F478869

General Info

Members Datasets Scaffolds Average Seq Length
746 284 746 123

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10324860|Ga0207706_103248602
Length 141
Sequence MPLSTPKDARKRPPAGRKPDDGYDPVLLQAIIAIGFAVGALVVSVLLGKSGVRTRTKDSAYECGMLPQGEAQPRFSVKFYLVAMLFILFDLEIVFMYPWAVVYRESIASSHVIFWSMLSFVSILMVGYVYALKKGAFDWKT

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
3 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
79 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
82 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
83 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
84 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
93 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
94 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
95 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
96 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
97 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
98 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
99 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
100 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
101 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
102 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
103 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
104 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
105 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
106 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
107 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
108 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
109 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
110 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
113 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
115 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
116 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
117 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
118 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
119 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
120 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
174 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
175 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
176 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
177 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
178 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
179 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
180 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
181 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
184 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
185 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
186 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
187 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
188 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
189 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
190 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
191 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
193 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
194 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
195 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
196 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
197 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
198 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
199 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
202 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
205 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
206 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
207 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
208 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
211 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
212 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
213 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
214 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
215 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
216 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
217 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
218 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
219 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
220 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
221 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
222 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
223 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
224 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
225 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
226 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
227 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
228 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
229 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
230 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
237 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
238 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
239 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
240 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
241 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
242 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
243 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
247 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
248 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
249 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
250 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
253 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
254 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
255 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
256 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
257 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
258 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
259 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
262 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
263 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
264 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
265 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
274 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
278 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
279 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
280 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
281 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
282 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
283 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
284 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.33
Metatranscriptomes 0.67
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.13
Nodule 0
Rhizoplane 6.03
Rhizosphere 92.09
Stem 0
Stem Tuber 0
Unclassified 1.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_10906538 2162886012 Unclassified 838
2 CNBas_1013603 3300000531 Bacteria 515
3 CNXas_1000075 3300000545 Bacteria 18549
4 JGI24746J21847_1018653 3300001977 Unclassified 980
5 JGI24739J22299_10233805 3300001989 Unclassified 538
6 JGI24743J22301_10058062 3300001991 Unclassified 794
7 JGI24750J21931_1037984 3300002070 Unclassified 725
8 JGI25406J46586_10088582 3300003203 Bacteria 937
9 JGI25406J46586_10110274 3300003203 Bacteria 815
10 rootH1_10150751 3300003316 Bacteria 3127
11 rootL2_10317932 3300003322 Bacteria 2948
12 Ga0065703_1023045 3300005272 Bacteria 765
13 Ga0065704_10016990 3300005289 Bacteria 1263
14 Ga0065712_10011282 3300005290 Bacteria 1859
15 Ga0065712_10025123 3300005290 Bacteria 1402
16 Ga0065712_10143914 3300005290 Bacteria 1389
17 Ga0065712_10175923 3300005290 Unclassified 1215
18 Ga0065712_10565745 3300005290 Unclassified 609
19 Ga0065715_10010884 3300005293 Bacteria 2487
20 Ga0065715_10345151 3300005293 Bacteria 960
21 Ga0065715_10365534 3300005293 Unclassified 919
22 Ga0065715_10405355 3300005293 Bacteria 876
23 Ga0065715_10759095 3300005293 Unclassified 627
24 Ga0065707_10006945 3300005295 Bacteria 3988
25 Ga0065707_10197376 3300005295 Bacteria 1328
26 Ga0070658_10111100 3300005327 Bacteria 2271
27 Ga0070676_10010812 3300005328 Bacteria 4952
28 Ga0070676_10286500 3300005328 Bacteria 1112
29 Ga0070676_10518752 3300005328 Unclassified 848
30 Ga0070676_10681742 3300005328 Unclassified 749
31 Ga0070690_100078353 3300005330 Bacteria 2159
32 Ga0070690_100128856 3300005330 Bacteria 1706
33 Ga0070690_100883550 3300005330 Bacteria 698
34 Ga0070670_100004474 3300005331 Bacteria 11709
35 Ga0070670_100005662 3300005331 Bacteria 10544
36 Ga0070670_100110578 3300005331 Bacteria 2367
37 Ga0070670_100136614 3300005331 Bacteria 2119
38 Ga0070670_100298824 3300005331 Bacteria 1408
39 Ga0070670_100933561 3300005331 Bacteria 787
40 Ga0070677_10020745 3300005333 Bacteria 2399
41 Ga0070677_10380217 3300005333 Bacteria 739
42 Ga0068869_100168634 3300005334 Bacteria 1709
43 Ga0068869_100268514 3300005334 Bacteria 1368
44 Ga0068869_100898900 3300005334 Unclassified 766
45 Ga0070666_10003567 3300005335 Bacteria 9436
46 Ga0070666_10020162 3300005335 Unclassified 4308
47 Ga0070666_10079986 3300005335 Bacteria 2233
48 Ga0070666_10158285 3300005335 Bacteria 1582
49 Ga0070680_100795732 3300005336 Bacteria 815
50 Ga0068868_100731574 3300005338 Bacteria 887
51 Ga0068868_100934788 3300005338 Bacteria 790
52 Ga0068868_101768189 3300005338 Bacteria 584
53 Ga0070660_100426316 3300005339 Bacteria 1099
54 Ga0070689_100008216 3300005340 Bacteria 7338
55 Ga0070689_100052879 3300005340 Bacteria 3142
56 Ga0070689_100197408 3300005340 Bacteria 1641
57 Ga0070689_100273636 3300005340 Unclassified 1399
58 Ga0070689_100771041 3300005340 Unclassified 844
59 Ga0070687_100001607 3300005343 Bacteria 8045
60 Ga0070687_100043763 3300005343 Bacteria 2277
61 Ga0070687_100158147 3300005343 Bacteria 1337
62 Ga0070661_100206258 3300005344 Unclassified 1503
63 Ga0070661_100298744 3300005344 Bacteria 1253
64 Ga0070668_100000836 3300005347 Bacteria 21289
65 Ga0070668_100060271 3300005347 Bacteria 2938
66 Ga0070668_100238498 3300005347 Bacteria 1505
67 Ga0070668_100307145 3300005347 Bacteria 1332
68 Ga0070669_100007775 3300005353 Bacteria 7658
69 Ga0070669_100012298 3300005353 Bacteria 6073
70 Ga0070669_100012867 3300005353 Bacteria 5942
71 Ga0070669_100015656 3300005353 Bacteria 5407
72 Ga0070669_100203623 3300005353 Bacteria 1558
73 Ga0070669_100306043 3300005353 Bacteria 1279
74 Ga0070669_100444288 3300005353 Bacteria 1068
75 Ga0070675_100009115 3300005354 Bacteria 7707
76 Ga0070675_100062758 3300005354 Bacteria 3070
77 Ga0070675_100181273 3300005354 Bacteria 1821
78 Ga0070675_100292935 3300005354 Bacteria 1432
79 Ga0070675_100511743 3300005354 Bacteria 1082
80 Ga0070671_100007786 3300005355 Bacteria 8560
81 Ga0070671_100018241 3300005355 Bacteria 5698
82 Ga0070671_100021568 3300005355 Bacteria 5261
83 Ga0070671_100124210 3300005355 Bacteria 2172
84 Ga0070671_100251728 3300005355 Bacteria 1501
85 Ga0070671_100347563 3300005355 Unclassified 1266
86 Ga0070671_100543440 3300005355 Bacteria 1001
87 Ga0070671_100627797 3300005355 Bacteria 929
88 Ga0070671_100633075 3300005355 Bacteria 925
89 Ga0070671_100640545 3300005355 Bacteria 920
90 Ga0070674_100000816 3300005356 Bacteria 16069
91 Ga0070674_100066011 3300005356 Bacteria 2541
92 Ga0070674_100090211 3300005356 Bacteria 2210
93 Ga0070674_100449560 3300005356 Bacteria 1063
94 Ga0070673_100004390 3300005364 Bacteria 8915
95 Ga0070673_100161221 3300005364 Bacteria 1907
96 Ga0070673_100233448 3300005364 Bacteria 1596
97 Ga0070673_100306459 3300005364 Unclassified 1400
98 Ga0070673_100685424 3300005364 Unclassified 940
99 Ga0070673_101809791 3300005364 Bacteria 579
100 Ga0070688_100001751 3300005365 Bacteria 10842
101 Ga0070688_101545172 3300005365 Bacteria 541
102 Ga0070659_100852800 3300005366 Unclassified 794
103 Ga0070667_100021783 3300005367 Bacteria 5318
104 Ga0070667_100030175 3300005367 Bacteria 4521
105 Ga0070667_100038282 3300005367 Bacteria 4021
106 Ga0070667_100180554 3300005367 Bacteria 1866
107 Ga0070667_102283360 3300005367 Unclassified 509
108 Ga0070703_10306227 3300005406 Unclassified 664
109 Ga0070703_10559805 3300005406 Bacteria 522
110 Ga0070709_10087421 3300005434 Bacteria 2048
111 Ga0070709_10256388 3300005434 Unclassified 1262
112 Ga0070709_10455436 3300005434 Bacteria 964
113 Ga0070714_100020574 3300005435 Bacteria 5392
114 Ga0070714_100082260 3300005435 Unclassified 2805
115 Ga0070714_100135745 3300005435 Bacteria 2203
116 Ga0070714_100305203 3300005435 Bacteria 1485
117 Ga0070714_100440101 3300005435 Bacteria 1237
118 Ga0070714_100494073 3300005435 Bacteria 1166
119 Ga0070714_101056619 3300005435 Unclassified 791
120 Ga0070713_100271334 3300005436 Unclassified 1553
121 Ga0070713_100272199 3300005436 Bacteria 1551
122 Ga0070713_100307993 3300005436 Bacteria 1460
123 Ga0070713_100718164 3300005436 Bacteria 955
124 Ga0070713_100890916 3300005436 Bacteria 855
125 Ga0070713_101093430 3300005436 Bacteria 770
126 Ga0070710_10043991 3300005437 Bacteria 2476
127 Ga0070710_10431404 3300005437 Bacteria 889
128 Ga0070710_10541690 3300005437 Bacteria 803
129 Ga0070710_10558249 3300005437 Bacteria 792
130 Ga0070710_10591099 3300005437 Unclassified 771
131 Ga0070711_100013195 3300005439 Bacteria 5184
132 Ga0070711_100026223 3300005439 Bacteria 3818
133 Ga0070711_100336495 3300005439 Bacteria 1210
134 Ga0070711_100719869 3300005439 Bacteria 841
135 Ga0070705_100007587 3300005440 Bacteria 5345
136 Ga0070705_100110705 3300005440 Bacteria 1754
137 Ga0070705_100177714 3300005440 Bacteria 1439
138 Ga0070705_100270215 3300005440 Bacteria 1204
139 Ga0070705_100359731 3300005440 Bacteria 1064
140 Ga0070705_101016102 3300005440 Unclassified 674
141 Ga0070700_100817619 3300005441 Unclassified 752
142 Ga0070694_100131997 3300005444 Bacteria 1805
143 Ga0070694_100186380 3300005444 Bacteria 1538
144 Ga0070708_100004838 3300005445 Bacteria 10624
145 Ga0070708_100010491 3300005445 Bacteria 7512
146 Ga0070708_100016567 3300005445 Bacteria 6120
147 Ga0070708_100023132 3300005445 Bacteria 5279
148 Ga0070708_100170012 3300005445 Unclassified 2034
149 Ga0070708_100185905 3300005445 Bacteria 1943
150 Ga0070708_100257375 3300005445 Unclassified 1640
151 Ga0070708_100383417 3300005445 Bacteria 1325
152 Ga0070708_100409508 3300005445 Unclassified 1279
153 Ga0070708_101029846 3300005445 Bacteria 772
154 Ga0070708_101110226 3300005445 Bacteria 741
155 Ga0070663_100378558 3300005455 Unclassified 1152
156 Ga0070678_100001971 3300005456 Bacteria 11086
157 Ga0070678_100041684 3300005456 Bacteria 3256
158 Ga0070678_100123728 3300005456 Bacteria 2044
159 Ga0070678_100210566 3300005456 Bacteria 1610
160 Ga0070662_100020162 3300005457 Unclassified 4537
161 Ga0070662_101020375 3300005457 Bacteria 709
162 Ga0068867_100014539 3300005459 Bacteria 5579
163 Ga0070685_10242682 3300005466 Unclassified 1190
164 Ga0070706_100000462 3300005467 Bacteria 48224
165 Ga0070706_100008839 3300005467 Bacteria 9386
166 Ga0070706_100021324 3300005467 Bacteria 5967
167 Ga0070706_100022886 3300005467 Bacteria 5755
168 Ga0070706_100035784 3300005467 Bacteria 4585
169 Ga0070706_100055509 3300005467 Bacteria 3656
170 Ga0070706_100091006 3300005467 Bacteria 2829
171 Ga0070706_100205972 3300005467 Unclassified 1837
172 Ga0070706_100225308 3300005467 Bacteria 1750
173 Ga0070706_100439735 3300005467 Bacteria 1214
174 Ga0070706_100455511 3300005467 Bacteria 1190
175 Ga0070706_100494904 3300005467 Unclassified 1138
176 Ga0070707_100000140 3300005468 Bacteria 68016
177 Ga0070707_100024766 3300005468 Bacteria 5689
178 Ga0070707_100025477 3300005468 Bacteria 5611
179 Ga0070707_100026733 3300005468 Bacteria 5482
180 Ga0070707_100034565 3300005468 Bacteria 4821
181 Ga0070707_100069579 3300005468 Bacteria 3389
182 Ga0070707_100096769 3300005468 Bacteria 2859
183 Ga0070707_100183426 3300005468 Unclassified 2040
184 Ga0070707_100288022 3300005468 Unclassified 1596
185 Ga0070707_100376656 3300005468 Bacteria 1379
186 Ga0070707_101186129 3300005468 Unclassified 730
187 Ga0070698_100019524 3300005471 Bacteria 7113
188 Ga0070698_100333310 3300005471 Bacteria 1448
189 Ga0070698_100341777 3300005471 Unclassified 1428
190 Ga0070698_100921865 3300005471 Unclassified 820
191 Ga0070699_100022015 3300005518 Bacteria 5490
192 Ga0070699_100047039 3300005518 Bacteria 3732
193 Ga0070699_100216745 3300005518 Bacteria 1705
194 Ga0070699_100420897 3300005518 Bacteria 1209
195 Ga0070699_100434220 3300005518 Bacteria 1190
196 Ga0070699_100831101 3300005518 Bacteria 845
197 Ga0070699_101724408 3300005518 Bacteria 574
198 Ga0070697_100001331 3300005536 Bacteria 18668
199 Ga0070697_100009941 3300005536 Bacteria 7422
200 Ga0070697_100017072 3300005536 Bacteria 5709
201 Ga0070697_100029828 3300005536 Unclassified 4377
202 Ga0070697_100045652 3300005536 Unclassified 3551
203 Ga0070697_100057459 3300005536 Bacteria 3165
204 Ga0070697_100059485 3300005536 Bacteria 3111
205 Ga0070697_100077262 3300005536 Bacteria 2738
206 Ga0070697_100088500 3300005536 Bacteria 2557
207 Ga0070697_100350898 3300005536 Unclassified 1274
208 Ga0070697_100456903 3300005536 Unclassified 1113
209 Ga0070697_100465301 3300005536 Unclassified 1103
210 Ga0070697_100994535 3300005536 Bacteria 745
211 Ga0070697_101072407 3300005536 Unclassified 717
212 Ga0070672_100004681 3300005543 Bacteria 8970
213 Ga0070672_100345602 3300005543 Unclassified 1267
214 Ga0070672_100950036 3300005543 Bacteria 761
215 Ga0070695_100080838 3300005545 Bacteria 2149
216 Ga0070696_100184588 3300005546 Unclassified 1549
217 Ga0070696_100287305 3300005546 Bacteria 1255
218 Ga0070693_100086081 3300005547 Bacteria 1885
219 Ga0070665_100085431 3300005548 Unclassified 3161
220 Ga0070665_100631098 3300005548 Unclassified 1084
221 Ga0070665_101002345 3300005548 Unclassified 847
222 Ga0070704_100223850 3300005549 Bacteria 1531
223 Ga0070704_100441156 3300005549 Bacteria 1119
224 Ga0068855_100161370 3300005563 Unclassified 2544
225 Ga0068855_100559227 3300005563 Bacteria 1237
226 Ga0070664_100182784 3300005564 Bacteria 1864
227 Ga0068864_100273730 3300005618 Bacteria 1574
228 Ga0068866_10316631 3300005718 Bacteria 980
229 Ga0068863_100665324 3300005841 Bacteria 1033
230 Ga0068858_100669252 3300005842 Bacteria 1009
231 Ga0068858_101330710 3300005842 Bacteria 707
232 Ga0068860_100080627 3300005843 Unclassified 3094
233 Ga0068860_100163408 3300005843 Bacteria 2148
234 Ga0068860_100342582 3300005843 Bacteria 1470
235 Ga0068862_100133256 3300005844 Bacteria 2200
236 Ga0081455_10221166 3300005937 Bacteria 1403
237 Ga0081539_10000061 3300005985 Bacteria 250890
238 Ga0081539_10000971 3300005985 Bacteria 53608
239 Ga0081539_10030103 3300005985 Bacteria 3377
240 Ga0081539_10124345 3300005985 Bacteria 1276
241 Ga0070717_10000793 3300006028 Bacteria 20762
242 Ga0070717_10010827 3300006028 Bacteria 6902
243 Ga0070717_10290963 3300006028 Bacteria 1450
244 Ga0070717_10290964 3300006028 Bacteria 1450
245 Ga0070717_10453366 3300006028 Bacteria 1156
246 Ga0070717_10851515 3300006028 Bacteria 830
247 Ga0070715_10204647 3300006163 Bacteria 1005
248 Ga0070715_10339272 3300006163 Unclassified 817
249 Ga0070715_10485118 3300006163 Bacteria 704
250 Ga0070716_100249271 3300006173 Bacteria 1209
251 Ga0070716_100290516 3300006173 Unclassified 1132
252 Ga0070716_100351951 3300006173 Unclassified 1043
253 Ga0070716_100393171 3300006173 Bacteria 995
254 Ga0070716_100618626 3300006173 Bacteria 817
255 Ga0070716_101248760 3300006173 Unclassified 598
256 Ga0070712_100007081 3300006175 Bacteria 6994
257 Ga0070712_100011407 3300006175 Bacteria 5633
258 Ga0070712_100067270 3300006175 Bacteria 2549
259 Ga0070712_100287614 3300006175 Bacteria 1326
260 Ga0070712_100342360 3300006175 Bacteria 1221
261 Ga0070712_100550074 3300006175 Bacteria 972
262 Ga0070712_100802108 3300006175 Bacteria 808
263 Ga0070712_101088250 3300006175 Bacteria 693
264 Ga0070712_101713405 3300006175 Bacteria 550
265 Ga0097621_100005822 3300006237 Bacteria 8704
266 Ga0097621_100082048 3300006237 Bacteria 2684
267 Ga0097621_100260443 3300006237 Bacteria 1521
268 Ga0097621_100595333 3300006237 Bacteria 1010
269 Ga0097621_101869172 3300006237 Bacteria 573
270 Ga0075370_10859779 3300006353 Bacteria 554
271 Ga0068871_100009985 3300006358 Bacteria 6899
272 Ga0068871_100022789 3300006358 Bacteria 4833
273 Ga0068871_100031335 3300006358 Bacteria 4193
274 Ga0068871_100061238 3300006358 Bacteria 3073
275 Ga0068871_100513008 3300006358 Bacteria 1082
276 Ga0075431_100580607 3300006847 Bacteria 1106
277 Ga0075431_102201433 3300006847 Unclassified 506
278 Ga0075433_10929573 3300006852 Unclassified 758
279 Ga0075434_100452700 3300006871 Bacteria 1305
280 Ga0075429_100971690 3300006880 Bacteria 743
281 Ga0068865_100142510 3300006881 Bacteria 1808
282 Ga0068865_100256758 3300006881 Bacteria 1382
283 Ga0068865_100445953 3300006881 Unclassified 1069
284 Ga0075436_100061108 3300006914 Bacteria 2603
285 Ga0075435_101420555 3300007076 Bacteria 608
286 Ga0105240_10268833 3300009093 Unclassified 1964
287 Ga0111539_10184244 3300009094 Bacteria 2438
288 Ga0105245_10011372 3300009098 Bacteria 7751
289 Ga0105245_10281277 3300009098 Bacteria 1626
290 Ga0105245_10418547 3300009098 Bacteria 1343
291 Ga0105245_10426254 3300009098 Bacteria 1330
292 Ga0105245_12094761 3300009098 Unclassified 619
293 Ga0105245_13047337 3300009098 Bacteria 519
294 Ga0114129_10098289 3300009147 Unclassified 4051
295 Ga0105243_10361812 3300009148 Bacteria 1336
296 Ga0105241_11846914 3300009174 Bacteria 591
297 Ga0105242_10295843 3300009176 Bacteria 1476
298 Ga0105248_12270943 3300009177 Bacteria 618
299 Ga0105237_10003109 3300009545 Bacteria 19993
300 Ga0105237_10346798 3300009545 Unclassified 1489
301 Ga0105249_10021221 3300009553 Bacteria 5815
302 Ga0105249_10712780 3300009553 Unclassified 1064
303 Ga0099796_10339526 3300010159 Bacteria 645
304 Ga0105239_10784053 3300010375 Unclassified 1092
305 Ga0105239_11640665 3300010375 Unclassified 744
306 Ga0105239_12603863 3300010375 Bacteria 590
307 Ga0157326_1036533 3300012513 Unclassified 673
308 Ga0157373_10594382 3300013100 Bacteria 805
309 Ga0157371_10364938 3300013102 Bacteria 1053
310 Ga0157374_10000068 3300013296 Bacteria 106195
311 Ga0157374_10029411 3300013296 Bacteria 4975
312 Ga0157374_10040211 3300013296 Unclassified 4305
313 Ga0157374_10055924 3300013296 Bacteria 3683
314 Ga0157374_10206760 3300013296 Unclassified 1924
315 Ga0157374_10784036 3300013296 Bacteria 969
316 Ga0157374_10869535 3300013296 Bacteria 919
317 Ga0157374_12490023 3300013296 Unclassified 545
318 Ga0157378_10025408 3300013297 Bacteria 5216
319 Ga0157378_10027846 3300013297 Bacteria 4984
320 Ga0157378_10043795 3300013297 Bacteria 3973
321 Ga0157378_10052208 3300013297 Unclassified 3638
322 Ga0157378_10094089 3300013297 Unclassified 2729
323 Ga0157378_10191086 3300013297 Bacteria 1931
324 Ga0157378_10262444 3300013297 Bacteria 1658
325 Ga0157378_10354152 3300013297 Bacteria 1435
326 Ga0157378_10426915 3300013297 Bacteria 1311
327 Ga0157378_10835272 3300013297 Unclassified 949
328 Ga0157378_10970901 3300013297 Bacteria 883
329 Ga0157378_11333005 3300013297 Unclassified 759
330 Ga0157378_11648334 3300013297 Unclassified 688
331 Ga0157378_12227312 3300013297 Archaea 599
332 Ga0157378_12556262 3300013297 Bacteria 563
333 Ga0163162_10015504 3300013306 Bacteria 7448
334 Ga0163162_10050676 3300013306 Unclassified 4163
335 Ga0163162_10054224 3300013306 Unclassified 4032
336 Ga0163162_10083884 3300013306 Bacteria 3261
337 Ga0163162_10086927 3300013306 Bacteria 3204
338 Ga0163162_10125953 3300013306 Bacteria 2668
339 Ga0163162_10275066 3300013306 Bacteria 1816
340 Ga0163162_10996557 3300013306 Unclassified 947
341 Ga0157372_10027573 3300013307 Bacteria 6189
342 Ga0157372_10063655 3300013307 Unclassified 4136
343 Ga0157372_10113959 3300013307 Bacteria 3099
344 Ga0157372_10377527 3300013307 Unclassified 1652
345 Ga0157372_10543656 3300013307 Bacteria 1354
346 Ga0157372_11018055 3300013307 Bacteria 959
347 Ga0157375_10006218 3300013308 Bacteria 10399
348 Ga0157375_10007176 3300013308 Bacteria 9738
349 Ga0157375_10777261 3300013308 Bacteria 1107
350 Ga0157375_12100738 3300013308 Bacteria 672
351 Ga0157375_12757746 3300013308 Unclassified 587
352 Ga0163163_10089916 3300014325 Unclassified 3083
353 Ga0163163_10589669 3300014325 Bacteria 1175
354 Ga0157379_10118681 3300014968 Bacteria 2379
355 Ga0157379_10359982 3300014968 Archaea 1333
356 Ga0157379_10643462 3300014968 Bacteria 992
357 Ga0157376_10010878 3300014969 Bacteria 6681
358 Ga0157376_10060696 3300014969 Bacteria 3176
359 Ga0157376_10229106 3300014969 Bacteria 1725
360 Ga0157376_10257366 3300014969 Bacteria 1633
361 Ga0157376_10351200 3300014969 Unclassified 1411
362 Ga0157376_10672494 3300014969 Unclassified 1038
363 Ga0157376_11442162 3300014969 Bacteria 721
364 Ga0163161_10008436 3300017792 Bacteria 7134
365 Ga0163161_10069036 3300017792 Bacteria 2583
366 Ga0163161_10858962 3300017792 Unclassified 766
367 Ga0206351_10539719 3300020077 Bacteria 965
368 Ga0206351_10792315 3300020077 Bacteria 835
369 Ga0206350_10137531 3300020080 Unclassified 808
370 Ga0154015_1647084 3300020610 Unclassified 1150
371 Ga0213872_10070266 3300021361 Bacteria 1579
372 Ga0213872_10091008 3300021361 Bacteria 1365
373 Ga0213872_10106613 3300021361 Unclassified 1247
374 Ga0213874_10206192 3300021377 Unclassified 709
375 Ga0213876_10001439 3300021384 Bacteria 14812
376 Ga0213876_10525509 3300021384 Unclassified 630
377 Ga0213875_10133793 3300021388 Bacteria 1159
378 Ga0213871_10005016 3300021441 Bacteria 2700
379 Ga0224712_10252954 3300022467 Bacteria 814
380 Ga0207673_1013859 3300025290 Bacteria 1060
381 Ga0207673_1020936 3300025290 Unclassified 884
382 Ga0207697_10000118 3300025315 Bacteria 37510
383 Ga0207697_10000734 3300025315 Bacteria 18602
384 Ga0207697_10000986 3300025315 Bacteria 15919
385 Ga0207697_10003844 3300025315 Bacteria 7325
386 Ga0207697_10087118 3300025315 Bacteria 1321
387 Ga0207653_10110549 3300025885 Bacteria 980
388 Ga0207682_10082233 3300025893 Bacteria 1382
389 Ga0207692_10207624 3300025898 Bacteria 1155
390 Ga0207692_10458511 3300025898 Bacteria 803
391 Ga0207692_10518236 3300025898 Bacteria 758
392 Ga0207692_10931846 3300025898 Bacteria 572
393 Ga0207642_10154459 3300025899 Bacteria 1226
394 Ga0207642_10249355 3300025899 Bacteria 1007
395 Ga0207688_10000809 3300025901 Bacteria 15639
396 Ga0207688_10005559 3300025901 Bacteria 6854
397 Ga0207688_10047402 3300025901 Unclassified 2400
398 Ga0207680_10006421 3300025903 Bacteria 5687
399 Ga0207680_10188942 3300025903 Unclassified 1397
400 Ga0207680_10271437 3300025903 Unclassified 1176
401 Ga0207680_10307966 3300025903 Bacteria 1105
402 Ga0207685_10004631 3300025905 Bacteria 3528
403 Ga0207699_10239725 3300025906 Bacteria 1245
404 Ga0207699_10406395 3300025906 Bacteria 970
405 Ga0207699_10431900 3300025906 Bacteria 942
406 Ga0207645_10002605 3300025907 Bacteria 14065
407 Ga0207645_10003810 3300025907 Bacteria 11307
408 Ga0207645_10006174 3300025907 Bacteria 8603
409 Ga0207645_10008430 3300025907 Bacteria 7190
410 Ga0207645_10207312 3300025907 Unclassified 1290
411 Ga0207645_10251424 3300025907 Unclassified 1169
412 Ga0207684_10000512 3300025910 Bacteria 48238
413 Ga0207684_10014154 3300025910 Bacteria 6885
414 Ga0207684_10033430 3300025910 Bacteria 4373
415 Ga0207684_10034454 3300025910 Bacteria 4302
416 Ga0207684_10061461 3300025910 Bacteria 3190
417 Ga0207684_10112733 3300025910 Bacteria 2328
418 Ga0207684_10167899 3300025910 Bacteria 1891
419 Ga0207684_10268927 3300025910 Unclassified 1471
420 Ga0207684_10348086 3300025910 Unclassified 1276
421 Ga0207684_10349412 3300025910 Bacteria 1273
422 Ga0207684_11180421 3300025910 Unclassified 634
423 Ga0207671_10002384 3300025914 Bacteria 20174
424 Ga0207693_10002803 3300025915 Bacteria 15109
425 Ga0207693_10006881 3300025915 Bacteria 9393
426 Ga0207693_10017486 3300025915 Bacteria 5719
427 Ga0207693_10084846 3300025915 Bacteria 2481
428 Ga0207693_10097798 3300025915 Bacteria 2302
429 Ga0207693_10176704 3300025915 Bacteria 1680
430 Ga0207693_10653095 3300025915 Bacteria 817
431 Ga0207693_10817970 3300025915 Bacteria 717
432 Ga0207693_11159811 3300025915 Bacteria 584
433 Ga0207693_11240295 3300025915 Bacteria 560
434 Ga0207663_10017481 3300025916 Unclassified 3997
435 Ga0207663_10035680 3300025916 Bacteria 2986
436 Ga0207663_10148145 3300025916 Bacteria 1643
437 Ga0207663_10216530 3300025916 Bacteria 1391
438 Ga0207662_10000945 3300025918 Bacteria 13482
439 Ga0207662_10047773 3300025918 Bacteria 2535
440 Ga0207657_10365876 3300025919 Bacteria 1136
441 Ga0207649_10125785 3300025920 Bacteria 1735
442 Ga0207649_10154040 3300025920 Unclassified 1586
443 Ga0207646_10000867 3300025922 Bacteria 39113
444 Ga0207646_10000886 3300025922 Bacteria 38660
445 Ga0207646_10001911 3300025922 Bacteria 25095
446 Ga0207646_10002892 3300025922 Bacteria 19929
447 Ga0207646_10034742 3300025922 Bacteria 4557
448 Ga0207646_10060147 3300025922 Unclassified 3393
449 Ga0207646_10085087 3300025922 Unclassified 2829
450 Ga0207646_10118378 3300025922 Bacteria 2380
451 Ga0207646_10123706 3300025922 Bacteria 2325
452 Ga0207646_10176920 3300025922 Unclassified 1927
453 Ga0207646_10291201 3300025922 Unclassified 1475
454 Ga0207646_10718114 3300025922 Unclassified 893
455 Ga0207681_10016600 3300025923 Bacteria 4609
456 Ga0207681_10050164 3300025923 Bacteria 2823
457 Ga0207681_10079647 3300025923 Bacteria 2308
458 Ga0207681_10155234 3300025923 Bacteria 1719
459 Ga0207681_10374400 3300025923 Bacteria 1145
460 Ga0207681_10466598 3300025923 Bacteria 1029
461 Ga0207681_11375964 3300025923 Bacteria 592
462 Ga0207650_10017752 3300025925 Bacteria 4984
463 Ga0207650_10154679 3300025925 Bacteria 1813
464 Ga0207650_10166811 3300025925 Bacteria 1748
465 Ga0207650_10264960 3300025925 Bacteria 1395
466 Ga0207659_10028327 3300025926 Bacteria 3805
467 Ga0207659_10070328 3300025926 Unclassified 2552
468 Ga0207659_10371772 3300025926 Unclassified 1190
469 Ga0207659_10581183 3300025926 Unclassified 954
470 Ga0207659_10616471 3300025926 Bacteria 926
471 Ga0207687_10284550 3300025927 Bacteria 1326
472 Ga0207687_10585467 3300025927 Unclassified 939
473 Ga0207700_10069860 3300025928 Bacteria 2697
474 Ga0207700_10240742 3300025928 Bacteria 1542
475 Ga0207700_10461422 3300025928 Bacteria 1121
476 Ga0207700_10604425 3300025928 Bacteria 976
477 Ga0207700_10715148 3300025928 Bacteria 894
478 Ga0207664_10024600 3300025929 Unclassified 4527
479 Ga0207664_10496140 3300025929 Bacteria 1093
480 Ga0207664_10571594 3300025929 Bacteria 1015
481 Ga0207664_10657039 3300025929 Bacteria 942
482 Ga0207664_11778334 3300025929 Unclassified 539
483 Ga0207644_10007138 3300025931 Bacteria 7279
484 Ga0207644_10027555 3300025931 Bacteria 3926
485 Ga0207644_10069801 3300025931 Unclassified 2566
486 Ga0207644_10248883 3300025931 Unclassified 1417
487 Ga0207644_10598501 3300025931 Bacteria 915
488 Ga0207644_10917940 3300025931 Bacteria 734
489 Ga0207690_10082845 3300025932 Bacteria 2244
490 Ga0207706_10006839 3300025933 Bacteria 10539
491 Ga0207706_10061535 3300025933 Bacteria 3306
492 Ga0207706_10081605 3300025933 Bacteria 2841
493 Ga0207706_10324860 3300025933 Unclassified 1339
494 Ga0207686_11525856 3300025934 Unclassified 551
495 Ga0207670_10031452 3300025936 Bacteria 3401
496 Ga0207670_10052031 3300025936 Bacteria 2753
497 Ga0207670_10435773 3300025936 Bacteria 1054
498 Ga0207669_10005902 3300025937 Bacteria 5542
499 Ga0207669_10087161 3300025937 Bacteria 2021
500 Ga0207669_10501506 3300025937 Bacteria 971
501 Ga0207704_10045848 3300025938 Unclassified 2600
502 Ga0207665_10018571 3300025939 Bacteria 4567
503 Ga0207665_10023367 3300025939 Bacteria 4073
504 Ga0207665_10251758 3300025939 Unclassified 1305
505 Ga0207665_10474236 3300025939 Unclassified 963
506 Ga0207665_10491871 3300025939 Bacteria 946
507 Ga0207665_10928460 3300025939 Bacteria 691
508 Ga0207691_10000359 3300025940 Bacteria 46053
509 Ga0207691_10009486 3300025940 Bacteria 9347
510 Ga0207691_10012453 3300025940 Bacteria 8156
511 Ga0207691_10317650 3300025940 Bacteria 1336
512 Ga0207691_10446375 3300025940 Bacteria 1101
513 Ga0207689_10148811 3300025942 Bacteria 1930
514 Ga0207679_10679974 3300025945 Unclassified 933
515 Ga0207679_10976237 3300025945 Unclassified 776
516 Ga0207651_10038807 3300025960 Bacteria 3133
517 Ga0207651_10240895 3300025960 Bacteria 1474
518 Ga0207651_10455286 3300025960 Unclassified 1098
519 Ga0207651_10838701 3300025960 Unclassified 816
520 Ga0207712_10493412 3300025961 Bacteria 1046
521 Ga0207668_10008896 3300025972 Bacteria 6005
522 Ga0207668_10027804 3300025972 Bacteria 3688
523 Ga0207640_10404204 3300025981 Bacteria 1113
524 Ga0207658_10008876 3300025986 Bacteria 6822
525 Ga0207658_10063811 3300025986 Bacteria 2761
526 Ga0207658_10128896 3300025986 Bacteria 2029
527 Ga0207658_10481745 3300025986 Bacteria 1102
528 Ga0207658_10679299 3300025986 Unclassified 929
529 Ga0207658_11020472 3300025986 Bacteria 755
530 Ga0207677_10020424 3300026023 Unclassified 4022
531 Ga0207677_10096548 3300026023 Bacteria 2163
532 Ga0207677_10176597 3300026023 Unclassified 1676
533 Ga0207677_10699263 3300026023 Unclassified 899
534 Ga0207677_10837298 3300026023 Bacteria 826
535 Ga0207677_12141467 3300026023 Unclassified 520
536 Ga0207703_10106139 3300026035 Bacteria 2389
537 Ga0207703_11201859 3300026035 Bacteria 729
538 Ga0207678_10378439 3300026067 Unclassified 1224
539 Ga0207708_11940245 3300026075 Bacteria 516
540 Ga0207702_10184631 3300026078 Bacteria 1923
541 Ga0207641_10299412 3300026088 Bacteria 1519
542 Ga0207641_10783864 3300026088 Bacteria 942
543 Ga0207648_10018637 3300026089 Bacteria 6281
544 Ga0207648_10460703 3300026089 Bacteria 1159
545 Ga0207648_10652873 3300026089 Unclassified 972
546 Ga0207683_10012367 3300026121 Bacteria 7283
547 Ga0207683_10013698 3300026121 Bacteria 6913
548 Ga0207683_10032322 3300026121 Bacteria 4546
549 Ga0207683_10294756 3300026121 Bacteria 1484
550 Ga0207683_11307893 3300026121 Bacteria 671
551 Ga0268266_10057819 3300028379 Bacteria 3337
552 Ga0268266_11280071 3300028379 Unclassified 708
553 Ga0268265_10035776 3300028380 Unclassified 3632
554 Ga0268265_10575238 3300028380 Bacteria 1073
555 Ga0268264_10039849 3300028381 Unclassified 3881
556 Ga0268264_10109586 3300028381 Bacteria 2416
557 Ga0268264_10194804 3300028381 Unclassified 1850
558 Ga0268264_10428633 3300028381 Bacteria 1277
559 Ga0265337_1154477 3300028556 Bacteria 622
560 Ga0265326_10002998 3300028558 Bacteria 5614
561 Ga0265319_1001901 3300028563 Bacteria 11865
562 Ga0265319_1080046 3300028563 Bacteria 1038
563 Ga0265318_10000545 3300028577 Bacteria 26811
564 Ga0265336_10000001 3300028666 Bacteria 916179
565 Ga0265336_10123397 3300028666 Bacteria 771
566 Ga0265338_10000004 3300028800 Bacteria 644793
567 Ga0265338_10280505 3300028800 Bacteria 1218
568 Ga0265324_10004424 3300029957 Bacteria 6364
569 Ga0265320_10082256 3300031240 Bacteria 1502
570 Ga0265325_10109896 3300031241 Bacteria 1341
571 Ga0265340_10000002 3300031247 Bacteria 711693
572 Ga0265327_10002862 3300031251 Bacteria 17366
573 Ga0265316_10158722 3300031344 Bacteria 1691
574 Ga0307513_10180196 3300031456 Bacteria 1977
575 Ga0265314_10260968 3300031711 Bacteria 989
576 Ga0373926_0288722 3300035083 Unclassified 639
577 Ga0373944_0069141 3300035089 Bacteria 1147
578 Ga0373952_0115351 3300035092 Bacteria 723
579 Ga0373932_0036941 3300035112 Bacteria 1390
580 Ga0373936_0141022 3300035113 Bacteria 1041
581 Ga0373945_0042416 3300035116 Bacteria 1649
582 Ga0373945_0259138 3300035116 Bacteria 736
583 Ga0373957_0101746 3300035120 Bacteria 1151
584 Ga0373960_0408785 3300035121 Bacteria 525
585 Ga0373943_0034253 3300035170 Bacteria 2422
586 Ga0373943_0083297 3300035170 Bacteria 1644
587 Ga0373943_0117825 3300035170 Bacteria 1408
588 Ga0373943_0453708 3300035170 Bacteria 745
589 Ga0373943_0983394 3300035170 Bacteria 506
590 Ga0373946_0026488 3300035171 Bacteria 2288
591 Ga0373946_0091862 3300035171 Unclassified 1346
592 Ga0373946_0094100 3300035171 Unclassified 1333
593 Ga0373946_0155725 3300035171 Bacteria 1069
594 Ga0373946_0231915 3300035171 Bacteria 895
595 Ga0373942_0083786 3300035207 Bacteria 951
596 Ga0373962_0064213 3300035242 Bacteria 1085
597 Ga0373924_0026918 3300035410 Bacteria 2284
598 Ga0373931_0159019 3300035691 Bacteria 1323
599 Ga0373935_0011921 3300035692 Bacteria 5223
600 Ga0373935_0036113 3300035692 Bacteria 3088
601 Ga0373935_0395080 3300035692 Bacteria 992
602 Ga0373927_0172607 3300035695 Bacteria 1417
603 Ga0373927_0226595 3300035695 Unclassified 1228
604 Ga0373933_0046231 3300035724 Bacteria 2584
605 Ga0373933_0326097 3300035724 Bacteria 996
606 Ga0373947_0209072 3300035725 Bacteria 1279
607 Ga0373947_0260135 3300035725 Bacteria 1150
608 Ga0373947_0280241 3300035725 Unclassified 1108
609 Ga0373947_0284911 3300035725 Bacteria 1099
610 Ga0373947_0666333 3300035725 Unclassified 710
611 Ga0373947_0850368 3300035725 Bacteria 623
612 Ga0373937_0464194 3300036401 Bacteria 1202
613 Ga0373925_0169652 3300037068 Bacteria 1722
614 Ga0373925_0287180 3300037068 Bacteria 1326
615 Ga0373925_0389321 3300037068 Unclassified 1136
616 Ga0373925_1123116 3300037068 Bacteria 646
617 Ga0373925_1571073 3300037068 Bacteria 538
618 Ga0395900_0003547 3300037418 Bacteria 16788
619 Ga0395900_0057428 3300037418 Unclassified 4007
620 Ga0395898_0358826 3300037466 Unclassified 1390
621 Ga0436364_0630572 3300037853 Bacteria 1689
622 Ga0395901_0410491 3300038443 Bacteria 1390
623 Ga0395901_0445695 3300038443 Unclassified 1325
624 Ga0436365_0539406 3300039437 Bacteria 56073
625 Ga0436365_0612721 3300039437 Unclassified 713
626 Ga0436360_0157154 3300039438 Unclassified 1315
627 Ga0436360_0491936 3300039438 Bacteria 3921
628 Ga0436360_0976560 3300039438 Bacteria 689
629 Ga0436360_0980270 3300039438 Bacteria 2171
630 Ga0436360_1363807 3300039438 Bacteria 1867
631 Ga0436361_0018337 3300039447 Unclassified 2172
632 Ga0436361_0062883 3300039447 Bacteria 5709
633 Ga0436361_0291564 3300039447 Bacteria 599
634 Ga0436361_0343340 3300039447 Bacteria 2513
635 Ga0436361_0730313 3300039447 Bacteria 1942
636 Ga0436363_0323230 3300039450 Unclassified 709
637 Ga0436362_0569913 3300039453 Bacteria 1678
638 Ga0436362_0812337 3300039453 Bacteria 542
639 Ga0436362_1128445 3300039453 Bacteria 820
640 Ga0451807_0006777 3300041486 Bacteria 873
641 Ga0451839_1491154 3300041496 Bacteria 531
642 Ga0451847_0204786 3300041503 Unclassified 680
643 Ga0439454_026515 3300042011 Bacteria 886
644 Ga0439460_0276531 3300042461 Bacteria 584
645 Ga0451577_0327625 3300042876 Bacteria 1389
646 Ga0453683_1061957 3300044673 Bacteria 539
647 Ga0466970_0914566 3300044765 Bacteria 516
648 Ga0451576_0055316 3300045051 Unclassified 4152
649 Ga0466967_0403167 3300045976 Bacteria 1331
650 Ga0495592_0385448 3300046454 Unclassified 891
651 Ga0495592_0389030 3300046454 Unclassified 886
652 Ga0495641_0063502 3300046461 Bacteria 1664
653 Ga0495653_0746304 3300046463 Bacteria 592
654 Ga0495580_0149757 3300046472 Bacteria 1617
655 Ga0495580_1042377 3300046472 Bacteria 520
656 Ga0495582_0341799 3300046473 Bacteria 862
657 Ga0495584_0224426 3300046491 Unclassified 955
658 Ga0495618_0000046 3300046514 Bacteria 93942
659 Ga0495628_0060024 3300046516 Bacteria 2985
660 Ga0495630_0067865 3300046517 Bacteria 2681
661 Ga0495631_0084372 3300046518 Bacteria 1369
662 Ga0495666_0352287 3300046526 Unclassified 663
663 Ga0495642_0062660 3300046528 Bacteria 1545
664 Ga0495665_0188039 3300046531 Bacteria 1072
665 Ga0495640_0735045 3300046533 Bacteria 591
666 Ga0495598_0022524 3300046537 Bacteria 1687
667 Ga0495598_0308012 3300046537 Unclassified 601
668 Ga0495621_0187951 3300046539 Unclassified 827
669 Ga0495633_0218432 3300046558 Bacteria 873
670 Ga0495656_0150027 3300046615 Unclassified 1125
671 Ga0495668_0833707 3300046616 Unclassified 511
672 Ga0495634_0619317 3300046642 Bacteria 627
673 Ga0495635_0192153 3300046663 Bacteria 1386
674 Ga0495659_0137339 3300046664 Unclassified 973
675 Ga0495659_0503685 3300046664 Bacteria 531
676 Ga0495588_0047045 3300046674 Bacteria 2214
677 Ga0495599_0304051 3300046678 Bacteria 962
678 Ga0495647_0021635 3300046681 Bacteria 2317
679 Ga0495658_0027939 3300046683 Bacteria 3041
680 Ga0495669_0002765 3300046684 Bacteria 7197
681 Ga0495669_0156673 3300046684 Unclassified 1080
682 Ga0495613_0099670 3300046689 Bacteria 2099
683 Ga0495624_0409976 3300046690 Bacteria 813
684 Ga0495589_0199558 3300046794 Unclassified 945
685 Ga0495581_0657122 3300047315 Unclassified 606
686 Ga0495676_0109852 3300047321 Bacteria 2025
687 Ga0495680_0823204 3300047322 Bacteria 605
688 Ga0495680_1032619 3300047322 Bacteria 523
689 Ga0495675_0430537 3300047444 Bacteria 765
690 Ga0495684_0004277 3300047471 Bacteria 11140
691 Ga0495614_0647288 3300048089 Bacteria 509
692 Ga0496100_0012467 3300048903 Bacteria 4875
693 Ga0496100_0309917 3300048903 Unclassified 1183
694 Ga0496100_0983501 3300048903 Bacteria 664
695 Ga0496101_0094852 3300048904 Bacteria 2225
696 Ga0496101_0182486 3300048904 Bacteria 1616
697 Ga0496101_1051513 3300048904 Bacteria 640
698 Ga0496102_0033083 3300048905 Unclassified 4645
699 Ga0496103_0040065 3300048906 Bacteria 2879
700 Ga0496103_0618174 3300048906 Bacteria 690
701 Ga0496104_0127527 3300048907 Bacteria 2443
702 Ga0496104_0178570 3300048907 Bacteria 2033
703 Ga0496104_0245678 3300048907 Bacteria 1702
704 Ga0496105_0195273 3300048908 Bacteria 1654
705 Ga0496106_0091747 3300048909 Bacteria 2345
706 Ga0496106_0893711 3300048909 Bacteria 702
707 Ga0496107_0164224 3300048910 Bacteria 1646
708 Ga0496107_0745762 3300048910 Bacteria 719
709 Ga0496108_0198354 3300048911 Bacteria 1741
710 Ga0496108_0384407 3300048911 Unclassified 1226
711 Ga0496108_0384710 3300048911 Bacteria 1225
712 Ga0496108_0933165 3300048911 Unclassified 744
713 Ga0496108_1275031 3300048911 Unclassified 619
714 Ga0496109_0036809 3300048912 Bacteria 4419
715 Ga0496109_0112051 3300048912 Bacteria 2537
716 Ga0496109_0488656 3300048912 Unclassified 1162
717 Ga0496109_0552898 3300048912 Unclassified 1086
718 Ga0496110_0121994 3300048913 Unclassified 2349
719 Ga0496110_0695532 3300048913 Unclassified 918
720 Ga0496110_0945213 3300048913 Bacteria 769
721 Ga0496112_0006431 3300048915 Bacteria 10314
722 Ga0496112_0056570 3300048915 Bacteria 3860
723 Ga0496112_0099578 3300048915 Bacteria 2876
724 Ga0496112_0126861 3300048915 Bacteria 2522
725 Ga0496112_0235761 3300048915 Bacteria 1783
726 Ga0496112_0326252 3300048915 Bacteria 1479
727 Ga0496113_0262774 3300048916 Bacteria 1379
728 Ga0496113_0327648 3300048916 Bacteria 1228
729 Ga0496113_0844117 3300048916 Unclassified 726
730 Ga0496114_0010794 3300048917 Bacteria 7271
731 Ga0496114_0320613 3300048917 Bacteria 1369
732 Ga0496115_0000059 3300048918 Bacteria 102022
733 Ga0496115_0000087 3300048918 Bacteria 86513
734 Ga0496115_0001268 3300048918 Bacteria 18088
735 Ga0496115_0071714 3300048918 Bacteria 2809
736 nmdc:mga05p37_225729_c1 3300050507 Bacteria 2258
737 nmdc:mga09592_846550_c1 3300050508 Unclassified 771
738 nmdc:mga06r32_1355312_c1 3300050510 Unclassified 654
739 nmdc:mga0n895_1824332_c1 3300050512 Bacteria 568
740 nmdc:mga0rr50_251146_c1 3300050513 Unclassified 1469
741 nmdc:mga08x19_25054_c1 3300050514 Bacteria 2384
742 nmdc:mga08x19_742534_c1 3300050514 Bacteria 697
743 nmdc:mga0a205_332786_c1 3300050515 Unclassified 1388
744 nmdc:mga0a205_619889_c1 3300050515 Bacteria 934
745 Ga0495619_0053326 3300053085 Bacteria 2675
746 Ga0495619_0429495 3300053085 Bacteria 911

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006175 Ga0070712_100342360 Ga0070712_1003423602 98
2 3300025915 Ga0207693_10097798 Ga0207693_100977982 98
3 3300013307 Ga0157372_11018055 Ga0157372_110180552 104
4 3300031456 Ga0307513_10180196 Ga0307513_101801961 109
5 3300013297 Ga0157378_12227312 Ga0157378_122273122 114
6 3300041503 Ga0451847_0204786 Ga0451847_0204786_11_391 114
7 3300005336 Ga0070680_100795732 Ga0070680_1007957322 115
8 3300005435 Ga0070714_100305203 Ga0070714_1003052033 115
9 3300005436 Ga0070713_100307993 Ga0070713_1003079932 115
10 3300005437 Ga0070710_10541690 Ga0070710_105416902 115
11 3300005437 Ga0070710_10558249 Ga0070710_105582492 115
12 3300005439 Ga0070711_100026223 Ga0070711_1000262232 115
13 3300005439 Ga0070711_100336495 Ga0070711_1003364952 115
14 3300005468 Ga0070707_100376656 Ga0070707_1003766562 115
15 3300006028 Ga0070717_10851515 Ga0070717_108515152 115
16 3300006175 Ga0070712_100067270 Ga0070712_1000672704 115
17 3300006175 Ga0070712_100802108 Ga0070712_1008021082 115
18 3300006353 Ga0075370_10859779 Ga0075370_108597792 115
19 3300006881 Ga0068865_100256758 Ga0068865_1002567581 115
20 3300009098 Ga0105245_13047337 Ga0105245_130473371 115
21 3300009545 Ga0105237_10003109 Ga0105237_1000310917 115
22 3300013296 Ga0157374_10869535 Ga0157374_108695352 115
23 3300025898 Ga0207692_10931846 Ga0207692_109318461 115
24 3300025914 Ga0207671_10002384 Ga0207671_100023844 115
25 3300025915 Ga0207693_10017486 Ga0207693_100174864 115
26 3300025915 Ga0207693_10653095 Ga0207693_106530952 115
27 3300025916 Ga0207663_10035680 Ga0207663_100356802 115
28 3300025928 Ga0207700_10240742 Ga0207700_102407422 115
29 3300025928 Ga0207700_10604425 Ga0207700_106044251 115
30 3300025929 Ga0207664_10657039 Ga0207664_106570392 115
31 3300025939 Ga0207665_10023367 Ga0207665_100233674 115
32 3300028556 Ga0265337_1154477 Ga0265337_11544771 115
33 3300028558 Ga0265326_10002998 Ga0265326_100029987 115
34 3300028563 Ga0265319_1001901 Ga0265319_10019017 115
35 3300028563 Ga0265319_1080046 Ga0265319_10800462 115
36 3300028577 Ga0265318_10000545 Ga0265318_1000054512 115
37 3300028666 Ga0265336_10000001 Ga0265336_10000001295 115
38 3300028666 Ga0265336_10123397 Ga0265336_101233972 115
39 3300028800 Ga0265338_10000004 Ga0265338_10000004586 115
40 3300028800 Ga0265338_10280505 Ga0265338_102805052 115
41 3300029957 Ga0265324_10004424 Ga0265324_100044247 115
42 3300031240 Ga0265320_10082256 Ga0265320_100822562 115
43 3300031241 Ga0265325_10109896 Ga0265325_101098963 115
44 3300031247 Ga0265340_10000002 Ga0265340_10000002586 115
45 3300031251 Ga0265327_10002862 Ga0265327_100028625 115
46 3300031344 Ga0265316_10158722 Ga0265316_101587222 115
47 3300031711 Ga0265314_10260968 Ga0265314_102609682 115
48 3300035170 Ga0373943_0983394 Ga0373943_0983394_113_469 115
49 3300035692 Ga0373935_0395080 Ga0373935_0395080_348_704 115
50 3300037068 Ga0373925_1571073 Ga0373925_1571073_22_378 115
51 3300039447 Ga0436361_0291564 Ga0436361_0291564_95_451 115
52 3300039453 Ga0436362_0812337 Ga0436362_0812337_160_516 115
53 3300039453 Ga0436362_1128445 Ga0436362_1128445_35_391 115
54 3300041496 Ga0451839_1491154 Ga0451839_1491154_142_498 115
55 3300042876 Ga0451577_0327625 Ga0451577_0327625_933_1307 115
56 3300044673 Ga0453683_1061957 Ga0453683_1061957_51_425 115
57 3300044765 Ga0466970_0914566 Ga0466970_0914566_127_483 115
58 3300046461 Ga0495641_0063502 Ga0495641_0063502_1031_1387 115
59 3300046463 Ga0495653_0746304 Ga0495653_0746304_205_561 115
60 3300046514 Ga0495618_0000046 Ga0495618_0000046_45342_45698 115
61 3300046531 Ga0495665_0188039 Ga0495665_0188039_461_817 115
62 3300046674 Ga0495588_0047045 Ga0495588_0047045_1590_1946 115
63 3300046681 Ga0495647_0021635 Ga0495647_0021635_730_1086 115
64 3300046690 Ga0495624_0409976 Ga0495624_0409976_21_377 115
65 3300047321 Ga0495676_0109852 Ga0495676_0109852_870_1226 115
66 3300047322 Ga0495680_0823204 Ga0495680_0823204_211_567 115
67 3300047471 Ga0495684_0004277 Ga0495684_0004277_2893_3249 115
68 3300048089 Ga0495614_0647288 Ga0495614_0647288_56_412 115
69 3300048903 Ga0496100_0012467 Ga0496100_0012467_3178_3534 115
70 3300048906 Ga0496103_0618174 Ga0496103_0618174_84_440 115
71 3300048918 Ga0496115_0000059 Ga0496115_0000059_75432_75788 115
72 3300048918 Ga0496115_0000087 Ga0496115_0000087_20579_20935 115
73 3300053085 Ga0495619_0429495 Ga0495619_0429495_273_629 115
74 3300006847 Ga0075431_100580607 Ga0075431_1005806072 116
75 3300009098 Ga0105245_10418547 Ga0105245_104185472 116
76 3300013297 Ga0157378_11333005 Ga0157378_113330052 116
77 3300026023 Ga0207677_10837298 Ga0207677_108372982 116
78 3300005340 Ga0070689_100052879 Ga0070689_1000528793 122
79 3300005355 Ga0070671_100640545 Ga0070671_1006405452 122
80 3300005406 Ga0070703_10559805 Ga0070703_105598051 122
81 3300005435 Ga0070714_100440101 Ga0070714_1004401013 122
82 3300005445 Ga0070708_100170012 Ga0070708_1001700123 122
83 3300005467 Ga0070706_100439735 Ga0070706_1004397352 122
84 3300005468 Ga0070707_100069579 Ga0070707_1000695793 122
85 3300005471 Ga0070698_100019524 Ga0070698_1000195245 122
86 3300005518 Ga0070699_100022015 Ga0070699_1000220155 122
87 3300005536 Ga0070697_100009941 Ga0070697_1000099417 122
88 3300006028 Ga0070717_10453366 Ga0070717_104533662 122
89 3300014968 Ga0157379_10118681 Ga0157379_101186811 122
90 3300014969 Ga0157376_11442162 Ga0157376_114421621 122
91 3300025885 Ga0207653_10110549 Ga0207653_101105492 122
92 3300025922 Ga0207646_10085087 Ga0207646_100850872 122
93 3300025936 Ga0207670_10052031 Ga0207670_100520313 122
94 3300035171 Ga0373946_0091862 Ga0373946_0091862_890_1258 122
95 3300035725 Ga0373947_0280241 Ga0373947_0280241_179_547 122
96 3300046526 Ga0495666_0352287 Ga0495666_0352287_118_486 122
97 2162886012 MBSR1b_contig_10906538 MBSR1b_0751.00003870 123
98 3300000531 CNBas_1013603 CNBas_10136032 123
99 3300000545 CNXas_1000075 CNXas_100007515 123
100 3300001977 JGI24746J21847_1018653 JGI24746J21847_10186531 123
101 3300001989 JGI24739J22299_10233805 JGI24739J22299_102338051 123
102 3300001991 JGI24743J22301_10058062 JGI24743J22301_100580622 123
103 3300002070 JGI24750J21931_1037984 JGI24750J21931_10379842 123
104 3300003203 JGI25406J46586_10088582 JGI25406J46586_100885822 123
105 3300003203 JGI25406J46586_10110274 JGI25406J46586_101102741 123
106 3300003316 rootH1_10150751 rootH1_101507513 123
107 3300003322 rootL2_10317932 rootL2_103179323 123
108 3300005272 Ga0065703_1023045 Ga0065703_10230451 123
109 3300005289 Ga0065704_10016990 Ga0065704_100169903 123
110 3300005290 Ga0065712_10011282 Ga0065712_100112823 123
111 3300005290 Ga0065712_10025123 Ga0065712_100251232 123
112 3300005290 Ga0065712_10143914 Ga0065712_101439142 123
113 3300005290 Ga0065712_10175923 Ga0065712_101759233 123
114 3300005290 Ga0065712_10565745 Ga0065712_105657451 123
115 3300005293 Ga0065715_10010884 Ga0065715_100108843 123
116 3300005293 Ga0065715_10345151 Ga0065715_103451511 123
117 3300005293 Ga0065715_10365534 Ga0065715_103655341 123
118 3300005293 Ga0065715_10405355 Ga0065715_104053552 123
119 3300005293 Ga0065715_10759095 Ga0065715_107590951 123
120 3300005295 Ga0065707_10006945 Ga0065707_100069454 123
121 3300005295 Ga0065707_10197376 Ga0065707_101973762 123
122 3300005327 Ga0070658_10111100 Ga0070658_101111002 123
123 3300005328 Ga0070676_10010812 Ga0070676_100108123 123
124 3300005328 Ga0070676_10286500 Ga0070676_102865001 123
125 3300005328 Ga0070676_10518752 Ga0070676_105187522 123
126 3300005328 Ga0070676_10681742 Ga0070676_106817422 123
127 3300005330 Ga0070690_100078353 Ga0070690_1000783533 123
128 3300005330 Ga0070690_100128856 Ga0070690_1001288563 123
129 3300005330 Ga0070690_100883550 Ga0070690_1008835501 123
130 3300005331 Ga0070670_100004474 Ga0070670_1000044745 123
131 3300005331 Ga0070670_100005662 Ga0070670_1000056623 123
132 3300005331 Ga0070670_100110578 Ga0070670_1001105783 123
133 3300005331 Ga0070670_100136614 Ga0070670_1001366142 123
134 3300005331 Ga0070670_100298824 Ga0070670_1002988241 123
135 3300005331 Ga0070670_100933561 Ga0070670_1009335612 123
136 3300005333 Ga0070677_10020745 Ga0070677_100207453 123
137 3300005333 Ga0070677_10380217 Ga0070677_103802171 123
138 3300005334 Ga0068869_100168634 Ga0068869_1001686343 123
139 3300005334 Ga0068869_100268514 Ga0068869_1002685143 123
140 3300005334 Ga0068869_100898900 Ga0068869_1008989001 123
141 3300005335 Ga0070666_10003567 Ga0070666_1000356710 123
142 3300005335 Ga0070666_10020162 Ga0070666_100201623 123
143 3300005335 Ga0070666_10079986 Ga0070666_100799861 123
144 3300005335 Ga0070666_10158285 Ga0070666_101582853 123
145 3300005338 Ga0068868_100731574 Ga0068868_1007315742 123
146 3300005338 Ga0068868_100934788 Ga0068868_1009347882 123
147 3300005338 Ga0068868_101768189 Ga0068868_1017681891 123
148 3300005339 Ga0070660_100426316 Ga0070660_1004263162 123
149 3300005340 Ga0070689_100008216 Ga0070689_1000082164 123
150 3300005340 Ga0070689_100197408 Ga0070689_1001974083 123
151 3300005340 Ga0070689_100273636 Ga0070689_1002736361 123
152 3300005340 Ga0070689_100771041 Ga0070689_1007710411 123
153 3300005343 Ga0070687_100001607 Ga0070687_1000016075 123
154 3300005343 Ga0070687_100043763 Ga0070687_1000437633 123
155 3300005343 Ga0070687_100158147 Ga0070687_1001581473 123
156 3300005344 Ga0070661_100206258 Ga0070661_1002062582 123
157 3300005344 Ga0070661_100298744 Ga0070661_1002987442 123
158 3300005347 Ga0070668_100000836 Ga0070668_10000083616 123
159 3300005347 Ga0070668_100060271 Ga0070668_1000602713 123
160 3300005347 Ga0070668_100238498 Ga0070668_1002384983 123
161 3300005347 Ga0070668_100307145 Ga0070668_1003071452 123
162 3300005353 Ga0070669_100007775 Ga0070669_1000077756 123
163 3300005353 Ga0070669_100012298 Ga0070669_1000122983 123
164 3300005353 Ga0070669_100012867 Ga0070669_1000128674 123
165 3300005353 Ga0070669_100015656 Ga0070669_1000156563 123
166 3300005353 Ga0070669_100203623 Ga0070669_1002036232 123
167 3300005353 Ga0070669_100306043 Ga0070669_1003060432 123
168 3300005353 Ga0070669_100444288 Ga0070669_1004442882 123
169 3300005354 Ga0070675_100009115 Ga0070675_1000091159 123
170 3300005354 Ga0070675_100062758 Ga0070675_1000627583 123
171 3300005354 Ga0070675_100181273 Ga0070675_1001812733 123
172 3300005354 Ga0070675_100292935 Ga0070675_1002929352 123
173 3300005354 Ga0070675_100511743 Ga0070675_1005117432 123
174 3300005355 Ga0070671_100007786 Ga0070671_1000077865 123
175 3300005355 Ga0070671_100018241 Ga0070671_1000182413 123
176 3300005355 Ga0070671_100021568 Ga0070671_1000215683 123
177 3300005355 Ga0070671_100124210 Ga0070671_1001242103 123
178 3300005355 Ga0070671_100251728 Ga0070671_1002517283 123
179 3300005355 Ga0070671_100347563 Ga0070671_1003475633 123
180 3300005355 Ga0070671_100543440 Ga0070671_1005434402 123
181 3300005355 Ga0070671_100627797 Ga0070671_1006277971 123
182 3300005355 Ga0070671_100633075 Ga0070671_1006330751 123
183 3300005356 Ga0070674_100000816 Ga0070674_10000081611 123
184 3300005356 Ga0070674_100066011 Ga0070674_1000660111 123
185 3300005356 Ga0070674_100090211 Ga0070674_1000902112 123
186 3300005356 Ga0070674_100449560 Ga0070674_1004495602 123
187 3300005364 Ga0070673_100004390 Ga0070673_1000043904 123
188 3300005364 Ga0070673_100161221 Ga0070673_1001612211 123
189 3300005364 Ga0070673_100233448 Ga0070673_1002334483 123
190 3300005364 Ga0070673_100306459 Ga0070673_1003064591 123
191 3300005364 Ga0070673_100685424 Ga0070673_1006854241 123
192 3300005364 Ga0070673_101809791 Ga0070673_1018097911 123
193 3300005365 Ga0070688_100001751 Ga0070688_10000175110 123
194 3300005365 Ga0070688_101545172 Ga0070688_1015451721 123
195 3300005366 Ga0070659_100852800 Ga0070659_1008528002 123
196 3300005367 Ga0070667_100021783 Ga0070667_1000217836 123
197 3300005367 Ga0070667_100030175 Ga0070667_1000301753 123
198 3300005367 Ga0070667_100038282 Ga0070667_1000382822 123
199 3300005367 Ga0070667_100180554 Ga0070667_1001805542 123
200 3300005367 Ga0070667_102283360 Ga0070667_1022833601 123
201 3300005406 Ga0070703_10306227 Ga0070703_103062271 123
202 3300005434 Ga0070709_10087421 Ga0070709_100874213 123
203 3300005434 Ga0070709_10256388 Ga0070709_102563882 123
204 3300005434 Ga0070709_10455436 Ga0070709_104554362 123
205 3300005435 Ga0070714_100020574 Ga0070714_1000205743 123
206 3300005435 Ga0070714_100082260 Ga0070714_1000822603 123
207 3300005435 Ga0070714_100135745 Ga0070714_1001357453 123
208 3300005435 Ga0070714_100494073 Ga0070714_1004940732 123
209 3300005435 Ga0070714_101056619 Ga0070714_1010566191 123
210 3300005436 Ga0070713_100271334 Ga0070713_1002713343 123
211 3300005436 Ga0070713_100272199 Ga0070713_1002721993 123
212 3300005436 Ga0070713_100718164 Ga0070713_1007181642 123
213 3300005436 Ga0070713_100890916 Ga0070713_1008909162 123
214 3300005436 Ga0070713_101093430 Ga0070713_1010934302 123
215 3300005437 Ga0070710_10043991 Ga0070710_100439914 123
216 3300005437 Ga0070710_10431404 Ga0070710_104314042 123
217 3300005437 Ga0070710_10591099 Ga0070710_105910992 123
218 3300005439 Ga0070711_100013195 Ga0070711_1000131952 123
219 3300005439 Ga0070711_100719869 Ga0070711_1007198691 123
220 3300005440 Ga0070705_100007587 Ga0070705_1000075874 123
221 3300005440 Ga0070705_100110705 Ga0070705_1001107053 123
222 3300005440 Ga0070705_100177714 Ga0070705_1001777142 123
223 3300005440 Ga0070705_100270215 Ga0070705_1002702152 123
224 3300005440 Ga0070705_100359731 Ga0070705_1003597312 123
225 3300005440 Ga0070705_101016102 Ga0070705_1010161021 123
226 3300005441 Ga0070700_100817619 Ga0070700_1008176191 123
227 3300005444 Ga0070694_100131997 Ga0070694_1001319972 123
228 3300005444 Ga0070694_100186380 Ga0070694_1001863803 123
229 3300005445 Ga0070708_100004838 Ga0070708_10000483814 123
230 3300005445 Ga0070708_100010491 Ga0070708_1000104914 123
231 3300005445 Ga0070708_100016567 Ga0070708_1000165673 123
232 3300005445 Ga0070708_100023132 Ga0070708_1000231321 123
233 3300005445 Ga0070708_100185905 Ga0070708_1001859052 123
234 3300005445 Ga0070708_100257375 Ga0070708_1002573753 123
235 3300005445 Ga0070708_100383417 Ga0070708_1003834172 123
236 3300005445 Ga0070708_100409508 Ga0070708_1004095082 123
237 3300005445 Ga0070708_101029846 Ga0070708_1010298461 123
238 3300005445 Ga0070708_101110226 Ga0070708_1011102262 123
239 3300005455 Ga0070663_100378558 Ga0070663_1003785583 123
240 3300005456 Ga0070678_100001971 Ga0070678_1000019717 123
241 3300005456 Ga0070678_100041684 Ga0070678_1000416842 123
242 3300005456 Ga0070678_100123728 Ga0070678_1001237282 123
243 3300005456 Ga0070678_100210566 Ga0070678_1002105662 123
244 3300005457 Ga0070662_100020162 Ga0070662_1000201621 123
245 3300005457 Ga0070662_101020375 Ga0070662_1010203752 123
246 3300005459 Ga0068867_100014539 Ga0068867_1000145394 123
247 3300005466 Ga0070685_10242682 Ga0070685_102426822 123
248 3300005467 Ga0070706_100000462 Ga0070706_1000004625 123
249 3300005467 Ga0070706_100008839 Ga0070706_1000088392 123
250 3300005467 Ga0070706_100021324 Ga0070706_1000213242 123
251 3300005467 Ga0070706_100022886 Ga0070706_1000228865 123
252 3300005467 Ga0070706_100035784 Ga0070706_1000357843 123
253 3300005467 Ga0070706_100055509 Ga0070706_1000555093 123
254 3300005467 Ga0070706_100091006 Ga0070706_1000910062 123
255 3300005467 Ga0070706_100205972 Ga0070706_1002059722 123
256 3300005467 Ga0070706_100225308 Ga0070706_1002253082 123
257 3300005467 Ga0070706_100455511 Ga0070706_1004555111 123
258 3300005467 Ga0070706_100494904 Ga0070706_1004949042 123
259 3300005468 Ga0070707_100000140 Ga0070707_1000001409 123
260 3300005468 Ga0070707_100024766 Ga0070707_1000247662 123
261 3300005468 Ga0070707_100025477 Ga0070707_1000254774 123
262 3300005468 Ga0070707_100026733 Ga0070707_1000267333 123
263 3300005468 Ga0070707_100034565 Ga0070707_1000345653 123
264 3300005468 Ga0070707_100096769 Ga0070707_1000967694 123
265 3300005468 Ga0070707_100183426 Ga0070707_1001834262 123
266 3300005468 Ga0070707_100288022 Ga0070707_1002880222 123
267 3300005468 Ga0070707_101186129 Ga0070707_1011861291 123
268 3300005471 Ga0070698_100333310 Ga0070698_1003333103 123
269 3300005471 Ga0070698_100341777 Ga0070698_1003417772 123
270 3300005471 Ga0070698_100921865 Ga0070698_1009218652 123
271 3300005518 Ga0070699_100047039 Ga0070699_1000470393 123
272 3300005518 Ga0070699_100216745 Ga0070699_1002167451 123
273 3300005518 Ga0070699_100420897 Ga0070699_1004208972 123
274 3300005518 Ga0070699_100434220 Ga0070699_1004342203 123
275 3300005518 Ga0070699_100831101 Ga0070699_1008311012 123
276 3300005518 Ga0070699_101724408 Ga0070699_1017244081 123
277 3300005536 Ga0070697_100001331 Ga0070697_1000013314 123
278 3300005536 Ga0070697_100017072 Ga0070697_1000170722 123
279 3300005536 Ga0070697_100029828 Ga0070697_1000298282 123
280 3300005536 Ga0070697_100045652 Ga0070697_1000456522 123
281 3300005536 Ga0070697_100057459 Ga0070697_1000574592 123
282 3300005536 Ga0070697_100059485 Ga0070697_1000594853 123
283 3300005536 Ga0070697_100077262 Ga0070697_1000772623 123
284 3300005536 Ga0070697_100088500 Ga0070697_1000885003 123
285 3300005536 Ga0070697_100350898 Ga0070697_1003508982 123
286 3300005536 Ga0070697_100456903 Ga0070697_1004569033 123
287 3300005536 Ga0070697_100465301 Ga0070697_1004653012 123
288 3300005536 Ga0070697_100994535 Ga0070697_1009945351 123
289 3300005536 Ga0070697_101072407 Ga0070697_1010724071 123
290 3300005543 Ga0070672_100004681 Ga0070672_1000046818 123
291 3300005543 Ga0070672_100345602 Ga0070672_1003456023 123
292 3300005543 Ga0070672_100950036 Ga0070672_1009500362 123
293 3300005545 Ga0070695_100080838 Ga0070695_1000808383 123
294 3300005546 Ga0070696_100184588 Ga0070696_1001845883 123
295 3300005546 Ga0070696_100287305 Ga0070696_1002873053 123
296 3300005547 Ga0070693_100086081 Ga0070693_1000860813 123
297 3300005548 Ga0070665_100085431 Ga0070665_1000854313 123
298 3300005548 Ga0070665_100631098 Ga0070665_1006310983 123
299 3300005548 Ga0070665_101002345 Ga0070665_1010023451 123
300 3300005549 Ga0070704_100223850 Ga0070704_1002238502 123
301 3300005549 Ga0070704_100441156 Ga0070704_1004411562 123
302 3300005563 Ga0068855_100161370 Ga0068855_1001613703 123
303 3300005563 Ga0068855_100559227 Ga0068855_1005592273 123
304 3300005564 Ga0070664_100182784 Ga0070664_1001827843 123
305 3300005618 Ga0068864_100273730 Ga0068864_1002737303 123
306 3300005718 Ga0068866_10316631 Ga0068866_103166311 123
307 3300005841 Ga0068863_100665324 Ga0068863_1006653242 123
308 3300005842 Ga0068858_100669252 Ga0068858_1006692523 123
309 3300005842 Ga0068858_101330710 Ga0068858_1013307102 123
310 3300005843 Ga0068860_100080627 Ga0068860_1000806272 123
311 3300005843 Ga0068860_100163408 Ga0068860_1001634083 123
312 3300005843 Ga0068860_100342582 Ga0068860_1003425823 123
313 3300005844 Ga0068862_100133256 Ga0068862_1001332563 123
314 3300005937 Ga0081455_10221166 Ga0081455_102211662 123
315 3300005985 Ga0081539_10000061 Ga0081539_10000061164 123
316 3300005985 Ga0081539_10000971 Ga0081539_1000097153 123
317 3300005985 Ga0081539_10030103 Ga0081539_100301033 123
318 3300005985 Ga0081539_10124345 Ga0081539_101243452 123
319 3300006028 Ga0070717_10000793 Ga0070717_1000079310 123
320 3300006028 Ga0070717_10010827 Ga0070717_100108272 123
321 3300006028 Ga0070717_10290963 Ga0070717_102909633 123
322 3300006028 Ga0070717_10290964 Ga0070717_102909643 123
323 3300006163 Ga0070715_10204647 Ga0070715_102046472 123
324 3300006163 Ga0070715_10339272 Ga0070715_103392722 123
325 3300006163 Ga0070715_10485118 Ga0070715_104851182 123
326 3300006173 Ga0070716_100249271 Ga0070716_1002492712 123
327 3300006173 Ga0070716_100290516 Ga0070716_1002905162 123
328 3300006173 Ga0070716_100351951 Ga0070716_1003519512 123
329 3300006173 Ga0070716_100393171 Ga0070716_1003931711 123
330 3300006173 Ga0070716_100618626 Ga0070716_1006186261 123
331 3300006173 Ga0070716_101248760 Ga0070716_1012487601 123
332 3300006175 Ga0070712_100007081 Ga0070712_1000070812 123
333 3300006175 Ga0070712_100011407 Ga0070712_1000114075 123
334 3300006175 Ga0070712_100287614 Ga0070712_1002876142 123
335 3300006175 Ga0070712_100550074 Ga0070712_1005500742 123
336 3300006175 Ga0070712_101088250 Ga0070712_1010882501 123
337 3300006175 Ga0070712_101713405 Ga0070712_1017134052 123
338 3300006237 Ga0097621_100005822 Ga0097621_1000058228 123
339 3300006237 Ga0097621_100082048 Ga0097621_1000820483 123
340 3300006237 Ga0097621_100260443 Ga0097621_1002604433 123
341 3300006237 Ga0097621_100595333 Ga0097621_1005953332 123
342 3300006237 Ga0097621_101869172 Ga0097621_1018691721 123
343 3300006358 Ga0068871_100009985 Ga0068871_1000099854 123
344 3300006358 Ga0068871_100022789 Ga0068871_1000227893 123
345 3300006358 Ga0068871_100031335 Ga0068871_1000313353 123
346 3300006358 Ga0068871_100061238 Ga0068871_1000612383 123
347 3300006358 Ga0068871_100513008 Ga0068871_1005130082 123
348 3300006847 Ga0075431_102201433 Ga0075431_1022014331 123
349 3300006852 Ga0075433_10929573 Ga0075433_109295732 123
350 3300006871 Ga0075434_100452700 Ga0075434_1004527002 123
351 3300006880 Ga0075429_100971690 Ga0075429_1009716902 123
352 3300006881 Ga0068865_100142510 Ga0068865_1001425103 123
353 3300006881 Ga0068865_100445953 Ga0068865_1004459533 123
354 3300006914 Ga0075436_100061108 Ga0075436_1000611082 123
355 3300007076 Ga0075435_101420555 Ga0075435_1014205551 123
356 3300009093 Ga0105240_10268833 Ga0105240_102688332 123
357 3300009094 Ga0111539_10184244 Ga0111539_101842443 123
358 3300009098 Ga0105245_10011372 Ga0105245_100113727 123
359 3300009098 Ga0105245_10281277 Ga0105245_102812773 123
360 3300009098 Ga0105245_10426254 Ga0105245_104262542 123
361 3300009098 Ga0105245_12094761 Ga0105245_120947611 123
362 3300009147 Ga0114129_10098289 Ga0114129_100982893 123
363 3300009148 Ga0105243_10361812 Ga0105243_103618121 123
364 3300009174 Ga0105241_11846914 Ga0105241_118469142 123
365 3300009176 Ga0105242_10295843 Ga0105242_102958432 123
366 3300009177 Ga0105248_12270943 Ga0105248_122709431 123
367 3300009545 Ga0105237_10346798 Ga0105237_103467981 123
368 3300009553 Ga0105249_10021221 Ga0105249_100212216 123
369 3300009553 Ga0105249_10712780 Ga0105249_107127803 123
370 3300010159 Ga0099796_10339526 Ga0099796_103395261 123
371 3300010375 Ga0105239_10784053 Ga0105239_107840532 123
372 3300010375 Ga0105239_11640665 Ga0105239_116406652 123
373 3300010375 Ga0105239_12603863 Ga0105239_126038631 123
374 3300012513 Ga0157326_1036533 Ga0157326_10365331 123
375 3300013100 Ga0157373_10594382 Ga0157373_105943822 123
376 3300013102 Ga0157371_10364938 Ga0157371_103649382 123
377 3300013296 Ga0157374_10000068 Ga0157374_1000006832 123
378 3300013296 Ga0157374_10029411 Ga0157374_100294113 123
379 3300013296 Ga0157374_10040211 Ga0157374_100402112 123
380 3300013296 Ga0157374_10055924 Ga0157374_100559243 123
381 3300013296 Ga0157374_10206760 Ga0157374_102067603 123
382 3300013296 Ga0157374_10784036 Ga0157374_107840362 123
383 3300013296 Ga0157374_12490023 Ga0157374_124900231 123
384 3300013297 Ga0157378_10025408 Ga0157378_100254085 123
385 3300013297 Ga0157378_10027846 Ga0157378_100278464 123
386 3300013297 Ga0157378_10043795 Ga0157378_100437952 123
387 3300013297 Ga0157378_10052208 Ga0157378_100522082 123
388 3300013297 Ga0157378_10094089 Ga0157378_100940893 123
389 3300013297 Ga0157378_10191086 Ga0157378_101910863 123
390 3300013297 Ga0157378_10262444 Ga0157378_102624443 123
391 3300013297 Ga0157378_10354152 Ga0157378_103541522 123
392 3300013297 Ga0157378_10426915 Ga0157378_104269153 123
393 3300013297 Ga0157378_10835272 Ga0157378_108352722 123
394 3300013297 Ga0157378_10970901 Ga0157378_109709012 123
395 3300013297 Ga0157378_11648334 Ga0157378_116483342 123
396 3300013297 Ga0157378_12556262 Ga0157378_125562622 123
397 3300013306 Ga0163162_10015504 Ga0163162_100155043 123
398 3300013306 Ga0163162_10050676 Ga0163162_100506764 123
399 3300013306 Ga0163162_10054224 Ga0163162_100542243 123
400 3300013306 Ga0163162_10083884 Ga0163162_100838842 123
401 3300013306 Ga0163162_10086927 Ga0163162_100869273 123
402 3300013306 Ga0163162_10125953 Ga0163162_101259533 123
403 3300013306 Ga0163162_10275066 Ga0163162_102750663 123
404 3300013306 Ga0163162_10996557 Ga0163162_109965572 123
405 3300013307 Ga0157372_10027573 Ga0157372_100275732 123
406 3300013307 Ga0157372_10063655 Ga0157372_100636554 123
407 3300013307 Ga0157372_10113959 Ga0157372_101139593 123
408 3300013307 Ga0157372_10377527 Ga0157372_103775274 123
409 3300013307 Ga0157372_10543656 Ga0157372_105436562 123
410 3300013308 Ga0157375_10006218 Ga0157375_100062188 123
411 3300013308 Ga0157375_10007176 Ga0157375_100071768 123
412 3300013308 Ga0157375_10777261 Ga0157375_107772612 123
413 3300013308 Ga0157375_12100738 Ga0157375_121007381 123
414 3300013308 Ga0157375_12757746 Ga0157375_127577461 123
415 3300014325 Ga0163163_10089916 Ga0163163_100899163 123
416 3300014325 Ga0163163_10589669 Ga0163163_105896692 123
417 3300014968 Ga0157379_10359982 Ga0157379_103599822 123
418 3300014968 Ga0157379_10643462 Ga0157379_106434622 123
419 3300014969 Ga0157376_10010878 Ga0157376_100108783 123
420 3300014969 Ga0157376_10060696 Ga0157376_100606963 123
421 3300014969 Ga0157376_10229106 Ga0157376_102291062 123
422 3300014969 Ga0157376_10257366 Ga0157376_102573661 123
423 3300014969 Ga0157376_10351200 Ga0157376_103512003 123
424 3300014969 Ga0157376_10672494 Ga0157376_106724942 123
425 3300017792 Ga0163161_10008436 Ga0163161_100084363 123
426 3300017792 Ga0163161_10069036 Ga0163161_100690362 123
427 3300017792 Ga0163161_10858962 Ga0163161_108589622 123
428 3300020077 Ga0206351_10539719 Ga0206351_105397192 123
429 3300020077 Ga0206351_10792315 Ga0206351_107923152 123
430 3300020080 Ga0206350_10137531 Ga0206350_101375311 123
431 3300020610 Ga0154015_1647084 Ga0154015_16470842 123
432 3300021361 Ga0213872_10070266 Ga0213872_100702662 123
433 3300021361 Ga0213872_10091008 Ga0213872_100910083 123
434 3300021361 Ga0213872_10106613 Ga0213872_101066132 123
435 3300021377 Ga0213874_10206192 Ga0213874_102061922 123
436 3300021384 Ga0213876_10001439 Ga0213876_1000143913 123
437 3300021384 Ga0213876_10525509 Ga0213876_105255092 123
438 3300021388 Ga0213875_10133793 Ga0213875_101337932 123
439 3300021441 Ga0213871_10005016 Ga0213871_100050163 123
440 3300022467 Ga0224712_10252954 Ga0224712_102529541 123
441 3300025290 Ga0207673_1013859 Ga0207673_10138592 123
442 3300025290 Ga0207673_1020936 Ga0207673_10209362 123
443 3300025315 Ga0207697_10000118 Ga0207697_100001187 123
444 3300025315 Ga0207697_10000734 Ga0207697_1000073411 123
445 3300025315 Ga0207697_10000986 Ga0207697_1000098611 123
446 3300025315 Ga0207697_10003844 Ga0207697_100038446 123
447 3300025315 Ga0207697_10087118 Ga0207697_100871182 123
448 3300025893 Ga0207682_10082233 Ga0207682_100822332 123
449 3300025898 Ga0207692_10207624 Ga0207692_102076242 123
450 3300025898 Ga0207692_10458511 Ga0207692_104585112 123
451 3300025898 Ga0207692_10518236 Ga0207692_105182361 123
452 3300025899 Ga0207642_10154459 Ga0207642_101544592 123
453 3300025899 Ga0207642_10249355 Ga0207642_102493552 123
454 3300025901 Ga0207688_10000809 Ga0207688_100008098 123
455 3300025901 Ga0207688_10005559 Ga0207688_100055596 123
456 3300025901 Ga0207688_10047402 Ga0207688_100474023 123
457 3300025903 Ga0207680_10006421 Ga0207680_100064213 123
458 3300025903 Ga0207680_10188942 Ga0207680_101889421 123
459 3300025903 Ga0207680_10271437 Ga0207680_102714373 123
460 3300025903 Ga0207680_10307966 Ga0207680_103079662 123
461 3300025905 Ga0207685_10004631 Ga0207685_100046313 123
462 3300025906 Ga0207699_10239725 Ga0207699_102397252 123
463 3300025906 Ga0207699_10406395 Ga0207699_104063951 123
464 3300025906 Ga0207699_10431900 Ga0207699_104319003 123
465 3300025907 Ga0207645_10002605 Ga0207645_100026056 123
466 3300025907 Ga0207645_10003810 Ga0207645_100038103 123
467 3300025907 Ga0207645_10006174 Ga0207645_100061744 123
468 3300025907 Ga0207645_10008430 Ga0207645_100084307 123
469 3300025907 Ga0207645_10207312 Ga0207645_102073122 123
470 3300025907 Ga0207645_10251424 Ga0207645_102514242 123
471 3300025910 Ga0207684_10000512 Ga0207684_100005126 123
472 3300025910 Ga0207684_10014154 Ga0207684_100141542 123
473 3300025910 Ga0207684_10033430 Ga0207684_100334303 123
474 3300025910 Ga0207684_10034454 Ga0207684_100344542 123
475 3300025910 Ga0207684_10061461 Ga0207684_100614612 123
476 3300025910 Ga0207684_10112733 Ga0207684_101127332 123
477 3300025910 Ga0207684_10167899 Ga0207684_101678992 123
478 3300025910 Ga0207684_10268927 Ga0207684_102689272 123
479 3300025910 Ga0207684_10348086 Ga0207684_103480862 123
480 3300025910 Ga0207684_10349412 Ga0207684_103494122 123
481 3300025910 Ga0207684_11180421 Ga0207684_111804211 123
482 3300025915 Ga0207693_10002803 Ga0207693_1000280310 123
483 3300025915 Ga0207693_10006881 Ga0207693_100068817 123
484 3300025915 Ga0207693_10084846 Ga0207693_100848463 123
485 3300025915 Ga0207693_10176704 Ga0207693_101767043 123
486 3300025915 Ga0207693_10817970 Ga0207693_108179701 123
487 3300025915 Ga0207693_11159811 Ga0207693_111598111 123
488 3300025915 Ga0207693_11240295 Ga0207693_112402951 123
489 3300025916 Ga0207663_10017481 Ga0207663_100174811 123
490 3300025916 Ga0207663_10148145 Ga0207663_101481452 123
491 3300025916 Ga0207663_10216530 Ga0207663_102165302 123
492 3300025918 Ga0207662_10000945 Ga0207662_100009455 123
493 3300025918 Ga0207662_10047773 Ga0207662_100477733 123
494 3300025919 Ga0207657_10365876 Ga0207657_103658762 123
495 3300025920 Ga0207649_10125785 Ga0207649_101257853 123
496 3300025920 Ga0207649_10154040 Ga0207649_101540403 123
497 3300025922 Ga0207646_10000867 Ga0207646_1000086716 123
498 3300025922 Ga0207646_10000886 Ga0207646_1000088620 123
499 3300025922 Ga0207646_10001911 Ga0207646_1000191116 123
500 3300025922 Ga0207646_10002892 Ga0207646_1000289217 123
501 3300025922 Ga0207646_10034742 Ga0207646_100347421 123
502 3300025922 Ga0207646_10060147 Ga0207646_100601473 123
503 3300025922 Ga0207646_10118378 Ga0207646_101183783 123
504 3300025922 Ga0207646_10123706 Ga0207646_101237062 123
505 3300025922 Ga0207646_10176920 Ga0207646_101769202 123
506 3300025922 Ga0207646_10291201 Ga0207646_102912013 123
507 3300025922 Ga0207646_10718114 Ga0207646_107181142 123
508 3300025923 Ga0207681_10016600 Ga0207681_100166004 123
509 3300025923 Ga0207681_10050164 Ga0207681_100501643 123
510 3300025923 Ga0207681_10079647 Ga0207681_100796473 123
511 3300025923 Ga0207681_10155234 Ga0207681_101552342 123
512 3300025923 Ga0207681_10374400 Ga0207681_103744002 123
513 3300025923 Ga0207681_10466598 Ga0207681_104665982 123
514 3300025923 Ga0207681_11375964 Ga0207681_113759642 123
515 3300025925 Ga0207650_10017752 Ga0207650_100177524 123
516 3300025925 Ga0207650_10154679 Ga0207650_101546792 123
517 3300025925 Ga0207650_10166811 Ga0207650_101668113 123
518 3300025925 Ga0207650_10264960 Ga0207650_102649603 123
519 3300025926 Ga0207659_10028327 Ga0207659_100283273 123
520 3300025926 Ga0207659_10070328 Ga0207659_100703281 123
521 3300025926 Ga0207659_10371772 Ga0207659_103717722 123
522 3300025926 Ga0207659_10581183 Ga0207659_105811832 123
523 3300025926 Ga0207659_10616471 Ga0207659_106164712 123
524 3300025927 Ga0207687_10284550 Ga0207687_102845502 123
525 3300025927 Ga0207687_10585467 Ga0207687_105854672 123
526 3300025928 Ga0207700_10069860 Ga0207700_100698604 123
527 3300025928 Ga0207700_10461422 Ga0207700_104614222 123
528 3300025928 Ga0207700_10715148 Ga0207700_107151482 123
529 3300025929 Ga0207664_10024600 Ga0207664_100246003 123
530 3300025929 Ga0207664_10496140 Ga0207664_104961401 123
531 3300025929 Ga0207664_10571594 Ga0207664_105715942 123
532 3300025929 Ga0207664_11778334 Ga0207664_117783341 123
533 3300025931 Ga0207644_10007138 Ga0207644_100071388 123
534 3300025931 Ga0207644_10027555 Ga0207644_100275553 123
535 3300025931 Ga0207644_10069801 Ga0207644_100698013 123
536 3300025931 Ga0207644_10248883 Ga0207644_102488832 123
537 3300025931 Ga0207644_10598501 Ga0207644_105985011 123
538 3300025931 Ga0207644_10917940 Ga0207644_109179402 123
539 3300025932 Ga0207690_10082845 Ga0207690_100828452 123
540 3300025933 Ga0207706_10006839 Ga0207706_100068394 123
541 3300025933 Ga0207706_10061535 Ga0207706_100615353 123
542 3300025933 Ga0207706_10081605 Ga0207706_100816053 123
543 3300025933 Ga0207706_10324860 Ga0207706_103248602 123
544 3300025934 Ga0207686_11525856 Ga0207686_115258561 123
545 3300025936 Ga0207670_10031452 Ga0207670_100314522 123
546 3300025936 Ga0207670_10435773 Ga0207670_104357732 123
547 3300025937 Ga0207669_10005902 Ga0207669_100059022 123
548 3300025937 Ga0207669_10087161 Ga0207669_100871613 123
549 3300025937 Ga0207669_10501506 Ga0207669_105015062 123
550 3300025938 Ga0207704_10045848 Ga0207704_100458481 123
551 3300025939 Ga0207665_10018571 Ga0207665_100185713 123
552 3300025939 Ga0207665_10251758 Ga0207665_102517582 123
553 3300025939 Ga0207665_10474236 Ga0207665_104742362 123
554 3300025939 Ga0207665_10491871 Ga0207665_104918712 123
555 3300025939 Ga0207665_10928460 Ga0207665_109284601 123
556 3300025940 Ga0207691_10000359 Ga0207691_1000035925 123
557 3300025940 Ga0207691_10009486 Ga0207691_100094865 123
558 3300025940 Ga0207691_10012453 Ga0207691_100124536 123
559 3300025940 Ga0207691_10317650 Ga0207691_103176502 123
560 3300025940 Ga0207691_10446375 Ga0207691_104463753 123
561 3300025942 Ga0207689_10148811 Ga0207689_101488112 123
562 3300025945 Ga0207679_10679974 Ga0207679_106799741 123
563 3300025945 Ga0207679_10976237 Ga0207679_109762372 123
564 3300025960 Ga0207651_10038807 Ga0207651_100388074 123
565 3300025960 Ga0207651_10240895 Ga0207651_102408952 123
566 3300025960 Ga0207651_10455286 Ga0207651_104552862 123
567 3300025960 Ga0207651_10838701 Ga0207651_108387012 123
568 3300025961 Ga0207712_10493412 Ga0207712_104934121 123
569 3300025972 Ga0207668_10008896 Ga0207668_100088963 123
570 3300025972 Ga0207668_10027804 Ga0207668_100278044 123
571 3300025981 Ga0207640_10404204 Ga0207640_104042042 123
572 3300025986 Ga0207658_10008876 Ga0207658_100088763 123
573 3300025986 Ga0207658_10063811 Ga0207658_100638113 123
574 3300025986 Ga0207658_10128896 Ga0207658_101288961 123
575 3300025986 Ga0207658_10481745 Ga0207658_104817452 123
576 3300025986 Ga0207658_10679299 Ga0207658_106792992 123
577 3300025986 Ga0207658_11020472 Ga0207658_110204721 123
578 3300026023 Ga0207677_10020424 Ga0207677_100204244 123
579 3300026023 Ga0207677_10096548 Ga0207677_100965484 123
580 3300026023 Ga0207677_10176597 Ga0207677_101765973 123
581 3300026023 Ga0207677_10699263 Ga0207677_106992632 123
582 3300026023 Ga0207677_12141467 Ga0207677_121414671 123
583 3300026035 Ga0207703_10106139 Ga0207703_101061393 123
584 3300026035 Ga0207703_11201859 Ga0207703_112018592 123
585 3300026067 Ga0207678_10378439 Ga0207678_103784391 123
586 3300026075 Ga0207708_11940245 Ga0207708_119402451 123
587 3300026078 Ga0207702_10184631 Ga0207702_101846313 123
588 3300026088 Ga0207641_10299412 Ga0207641_102994123 123
589 3300026088 Ga0207641_10783864 Ga0207641_107838642 123
590 3300026089 Ga0207648_10018637 Ga0207648_100186374 123
591 3300026089 Ga0207648_10460703 Ga0207648_104607032 123
592 3300026089 Ga0207648_10652873 Ga0207648_106528733 123
593 3300026121 Ga0207683_10012367 Ga0207683_100123672 123
594 3300026121 Ga0207683_10013698 Ga0207683_100136985 123
595 3300026121 Ga0207683_10032322 Ga0207683_100323223 123
596 3300026121 Ga0207683_10294756 Ga0207683_102947563 123
597 3300026121 Ga0207683_11307893 Ga0207683_113078931 123
598 3300028379 Ga0268266_10057819 Ga0268266_100578194 123
599 3300028379 Ga0268266_11280071 Ga0268266_112800711 123
600 3300028380 Ga0268265_10035776 Ga0268265_100357761 123
601 3300028380 Ga0268265_10575238 Ga0268265_105752381 123
602 3300028381 Ga0268264_10039849 Ga0268264_100398491 123
603 3300028381 Ga0268264_10109586 Ga0268264_101095863 123
604 3300028381 Ga0268264_10194804 Ga0268264_101948043 123
605 3300028381 Ga0268264_10428633 Ga0268264_104286333 123
606 3300035083 Ga0373926_0288722 Ga0373926_0288722_101_472 123
607 3300035089 Ga0373944_0069141 Ga0373944_0069141_419_790 123
608 3300035092 Ga0373952_0115351 Ga0373952_0115351_103_498 123
609 3300035112 Ga0373932_0036941 Ga0373932_0036941_765_1160 123
610 3300035113 Ga0373936_0141022 Ga0373936_0141022_631_1002 123
611 3300035116 Ga0373945_0042416 Ga0373945_0042416_345_716 123
612 3300035116 Ga0373945_0259138 Ga0373945_0259138_292_663 123
613 3300035120 Ga0373957_0101746 Ga0373957_0101746_642_1013 123
614 3300035121 Ga0373960_0408785 Ga0373960_0408785_55_426 123
615 3300035170 Ga0373943_0034253 Ga0373943_0034253_488_859 123
616 3300035170 Ga0373943_0083297 Ga0373943_0083297_584_955 123
617 3300035170 Ga0373943_0117825 Ga0373943_0117825_576_947 123
618 3300035170 Ga0373943_0453708 Ga0373943_0453708_237_608 123
619 3300035171 Ga0373946_0026488 Ga0373946_0026488_1298_1669 123
620 3300035171 Ga0373946_0094100 Ga0373946_0094100_281_652 123
621 3300035171 Ga0373946_0155725 Ga0373946_0155725_342_713 123
622 3300035171 Ga0373946_0231915 Ga0373946_0231915_19_390 123
623 3300035207 Ga0373942_0083786 Ga0373942_0083786_182_577 123
624 3300035242 Ga0373962_0064213 Ga0373962_0064213_274_645 123
625 3300035410 Ga0373924_0026918 Ga0373924_0026918_1777_2148 123
626 3300035691 Ga0373931_0159019 Ga0373931_0159019_726_1097 123
627 3300035692 Ga0373935_0011921 Ga0373935_0011921_2393_2764 123
628 3300035692 Ga0373935_0036113 Ga0373935_0036113_906_1277 123
629 3300035695 Ga0373927_0172607 Ga0373927_0172607_311_682 123
630 3300035695 Ga0373927_0226595 Ga0373927_0226595_504_875 123
631 3300035724 Ga0373933_0046231 Ga0373933_0046231_599_970 123
632 3300035724 Ga0373933_0326097 Ga0373933_0326097_459_830 123
633 3300035725 Ga0373947_0209072 Ga0373947_0209072_576_947 123
634 3300035725 Ga0373947_0260135 Ga0373947_0260135_398_769 123
635 3300035725 Ga0373947_0284911 Ga0373947_0284911_710_1081 123
636 3300035725 Ga0373947_0666333 Ga0373947_0666333_278_649 123
637 3300035725 Ga0373947_0850368 Ga0373947_0850368_34_408 123
638 3300036401 Ga0373937_0464194 Ga0373937_0464194_457_828 123
639 3300037068 Ga0373925_0169652 Ga0373925_0169652_483_854 123
640 3300037068 Ga0373925_0287180 Ga0373925_0287180_485_856 123
641 3300037068 Ga0373925_0389321 Ga0373925_0389321_434_808 123
642 3300037068 Ga0373925_1123116 Ga0373925_1123116_105_476 123
643 3300037418 Ga0395900_0003547 Ga0395900_0003547_3215_3586 123
644 3300037418 Ga0395900_0057428 Ga0395900_0057428_1144_1515 123
645 3300037466 Ga0395898_0358826 Ga0395898_0358826_586_957 123
646 3300037853 Ga0436364_0630572 Ga0436364_0630572_649_1020 123
647 3300038443 Ga0395901_0410491 Ga0395901_0410491_222_593 123
648 3300038443 Ga0395901_0445695 Ga0395901_0445695_108_479 123
649 3300039437 Ga0436365_0539406 Ga0436365_0539406_21187_21564 123
650 3300039437 Ga0436365_0612721 Ga0436365_0612721_117_488 123
651 3300039438 Ga0436360_0157154 Ga0436360_0157154_275_652 123
652 3300039438 Ga0436360_0491936 Ga0436360_0491936_2759_3136 123
653 3300039438 Ga0436360_0976560 Ga0436360_0976560_278_655 123
654 3300039438 Ga0436360_0980270 Ga0436360_0980270_51_428 123
655 3300039438 Ga0436360_1363807 Ga0436360_1363807_1189_1566 123
656 3300039447 Ga0436361_0018337 Ga0436361_0018337_451_828 123
657 3300039447 Ga0436361_0062883 Ga0436361_0062883_3043_3420 123
658 3300039447 Ga0436361_0343340 Ga0436361_0343340_1107_1484 123
659 3300039447 Ga0436361_0730313 Ga0436361_0730313_1378_1755 123
660 3300039450 Ga0436363_0323230 Ga0436363_0323230_196_567 123
661 3300039453 Ga0436362_0569913 Ga0436362_0569913_1127_1504 123
662 3300041486 Ga0451807_0006777 Ga0451807_0006777_217_588 123
663 3300042011 Ga0439454_026515 Ga0439454_026515_83_454 123
664 3300042461 Ga0439460_0276531 Ga0439460_0276531_54_425 123
665 3300045051 Ga0451576_0055316 Ga0451576_0055316_1469_1840 123
666 3300045976 Ga0466967_0403167 Ga0466967_0403167_40_411 123
667 3300046454 Ga0495592_0385448 Ga0495592_0385448_229_600 123
668 3300046454 Ga0495592_0389030 Ga0495592_0389030_39_410 123
669 3300046472 Ga0495580_0149757 Ga0495580_0149757_29_400 123
670 3300046472 Ga0495580_1042377 Ga0495580_1042377_132_503 123
671 3300046473 Ga0495582_0341799 Ga0495582_0341799_465_836 123
672 3300046491 Ga0495584_0224426 Ga0495584_0224426_155_526 123
673 3300046516 Ga0495628_0060024 Ga0495628_0060024_2144_2515 123
674 3300046517 Ga0495630_0067865 Ga0495630_0067865_1506_1877 123
675 3300046518 Ga0495631_0084372 Ga0495631_0084372_303_674 123
676 3300046528 Ga0495642_0062660 Ga0495642_0062660_142_513 123
677 3300046533 Ga0495640_0735045 Ga0495640_0735045_11_382 123
678 3300046537 Ga0495598_0022524 Ga0495598_0022524_907_1278 123
679 3300046537 Ga0495598_0308012 Ga0495598_0308012_220_591 123
680 3300046539 Ga0495621_0187951 Ga0495621_0187951_221_592 123
681 3300046558 Ga0495633_0218432 Ga0495633_0218432_50_421 123
682 3300046615 Ga0495656_0150027 Ga0495656_0150027_517_888 123
683 3300046616 Ga0495668_0833707 Ga0495668_0833707_60_431 123
684 3300046642 Ga0495634_0619317 Ga0495634_0619317_232_603 123
685 3300046663 Ga0495635_0192153 Ga0495635_0192153_879_1250 123
686 3300046664 Ga0495659_0137339 Ga0495659_0137339_442_813 123
687 3300046664 Ga0495659_0503685 Ga0495659_0503685_148_519 123
688 3300046678 Ga0495599_0304051 Ga0495599_0304051_457_828 123
689 3300046683 Ga0495658_0027939 Ga0495658_0027939_1923_2294 123
690 3300046684 Ga0495669_0002765 Ga0495669_0002765_6287_6658 123
691 3300046684 Ga0495669_0156673 Ga0495669_0156673_62_433 123
692 3300046689 Ga0495613_0099670 Ga0495613_0099670_1391_1762 123
693 3300046794 Ga0495589_0199558 Ga0495589_0199558_67_438 123
694 3300047315 Ga0495581_0657122 Ga0495581_0657122_16_387 123
695 3300047322 Ga0495680_1032619 Ga0495680_1032619_85_456 123
696 3300047444 Ga0495675_0430537 Ga0495675_0430537_256_627 123
697 3300048903 Ga0496100_0309917 Ga0496100_0309917_627_998 123
698 3300048903 Ga0496100_0983501 Ga0496100_0983501_225_596 123
699 3300048904 Ga0496101_0094852 Ga0496101_0094852_621_992 123
700 3300048904 Ga0496101_0182486 Ga0496101_0182486_804_1199 123
701 3300048904 Ga0496101_1051513 Ga0496101_1051513_84_455 123
702 3300048905 Ga0496102_0033083 Ga0496102_0033083_2386_2781 123
703 3300048906 Ga0496103_0040065 Ga0496103_0040065_1452_1847 123
704 3300048907 Ga0496104_0127527 Ga0496104_0127527_2016_2387 123
705 3300048907 Ga0496104_0178570 Ga0496104_0178570_652_1023 123
706 3300048907 Ga0496104_0245678 Ga0496104_0245678_961_1332 123
707 3300048908 Ga0496105_0195273 Ga0496105_0195273_877_1272 123
708 3300048909 Ga0496106_0091747 Ga0496106_0091747_1271_1642 123
709 3300048909 Ga0496106_0893711 Ga0496106_0893711_222_593 123
710 3300048910 Ga0496107_0164224 Ga0496107_0164224_390_785 123
711 3300048910 Ga0496107_0745762 Ga0496107_0745762_248_619 123
712 3300048911 Ga0496108_0198354 Ga0496108_0198354_672_1043 123
713 3300048911 Ga0496108_0384407 Ga0496108_0384407_443_814 123
714 3300048911 Ga0496108_0384710 Ga0496108_0384710_232_603 123
715 3300048911 Ga0496108_0933165 Ga0496108_0933165_162_533 123
716 3300048911 Ga0496108_1275031 Ga0496108_1275031_206_601 123
717 3300048912 Ga0496109_0036809 Ga0496109_0036809_2944_3339 123
718 3300048912 Ga0496109_0112051 Ga0496109_0112051_406_777 123
719 3300048912 Ga0496109_0488656 Ga0496109_0488656_369_764 123
720 3300048912 Ga0496109_0552898 Ga0496109_0552898_150_521 123
721 3300048913 Ga0496110_0121994 Ga0496110_0121994_307_678 123
722 3300048913 Ga0496110_0695532 Ga0496110_0695532_112_483 123
723 3300048913 Ga0496110_0945213 Ga0496110_0945213_139_510 123
724 3300048915 Ga0496112_0006431 Ga0496112_0006431_8155_8526 123
725 3300048915 Ga0496112_0056570 Ga0496112_0056570_2176_2547 123
726 3300048915 Ga0496112_0099578 Ga0496112_0099578_2200_2571 123
727 3300048915 Ga0496112_0126861 Ga0496112_0126861_912_1283 123
728 3300048915 Ga0496112_0235761 Ga0496112_0235761_1091_1486 123
729 3300048915 Ga0496112_0326252 Ga0496112_0326252_139_510 123
730 3300048916 Ga0496113_0262774 Ga0496113_0262774_56_427 123
731 3300048916 Ga0496113_0327648 Ga0496113_0327648_377_772 123
732 3300048916 Ga0496113_0844117 Ga0496113_0844117_125_496 123
733 3300048917 Ga0496114_0010794 Ga0496114_0010794_1299_1670 123
734 3300048917 Ga0496114_0320613 Ga0496114_0320613_15_410 123
735 3300048918 Ga0496115_0001268 Ga0496115_0001268_2560_2931 123
736 3300048918 Ga0496115_0071714 Ga0496115_0071714_2239_2634 123
737 3300050507 nmdc:mga05p37_225729_c1 nmdc:mga05p37_225729_c1_86_481 123
738 3300050508 nmdc:mga09592_846550_c1 nmdc:mga09592_846550_c1_104_499 123
739 3300050510 nmdc:mga06r32_1355312_c1 nmdc:mga06r32_1355312_c1_181_576 123
740 3300050512 nmdc:mga0n895_1824332_c1 nmdc:mga0n895_1824332_c1_103_495 123
741 3300050513 nmdc:mga0rr50_251146_c1 nmdc:mga0rr50_251146_c1_1022_1417 123
742 3300050514 nmdc:mga08x19_25054_c1 nmdc:mga08x19_25054_c1_150_521 123
743 3300050514 nmdc:mga08x19_742534_c1 nmdc:mga08x19_742534_c1_54_428 123
744 3300050515 nmdc:mga0a205_332786_c1 nmdc:mga0a205_332786_c1_839_1210 123
745 3300050515 nmdc:mga0a205_619889_c1 nmdc:mga0a205_619889_c1_190_561 123
746 3300053085 Ga0495619_0053326 Ga0495619_0053326_1973_2344 123

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00507

Oxidored_q4

NADH-ubiquinone/plastoquinone oxidoreductase, chain 3

37

139

0.93

Feature Viewer

pLDDT pTM Quality
78.74 0.46 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map