0044071_1722_2597 | 272 |
| 692 | 3300049741 | Ga0501079_0065677 | Ga0501079_0065677_972_1847 | 272 |
| 693 | 3300049741 | Ga0501079_0367567 | Ga0501079_0367567_201_1019 | 272 |
| 694 | 3300049743 | Ga0501081_0099755 | Ga0501081_0099755_884_1762 | 272 |
| 695 | 3300049743 | Ga0501081_0148815 | Ga0501081_0148815_694_1512 | 272 |
| 696 | 3300049824 | Ga0501045_0177378 | Ga0501045_0177378_253_1071 | 272 |
| 697 | 3300050507 | nmdc:mga05p37_174307_c1 | nmdc:mga05p37_174307_c1_368_1240 | 272 |
| 698 | 3300050507 | nmdc:mga05p37_18630_c1 | nmdc:mga05p37_18630_c1_5201_6049 | 272 |
| 699 | 3300050507 | nmdc:mga05p37_277670_c1 | nmdc:mga05p37_277670_c1_1147_1965 | 272 |
| 700 | 3300050507 | nmdc:mga05p37_593775_c1 | nmdc:mga05p37_593775_c1_159_977 | 272 |
| 701 | 3300050508 | nmdc:mga09592_16926_c1 | nmdc:mga09592_16926_c1_4863_5738 | 272 |
| 702 | 3300050508 | nmdc:mga09592_39020_c1 | nmdc:mga09592_39020_c1_915_1733 | 272 |
| 703 | 3300050509 | nmdc:mga0qj67_16395_c1 | nmdc:mga0qj67_16395_c1_2837_3700 | 272 |
| 704 | 3300050509 | nmdc:mga0qj67_295401_c1 | nmdc:mga0qj67_295401_c1_181_1059 | 272 |
| 705 | 3300050509 | nmdc:mga0qj67_382814_c1 | nmdc:mga0qj67_382814_c1_264_1082 | 272 |
| 706 | 3300050509 | nmdc:mga0qj67_485939_c1 | nmdc:mga0qj67_485939_c1_83_901 | 272 |
| 707 | 3300050511 | nmdc:mga08y16_19349_c1 | nmdc:mga08y16_19349_c1_4022_4897 | 272 |
| 708 | 3300050511 | nmdc:mga08y16_241269_c1 | nmdc:mga08y16_241269_c1_37_912 | 272 |
| 709 | 3300050511 | nmdc:mga08y16_488327_c1 | nmdc:mga08y16_488327_c1_97_915 | 272 |
| 710 | 3300050511 | nmdc:mga08y16_65008_c1 | nmdc:mga08y16_65008_c1_318_1136 | 272 |
| 711 | 3300050511 | nmdc:mga08y16_8030_c1 | nmdc:mga08y16_8030_c1_2590_3408 | 272 |
| 712 | 3300050512 | nmdc:mga0n895_186252_c1 | nmdc:mga0n895_186252_c1_18_836 | 272 |
| 713 | 3300050512 | nmdc:mga0n895_24452_c1 | nmdc:mga0n895_24452_c1_3952_4770 | 272 |
| 714 | 3300050512 | nmdc:mga0n895_328945_c1 | nmdc:mga0n895_328945_c1_264_1082 | 272 |
| 715 | 3300050512 | nmdc:mga0n895_398267_c1 | nmdc:mga0n895_398267_c1_74_949 | 272 |
| 716 | 3300050512 | nmdc:mga0n895_86363_c1 | nmdc:mga0n895_86363_c1_1903_2721 | 272 |
| 717 | 3300050513 | nmdc:mga0rr50_38539_c1 | nmdc:mga0rr50_38539_c1_1466_2284 | 272 |
| 718 | 3300050513 | nmdc:mga0rr50_5178_c1 | nmdc:mga0rr50_5178_c1_1436_2254 | 272 |
| 719 | 3300050513 | nmdc:mga0rr50_9234_c1 | nmdc:mga0rr50_9234_c1_3633_4451 | 272 |
| 720 | 3300050514 | nmdc:mga08x19_1086_c1 | nmdc:mga08x19_1086_c1_7879_8697 | 272 |
| 721 | 3300050514 | nmdc:mga08x19_15159_c1 | nmdc:mga08x19_15159_c1_3201_4019 | 272 |
| 722 | 3300050514 | nmdc:mga08x19_369_c2 | nmdc:mga08x19_369_c2_4997_5815 | 272 |
| 723 | 3300050514 | nmdc:mga08x19_59734_c1 | nmdc:mga08x19_59734_c1_1498_2316 | 272 |
| 724 | 3300050515 | nmdc:mga0a205_126559_c1 | nmdc:mga0a205_126559_c1_323_1141 | 272 |
| 725 | 3300050515 | nmdc:mga0a205_1767_c1 | nmdc:mga0a205_1767_c1_10519_11337 | 272 |
| 726 | 3300053077 | Ga0495601_0001991 | Ga0495601_0001991_3166_4041 | 272 |
| 727 | 3300053077 | Ga0495601_0005391 | Ga0495601_0005391_4476_5351 | 272 |
| 728 | 3300053077 | Ga0495601_0015469 | Ga0495601_0015469_3610_4428 | 272 |
| 729 | 3300053077 | Ga0495601_0189318 | Ga0495601_0189318_403_1221 | 272 |
| 730 | 3300053077 | Ga0495601_0213778 | Ga0495601_0213778_143_1036 | 272 |
| 731 | 3300053078 | Ga0495612_0000353 | Ga0495612_0000353_16039_16914 | 272 |
| 732 | 3300053078 | Ga0495612_0077952 | Ga0495612_0077952_193_1068 | 272 |
| 733 | 3300053084 | Ga0495595_0007988 | Ga0495595_0007988_3412_4287 | 272 |
| 734 | 3300053084 | Ga0495595_0017855 | Ga0495595_0017855_540_1415 | 272 |
| 735 | 3300053084 | Ga0495595_0084487 | Ga0495595_0084487_431_1306 | 272 |
| 736 | 3300053085 | Ga0495619_0011558 | Ga0495619_0011558_1868_2743 | 272 |
| 737 | 3300053085 | Ga0495619_0011605 | Ga0495619_0011605_2000_2875 | 272 |
| 738 | 3300053085 | Ga0495619_0421070 | Ga0495619_0421070_90_908 | 272 |
| 739 | 3300053153 | Ga0500616_0010041 | Ga0500616_0010041_4740_5597 | 272 |
| 740 | 3300054114 | Ga0501084_0003157 | Ga0501084_0003157_2254_3072 | 272 |
| 741 | 3300054114 | Ga0501084_0195663 | Ga0501084_0195663_345_1220 | 272 |
| 742 | 3300060353 | Ga0501082_0090056 | Ga0501082_0090056_1152_1970 | 272 |
| 743 | 3300061734 | Ga0530510_0026321 | Ga0530510_0026321_1461_2339 | 272 |
| 744 | 3300061734 | Ga0530510_0050025 | Ga0530510_0050025_921_1739 | 272 |
| 745 | 3300061734 | Ga0530510_0114058 | Ga0530510_0114058_844_1719 | 272 |
| 746 | 3300061734 | Ga0530510_0178720 | Ga0530510_0178720_601_1476 | 272 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5316 | 2 | 261 |
| 7kyo-assembly1.cif.gz_C-2 | psabc from streptococcus pneumoniae in complex with fab | 0.5006 | 2 | 261 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4945 | 3 | 271 |
| 4dbl-assembly1.cif.gz_B | crystal structure of e159q mutant of btucdf | 0.4849 | 2 | 263 |
| 7kyp-assembly4.cif.gz_N | psabc from streptococcus pneumoniae in complex with fab | 0.4696 | 3 | 271 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8708 | 2 | 259 | 1.10.3470.10 |
| af_P0AEX7_11_292_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8261 | 2 | 259 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.8067 | 2 | 261 | 1.10.3470.10 |
| af_P0AFS1_34_305_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7741 | 2 | 259 | 1.10.3470.10 |
| af_Q58665_14_295_1.10.3470.10 | Mainly Alpha;Orthogonal Bundle;ABC transporter involved in vitamin B12 uptake, BtuC;ABC transporter involved in vitamin B12 uptake, BtuC | 0.7718 | 2 | 261 | 1.10.3470.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A3S0FD86-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9701 | 2 | 192 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A4P7YWF2-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9586 | 2 | 212 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A382KPH0-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9578 | 3 | 184 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A1I5Y358-F1-model_v4 | Branched-chain amino acid transport system / permease component | 0.9519 | 2 | 190 |
GO:0005886
GO:0006865 GO:0022857 |
| AF-A0A537CK55-F1-model_v4 | Branched-chain amino acid ABC transporter permease | 0.9508 | 3 | 187 |
GO:0005886
GO:0006865 GO:0022857 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar