F478869
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 746 | 284 | 746 | 123 |
Family's Representative Sequence
| Representative Sequence | 3300025933|Ga0207706_10324860|Ga0207706_103248602 |
| Length | 141 |
| Sequence | MPLSTPKDARKRPPAGRKPDDGYDPVLLQAIIAIGFAVGALVVSVLLGKSGVRTRTKDSAYECGMLPQGEAQPRFSVKFYLVAMLFILFDLEIVFMYPWAVVYRESIASSHVIFWSMLSFVSILMVGYVYALKKGAFDWKT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 3300000531 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 4 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 5 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 6 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 7 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 10 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 11 | 3300005272 | Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 | Metagenome | Rhizosphere |
| 12 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 14 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 15 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 69 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 82 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 83 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 84 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 85 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 86 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 87 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 88 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 99 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300012513 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 | Metagenome | Rhizosphere |
| 101 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 113 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 115 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 116 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 117 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 118 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 119 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 120 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 175 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 176 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 177 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 178 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 179 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 180 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 181 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 182 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 183 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 184 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 185 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 186 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 187 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 188 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 190 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 191 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 192 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 193 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 194 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 195 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 196 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 197 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 198 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 199 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 202 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 203 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 204 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 205 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 206 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 207 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 208 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 209 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 210 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 211 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 212 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 213 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 214 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 215 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 216 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 218 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 219 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 220 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 221 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 222 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 223 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 224 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 225 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 226 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 263 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 264 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 265 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 266 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 267 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 268 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 269 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 270 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 271 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 272 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 273 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 274 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 275 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 276 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 277 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 278 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 279 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 280 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.33 |
| Metatranscriptomes | 0.67 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.13 |
| Nodule | 0 |
| Rhizoplane | 6.03 |
| Rhizosphere | 92.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MBSR1b_contig_10906538 | 2162886012 | Unclassified | 838 |
| 2 | CNBas_1013603 | 3300000531 | Bacteria | 515 |
| 3 | CNXas_1000075 | 3300000545 | Bacteria | 18549 |
| 4 | JGI24746J21847_1018653 | 3300001977 | Unclassified | 980 |
| 5 | JGI24739J22299_10233805 | 3300001989 | Unclassified | 538 |
| 6 | JGI24743J22301_10058062 | 3300001991 | Unclassified | 794 |
| 7 | JGI24750J21931_1037984 | 3300002070 | Unclassified | 725 |
| 8 | JGI25406J46586_10088582 | 3300003203 | Bacteria | 937 |
| 9 | JGI25406J46586_10110274 | 3300003203 | Bacteria | 815 |
| 10 | rootH1_10150751 | 3300003316 | Bacteria | 3127 |
| 11 | rootL2_10317932 | 3300003322 | Bacteria | 2948 |
| 12 | Ga0065703_1023045 | 3300005272 | Bacteria | 765 |
| 13 | Ga0065704_10016990 | 3300005289 | Bacteria | 1263 |
| 14 | Ga0065712_10011282 | 3300005290 | Bacteria | 1859 |
| 15 | Ga0065712_10025123 | 3300005290 | Bacteria | 1402 |
| 16 | Ga0065712_10143914 | 3300005290 | Bacteria | 1389 |
| 17 | Ga0065712_10175923 | 3300005290 | Unclassified | 1215 |
| 18 | Ga0065712_10565745 | 3300005290 | Unclassified | 609 |
| 19 | Ga0065715_10010884 | 3300005293 | Bacteria | 2487 |
| 20 | Ga0065715_10345151 | 3300005293 | Bacteria | 960 |
| 21 | Ga0065715_10365534 | 3300005293 | Unclassified | 919 |
| 22 | Ga0065715_10405355 | 3300005293 | Bacteria | 876 |
| 23 | Ga0065715_10759095 | 3300005293 | Unclassified | 627 |
| 24 | Ga0065707_10006945 | 3300005295 | Bacteria | 3988 |
| 25 | Ga0065707_10197376 | 3300005295 | Bacteria | 1328 |
| 26 | Ga0070658_10111100 | 3300005327 | Bacteria | 2271 |
| 27 | Ga0070676_10010812 | 3300005328 | Bacteria | 4952 |
| 28 | Ga0070676_10286500 | 3300005328 | Bacteria | 1112 |
| 29 | Ga0070676_10518752 | 3300005328 | Unclassified | 848 |
| 30 | Ga0070676_10681742 | 3300005328 | Unclassified | 749 |
| 31 | Ga0070690_100078353 | 3300005330 | Bacteria | 2159 |
| 32 | Ga0070690_100128856 | 3300005330 | Bacteria | 1706 |
| 33 | Ga0070690_100883550 | 3300005330 | Bacteria | 698 |
| 34 | Ga0070670_100004474 | 3300005331 | Bacteria | 11709 |
| 35 | Ga0070670_100005662 | 3300005331 | Bacteria | 10544 |
| 36 | Ga0070670_100110578 | 3300005331 | Bacteria | 2367 |
| 37 | Ga0070670_100136614 | 3300005331 | Bacteria | 2119 |
| 38 | Ga0070670_100298824 | 3300005331 | Bacteria | 1408 |
| 39 | Ga0070670_100933561 | 3300005331 | Bacteria | 787 |
| 40 | Ga0070677_10020745 | 3300005333 | Bacteria | 2399 |
| 41 | Ga0070677_10380217 | 3300005333 | Bacteria | 739 |
| 42 | Ga0068869_100168634 | 3300005334 | Bacteria | 1709 |
| 43 | Ga0068869_100268514 | 3300005334 | Bacteria | 1368 |
| 44 | Ga0068869_100898900 | 3300005334 | Unclassified | 766 |
| 45 | Ga0070666_10003567 | 3300005335 | Bacteria | 9436 |
| 46 | Ga0070666_10020162 | 3300005335 | Unclassified | 4308 |
| 47 | Ga0070666_10079986 | 3300005335 | Bacteria | 2233 |
| 48 | Ga0070666_10158285 | 3300005335 | Bacteria | 1582 |
| 49 | Ga0070680_100795732 | 3300005336 | Bacteria | 815 |
| 50 | Ga0068868_100731574 | 3300005338 | Bacteria | 887 |
| 51 | Ga0068868_100934788 | 3300005338 | Bacteria | 790 |
| 52 | Ga0068868_101768189 | 3300005338 | Bacteria | 584 |
| 53 | Ga0070660_100426316 | 3300005339 | Bacteria | 1099 |
| 54 | Ga0070689_100008216 | 3300005340 | Bacteria | 7338 |
| 55 | Ga0070689_100052879 | 3300005340 | Bacteria | 3142 |
| 56 | Ga0070689_100197408 | 3300005340 | Bacteria | 1641 |
| 57 | Ga0070689_100273636 | 3300005340 | Unclassified | 1399 |
| 58 | Ga0070689_100771041 | 3300005340 | Unclassified | 844 |
| 59 | Ga0070687_100001607 | 3300005343 | Bacteria | 8045 |
| 60 | Ga0070687_100043763 | 3300005343 | Bacteria | 2277 |
| 61 | Ga0070687_100158147 | 3300005343 | Bacteria | 1337 |
| 62 | Ga0070661_100206258 | 3300005344 | Unclassified | 1503 |
| 63 | Ga0070661_100298744 | 3300005344 | Bacteria | 1253 |
| 64 | Ga0070668_100000836 | 3300005347 | Bacteria | 21289 |
| 65 | Ga0070668_100060271 | 3300005347 | Bacteria | 2938 |
| 66 | Ga0070668_100238498 | 3300005347 | Bacteria | 1505 |
| 67 | Ga0070668_100307145 | 3300005347 | Bacteria | 1332 |
| 68 | Ga0070669_100007775 | 3300005353 | Bacteria | 7658 |
| 69 | Ga0070669_100012298 | 3300005353 | Bacteria | 6073 |
| 70 | Ga0070669_100012867 | 3300005353 | Bacteria | 5942 |
| 71 | Ga0070669_100015656 | 3300005353 | Bacteria | 5407 |
| 72 | Ga0070669_100203623 | 3300005353 | Bacteria | 1558 |
| 73 | Ga0070669_100306043 | 3300005353 | Bacteria | 1279 |
| 74 | Ga0070669_100444288 | 3300005353 | Bacteria | 1068 |
| 75 | Ga0070675_100009115 | 3300005354 | Bacteria | 7707 |
| 76 | Ga0070675_100062758 | 3300005354 | Bacteria | 3070 |
| 77 | Ga0070675_100181273 | 3300005354 | Bacteria | 1821 |
| 78 | Ga0070675_100292935 | 3300005354 | Bacteria | 1432 |
| 79 | Ga0070675_100511743 | 3300005354 | Bacteria | 1082 |
| 80 | Ga0070671_100007786 | 3300005355 | Bacteria | 8560 |
| 81 | Ga0070671_100018241 | 3300005355 | Bacteria | 5698 |
| 82 | Ga0070671_100021568 | 3300005355 | Bacteria | 5261 |
| 83 | Ga0070671_100124210 | 3300005355 | Bacteria | 2172 |
| 84 | Ga0070671_100251728 | 3300005355 | Bacteria | 1501 |
| 85 | Ga0070671_100347563 | 3300005355 | Unclassified | 1266 |
| 86 | Ga0070671_100543440 | 3300005355 | Bacteria | 1001 |
| 87 | Ga0070671_100627797 | 3300005355 | Bacteria | 929 |
| 88 | Ga0070671_100633075 | 3300005355 | Bacteria | 925 |
| 89 | Ga0070671_100640545 | 3300005355 | Bacteria | 920 |
| 90 | Ga0070674_100000816 | 3300005356 | Bacteria | 16069 |
| 91 | Ga0070674_100066011 | 3300005356 | Bacteria | 2541 |
| 92 | Ga0070674_100090211 | 3300005356 | Bacteria | 2210 |
| 93 | Ga0070674_100449560 | 3300005356 | Bacteria | 1063 |
| 94 | Ga0070673_100004390 | 3300005364 | Bacteria | 8915 |
| 95 | Ga0070673_100161221 | 3300005364 | Bacteria | 1907 |
| 96 | Ga0070673_100233448 | 3300005364 | Bacteria | 1596 |
| 97 | Ga0070673_100306459 | 3300005364 | Unclassified | 1400 |
| 98 | Ga0070673_100685424 | 3300005364 | Unclassified | 940 |
| 99 | Ga0070673_101809791 | 3300005364 | Bacteria | 579 |
| 100 | Ga0070688_100001751 | 3300005365 | Bacteria | 10842 |
| 101 | Ga0070688_101545172 | 3300005365 | Bacteria | 541 |
| 102 | Ga0070659_100852800 | 3300005366 | Unclassified | 794 |
| 103 | Ga0070667_100021783 | 3300005367 | Bacteria | 5318 |
| 104 | Ga0070667_100030175 | 3300005367 | Bacteria | 4521 |
| 105 | Ga0070667_100038282 | 3300005367 | Bacteria | 4021 |
| 106 | Ga0070667_100180554 | 3300005367 | Bacteria | 1866 |
| 107 | Ga0070667_102283360 | 3300005367 | Unclassified | 509 |
| 108 | Ga0070703_10306227 | 3300005406 | Unclassified | 664 |
| 109 | Ga0070703_10559805 | 3300005406 | Bacteria | 522 |
| 110 | Ga0070709_10087421 | 3300005434 | Bacteria | 2048 |
| 111 | Ga0070709_10256388 | 3300005434 | Unclassified | 1262 |
| 112 | Ga0070709_10455436 | 3300005434 | Bacteria | 964 |
| 113 | Ga0070714_100020574 | 3300005435 | Bacteria | 5392 |
| 114 | Ga0070714_100082260 | 3300005435 | Unclassified | 2805 |
| 115 | Ga0070714_100135745 | 3300005435 | Bacteria | 2203 |
| 116 | Ga0070714_100305203 | 3300005435 | Bacteria | 1485 |
| 117 | Ga0070714_100440101 | 3300005435 | Bacteria | 1237 |
| 118 | Ga0070714_100494073 | 3300005435 | Bacteria | 1166 |
| 119 | Ga0070714_101056619 | 3300005435 | Unclassified | 791 |
| 120 | Ga0070713_100271334 | 3300005436 | Unclassified | 1553 |
| 121 | Ga0070713_100272199 | 3300005436 | Bacteria | 1551 |
| 122 | Ga0070713_100307993 | 3300005436 | Bacteria | 1460 |
| 123 | Ga0070713_100718164 | 3300005436 | Bacteria | 955 |
| 124 | Ga0070713_100890916 | 3300005436 | Bacteria | 855 |
| 125 | Ga0070713_101093430 | 3300005436 | Bacteria | 770 |
| 126 | Ga0070710_10043991 | 3300005437 | Bacteria | 2476 |
| 127 | Ga0070710_10431404 | 3300005437 | Bacteria | 889 |
| 128 | Ga0070710_10541690 | 3300005437 | Bacteria | 803 |
| 129 | Ga0070710_10558249 | 3300005437 | Bacteria | 792 |
| 130 | Ga0070710_10591099 | 3300005437 | Unclassified | 771 |
| 131 | Ga0070711_100013195 | 3300005439 | Bacteria | 5184 |
| 132 | Ga0070711_100026223 | 3300005439 | Bacteria | 3818 |
| 133 | Ga0070711_100336495 | 3300005439 | Bacteria | 1210 |
| 134 | Ga0070711_100719869 | 3300005439 | Bacteria | 841 |
| 135 | Ga0070705_100007587 | 3300005440 | Bacteria | 5345 |
| 136 | Ga0070705_100110705 | 3300005440 | Bacteria | 1754 |
| 137 | Ga0070705_100177714 | 3300005440 | Bacteria | 1439 |
| 138 | Ga0070705_100270215 | 3300005440 | Bacteria | 1204 |
| 139 | Ga0070705_100359731 | 3300005440 | Bacteria | 1064 |
| 140 | Ga0070705_101016102 | 3300005440 | Unclassified | 674 |
| 141 | Ga0070700_100817619 | 3300005441 | Unclassified | 752 |
| 142 | Ga0070694_100131997 | 3300005444 | Bacteria | 1805 |
| 143 | Ga0070694_100186380 | 3300005444 | Bacteria | 1538 |
| 144 | Ga0070708_100004838 | 3300005445 | Bacteria | 10624 |
| 145 | Ga0070708_100010491 | 3300005445 | Bacteria | 7512 |
| 146 | Ga0070708_100016567 | 3300005445 | Bacteria | 6120 |
| 147 | Ga0070708_100023132 | 3300005445 | Bacteria | 5279 |
| 148 | Ga0070708_100170012 | 3300005445 | Unclassified | 2034 |
| 149 | Ga0070708_100185905 | 3300005445 | Bacteria | 1943 |
| 150 | Ga0070708_100257375 | 3300005445 | Unclassified | 1640 |
| 151 | Ga0070708_100383417 | 3300005445 | Bacteria | 1325 |
| 152 | Ga0070708_100409508 | 3300005445 | Unclassified | 1279 |
| 153 | Ga0070708_101029846 | 3300005445 | Bacteria | 772 |
| 154 | Ga0070708_101110226 | 3300005445 | Bacteria | 741 |
| 155 | Ga0070663_100378558 | 3300005455 | Unclassified | 1152 |
| 156 | Ga0070678_100001971 | 3300005456 | Bacteria | 11086 |
| 157 | Ga0070678_100041684 | 3300005456 | Bacteria | 3256 |
| 158 | Ga0070678_100123728 | 3300005456 | Bacteria | 2044 |
| 159 | Ga0070678_100210566 | 3300005456 | Bacteria | 1610 |
| 160 | Ga0070662_100020162 | 3300005457 | Unclassified | 4537 |
| 161 | Ga0070662_101020375 | 3300005457 | Bacteria | 709 |
| 162 | Ga0068867_100014539 | 3300005459 | Bacteria | 5579 |
| 163 | Ga0070685_10242682 | 3300005466 | Unclassified | 1190 |
| 164 | Ga0070706_100000462 | 3300005467 | Bacteria | 48224 |
| 165 | Ga0070706_100008839 | 3300005467 | Bacteria | 9386 |
| 166 | Ga0070706_100021324 | 3300005467 | Bacteria | 5967 |
| 167 | Ga0070706_100022886 | 3300005467 | Bacteria | 5755 |
| 168 | Ga0070706_100035784 | 3300005467 | Bacteria | 4585 |
| 169 | Ga0070706_100055509 | 3300005467 | Bacteria | 3656 |
| 170 | Ga0070706_100091006 | 3300005467 | Bacteria | 2829 |
| 171 | Ga0070706_100205972 | 3300005467 | Unclassified | 1837 |
| 172 | Ga0070706_100225308 | 3300005467 | Bacteria | 1750 |
| 173 | Ga0070706_100439735 | 3300005467 | Bacteria | 1214 |
| 174 | Ga0070706_100455511 | 3300005467 | Bacteria | 1190 |
| 175 | Ga0070706_100494904 | 3300005467 | Unclassified | 1138 |
| 176 | Ga0070707_100000140 | 3300005468 | Bacteria | 68016 |
| 177 | Ga0070707_100024766 | 3300005468 | Bacteria | 5689 |
| 178 | Ga0070707_100025477 | 3300005468 | Bacteria | 5611 |
| 179 | Ga0070707_100026733 | 3300005468 | Bacteria | 5482 |
| 180 | Ga0070707_100034565 | 3300005468 | Bacteria | 4821 |
| 181 | Ga0070707_100069579 | 3300005468 | Bacteria | 3389 |
| 182 | Ga0070707_100096769 | 3300005468 | Bacteria | 2859 |
| 183 | Ga0070707_100183426 | 3300005468 | Unclassified | 2040 |
| 184 | Ga0070707_100288022 | 3300005468 | Unclassified | 1596 |
| 185 | Ga0070707_100376656 | 3300005468 | Bacteria | 1379 |
| 186 | Ga0070707_101186129 | 3300005468 | Unclassified | 730 |
| 187 | Ga0070698_100019524 | 3300005471 | Bacteria | 7113 |
| 188 | Ga0070698_100333310 | 3300005471 | Bacteria | 1448 |
| 189 | Ga0070698_100341777 | 3300005471 | Unclassified | 1428 |
| 190 | Ga0070698_100921865 | 3300005471 | Unclassified | 820 |
| 191 | Ga0070699_100022015 | 3300005518 | Bacteria | 5490 |
| 192 | Ga0070699_100047039 | 3300005518 | Bacteria | 3732 |
| 193 | Ga0070699_100216745 | 3300005518 | Bacteria | 1705 |
| 194 | Ga0070699_100420897 | 3300005518 | Bacteria | 1209 |
| 195 | Ga0070699_100434220 | 3300005518 | Bacteria | 1190 |
| 196 | Ga0070699_100831101 | 3300005518 | Bacteria | 845 |
| 197 | Ga0070699_101724408 | 3300005518 | Bacteria | 574 |
| 198 | Ga0070697_100001331 | 3300005536 | Bacteria | 18668 |
| 199 | Ga0070697_100009941 | 3300005536 | Bacteria | 7422 |
| 200 | Ga0070697_100017072 | 3300005536 | Bacteria | 5709 |
| 201 | Ga0070697_100029828 | 3300005536 | Unclassified | 4377 |
| 202 | Ga0070697_100045652 | 3300005536 | Unclassified | 3551 |
| 203 | Ga0070697_100057459 | 3300005536 | Bacteria | 3165 |
| 204 | Ga0070697_100059485 | 3300005536 | Bacteria | 3111 |
| 205 | Ga0070697_100077262 | 3300005536 | Bacteria | 2738 |
| 206 | Ga0070697_100088500 | 3300005536 | Bacteria | 2557 |
| 207 | Ga0070697_100350898 | 3300005536 | Unclassified | 1274 |
| 208 | Ga0070697_100456903 | 3300005536 | Unclassified | 1113 |
| 209 | Ga0070697_100465301 | 3300005536 | Unclassified | 1103 |
| 210 | Ga0070697_100994535 | 3300005536 | Bacteria | 745 |
| 211 | Ga0070697_101072407 | 3300005536 | Unclassified | 717 |
| 212 | Ga0070672_100004681 | 3300005543 | Bacteria | 8970 |
| 213 | Ga0070672_100345602 | 3300005543 | Unclassified | 1267 |
| 214 | Ga0070672_100950036 | 3300005543 | Bacteria | 761 |
| 215 | Ga0070695_100080838 | 3300005545 | Bacteria | 2149 |
| 216 | Ga0070696_100184588 | 3300005546 | Unclassified | 1549 |
| 217 | Ga0070696_100287305 | 3300005546 | Bacteria | 1255 |
| 218 | Ga0070693_100086081 | 3300005547 | Bacteria | 1885 |
| 219 | Ga0070665_100085431 | 3300005548 | Unclassified | 3161 |
| 220 | Ga0070665_100631098 | 3300005548 | Unclassified | 1084 |
| 221 | Ga0070665_101002345 | 3300005548 | Unclassified | 847 |
| 222 | Ga0070704_100223850 | 3300005549 | Bacteria | 1531 |
| 223 | Ga0070704_100441156 | 3300005549 | Bacteria | 1119 |
| 224 | Ga0068855_100161370 | 3300005563 | Unclassified | 2544 |
| 225 | Ga0068855_100559227 | 3300005563 | Bacteria | 1237 |
| 226 | Ga0070664_100182784 | 3300005564 | Bacteria | 1864 |
| 227 | Ga0068864_100273730 | 3300005618 | Bacteria | 1574 |
| 228 | Ga0068866_10316631 | 3300005718 | Bacteria | 980 |
| 229 | Ga0068863_100665324 | 3300005841 | Bacteria | 1033 |
| 230 | Ga0068858_100669252 | 3300005842 | Bacteria | 1009 |
| 231 | Ga0068858_101330710 | 3300005842 | Bacteria | 707 |
| 232 | Ga0068860_100080627 | 3300005843 | Unclassified | 3094 |
| 233 | Ga0068860_100163408 | 3300005843 | Bacteria | 2148 |
| 234 | Ga0068860_100342582 | 3300005843 | Bacteria | 1470 |
| 235 | Ga0068862_100133256 | 3300005844 | Bacteria | 2200 |
| 236 | Ga0081455_10221166 | 3300005937 | Bacteria | 1403 |
| 237 | Ga0081539_10000061 | 3300005985 | Bacteria | 250890 |
| 238 | Ga0081539_10000971 | 3300005985 | Bacteria | 53608 |
| 239 | Ga0081539_10030103 | 3300005985 | Bacteria | 3377 |
| 240 | Ga0081539_10124345 | 3300005985 | Bacteria | 1276 |
| 241 | Ga0070717_10000793 | 3300006028 | Bacteria | 20762 |
| 242 | Ga0070717_10010827 | 3300006028 | Bacteria | 6902 |
| 243 | Ga0070717_10290963 | 3300006028 | Bacteria | 1450 |
| 244 | Ga0070717_10290964 | 3300006028 | Bacteria | 1450 |
| 245 | Ga0070717_10453366 | 3300006028 | Bacteria | 1156 |
| 246 | Ga0070717_10851515 | 3300006028 | Bacteria | 830 |
| 247 | Ga0070715_10204647 | 3300006163 | Bacteria | 1005 |
| 248 | Ga0070715_10339272 | 3300006163 | Unclassified | 817 |
| 249 | Ga0070715_10485118 | 3300006163 | Bacteria | 704 |
| 250 | Ga0070716_100249271 | 3300006173 | Bacteria | 1209 |
| 251 | Ga0070716_100290516 | 3300006173 | Unclassified | 1132 |
| 252 | Ga0070716_100351951 | 3300006173 | Unclassified | 1043 |
| 253 | Ga0070716_100393171 | 3300006173 | Bacteria | 995 |
| 254 | Ga0070716_100618626 | 3300006173 | Bacteria | 817 |
| 255 | Ga0070716_101248760 | 3300006173 | Unclassified | 598 |
| 256 | Ga0070712_100007081 | 3300006175 | Bacteria | 6994 |
| 257 | Ga0070712_100011407 | 3300006175 | Bacteria | 5633 |
| 258 | Ga0070712_100067270 | 3300006175 | Bacteria | 2549 |
| 259 | Ga0070712_100287614 | 3300006175 | Bacteria | 1326 |
| 260 | Ga0070712_100342360 | 3300006175 | Bacteria | 1221 |
| 261 | Ga0070712_100550074 | 3300006175 | Bacteria | 972 |
| 262 | Ga0070712_100802108 | 3300006175 | Bacteria | 808 |
| 263 | Ga0070712_101088250 | 3300006175 | Bacteria | 693 |
| 264 | Ga0070712_101713405 | 3300006175 | Bacteria | 550 |
| 265 | Ga0097621_100005822 | 3300006237 | Bacteria | 8704 |
| 266 | Ga0097621_100082048 | 3300006237 | Bacteria | 2684 |
| 267 | Ga0097621_100260443 | 3300006237 | Bacteria | 1521 |
| 268 | Ga0097621_100595333 | 3300006237 | Bacteria | 1010 |
| 269 | Ga0097621_101869172 | 3300006237 | Bacteria | 573 |
| 270 | Ga0075370_10859779 | 3300006353 | Bacteria | 554 |
| 271 | Ga0068871_100009985 | 3300006358 | Bacteria | 6899 |
| 272 | Ga0068871_100022789 | 3300006358 | Bacteria | 4833 |
| 273 | Ga0068871_100031335 | 3300006358 | Bacteria | 4193 |
| 274 | Ga0068871_100061238 | 3300006358 | Bacteria | 3073 |
| 275 | Ga0068871_100513008 | 3300006358 | Bacteria | 1082 |
| 276 | Ga0075431_100580607 | 3300006847 | Bacteria | 1106 |
| 277 | Ga0075431_102201433 | 3300006847 | Unclassified | 506 |
| 278 | Ga0075433_10929573 | 3300006852 | Unclassified | 758 |
| 279 | Ga0075434_100452700 | 3300006871 | Bacteria | 1305 |
| 280 | Ga0075429_100971690 | 3300006880 | Bacteria | 743 |
| 281 | Ga0068865_100142510 | 3300006881 | Bacteria | 1808 |
| 282 | Ga0068865_100256758 | 3300006881 | Bacteria | 1382 |
| 283 | Ga0068865_100445953 | 3300006881 | Unclassified | 1069 |
| 284 | Ga0075436_100061108 | 3300006914 | Bacteria | 2603 |
| 285 | Ga0075435_101420555 | 3300007076 | Bacteria | 608 |
| 286 | Ga0105240_10268833 | 3300009093 | Unclassified | 1964 |
| 287 | Ga0111539_10184244 | 3300009094 | Bacteria | 2438 |
| 288 | Ga0105245_10011372 | 3300009098 | Bacteria | 7751 |
| 289 | Ga0105245_10281277 | 3300009098 | Bacteria | 1626 |
| 290 | Ga0105245_10418547 | 3300009098 | Bacteria | 1343 |
| 291 | Ga0105245_10426254 | 3300009098 | Bacteria | 1330 |
| 292 | Ga0105245_12094761 | 3300009098 | Unclassified | 619 |
| 293 | Ga0105245_13047337 | 3300009098 | Bacteria | 519 |
| 294 | Ga0114129_10098289 | 3300009147 | Unclassified | 4051 |
| 295 | Ga0105243_10361812 | 3300009148 | Bacteria | 1336 |
| 296 | Ga0105241_11846914 | 3300009174 | Bacteria | 591 |
| 297 | Ga0105242_10295843 | 3300009176 | Bacteria | 1476 |
| 298 | Ga0105248_12270943 | 3300009177 | Bacteria | 618 |
| 299 | Ga0105237_10003109 | 3300009545 | Bacteria | 19993 |
| 300 | Ga0105237_10346798 | 3300009545 | Unclassified | 1489 |
| 301 | Ga0105249_10021221 | 3300009553 | Bacteria | 5815 |
| 302 | Ga0105249_10712780 | 3300009553 | Unclassified | 1064 |
| 303 | Ga0099796_10339526 | 3300010159 | Bacteria | 645 |
| 304 | Ga0105239_10784053 | 3300010375 | Unclassified | 1092 |
| 305 | Ga0105239_11640665 | 3300010375 | Unclassified | 744 |
| 306 | Ga0105239_12603863 | 3300010375 | Bacteria | 590 |
| 307 | Ga0157326_1036533 | 3300012513 | Unclassified | 673 |
| 308 | Ga0157373_10594382 | 3300013100 | Bacteria | 805 |
| 309 | Ga0157371_10364938 | 3300013102 | Bacteria | 1053 |
| 310 | Ga0157374_10000068 | 3300013296 | Bacteria | 106195 |
| 311 | Ga0157374_10029411 | 3300013296 | Bacteria | 4975 |
| 312 | Ga0157374_10040211 | 3300013296 | Unclassified | 4305 |
| 313 | Ga0157374_10055924 | 3300013296 | Bacteria | 3683 |
| 314 | Ga0157374_10206760 | 3300013296 | Unclassified | 1924 |
| 315 | Ga0157374_10784036 | 3300013296 | Bacteria | 969 |
| 316 | Ga0157374_10869535 | 3300013296 | Bacteria | 919 |
| 317 | Ga0157374_12490023 | 3300013296 | Unclassified | 545 |
| 318 | Ga0157378_10025408 | 3300013297 | Bacteria | 5216 |
| 319 | Ga0157378_10027846 | 3300013297 | Bacteria | 4984 |
| 320 | Ga0157378_10043795 | 3300013297 | Bacteria | 3973 |
| 321 | Ga0157378_10052208 | 3300013297 | Unclassified | 3638 |
| 322 | Ga0157378_10094089 | 3300013297 | Unclassified | 2729 |
| 323 | Ga0157378_10191086 | 3300013297 | Bacteria | 1931 |
| 324 | Ga0157378_10262444 | 3300013297 | Bacteria | 1658 |
| 325 | Ga0157378_10354152 | 3300013297 | Bacteria | 1435 |
| 326 | Ga0157378_10426915 | 3300013297 | Bacteria | 1311 |
| 327 | Ga0157378_10835272 | 3300013297 | Unclassified | 949 |
| 328 | Ga0157378_10970901 | 3300013297 | Bacteria | 883 |
| 329 | Ga0157378_11333005 | 3300013297 | Unclassified | 759 |
| 330 | Ga0157378_11648334 | 3300013297 | Unclassified | 688 |
| 331 | Ga0157378_12227312 | 3300013297 | Archaea | 599 |
| 332 | Ga0157378_12556262 | 3300013297 | Bacteria | 563 |
| 333 | Ga0163162_10015504 | 3300013306 | Bacteria | 7448 |
| 334 | Ga0163162_10050676 | 3300013306 | Unclassified | 4163 |
| 335 | Ga0163162_10054224 | 3300013306 | Unclassified | 4032 |
| 336 | Ga0163162_10083884 | 3300013306 | Bacteria | 3261 |
| 337 | Ga0163162_10086927 | 3300013306 | Bacteria | 3204 |
| 338 | Ga0163162_10125953 | 3300013306 | Bacteria | 2668 |
| 339 | Ga0163162_10275066 | 3300013306 | Bacteria | 1816 |
| 340 | Ga0163162_10996557 | 3300013306 | Unclassified | 947 |
| 341 | Ga0157372_10027573 | 3300013307 | Bacteria | 6189 |
| 342 | Ga0157372_10063655 | 3300013307 | Unclassified | 4136 |
| 343 | Ga0157372_10113959 | 3300013307 | Bacteria | 3099 |
| 344 | Ga0157372_10377527 | 3300013307 | Unclassified | 1652 |
| 345 | Ga0157372_10543656 | 3300013307 | Bacteria | 1354 |
| 346 | Ga0157372_11018055 | 3300013307 | Bacteria | 959 |
| 347 | Ga0157375_10006218 | 3300013308 | Bacteria | 10399 |
| 348 | Ga0157375_10007176 | 3300013308 | Bacteria | 9738 |
| 349 | Ga0157375_10777261 | 3300013308 | Bacteria | 1107 |
| 350 | Ga0157375_12100738 | 3300013308 | Bacteria | 672 |
| 351 | Ga0157375_12757746 | 3300013308 | Unclassified | 587 |
| 352 | Ga0163163_10089916 | 3300014325 | Unclassified | 3083 |
| 353 | Ga0163163_10589669 | 3300014325 | Bacteria | 1175 |
| 354 | Ga0157379_10118681 | 3300014968 | Bacteria | 2379 |
| 355 | Ga0157379_10359982 | 3300014968 | Archaea | 1333 |
| 356 | Ga0157379_10643462 | 3300014968 | Bacteria | 992 |
| 357 | Ga0157376_10010878 | 3300014969 | Bacteria | 6681 |
| 358 | Ga0157376_10060696 | 3300014969 | Bacteria | 3176 |
| 359 | Ga0157376_10229106 | 3300014969 | Bacteria | 1725 |
| 360 | Ga0157376_10257366 | 3300014969 | Bacteria | 1633 |
| 361 | Ga0157376_10351200 | 3300014969 | Unclassified | 1411 |
| 362 | Ga0157376_10672494 | 3300014969 | Unclassified | 1038 |
| 363 | Ga0157376_11442162 | 3300014969 | Bacteria | 721 |
| 364 | Ga0163161_10008436 | 3300017792 | Bacteria | 7134 |
| 365 | Ga0163161_10069036 | 3300017792 | Bacteria | 2583 |
| 366 | Ga0163161_10858962 | 3300017792 | Unclassified | 766 |
| 367 | Ga0206351_10539719 | 3300020077 | Bacteria | 965 |
| 368 | Ga0206351_10792315 | 3300020077 | Bacteria | 835 |
| 369 | Ga0206350_10137531 | 3300020080 | Unclassified | 808 |
| 370 | Ga0154015_1647084 | 3300020610 | Unclassified | 1150 |
| 371 | Ga0213872_10070266 | 3300021361 | Bacteria | 1579 |
| 372 | Ga0213872_10091008 | 3300021361 | Bacteria | 1365 |
| 373 | Ga0213872_10106613 | 3300021361 | Unclassified | 1247 |
| 374 | Ga0213874_10206192 | 3300021377 | Unclassified | 709 |
| 375 | Ga0213876_10001439 | 3300021384 | Bacteria | 14812 |
| 376 | Ga0213876_10525509 | 3300021384 | Unclassified | 630 |
| 377 | Ga0213875_10133793 | 3300021388 | Bacteria | 1159 |
| 378 | Ga0213871_10005016 | 3300021441 | Bacteria | 2700 |
| 379 | Ga0224712_10252954 | 3300022467 | Bacteria | 814 |
| 380 | Ga0207673_1013859 | 3300025290 | Bacteria | 1060 |
| 381 | Ga0207673_1020936 | 3300025290 | Unclassified | 884 |
| 382 | Ga0207697_10000118 | 3300025315 | Bacteria | 37510 |
| 383 | Ga0207697_10000734 | 3300025315 | Bacteria | 18602 |
| 384 | Ga0207697_10000986 | 3300025315 | Bacteria | 15919 |
| 385 | Ga0207697_10003844 | 3300025315 | Bacteria | 7325 |
| 386 | Ga0207697_10087118 | 3300025315 | Bacteria | 1321 |
| 387 | Ga0207653_10110549 | 3300025885 | Bacteria | 980 |
| 388 | Ga0207682_10082233 | 3300025893 | Bacteria | 1382 |
| 389 | Ga0207692_10207624 | 3300025898 | Bacteria | 1155 |
| 390 | Ga0207692_10458511 | 3300025898 | Bacteria | 803 |
| 391 | Ga0207692_10518236 | 3300025898 | Bacteria | 758 |
| 392 | Ga0207692_10931846 | 3300025898 | Bacteria | 572 |
| 393 | Ga0207642_10154459 | 3300025899 | Bacteria | 1226 |
| 394 | Ga0207642_10249355 | 3300025899 | Bacteria | 1007 |
| 395 | Ga0207688_10000809 | 3300025901 | Bacteria | 15639 |
| 396 | Ga0207688_10005559 | 3300025901 | Bacteria | 6854 |
| 397 | Ga0207688_10047402 | 3300025901 | Unclassified | 2400 |
| 398 | Ga0207680_10006421 | 3300025903 | Bacteria | 5687 |
| 399 | Ga0207680_10188942 | 3300025903 | Unclassified | 1397 |
| 400 | Ga0207680_10271437 | 3300025903 | Unclassified | 1176 |
| 401 | Ga0207680_10307966 | 3300025903 | Bacteria | 1105 |
| 402 | Ga0207685_10004631 | 3300025905 | Bacteria | 3528 |
| 403 | Ga0207699_10239725 | 3300025906 | Bacteria | 1245 |
| 404 | Ga0207699_10406395 | 3300025906 | Bacteria | 970 |
| 405 | Ga0207699_10431900 | 3300025906 | Bacteria | 942 |
| 406 | Ga0207645_10002605 | 3300025907 | Bacteria | 14065 |
| 407 | Ga0207645_10003810 | 3300025907 | Bacteria | 11307 |
| 408 | Ga0207645_10006174 | 3300025907 | Bacteria | 8603 |
| 409 | Ga0207645_10008430 | 3300025907 | Bacteria | 7190 |
| 410 | Ga0207645_10207312 | 3300025907 | Unclassified | 1290 |
| 411 | Ga0207645_10251424 | 3300025907 | Unclassified | 1169 |
| 412 | Ga0207684_10000512 | 3300025910 | Bacteria | 48238 |
| 413 | Ga0207684_10014154 | 3300025910 | Bacteria | 6885 |
| 414 | Ga0207684_10033430 | 3300025910 | Bacteria | 4373 |
| 415 | Ga0207684_10034454 | 3300025910 | Bacteria | 4302 |
| 416 | Ga0207684_10061461 | 3300025910 | Bacteria | 3190 |
| 417 | Ga0207684_10112733 | 3300025910 | Bacteria | 2328 |
| 418 | Ga0207684_10167899 | 3300025910 | Bacteria | 1891 |
| 419 | Ga0207684_10268927 | 3300025910 | Unclassified | 1471 |
| 420 | Ga0207684_10348086 | 3300025910 | Unclassified | 1276 |
| 421 | Ga0207684_10349412 | 3300025910 | Bacteria | 1273 |
| 422 | Ga0207684_11180421 | 3300025910 | Unclassified | 634 |
| 423 | Ga0207671_10002384 | 3300025914 | Bacteria | 20174 |
| 424 | Ga0207693_10002803 | 3300025915 | Bacteria | 15109 |
| 425 | Ga0207693_10006881 | 3300025915 | Bacteria | 9393 |
| 426 | Ga0207693_10017486 | 3300025915 | Bacteria | 5719 |
| 427 | Ga0207693_10084846 | 3300025915 | Bacteria | 2481 |
| 428 | Ga0207693_10097798 | 3300025915 | Bacteria | 2302 |
| 429 | Ga0207693_10176704 | 3300025915 | Bacteria | 1680 |
| 430 | Ga0207693_10653095 | 3300025915 | Bacteria | 817 |
| 431 | Ga0207693_10817970 | 3300025915 | Bacteria | 717 |
| 432 | Ga0207693_11159811 | 3300025915 | Bacteria | 584 |
| 433 | Ga0207693_11240295 | 3300025915 | Bacteria | 560 |
| 434 | Ga0207663_10017481 | 3300025916 | Unclassified | 3997 |
| 435 | Ga0207663_10035680 | 3300025916 | Bacteria | 2986 |
| 436 | Ga0207663_10148145 | 3300025916 | Bacteria | 1643 |
| 437 | Ga0207663_10216530 | 3300025916 | Bacteria | 1391 |
| 438 | Ga0207662_10000945 | 3300025918 | Bacteria | 13482 |
| 439 | Ga0207662_10047773 | 3300025918 | Bacteria | 2535 |
| 440 | Ga0207657_10365876 | 3300025919 | Bacteria | 1136 |
| 441 | Ga0207649_10125785 | 3300025920 | Bacteria | 1735 |
| 442 | Ga0207649_10154040 | 3300025920 | Unclassified | 1586 |
| 443 | Ga0207646_10000867 | 3300025922 | Bacteria | 39113 |
| 444 | Ga0207646_10000886 | 3300025922 | Bacteria | 38660 |
| 445 | Ga0207646_10001911 | 3300025922 | Bacteria | 25095 |
| 446 | Ga0207646_10002892 | 3300025922 | Bacteria | 19929 |
| 447 | Ga0207646_10034742 | 3300025922 | Bacteria | 4557 |
| 448 | Ga0207646_10060147 | 3300025922 | Unclassified | 3393 |
| 449 | Ga0207646_10085087 | 3300025922 | Unclassified | 2829 |
| 450 | Ga0207646_10118378 | 3300025922 | Bacteria | 2380 |
| 451 | Ga0207646_10123706 | 3300025922 | Bacteria | 2325 |
| 452 | Ga0207646_10176920 | 3300025922 | Unclassified | 1927 |
| 453 | Ga0207646_10291201 | 3300025922 | Unclassified | 1475 |
| 454 | Ga0207646_10718114 | 3300025922 | Unclassified | 893 |
| 455 | Ga0207681_10016600 | 3300025923 | Bacteria | 4609 |
| 456 | Ga0207681_10050164 | 3300025923 | Bacteria | 2823 |
| 457 | Ga0207681_10079647 | 3300025923 | Bacteria | 2308 |
| 458 | Ga0207681_10155234 | 3300025923 | Bacteria | 1719 |
| 459 | Ga0207681_10374400 | 3300025923 | Bacteria | 1145 |
| 460 | Ga0207681_10466598 | 3300025923 | Bacteria | 1029 |
| 461 | Ga0207681_11375964 | 3300025923 | Bacteria | 592 |
| 462 | Ga0207650_10017752 | 3300025925 | Bacteria | 4984 |
| 463 | Ga0207650_10154679 | 3300025925 | Bacteria | 1813 |
| 464 | Ga0207650_10166811 | 3300025925 | Bacteria | 1748 |
| 465 | Ga0207650_10264960 | 3300025925 | Bacteria | 1395 |
| 466 | Ga0207659_10028327 | 3300025926 | Bacteria | 3805 |
| 467 | Ga0207659_10070328 | 3300025926 | Unclassified | 2552 |
| 468 | Ga0207659_10371772 | 3300025926 | Unclassified | 1190 |
| 469 | Ga0207659_10581183 | 3300025926 | Unclassified | 954 |
| 470 | Ga0207659_10616471 | 3300025926 | Bacteria | 926 |
| 471 | Ga0207687_10284550 | 3300025927 | Bacteria | 1326 |
| 472 | Ga0207687_10585467 | 3300025927 | Unclassified | 939 |
| 473 | Ga0207700_10069860 | 3300025928 | Bacteria | 2697 |
| 474 | Ga0207700_10240742 | 3300025928 | Bacteria | 1542 |
| 475 | Ga0207700_10461422 | 3300025928 | Bacteria | 1121 |
| 476 | Ga0207700_10604425 | 3300025928 | Bacteria | 976 |
| 477 | Ga0207700_10715148 | 3300025928 | Bacteria | 894 |
| 478 | Ga0207664_10024600 | 3300025929 | Unclassified | 4527 |
| 479 | Ga0207664_10496140 | 3300025929 | Bacteria | 1093 |
| 480 | Ga0207664_10571594 | 3300025929 | Bacteria | 1015 |
| 481 | Ga0207664_10657039 | 3300025929 | Bacteria | 942 |
| 482 | Ga0207664_11778334 | 3300025929 | Unclassified | 539 |
| 483 | Ga0207644_10007138 | 3300025931 | Bacteria | 7279 |
| 484 | Ga0207644_10027555 | 3300025931 | Bacteria | 3926 |
| 485 | Ga0207644_10069801 | 3300025931 | Unclassified | 2566 |
| 486 | Ga0207644_10248883 | 3300025931 | Unclassified | 1417 |
| 487 | Ga0207644_10598501 | 3300025931 | Bacteria | 915 |
| 488 | Ga0207644_10917940 | 3300025931 | Bacteria | 734 |
| 489 | Ga0207690_10082845 | 3300025932 | Bacteria | 2244 |
| 490 | Ga0207706_10006839 | 3300025933 | Bacteria | 10539 |
| 491 | Ga0207706_10061535 | 3300025933 | Bacteria | 3306 |
| 492 | Ga0207706_10081605 | 3300025933 | Bacteria | 2841 |
| 493 | Ga0207706_10324860 | 3300025933 | Unclassified | 1339 |
| 494 | Ga0207686_11525856 | 3300025934 | Unclassified | 551 |
| 495 | Ga0207670_10031452 | 3300025936 | Bacteria | 3401 |
| 496 | Ga0207670_10052031 | 3300025936 | Bacteria | 2753 |
| 497 | Ga0207670_10435773 | 3300025936 | Bacteria | 1054 |
| 498 | Ga0207669_10005902 | 3300025937 | Bacteria | 5542 |
| 499 | Ga0207669_10087161 | 3300025937 | Bacteria | 2021 |
| 500 | Ga0207669_10501506 | 3300025937 | Bacteria | 971 |
| 501 | Ga0207704_10045848 | 3300025938 | Unclassified | 2600 |
| 502 | Ga0207665_10018571 | 3300025939 | Bacteria | 4567 |
| 503 | Ga0207665_10023367 | 3300025939 | Bacteria | 4073 |
| 504 | Ga0207665_10251758 | 3300025939 | Unclassified | 1305 |
| 505 | Ga0207665_10474236 | 3300025939 | Unclassified | 963 |
| 506 | Ga0207665_10491871 | 3300025939 | Bacteria | 946 |
| 507 | Ga0207665_10928460 | 3300025939 | Bacteria | 691 |
| 508 | Ga0207691_10000359 | 3300025940 | Bacteria | 46053 |
| 509 | Ga0207691_10009486 | 3300025940 | Bacteria | 9347 |
| 510 | Ga0207691_10012453 | 3300025940 | Bacteria | 8156 |
| 511 | Ga0207691_10317650 | 3300025940 | Bacteria | 1336 |
| 512 | Ga0207691_10446375 | 3300025940 | Bacteria | 1101 |
| 513 | Ga0207689_10148811 | 3300025942 | Bacteria | 1930 |
| 514 | Ga0207679_10679974 | 3300025945 | Unclassified | 933 |
| 515 | Ga0207679_10976237 | 3300025945 | Unclassified | 776 |
| 516 | Ga0207651_10038807 | 3300025960 | Bacteria | 3133 |
| 517 | Ga0207651_10240895 | 3300025960 | Bacteria | 1474 |
| 518 | Ga0207651_10455286 | 3300025960 | Unclassified | 1098 |
| 519 | Ga0207651_10838701 | 3300025960 | Unclassified | 816 |
| 520 | Ga0207712_10493412 | 3300025961 | Bacteria | 1046 |
| 521 | Ga0207668_10008896 | 3300025972 | Bacteria | 6005 |
| 522 | Ga0207668_10027804 | 3300025972 | Bacteria | 3688 |
| 523 | Ga0207640_10404204 | 3300025981 | Bacteria | 1113 |
| 524 | Ga0207658_10008876 | 3300025986 | Bacteria | 6822 |
| 525 | Ga0207658_10063811 | 3300025986 | Bacteria | 2761 |
| 526 | Ga0207658_10128896 | 3300025986 | Bacteria | 2029 |
| 527 | Ga0207658_10481745 | 3300025986 | Bacteria | 1102 |
| 528 | Ga0207658_10679299 | 3300025986 | Unclassified | 929 |
| 529 | Ga0207658_11020472 | 3300025986 | Bacteria | 755 |
| 530 | Ga0207677_10020424 | 3300026023 | Unclassified | 4022 |
| 531 | Ga0207677_10096548 | 3300026023 | Bacteria | 2163 |
| 532 | Ga0207677_10176597 | 3300026023 | Unclassified | 1676 |
| 533 | Ga0207677_10699263 | 3300026023 | Unclassified | 899 |
| 534 | Ga0207677_10837298 | 3300026023 | Bacteria | 826 |
| 535 | Ga0207677_12141467 | 3300026023 | Unclassified | 520 |
| 536 | Ga0207703_10106139 | 3300026035 | Bacteria | 2389 |
| 537 | Ga0207703_11201859 | 3300026035 | Bacteria | 729 |
| 538 | Ga0207678_10378439 | 3300026067 | Unclassified | 1224 |
| 539 | Ga0207708_11940245 | 3300026075 | Bacteria | 516 |
| 540 | Ga0207702_10184631 | 3300026078 | Bacteria | 1923 |
| 541 | Ga0207641_10299412 | 3300026088 | Bacteria | 1519 |
| 542 | Ga0207641_10783864 | 3300026088 | Bacteria | 942 |
| 543 | Ga0207648_10018637 | 3300026089 | Bacteria | 6281 |
| 544 | Ga0207648_10460703 | 3300026089 | Bacteria | 1159 |
| 545 | Ga0207648_10652873 | 3300026089 | Unclassified | 972 |
| 546 | Ga0207683_10012367 | 3300026121 | Bacteria | 7283 |
| 547 | Ga0207683_10013698 | 3300026121 | Bacteria | 6913 |
| 548 | Ga0207683_10032322 | 3300026121 | Bacteria | 4546 |
| 549 | Ga0207683_10294756 | 3300026121 | Bacteria | 1484 |
| 550 | Ga0207683_11307893 | 3300026121 | Bacteria | 671 |
| 551 | Ga0268266_10057819 | 3300028379 | Bacteria | 3337 |
| 552 | Ga0268266_11280071 | 3300028379 | Unclassified | 708 |
| 553 | Ga0268265_10035776 | 3300028380 | Unclassified | 3632 |
| 554 | Ga0268265_10575238 | 3300028380 | Bacteria | 1073 |
| 555 | Ga0268264_10039849 | 3300028381 | Unclassified | 3881 |
| 556 | Ga0268264_10109586 | 3300028381 | Bacteria | 2416 |
| 557 | Ga0268264_10194804 | 3300028381 | Unclassified | 1850 |
| 558 | Ga0268264_10428633 | 3300028381 | Bacteria | 1277 |
| 559 | Ga0265337_1154477 | 3300028556 | Bacteria | 622 |
| 560 | Ga0265326_10002998 | 3300028558 | Bacteria | 5614 |
| 561 | Ga0265319_1001901 | 3300028563 | Bacteria | 11865 |
| 562 | Ga0265319_1080046 | 3300028563 | Bacteria | 1038 |
| 563 | Ga0265318_10000545 | 3300028577 | Bacteria | 26811 |
| 564 | Ga0265336_10000001 | 3300028666 | Bacteria | 916179 |
| 565 | Ga0265336_10123397 | 3300028666 | Bacteria | 771 |
| 566 | Ga0265338_10000004 | 3300028800 | Bacteria | 644793 |
| 567 | Ga0265338_10280505 | 3300028800 | Bacteria | 1218 |
| 568 | Ga0265324_10004424 | 3300029957 | Bacteria | 6364 |
| 569 | Ga0265320_10082256 | 3300031240 | Bacteria | 1502 |
| 570 | Ga0265325_10109896 | 3300031241 | Bacteria | 1341 |
| 571 | Ga0265340_10000002 | 3300031247 | Bacteria | 711693 |
| 572 | Ga0265327_10002862 | 3300031251 | Bacteria | 17366 |
| 573 | Ga0265316_10158722 | 3300031344 | Bacteria | 1691 |
| 574 | Ga0307513_10180196 | 3300031456 | Bacteria | 1977 |
| 575 | Ga0265314_10260968 | 3300031711 | Bacteria | 989 |
| 576 | Ga0373926_0288722 | 3300035083 | Unclassified | 639 |
| 577 | Ga0373944_0069141 | 3300035089 | Bacteria | 1147 |
| 578 | Ga0373952_0115351 | 3300035092 | Bacteria | 723 |
| 579 | Ga0373932_0036941 | 3300035112 | Bacteria | 1390 |
| 580 | Ga0373936_0141022 | 3300035113 | Bacteria | 1041 |
| 581 | Ga0373945_0042416 | 3300035116 | Bacteria | 1649 |
| 582 | Ga0373945_0259138 | 3300035116 | Bacteria | 736 |
| 583 | Ga0373957_0101746 | 3300035120 | Bacteria | 1151 |
| 584 | Ga0373960_0408785 | 3300035121 | Bacteria | 525 |
| 585 | Ga0373943_0034253 | 3300035170 | Bacteria | 2422 |
| 586 | Ga0373943_0083297 | 3300035170 | Bacteria | 1644 |
| 587 | Ga0373943_0117825 | 3300035170 | Bacteria | 1408 |
| 588 | Ga0373943_0453708 | 3300035170 | Bacteria | 745 |
| 589 | Ga0373943_0983394 | 3300035170 | Bacteria | 506 |
| 590 | Ga0373946_0026488 | 3300035171 | Bacteria | 2288 |
| 591 | Ga0373946_0091862 | 3300035171 | Unclassified | 1346 |
| 592 | Ga0373946_0094100 | 3300035171 | Unclassified | 1333 |
| 593 | Ga0373946_0155725 | 3300035171 | Bacteria | 1069 |
| 594 | Ga0373946_0231915 | 3300035171 | Bacteria | 895 |
| 595 | Ga0373942_0083786 | 3300035207 | Bacteria | 951 |
| 596 | Ga0373962_0064213 | 3300035242 | Bacteria | 1085 |
| 597 | Ga0373924_0026918 | 3300035410 | Bacteria | 2284 |
| 598 | Ga0373931_0159019 | 3300035691 | Bacteria | 1323 |
| 599 | Ga0373935_0011921 | 3300035692 | Bacteria | 5223 |
| 600 | Ga0373935_0036113 | 3300035692 | Bacteria | 3088 |
| 601 | Ga0373935_0395080 | 3300035692 | Bacteria | 992 |
| 602 | Ga0373927_0172607 | 3300035695 | Bacteria | 1417 |
| 603 | Ga0373927_0226595 | 3300035695 | Unclassified | 1228 |
| 604 | Ga0373933_0046231 | 3300035724 | Bacteria | 2584 |
| 605 | Ga0373933_0326097 | 3300035724 | Bacteria | 996 |
| 606 | Ga0373947_0209072 | 3300035725 | Bacteria | 1279 |
| 607 | Ga0373947_0260135 | 3300035725 | Bacteria | 1150 |
| 608 | Ga0373947_0280241 | 3300035725 | Unclassified | 1108 |
| 609 | Ga0373947_0284911 | 3300035725 | Bacteria | 1099 |
| 610 | Ga0373947_0666333 | 3300035725 | Unclassified | 710 |
| 611 | Ga0373947_0850368 | 3300035725 | Bacteria | 623 |
| 612 | Ga0373937_0464194 | 3300036401 | Bacteria | 1202 |
| 613 | Ga0373925_0169652 | 3300037068 | Bacteria | 1722 |
| 614 | Ga0373925_0287180 | 3300037068 | Bacteria | 1326 |
| 615 | Ga0373925_0389321 | 3300037068 | Unclassified | 1136 |
| 616 | Ga0373925_1123116 | 3300037068 | Bacteria | 646 |
| 617 | Ga0373925_1571073 | 3300037068 | Bacteria | 538 |
| 618 | Ga0395900_0003547 | 3300037418 | Bacteria | 16788 |
| 619 | Ga0395900_0057428 | 3300037418 | Unclassified | 4007 |
| 620 | Ga0395898_0358826 | 3300037466 | Unclassified | 1390 |
| 621 | Ga0436364_0630572 | 3300037853 | Bacteria | 1689 |
| 622 | Ga0395901_0410491 | 3300038443 | Bacteria | 1390 |
| 623 | Ga0395901_0445695 | 3300038443 | Unclassified | 1325 |
| 624 | Ga0436365_0539406 | 3300039437 | Bacteria | 56073 |
| 625 | Ga0436365_0612721 | 3300039437 | Unclassified | 713 |
| 626 | Ga0436360_0157154 | 3300039438 | Unclassified | 1315 |
| 627 | Ga0436360_0491936 | 3300039438 | Bacteria | 3921 |
| 628 | Ga0436360_0976560 | 3300039438 | Bacteria | 689 |
| 629 | Ga0436360_0980270 | 3300039438 | Bacteria | 2171 |
| 630 | Ga0436360_1363807 | 3300039438 | Bacteria | 1867 |
| 631 | Ga0436361_0018337 | 3300039447 | Unclassified | 2172 |
| 632 | Ga0436361_0062883 | 3300039447 | Bacteria | 5709 |
| 633 | Ga0436361_0291564 | 3300039447 | Bacteria | 599 |
| 634 | Ga0436361_0343340 | 3300039447 | Bacteria | 2513 |
| 635 | Ga0436361_0730313 | 3300039447 | Bacteria | 1942 |
| 636 | Ga0436363_0323230 | 3300039450 | Unclassified | 709 |
| 637 | Ga0436362_0569913 | 3300039453 | Bacteria | 1678 |
| 638 | Ga0436362_0812337 | 3300039453 | Bacteria | 542 |
| 639 | Ga0436362_1128445 | 3300039453 | Bacteria | 820 |
| 640 | Ga0451807_0006777 | 3300041486 | Bacteria | 873 |
| 641 | Ga0451839_1491154 | 3300041496 | Bacteria | 531 |
| 642 | Ga0451847_0204786 | 3300041503 | Unclassified | 680 |
| 643 | Ga0439454_026515 | 3300042011 | Bacteria | 886 |
| 644 | Ga0439460_0276531 | 3300042461 | Bacteria | 584 |
| 645 | Ga0451577_0327625 | 3300042876 | Bacteria | 1389 |
| 646 | Ga0453683_1061957 | 3300044673 | Bacteria | 539 |
| 647 | Ga0466970_0914566 | 3300044765 | Bacteria | 516 |
| 648 | Ga0451576_0055316 | 3300045051 | Unclassified | 4152 |
| 649 | Ga0466967_0403167 | 3300045976 | Bacteria | 1331 |
| 650 | Ga0495592_0385448 | 3300046454 | Unclassified | 891 |
| 651 | Ga0495592_0389030 | 3300046454 | Unclassified | 886 |
| 652 | Ga0495641_0063502 | 3300046461 | Bacteria | 1664 |
| 653 | Ga0495653_0746304 | 3300046463 | Bacteria | 592 |
| 654 | Ga0495580_0149757 | 3300046472 | Bacteria | 1617 |
| 655 | Ga0495580_1042377 | 3300046472 | Bacteria | 520 |
| 656 | Ga0495582_0341799 | 3300046473 | Bacteria | 862 |
| 657 | Ga0495584_0224426 | 3300046491 | Unclassified | 955 |
| 658 | Ga0495618_0000046 | 3300046514 | Bacteria | 93942 |
| 659 | Ga0495628_0060024 | 3300046516 | Bacteria | 2985 |
| 660 | Ga0495630_0067865 | 3300046517 | Bacteria | 2681 |
| 661 | Ga0495631_0084372 | 3300046518 | Bacteria | 1369 |
| 662 | Ga0495666_0352287 | 3300046526 | Unclassified | 663 |
| 663 | Ga0495642_0062660 | 3300046528 | Bacteria | 1545 |
| 664 | Ga0495665_0188039 | 3300046531 | Bacteria | 1072 |
| 665 | Ga0495640_0735045 | 3300046533 | Bacteria | 591 |
| 666 | Ga0495598_0022524 | 3300046537 | Bacteria | 1687 |
| 667 | Ga0495598_0308012 | 3300046537 | Unclassified | 601 |
| 668 | Ga0495621_0187951 | 3300046539 | Unclassified | 827 |
| 669 | Ga0495633_0218432 | 3300046558 | Bacteria | 873 |
| 670 | Ga0495656_0150027 | 3300046615 | Unclassified | 1125 |
| 671 | Ga0495668_0833707 | 3300046616 | Unclassified | 511 |
| 672 | Ga0495634_0619317 | 3300046642 | Bacteria | 627 |
| 673 | Ga0495635_0192153 | 3300046663 | Bacteria | 1386 |
| 674 | Ga0495659_0137339 | 3300046664 | Unclassified | 973 |
| 675 | Ga0495659_0503685 | 3300046664 | Bacteria | 531 |
| 676 | Ga0495588_0047045 | 3300046674 | Bacteria | 2214 |
| 677 | Ga0495599_0304051 | 3300046678 | Bacteria | 962 |
| 678 | Ga0495647_0021635 | 3300046681 | Bacteria | 2317 |
| 679 | Ga0495658_0027939 | 3300046683 | Bacteria | 3041 |
| 680 | Ga0495669_0002765 | 3300046684 | Bacteria | 7197 |
| 681 | Ga0495669_0156673 | 3300046684 | Unclassified | 1080 |
| 682 | Ga0495613_0099670 | 3300046689 | Bacteria | 2099 |
| 683 | Ga0495624_0409976 | 3300046690 | Bacteria | 813 |
| 684 | Ga0495589_0199558 | 3300046794 | Unclassified | 945 |
| 685 | Ga0495581_0657122 | 3300047315 | Unclassified | 606 |
| 686 | Ga0495676_0109852 | 3300047321 | Bacteria | 2025 |
| 687 | Ga0495680_0823204 | 3300047322 | Bacteria | 605 |
| 688 | Ga0495680_1032619 | 3300047322 | Bacteria | 523 |
| 689 | Ga0495675_0430537 | 3300047444 | Bacteria | 765 |
| 690 | Ga0495684_0004277 | 3300047471 | Bacteria | 11140 |
| 691 | Ga0495614_0647288 | 3300048089 | Bacteria | 509 |
| 692 | Ga0496100_0012467 | 3300048903 | Bacteria | 4875 |
| 693 | Ga0496100_0309917 | 3300048903 | Unclassified | 1183 |
| 694 | Ga0496100_0983501 | 3300048903 | Bacteria | 664 |
| 695 | Ga0496101_0094852 | 3300048904 | Bacteria | 2225 |
| 696 | Ga0496101_0182486 | 3300048904 | Bacteria | 1616 |
| 697 | Ga0496101_1051513 | 3300048904 | Bacteria | 640 |
| 698 | Ga0496102_0033083 | 3300048905 | Unclassified | 4645 |
| 699 | Ga0496103_0040065 | 3300048906 | Bacteria | 2879 |
| 700 | Ga0496103_0618174 | 3300048906 | Bacteria | 690 |
| 701 | Ga0496104_0127527 | 3300048907 | Bacteria | 2443 |
| 702 | Ga0496104_0178570 | 3300048907 | Bacteria | 2033 |
| 703 | Ga0496104_0245678 | 3300048907 | Bacteria | 1702 |
| 704 | Ga0496105_0195273 | 3300048908 | Bacteria | 1654 |
| 705 | Ga0496106_0091747 | 3300048909 | Bacteria | 2345 |
| 706 | Ga0496106_0893711 | 3300048909 | Bacteria | 702 |
| 707 | Ga0496107_0164224 | 3300048910 | Bacteria | 1646 |
| 708 | Ga0496107_0745762 | 3300048910 | Bacteria | 719 |
| 709 | Ga0496108_0198354 | 3300048911 | Bacteria | 1741 |
| 710 | Ga0496108_0384407 | 3300048911 | Unclassified | 1226 |
| 711 | Ga0496108_0384710 | 3300048911 | Bacteria | 1225 |
| 712 | Ga0496108_0933165 | 3300048911 | Unclassified | 744 |
| 713 | Ga0496108_1275031 | 3300048911 | Unclassified | 619 |
| 714 | Ga0496109_0036809 | 3300048912 | Bacteria | 4419 |
| 715 | Ga0496109_0112051 | 3300048912 | Bacteria | 2537 |
| 716 | Ga0496109_0488656 | 3300048912 | Unclassified | 1162 |
| 717 | Ga0496109_0552898 | 3300048912 | Unclassified | 1086 |
| 718 | Ga0496110_0121994 | 3300048913 | Unclassified | 2349 |
| 719 | Ga0496110_0695532 | 3300048913 | Unclassified | 918 |
| 720 | Ga0496110_0945213 | 3300048913 | Bacteria | 769 |
| 721 | Ga0496112_0006431 | 3300048915 | Bacteria | 10314 |
| 722 | Ga0496112_0056570 | 3300048915 | Bacteria | 3860 |
| 723 | Ga0496112_0099578 | 3300048915 | Bacteria | 2876 |
| 724 | Ga0496112_0126861 | 3300048915 | Bacteria | 2522 |
| 725 | Ga0496112_0235761 | 3300048915 | Bacteria | 1783 |
| 726 | Ga0496112_0326252 | 3300048915 | Bacteria | 1479 |
| 727 | Ga0496113_0262774 | 3300048916 | Bacteria | 1379 |
| 728 | Ga0496113_0327648 | 3300048916 | Bacteria | 1228 |
| 729 | Ga0496113_0844117 | 3300048916 | Unclassified | 726 |
| 730 | Ga0496114_0010794 | 3300048917 | Bacteria | 7271 |
| 731 | Ga0496114_0320613 | 3300048917 | Bacteria | 1369 |
| 732 | Ga0496115_0000059 | 3300048918 | Bacteria | 102022 |
| 733 | Ga0496115_0000087 | 3300048918 | Bacteria | 86513 |
| 734 | Ga0496115_0001268 | 3300048918 | Bacteria | 18088 |
| 735 | Ga0496115_0071714 | 3300048918 | Bacteria | 2809 |
| 736 | nmdc:mga05p37_225729_c1 | 3300050507 | Bacteria | 2258 |
| 737 | nmdc:mga09592_846550_c1 | 3300050508 | Unclassified | 771 |
| 738 | nmdc:mga06r32_1355312_c1 | 3300050510 | Unclassified | 654 |
| 739 | nmdc:mga0n895_1824332_c1 | 3300050512 | Bacteria | 568 |
| 740 | nmdc:mga0rr50_251146_c1 | 3300050513 | Unclassified | 1469 |
| 741 | nmdc:mga08x19_25054_c1 | 3300050514 | Bacteria | 2384 |
| 742 | nmdc:mga08x19_742534_c1 | 3300050514 | Bacteria | 697 |
| 743 | nmdc:mga0a205_332786_c1 | 3300050515 | Unclassified | 1388 |
| 744 | nmdc:mga0a205_619889_c1 | 3300050515 | Bacteria | 934 |
| 745 | Ga0495619_0053326 | 3300053085 | Bacteria | 2675 |
| 746 | Ga0495619_0429495 | 3300053085 | Bacteria | 911 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300006175 | Ga0070712_100342360 | Ga0070712_1003423602 | 98 |
| 2 | 3300025915 | Ga0207693_10097798 | Ga0207693_100977982 | 98 |
| 3 | 3300013307 | Ga0157372_11018055 | Ga0157372_110180552 | 104 |
| 4 | 3300031456 | Ga0307513_10180196 | Ga0307513_101801961 | 109 |
| 5 | 3300013297 | Ga0157378_12227312 | Ga0157378_122273122 | 114 |
| 6 | 3300041503 | Ga0451847_0204786 | Ga0451847_0204786_11_391 | 114 |
| 7 | 3300005336 | Ga0070680_100795732 | Ga0070680_1007957322 | 115 |
| 8 | 3300005435 | Ga0070714_100305203 | Ga0070714_1003052033 | 115 |
| 9 | 3300005436 | Ga0070713_100307993 | Ga0070713_1003079932 | 115 |
| 10 | 3300005437 | Ga0070710_10541690 | Ga0070710_105416902 | 115 |
| 11 | 3300005437 | Ga0070710_10558249 | Ga0070710_105582492 | 115 |
| 12 | 3300005439 | Ga0070711_100026223 | Ga0070711_1000262232 | 115 |
| 13 | 3300005439 | Ga0070711_100336495 | Ga0070711_1003364952 | 115 |
| 14 | 3300005468 | Ga0070707_100376656 | Ga0070707_1003766562 | 115 |
| 15 | 3300006028 | Ga0070717_10851515 | Ga0070717_108515152 | 115 |
| 16 | 3300006175 | Ga0070712_100067270 | Ga0070712_1000672704 | 115 |
| 17 | 3300006175 | Ga0070712_100802108 | Ga0070712_1008021082 | 115 |
| 18 | 3300006353 | Ga0075370_10859779 | Ga0075370_108597792 | 115 |
| 19 | 3300006881 | Ga0068865_100256758 | Ga0068865_1002567581 | 115 |
| 20 | 3300009098 | Ga0105245_13047337 | Ga0105245_130473371 | 115 |
| 21 | 3300009545 | Ga0105237_10003109 | Ga0105237_1000310917 | 115 |
| 22 | 3300013296 | Ga0157374_10869535 | Ga0157374_108695352 | 115 |
| 23 | 3300025898 | Ga0207692_10931846 | Ga0207692_109318461 | 115 |
| 24 | 3300025914 | Ga0207671_10002384 | Ga0207671_100023844 | 115 |
| 25 | 3300025915 | Ga0207693_10017486 | Ga0207693_100174864 | 115 |
| 26 | 3300025915 | Ga0207693_10653095 | Ga0207693_106530952 | 115 |
| 27 | 3300025916 | Ga0207663_10035680 | Ga0207663_100356802 | 115 |
| 28 | 3300025928 | Ga0207700_10240742 | Ga0207700_102407422 | 115 |
| 29 | 3300025928 | Ga0207700_10604425 | Ga0207700_106044251 | 115 |
| 30 | 3300025929 | Ga0207664_10657039 | Ga0207664_106570392 | 115 |
| 31 | 3300025939 | Ga0207665_10023367 | Ga0207665_100233674 | 115 |
| 32 | 3300028556 | Ga0265337_1154477 | Ga0265337_11544771 | 115 |
| 33 | 3300028558 | Ga0265326_10002998 | Ga0265326_100029987 | 115 |
| 34 | 3300028563 | Ga0265319_1001901 | Ga0265319_10019017 | 115 |
| 35 | 3300028563 | Ga0265319_1080046 | Ga0265319_10800462 | 115 |
| 36 | 3300028577 | Ga0265318_10000545 | Ga0265318_1000054512 | 115 |
| 37 | 3300028666 | Ga0265336_10000001 | Ga0265336_10000001295 | 115 |
| 38 | 3300028666 | Ga0265336_10123397 | Ga0265336_101233972 | 115 |
| 39 | 3300028800 | Ga0265338_10000004 | Ga0265338_10000004586 | 115 |
| 40 | 3300028800 | Ga0265338_10280505 | Ga0265338_102805052 | 115 |
| 41 | 3300029957 | Ga0265324_10004424 | Ga0265324_100044247 | 115 |
| 42 | 3300031240 | Ga0265320_10082256 | Ga0265320_100822562 | 115 |
| 43 | 3300031241 | Ga0265325_10109896 | Ga0265325_101098963 | 115 |
| 44 | 3300031247 | Ga0265340_10000002 | Ga0265340_10000002586 | 115 |
| 45 | 3300031251 | Ga0265327_10002862 | Ga0265327_100028625 | 115 |
| 46 | 3300031344 | Ga0265316_10158722 | Ga0265316_101587222 | 115 |
| 47 | 3300031711 | Ga0265314_10260968 | Ga0265314_102609682 | 115 |
| 48 | 3300035170 | Ga0373943_0983394 | Ga0373943_0983394_113_469 | 115 |
| 49 | 3300035692 | Ga0373935_0395080 | Ga0373935_0395080_348_704 | 115 |
| 50 | 3300037068 | Ga0373925_1571073 | Ga0373925_1571073_22_378 | 115 |
| 51 | 3300039447 | Ga0436361_0291564 | Ga0436361_0291564_95_451 | 115 |
| 52 | 3300039453 | Ga0436362_0812337 | Ga0436362_0812337_160_516 | 115 |
| 53 | 3300039453 | Ga0436362_1128445 | Ga0436362_1128445_35_391 | 115 |
| 54 | 3300041496 | Ga0451839_1491154 | Ga0451839_1491154_142_498 | 115 |
| 55 | 3300042876 | Ga0451577_0327625 | Ga0451577_0327625_933_1307 | 115 |
| 56 | 3300044673 | Ga0453683_1061957 | Ga0453683_1061957_51_425 | 115 |
| 57 | 3300044765 | Ga0466970_0914566 | Ga0466970_0914566_127_483 | 115 |
| 58 | 3300046461 | Ga0495641_0063502 | Ga0495641_0063502_1031_1387 | 115 |
| 59 | 3300046463 | Ga0495653_0746304 | Ga0495653_0746304_205_561 | 115 |
| 60 | 3300046514 | Ga0495618_0000046 | Ga0495618_0000046_45342_45698 | 115 |
| 61 | 3300046531 | Ga0495665_0188039 | Ga0495665_0188039_461_817 | 115 |
| 62 | 3300046674 | Ga0495588_0047045 | Ga0495588_0047045_1590_1946 | 115 |
| 63 | 3300046681 | Ga0495647_0021635 | Ga0495647_0021635_730_1086 | 115 |
| 64 | 3300046690 | Ga0495624_0409976 | Ga0495624_0409976_21_377 | 115 |
| 65 | 3300047321 | Ga0495676_0109852 | Ga0495676_0109852_870_1226 | 115 |
| 66 | 3300047322 | Ga0495680_0823204 | Ga0495680_0823204_211_567 | 115 |
| 67 | 3300047471 | Ga0495684_0004277 | Ga0495684_0004277_2893_3249 | 115 |
| 68 | 3300048089 | Ga0495614_0647288 | Ga0495614_0647288_56_412 | 115 |
| 69 | 3300048903 | Ga0496100_0012467 | Ga0496100_0012467_3178_3534 | 115 |
| 70 | 3300048906 | Ga0496103_0618174 | Ga0496103_0618174_84_440 | 115 |
| 71 | 3300048918 | Ga0496115_0000059 | Ga0496115_0000059_75432_75788 | 115 |
| 72 | 3300048918 | Ga0496115_0000087 | Ga0496115_0000087_20579_20935 | 115 |
| 73 | 3300053085 | Ga0495619_0429495 | Ga0495619_0429495_273_629 | 115 |
| 74 | 3300006847 | Ga0075431_100580607 | Ga0075431_1005806072 | 116 |
| 75 | 3300009098 | Ga0105245_10418547 | Ga0105245_104185472 | 116 |
| 76 | 3300013297 | Ga0157378_11333005 | Ga0157378_113330052 | 116 |
| 77 | 3300026023 | Ga0207677_10837298 | Ga0207677_108372982 | 116 |
| 78 | 3300005340 | Ga0070689_100052879 | Ga0070689_1000528793 | 122 |
| 79 | 3300005355 | Ga0070671_100640545 | Ga0070671_1006405452 | 122 |
| 80 | 3300005406 | Ga0070703_10559805 | Ga0070703_105598051 | 122 |
| 81 | 3300005435 | Ga0070714_100440101 | Ga0070714_1004401013 | 122 |
| 82 | 3300005445 | Ga0070708_100170012 | Ga0070708_1001700123 | 122 |
| 83 | 3300005467 | Ga0070706_100439735 | Ga0070706_1004397352 | 122 |
| 84 | 3300005468 | Ga0070707_100069579 | Ga0070707_1000695793 | 122 |
| 85 | 3300005471 | Ga0070698_100019524 | Ga0070698_1000195245 | 122 |
| 86 | 3300005518 | Ga0070699_100022015 | Ga0070699_1000220155 | 122 |
| 87 | 3300005536 | Ga0070697_100009941 | Ga0070697_1000099417 | 122 |
| 88 | 3300006028 | Ga0070717_10453366 | Ga0070717_104533662 | 122 |
| 89 | 3300014968 | Ga0157379_10118681 | Ga0157379_101186811 | 122 |
| 90 | 3300014969 | Ga0157376_11442162 | Ga0157376_114421621 | 122 |
| 91 | 3300025885 | Ga0207653_10110549 | Ga0207653_101105492 | 122 |
| 92 | 3300025922 | Ga0207646_10085087 | Ga0207646_100850872 | 122 |
| 93 | 3300025936 | Ga0207670_10052031 | Ga0207670_100520313 | 122 |
| 94 | 3300035171 | Ga0373946_0091862 | Ga0373946_0091862_890_1258 | 122 |
| 95 | 3300035725 | Ga0373947_0280241 | Ga0373947_0280241_179_547 | 122 |
| 96 | 3300046526 | Ga0495666_0352287 | Ga0495666_0352287_118_486 | 122 |
| 97 | 2162886012 | MBSR1b_contig_10906538 | MBSR1b_0751.00003870 | 123 |
| 98 | 3300000531 | CNBas_1013603 | CNBas_10136032 | 123 |
| 99 | 3300000545 | CNXas_1000075 | CNXas_100007515 | 123 |
| 100 | 3300001977 | JGI24746J21847_1018653 | JGI24746J21847_10186531 | 123 |
| 101 | 3300001989 | JGI24739J22299_10233805 | JGI24739J22299_102338051 | 123 |
| 102 | 3300001991 | JGI24743J22301_10058062 | JGI24743J22301_100580622 | 123 |
| 103 | 3300002070 | JGI24750J21931_1037984 | JGI24750J21931_10379842 | 123 |
| 104 | 3300003203 | JGI25406J46586_10088582 | JGI25406J46586_100885822 | 123 |
| 105 | 3300003203 | JGI25406J46586_10110274 | JGI25406J46586_101102741 | 123 |
| 106 | 3300003316 | rootH1_10150751 | rootH1_101507513 | 123 |
| 107 | 3300003322 | rootL2_10317932 | rootL2_103179323 | 123 |
| 108 | 3300005272 | Ga0065703_1023045 | Ga0065703_10230451 | 123 |
| 109 | 3300005289 | Ga0065704_10016990 | Ga0065704_100169903 | 123 |
| 110 | 3300005290 | Ga0065712_10011282 | Ga0065712_100112823 | 123 |
| 111 | 3300005290 | Ga0065712_10025123 | Ga0065712_100251232 | 123 |
| 112 | 3300005290 | Ga0065712_10143914 | Ga0065712_101439142 | 123 |
| 113 | 3300005290 | Ga0065712_10175923 | Ga0065712_101759233 | 123 |
| 114 | 3300005290 | Ga0065712_10565745 | Ga0065712_105657451 | 123 |
| 115 | 3300005293 | Ga0065715_10010884 | Ga0065715_100108843 | 123 |
| 116 | 3300005293 | Ga0065715_10345151 | Ga0065715_103451511 | 123 |
| 117 | 3300005293 | Ga0065715_10365534 | Ga0065715_103655341 | 123 |
| 118 | 3300005293 | Ga0065715_10405355 | Ga0065715_104053552 | 123 |
| 119 | 3300005293 | Ga0065715_10759095 | Ga0065715_107590951 | 123 |
| 120 | 3300005295 | Ga0065707_10006945 | Ga0065707_100069454 | 123 |
| 121 | 3300005295 | Ga0065707_10197376 | Ga0065707_101973762 | 123 |
| 122 | 3300005327 | Ga0070658_10111100 | Ga0070658_101111002 | 123 |
| 123 | 3300005328 | Ga0070676_10010812 | Ga0070676_100108123 | 123 |
| 124 | 3300005328 | Ga0070676_10286500 | Ga0070676_102865001 | 123 |
| 125 | 3300005328 | Ga0070676_10518752 | Ga0070676_105187522 | 123 |
| 126 | 3300005328 | Ga0070676_10681742 | Ga0070676_106817422 | 123 |
| 127 | 3300005330 | Ga0070690_100078353 | Ga0070690_1000783533 | 123 |
| 128 | 3300005330 | Ga0070690_100128856 | Ga0070690_1001288563 | 123 |
| 129 | 3300005330 | Ga0070690_100883550 | Ga0070690_1008835501 | 123 |
| 130 | 3300005331 | Ga0070670_100004474 | Ga0070670_1000044745 | 123 |
| 131 | 3300005331 | Ga0070670_100005662 | Ga0070670_1000056623 | 123 |
| 132 | 3300005331 | Ga0070670_100110578 | Ga0070670_1001105783 | 123 |
| 133 | 3300005331 | Ga0070670_100136614 | Ga0070670_1001366142 | 123 |
| 134 | 3300005331 | Ga0070670_100298824 | Ga0070670_1002988241 | 123 |
| 135 | 3300005331 | Ga0070670_100933561 | Ga0070670_1009335612 | 123 |
| 136 | 3300005333 | Ga0070677_10020745 | Ga0070677_100207453 | 123 |
| 137 | 3300005333 | Ga0070677_10380217 | Ga0070677_103802171 | 123 |
| 138 | 3300005334 | Ga0068869_100168634 | Ga0068869_1001686343 | 123 |
| 139 | 3300005334 | Ga0068869_100268514 | Ga0068869_1002685143 | 123 |
| 140 | 3300005334 | Ga0068869_100898900 | Ga0068869_1008989001 | 123 |
| 141 | 3300005335 | Ga0070666_10003567 | Ga0070666_1000356710 | 123 |
| 142 | 3300005335 | Ga0070666_10020162 | Ga0070666_100201623 | 123 |
| 143 | 3300005335 | Ga0070666_10079986 | Ga0070666_100799861 | 123 |
| 144 | 3300005335 | Ga0070666_10158285 | Ga0070666_101582853 | 123 |
| 145 | 3300005338 | Ga0068868_100731574 | Ga0068868_1007315742 | 123 |
| 146 | 3300005338 | Ga0068868_100934788 | Ga0068868_1009347882 | 123 |
| 147 | 3300005338 | Ga0068868_101768189 | Ga0068868_1017681891 | 123 |
| 148 | 3300005339 | Ga0070660_100426316 | Ga0070660_1004263162 | 123 |
| 149 | 3300005340 | Ga0070689_100008216 | Ga0070689_1000082164 | 123 |
| 150 | 3300005340 | Ga0070689_100197408 | Ga0070689_1001974083 | 123 |
| 151 | 3300005340 | Ga0070689_100273636 | Ga0070689_1002736361 | 123 |
| 152 | 3300005340 | Ga0070689_100771041 | Ga0070689_1007710411 | 123 |
| 153 | 3300005343 | Ga0070687_100001607 | Ga0070687_1000016075 | 123 |
| 154 | 3300005343 | Ga0070687_100043763 | Ga0070687_1000437633 | 123 |
| 155 | 3300005343 | Ga0070687_100158147 | Ga0070687_1001581473 | 123 |
| 156 | 3300005344 | Ga0070661_100206258 | Ga0070661_1002062582 | 123 |
| 157 | 3300005344 | Ga0070661_100298744 | Ga0070661_1002987442 | 123 |
| 158 | 3300005347 | Ga0070668_100000836 | Ga0070668_10000083616 | 123 |
| 159 | 3300005347 | Ga0070668_100060271 | Ga0070668_1000602713 | 123 |
| 160 | 3300005347 | Ga0070668_100238498 | Ga0070668_1002384983 | 123 |
| 161 | 3300005347 | Ga0070668_100307145 | Ga0070668_1003071452 | 123 |
| 162 | 3300005353 | Ga0070669_100007775 | Ga0070669_1000077756 | 123 |
| 163 | 3300005353 | Ga0070669_100012298 | Ga0070669_1000122983 | 123 |
| 164 | 3300005353 | Ga0070669_100012867 | Ga0070669_1000128674 | 123 |
| 165 | 3300005353 | Ga0070669_100015656 | Ga0070669_1000156563 | 123 |
| 166 | 3300005353 | Ga0070669_100203623 | Ga0070669_1002036232 | 123 |
| 167 | 3300005353 | Ga0070669_100306043 | Ga0070669_1003060432 | 123 |
| 168 | 3300005353 | Ga0070669_100444288 | Ga0070669_1004442882 | 123 |
| 169 | 3300005354 | Ga0070675_100009115 | Ga0070675_1000091159 | 123 |
| 170 | 3300005354 | Ga0070675_100062758 | Ga0070675_1000627583 | 123 |
| 171 | 3300005354 | Ga0070675_100181273 | Ga0070675_1001812733 | 123 |
| 172 | 3300005354 | Ga0070675_100292935 | Ga0070675_1002929352 | 123 |
| 173 | 3300005354 | Ga0070675_100511743 | Ga0070675_1005117432 | 123 |
| 174 | 3300005355 | Ga0070671_100007786 | Ga0070671_1000077865 | 123 |
| 175 | 3300005355 | Ga0070671_100018241 | Ga0070671_1000182413 | 123 |
| 176 | 3300005355 | Ga0070671_100021568 | Ga0070671_1000215683 | 123 |
| 177 | 3300005355 | Ga0070671_100124210 | Ga0070671_1001242103 | 123 |
| 178 | 3300005355 | Ga0070671_100251728 | Ga0070671_1002517283 | 123 |
| 179 | 3300005355 | Ga0070671_100347563 | Ga0070671_1003475633 | 123 |
| 180 | 3300005355 | Ga0070671_100543440 | Ga0070671_1005434402 | 123 |
| 181 | 3300005355 | Ga0070671_100627797 | Ga0070671_1006277971 | 123 |
| 182 | 3300005355 | Ga0070671_100633075 | Ga0070671_1006330751 | 123 |
| 183 | 3300005356 | Ga0070674_100000816 | Ga0070674_10000081611 | 123 |
| 184 | 3300005356 | Ga0070674_100066011 | Ga0070674_1000660111 | 123 |
| 185 | 3300005356 | Ga0070674_100090211 | Ga0070674_1000902112 | 123 |
| 186 | 3300005356 | Ga0070674_100449560 | Ga0070674_1004495602 | 123 |
| 187 | 3300005364 | Ga0070673_100004390 | Ga0070673_1000043904 | 123 |
| 188 | 3300005364 | Ga0070673_100161221 | Ga0070673_1001612211 | 123 |
| 189 | 3300005364 | Ga0070673_100233448 | Ga0070673_1002334483 | 123 |
| 190 | 3300005364 | Ga0070673_100306459 | Ga0070673_1003064591 | 123 |
| 191 | 3300005364 | Ga0070673_100685424 | Ga0070673_1006854241 | 123 |
| 192 | 3300005364 | Ga0070673_101809791 | Ga0070673_1018097911 | 123 |
| 193 | 3300005365 | Ga0070688_100001751 | Ga0070688_10000175110 | 123 |
| 194 | 3300005365 | Ga0070688_101545172 | Ga0070688_1015451721 | 123 |
| 195 | 3300005366 | Ga0070659_100852800 | Ga0070659_1008528002 | 123 |
| 196 | 3300005367 | Ga0070667_100021783 | Ga0070667_1000217836 | 123 |
| 197 | 3300005367 | Ga0070667_100030175 | Ga0070667_1000301753 | 123 |
| 198 | 3300005367 | Ga0070667_100038282 | Ga0070667_1000382822 | 123 |
| 199 | 3300005367 | Ga0070667_100180554 | Ga0070667_1001805542 | 123 |
| 200 | 3300005367 | Ga0070667_102283360 | Ga0070667_1022833601 | 123 |
| 201 | 3300005406 | Ga0070703_10306227 | Ga0070703_103062271 | 123 |
| 202 | 3300005434 | Ga0070709_10087421 | Ga0070709_100874213 | 123 |
| 203 | 3300005434 | Ga0070709_10256388 | Ga0070709_102563882 | 123 |
| 204 | 3300005434 | Ga0070709_10455436 | Ga0070709_104554362 | 123 |
| 205 | 3300005435 | Ga0070714_100020574 | Ga0070714_1000205743 | 123 |
| 206 | 3300005435 | Ga0070714_100082260 | Ga0070714_1000822603 | 123 |
| 207 | 3300005435 | Ga0070714_100135745 | Ga0070714_1001357453 | 123 |
| 208 | 3300005435 | Ga0070714_100494073 | Ga0070714_1004940732 | 123 |
| 209 | 3300005435 | Ga0070714_101056619 | Ga0070714_1010566191 | 123 |
| 210 | 3300005436 | Ga0070713_100271334 | Ga0070713_1002713343 | 123 |
| 211 | 3300005436 | Ga0070713_100272199 | Ga0070713_1002721993 | 123 |
| 212 | 3300005436 | Ga0070713_100718164 | Ga0070713_1007181642 | 123 |
| 213 | 3300005436 | Ga0070713_100890916 | Ga0070713_1008909162 | 123 |
| 214 | 3300005436 | Ga0070713_101093430 | Ga0070713_1010934302 | 123 |
| 215 | 3300005437 | Ga0070710_10043991 | Ga0070710_100439914 | 123 |
| 216 | 3300005437 | Ga0070710_10431404 | Ga0070710_104314042 | 123 |
| 217 | 3300005437 | Ga0070710_10591099 | Ga0070710_105910992 | 123 |
| 218 | 3300005439 | Ga0070711_100013195 | Ga0070711_1000131952 | 123 |
| 219 | 3300005439 | Ga0070711_100719869 | Ga0070711_1007198691 | 123 |
| 220 | 3300005440 | Ga0070705_100007587 | Ga0070705_1000075874 | 123 |
| 221 | 3300005440 | Ga0070705_100110705 | Ga0070705_1001107053 | 123 |
| 222 | 3300005440 | Ga0070705_100177714 | Ga0070705_1001777142 | 123 |
| 223 | 3300005440 | Ga0070705_100270215 | Ga0070705_1002702152 | 123 |
| 224 | 3300005440 | Ga0070705_100359731 | Ga0070705_1003597312 | 123 |
| 225 | 3300005440 | Ga0070705_101016102 | Ga0070705_1010161021 | 123 |
| 226 | 3300005441 | Ga0070700_100817619 | Ga0070700_1008176191 | 123 |
| 227 | 3300005444 | Ga0070694_100131997 | Ga0070694_1001319972 | 123 |
| 228 | 3300005444 | Ga0070694_100186380 | Ga0070694_1001863803 | 123 |
| 229 | 3300005445 | Ga0070708_100004838 | Ga0070708_10000483814 | 123 |
| 230 | 3300005445 | Ga0070708_100010491 | Ga0070708_1000104914 | 123 |
| 231 | 3300005445 | Ga0070708_100016567 | Ga0070708_1000165673 | 123 |
| 232 | 3300005445 | Ga0070708_100023132 | Ga0070708_1000231321 | 123 |
| 233 | 3300005445 | Ga0070708_100185905 | Ga0070708_1001859052 | 123 |
| 234 | 3300005445 | Ga0070708_100257375 | Ga0070708_1002573753 | 123 |
| 235 | 3300005445 | Ga0070708_100383417 | Ga0070708_1003834172 | 123 |
| 236 | 3300005445 | Ga0070708_100409508 | Ga0070708_1004095082 | 123 |
| 237 | 3300005445 | Ga0070708_101029846 | Ga0070708_1010298461 | 123 |
| 238 | 3300005445 | Ga0070708_101110226 | Ga0070708_1011102262 | 123 |
| 239 | 3300005455 | Ga0070663_100378558 | Ga0070663_1003785583 | 123 |
| 240 | 3300005456 | Ga0070678_100001971 | Ga0070678_1000019717 | 123 |
| 241 | 3300005456 | Ga0070678_100041684 | Ga0070678_1000416842 | 123 |
| 242 | 3300005456 | Ga0070678_100123728 | Ga0070678_1001237282 | 123 |
| 243 | 3300005456 | Ga0070678_100210566 | Ga0070678_1002105662 | 123 |
| 244 | 3300005457 | Ga0070662_100020162 | Ga0070662_1000201621 | 123 |
| 245 | 3300005457 | Ga0070662_101020375 | Ga0070662_1010203752 | 123 |
| 246 | 3300005459 | Ga0068867_100014539 | Ga0068867_1000145394 | 123 |
| 247 | 3300005466 | Ga0070685_10242682 | Ga0070685_102426822 | 123 |
| 248 | 3300005467 | Ga0070706_100000462 | Ga0070706_1000004625 | 123 |
| 249 | 3300005467 | Ga0070706_100008839 | Ga0070706_1000088392 | 123 |
| 250 | 3300005467 | Ga0070706_100021324 | Ga0070706_1000213242 | 123 |
| 251 | 3300005467 | Ga0070706_100022886 | Ga0070706_1000228865 | 123 |
| 252 | 3300005467 | Ga0070706_100035784 | Ga0070706_1000357843 | 123 |
| 253 | 3300005467 | Ga0070706_100055509 | Ga0070706_1000555093 | 123 |
| 254 | 3300005467 | Ga0070706_100091006 | Ga0070706_1000910062 | 123 |
| 255 | 3300005467 | Ga0070706_100205972 | Ga0070706_1002059722 | 123 |
| 256 | 3300005467 | Ga0070706_100225308 | Ga0070706_1002253082 | 123 |
| 257 | 3300005467 | Ga0070706_100455511 | Ga0070706_1004555111 | 123 |
| 258 | 3300005467 | Ga0070706_100494904 | Ga0070706_1004949042 | 123 |
| 259 | 3300005468 | Ga0070707_100000140 | Ga0070707_1000001409 | 123 |
| 260 | 3300005468 | Ga0070707_100024766 | Ga0070707_1000247662 | 123 |
| 261 | 3300005468 | Ga0070707_100025477 | Ga0070707_1000254774 | 123 |
| 262 | 3300005468 | Ga0070707_100026733 | Ga0070707_1000267333 | 123 |
| 263 | 3300005468 | Ga0070707_100034565 | Ga0070707_1000345653 | 123 |
| 264 | 3300005468 | Ga0070707_100096769 | Ga0070707_1000967694 | 123 |
| 265 | 3300005468 | Ga0070707_100183426 | Ga0070707_1001834262 | 123 |
| 266 | 3300005468 | Ga0070707_100288022 | Ga0070707_1002880222 | 123 |
| 267 | 3300005468 | Ga0070707_101186129 | Ga0070707_1011861291 | 123 |
| 268 | 3300005471 | Ga0070698_100333310 | Ga0070698_1003333103 | 123 |
| 269 | 3300005471 | Ga0070698_100341777 | Ga0070698_1003417772 | 123 |
| 270 | 3300005471 | Ga0070698_100921865 | Ga0070698_1009218652 | 123 |
| 271 | 3300005518 | Ga0070699_100047039 | Ga0070699_1000470393 | 123 |
| 272 | 3300005518 | Ga0070699_100216745 | Ga0070699_1002167451 | 123 |
| 273 | 3300005518 | Ga0070699_100420897 | Ga0070699_1004208972 | 123 |
| 274 | 3300005518 | Ga0070699_100434220 | Ga0070699_1004342203 | 123 |
| 275 | 3300005518 | Ga0070699_100831101 | Ga0070699_1008311012 | 123 |
| 276 | 3300005518 | Ga0070699_101724408 | Ga0070699_1017244081 | 123 |
| 277 | 3300005536 | Ga0070697_100001331 | Ga0070697_1000013314 | 123 |
| 278 | 3300005536 | Ga0070697_100017072 | Ga0070697_1000170722 | 123 |
| 279 | 3300005536 | Ga0070697_100029828 | Ga0070697_1000298282 | 123 |
| 280 | 3300005536 | Ga0070697_100045652 | Ga0070697_1000456522 | 123 |
| 281 | 3300005536 | Ga0070697_100057459 | Ga0070697_1000574592 | 123 |
| 282 | 3300005536 | Ga0070697_100059485 | Ga0070697_1000594853 | 123 |
| 283 | 3300005536 | Ga0070697_100077262 | Ga0070697_1000772623 | 123 |
| 284 | 3300005536 | Ga0070697_100088500 | Ga0070697_1000885003 | 123 |
| 285 | 3300005536 | Ga0070697_100350898 | Ga0070697_1003508982 | 123 |
| 286 | 3300005536 | Ga0070697_100456903 | Ga0070697_1004569033 | 123 |
| 287 | 3300005536 | Ga0070697_100465301 | Ga0070697_1004653012 | 123 |
| 288 | 3300005536 | Ga0070697_100994535 | Ga0070697_1009945351 | 123 |
| 289 | 3300005536 | Ga0070697_101072407 | Ga0070697_1010724071 | 123 |
| 290 | 3300005543 | Ga0070672_100004681 | Ga0070672_1000046818 | 123 |
| 291 | 3300005543 | Ga0070672_100345602 | Ga0070672_1003456023 | 123 |
| 292 | 3300005543 | Ga0070672_100950036 | Ga0070672_1009500362 | 123 |
| 293 | 3300005545 | Ga0070695_100080838 | Ga0070695_1000808383 | 123 |
| 294 | 3300005546 | Ga0070696_100184588 | Ga0070696_1001845883 | 123 |
| 295 | 3300005546 | Ga0070696_100287305 | Ga0070696_1002873053 | 123 |
| 296 | 3300005547 | Ga0070693_100086081 | Ga0070693_1000860813 | 123 |
| 297 | 3300005548 | Ga0070665_100085431 | Ga0070665_1000854313 | 123 |
| 298 | 3300005548 | Ga0070665_100631098 | Ga0070665_1006310983 | 123 |
| 299 | 3300005548 | Ga0070665_101002345 | Ga0070665_1010023451 | 123 |
| 300 | 3300005549 | Ga0070704_100223850 | Ga0070704_1002238502 | 123 |
| 301 | 3300005549 | Ga0070704_100441156 | Ga0070704_1004411562 | 123 |
| 302 | 3300005563 | Ga0068855_100161370 | Ga0068855_1001613703 | 123 |
| 303 | 3300005563 | Ga0068855_100559227 | Ga0068855_1005592273 | 123 |
| 304 | 3300005564 | Ga0070664_100182784 | Ga0070664_1001827843 | 123 |
| 305 | 3300005618 | Ga0068864_100273730 | Ga0068864_1002737303 | 123 |
| 306 | 3300005718 | Ga0068866_10316631 | Ga0068866_103166311 | 123 |
| 307 | 3300005841 | Ga0068863_100665324 | Ga0068863_1006653242 | 123 |
| 308 | 3300005842 | Ga0068858_100669252 | Ga0068858_1006692523 | 123 |
| 309 | 3300005842 | Ga0068858_101330710 | Ga0068858_1013307102 | 123 |
| 310 | 3300005843 | Ga0068860_100080627 | Ga0068860_1000806272 | 123 |
| 311 | 3300005843 | Ga0068860_100163408 | Ga0068860_1001634083 | 123 |
| 312 | 3300005843 | Ga0068860_100342582 | Ga0068860_1003425823 | 123 |
| 313 | 3300005844 | Ga0068862_100133256 | Ga0068862_1001332563 | 123 |
| 314 | 3300005937 | Ga0081455_10221166 | Ga0081455_102211662 | 123 |
| 315 | 3300005985 | Ga0081539_10000061 | Ga0081539_10000061164 | 123 |
| 316 | 3300005985 | Ga0081539_10000971 | Ga0081539_1000097153 | 123 |
| 317 | 3300005985 | Ga0081539_10030103 | Ga0081539_100301033 | 123 |
| 318 | 3300005985 | Ga0081539_10124345 | Ga0081539_101243452 | 123 |
| 319 | 3300006028 | Ga0070717_10000793 | Ga0070717_1000079310 | 123 |
| 320 | 3300006028 | Ga0070717_10010827 | Ga0070717_100108272 | 123 |
| 321 | 3300006028 | Ga0070717_10290963 | Ga0070717_102909633 | 123 |
| 322 | 3300006028 | Ga0070717_10290964 | Ga0070717_102909643 | 123 |
| 323 | 3300006163 | Ga0070715_10204647 | Ga0070715_102046472 | 123 |
| 324 | 3300006163 | Ga0070715_10339272 | Ga0070715_103392722 | 123 |
| 325 | 3300006163 | Ga0070715_10485118 | Ga0070715_104851182 | 123 |
| 326 | 3300006173 | Ga0070716_100249271 | Ga0070716_1002492712 | 123 |
| 327 | 3300006173 | Ga0070716_100290516 | Ga0070716_1002905162 | 123 |
| 328 | 3300006173 | Ga0070716_100351951 | Ga0070716_1003519512 | 123 |
| 329 | 3300006173 | Ga0070716_100393171 | Ga0070716_1003931711 | 123 |
| 330 | 3300006173 | Ga0070716_100618626 | Ga0070716_1006186261 | 123 |
| 331 | 3300006173 | Ga0070716_101248760 | Ga0070716_1012487601 | 123 |
| 332 | 3300006175 | Ga0070712_100007081 | Ga0070712_1000070812 | 123 |
| 333 | 3300006175 | Ga0070712_100011407 | Ga0070712_1000114075 | 123 |
| 334 | 3300006175 | Ga0070712_100287614 | Ga0070712_1002876142 | 123 |
| 335 | 3300006175 | Ga0070712_100550074 | Ga0070712_1005500742 | 123 |
| 336 | 3300006175 | Ga0070712_101088250 | Ga0070712_1010882501 | 123 |
| 337 | 3300006175 | Ga0070712_101713405 | Ga0070712_1017134052 | 123 |
| 338 | 3300006237 | Ga0097621_100005822 | Ga0097621_1000058228 | 123 |
| 339 | 3300006237 | Ga0097621_100082048 | Ga0097621_1000820483 | 123 |
| 340 | 3300006237 | Ga0097621_100260443 | Ga0097621_1002604433 | 123 |
| 341 | 3300006237 | Ga0097621_100595333 | Ga0097621_1005953332 | 123 |
| 342 | 3300006237 | Ga0097621_101869172 | Ga0097621_1018691721 | 123 |
| 343 | 3300006358 | Ga0068871_100009985 | Ga0068871_1000099854 | 123 |
| 344 | 3300006358 | Ga0068871_100022789 | Ga0068871_1000227893 | 123 |
| 345 | 3300006358 | Ga0068871_100031335 | Ga0068871_1000313353 | 123 |
| 346 | 3300006358 | Ga0068871_100061238 | Ga0068871_1000612383 | 123 |
| 347 | 3300006358 | Ga0068871_100513008 | Ga0068871_1005130082 | 123 |
| 348 | 3300006847 | Ga0075431_102201433 | Ga0075431_1022014331 | 123 |
| 349 | 3300006852 | Ga0075433_10929573 | Ga0075433_109295732 | 123 |
| 350 | 3300006871 | Ga0075434_100452700 | Ga0075434_1004527002 | 123 |
| 351 | 3300006880 | Ga0075429_100971690 | Ga0075429_1009716902 | 123 |
| 352 | 3300006881 | Ga0068865_100142510 | Ga0068865_1001425103 | 123 |
| 353 | 3300006881 | Ga0068865_100445953 | Ga0068865_1004459533 | 123 |
| 354 | 3300006914 | Ga0075436_100061108 | Ga0075436_1000611082 | 123 |
| 355 | 3300007076 | Ga0075435_101420555 | Ga0075435_1014205551 | 123 |
| 356 | 3300009093 | Ga0105240_10268833 | Ga0105240_102688332 | 123 |
| 357 | 3300009094 | Ga0111539_10184244 | Ga0111539_101842443 | 123 |
| 358 | 3300009098 | Ga0105245_10011372 | Ga0105245_100113727 | 123 |
| 359 | 3300009098 | Ga0105245_10281277 | Ga0105245_102812773 | 123 |
| 360 | 3300009098 | Ga0105245_10426254 | Ga0105245_104262542 | 123 |
| 361 | 3300009098 | Ga0105245_12094761 | Ga0105245_120947611 | 123 |
| 362 | 3300009147 | Ga0114129_10098289 | Ga0114129_100982893 | 123 |
| 363 | 3300009148 | Ga0105243_10361812 | Ga0105243_103618121 | 123 |
| 364 | 3300009174 | Ga0105241_11846914 | Ga0105241_118469142 | 123 |
| 365 | 3300009176 | Ga0105242_10295843 | Ga0105242_102958432 | 123 |
| 366 | 3300009177 | Ga0105248_12270943 | Ga0105248_122709431 | 123 |
| 367 | 3300009545 | Ga0105237_10346798 | Ga0105237_103467981 | 123 |
| 368 | 3300009553 | Ga0105249_10021221 | Ga0105249_100212216 | 123 |
| 369 | 3300009553 | Ga0105249_10712780 | Ga0105249_107127803 | 123 |
| 370 | 3300010159 | Ga0099796_10339526 | Ga0099796_103395261 | 123 |
| 371 | 3300010375 | Ga0105239_10784053 | Ga0105239_107840532 | 123 |
| 372 | 3300010375 | Ga0105239_11640665 | Ga0105239_116406652 | 123 |
| 373 | 3300010375 | Ga0105239_12603863 | Ga0105239_126038631 | 123 |
| 374 | 3300012513 | Ga0157326_1036533 | Ga0157326_10365331 | 123 |
| 375 | 3300013100 | Ga0157373_10594382 | Ga0157373_105943822 | 123 |
| 376 | 3300013102 | Ga0157371_10364938 | Ga0157371_103649382 | 123 |
| 377 | 3300013296 | Ga0157374_10000068 | Ga0157374_1000006832 | 123 |
| 378 | 3300013296 | Ga0157374_10029411 | Ga0157374_100294113 | 123 |
| 379 | 3300013296 | Ga0157374_10040211 | Ga0157374_100402112 | 123 |
| 380 | 3300013296 | Ga0157374_10055924 | Ga0157374_100559243 | 123 |
| 381 | 3300013296 | Ga0157374_10206760 | Ga0157374_102067603 | 123 |
| 382 | 3300013296 | Ga0157374_10784036 | Ga0157374_107840362 | 123 |
| 383 | 3300013296 | Ga0157374_12490023 | Ga0157374_124900231 | 123 |
| 384 | 3300013297 | Ga0157378_10025408 | Ga0157378_100254085 | 123 |
| 385 | 3300013297 | Ga0157378_10027846 | Ga0157378_100278464 | 123 |
| 386 | 3300013297 | Ga0157378_10043795 | Ga0157378_100437952 | 123 |
| 387 | 3300013297 | Ga0157378_10052208 | Ga0157378_100522082 | 123 |
| 388 | 3300013297 | Ga0157378_10094089 | Ga0157378_100940893 | 123 |
| 389 | 3300013297 | Ga0157378_10191086 | Ga0157378_101910863 | 123 |
| 390 | 3300013297 | Ga0157378_10262444 | Ga0157378_102624443 | 123 |
| 391 | 3300013297 | Ga0157378_10354152 | Ga0157378_103541522 | 123 |
| 392 | 3300013297 | Ga0157378_10426915 | Ga0157378_104269153 | 123 |
| 393 | 3300013297 | Ga0157378_10835272 | Ga0157378_108352722 | 123 |
| 394 | 3300013297 | Ga0157378_10970901 | Ga0157378_109709012 | 123 |
| 395 | 3300013297 | Ga0157378_11648334 | Ga0157378_116483342 | 123 |
| 396 | 3300013297 | Ga0157378_12556262 | Ga0157378_125562622 | 123 |
| 397 | 3300013306 | Ga0163162_10015504 | Ga0163162_100155043 | 123 |
| 398 | 3300013306 | Ga0163162_10050676 | Ga0163162_100506764 | 123 |
| 399 | 3300013306 | Ga0163162_10054224 | Ga0163162_100542243 | 123 |
| 400 | 3300013306 | Ga0163162_10083884 | Ga0163162_100838842 | 123 |
| 401 | 3300013306 | Ga0163162_10086927 | Ga0163162_100869273 | 123 |
| 402 | 3300013306 | Ga0163162_10125953 | Ga0163162_101259533 | 123 |
| 403 | 3300013306 | Ga0163162_10275066 | Ga0163162_102750663 | 123 |
| 404 | 3300013306 | Ga0163162_10996557 | Ga0163162_109965572 | 123 |
| 405 | 3300013307 | Ga0157372_10027573 | Ga0157372_100275732 | 123 |
| 406 | 3300013307 | Ga0157372_10063655 | Ga0157372_100636554 | 123 |
| 407 | 3300013307 | Ga0157372_10113959 | Ga0157372_101139593 | 123 |
| 408 | 3300013307 | Ga0157372_10377527 | Ga0157372_103775274 | 123 |
| 409 | 3300013307 | Ga0157372_10543656 | Ga0157372_105436562 | 123 |
| 410 | 3300013308 | Ga0157375_10006218 | Ga0157375_100062188 | 123 |
| 411 | 3300013308 | Ga0157375_10007176 | Ga0157375_100071768 | 123 |
| 412 | 3300013308 | Ga0157375_10777261 | Ga0157375_107772612 | 123 |
| 413 | 3300013308 | Ga0157375_12100738 | Ga0157375_121007381 | 123 |
| 414 | 3300013308 | Ga0157375_12757746 | Ga0157375_127577461 | 123 |
| 415 | 3300014325 | Ga0163163_10089916 | Ga0163163_100899163 | 123 |
| 416 | 3300014325 | Ga0163163_10589669 | Ga0163163_105896692 | 123 |
| 417 | 3300014968 | Ga0157379_10359982 | Ga0157379_103599822 | 123 |
| 418 | 3300014968 | Ga0157379_10643462 | Ga0157379_106434622 | 123 |
| 419 | 3300014969 | Ga0157376_10010878 | Ga0157376_100108783 | 123 |
| 420 | 3300014969 | Ga0157376_10060696 | Ga0157376_100606963 | 123 |
| 421 | 3300014969 | Ga0157376_10229106 | Ga0157376_102291062 | 123 |
| 422 | 3300014969 | Ga0157376_10257366 | Ga0157376_102573661 | 123 |
| 423 | 3300014969 | Ga0157376_10351200 | Ga0157376_103512003 | 123 |
| 424 | 3300014969 | Ga0157376_10672494 | Ga0157376_106724942 | 123 |
| 425 | 3300017792 | Ga0163161_10008436 | Ga0163161_100084363 | 123 |
| 426 | 3300017792 | Ga0163161_10069036 | Ga0163161_100690362 | 123 |
| 427 | 3300017792 | Ga0163161_10858962 | Ga0163161_108589622 | 123 |
| 428 | 3300020077 | Ga0206351_10539719 | Ga0206351_105397192 | 123 |
| 429 | 3300020077 | Ga0206351_10792315 | Ga0206351_107923152 | 123 |
| 430 | 3300020080 | Ga0206350_10137531 | Ga0206350_101375311 | 123 |
| 431 | 3300020610 | Ga0154015_1647084 | Ga0154015_16470842 | 123 |
| 432 | 3300021361 | Ga0213872_10070266 | Ga0213872_100702662 | 123 |
| 433 | 3300021361 | Ga0213872_10091008 | Ga0213872_100910083 | 123 |
| 434 | 3300021361 | Ga0213872_10106613 | Ga0213872_101066132 | 123 |
| 435 | 3300021377 | Ga0213874_10206192 | Ga0213874_102061922 | 123 |
| 436 | 3300021384 | Ga0213876_10001439 | Ga0213876_1000143913 | 123 |
| 437 | 3300021384 | Ga0213876_10525509 | Ga0213876_105255092 | 123 |
| 438 | 3300021388 | Ga0213875_10133793 | Ga0213875_101337932 | 123 |
| 439 | 3300021441 | Ga0213871_10005016 | Ga0213871_100050163 | 123 |
| 440 | 3300022467 | Ga0224712_10252954 | Ga0224712_102529541 | 123 |
| 441 | 3300025290 | Ga0207673_1013859 | Ga0207673_10138592 | 123 |
| 442 | 3300025290 | Ga0207673_1020936 | Ga0207673_10209362 | 123 |
| 443 | 3300025315 | Ga0207697_10000118 | Ga0207697_100001187 | 123 |
| 444 | 3300025315 | Ga0207697_10000734 | Ga0207697_1000073411 | 123 |
| 445 | 3300025315 | Ga0207697_10000986 | Ga0207697_1000098611 | 123 |
| 446 | 3300025315 | Ga0207697_10003844 | Ga0207697_100038446 | 123 |
| 447 | 3300025315 | Ga0207697_10087118 | Ga0207697_100871182 | 123 |
| 448 | 3300025893 | Ga0207682_10082233 | Ga0207682_100822332 | 123 |
| 449 | 3300025898 | Ga0207692_10207624 | Ga0207692_102076242 | 123 |
| 450 | 3300025898 | Ga0207692_10458511 | Ga0207692_104585112 | 123 |
| 451 | 3300025898 | Ga0207692_10518236 | Ga0207692_105182361 | 123 |
| 452 | 3300025899 | Ga0207642_10154459 | Ga0207642_101544592 | 123 |
| 453 | 3300025899 | Ga0207642_10249355 | Ga0207642_102493552 | 123 |
| 454 | 3300025901 | Ga0207688_10000809 | Ga0207688_100008098 | 123 |
| 455 | 3300025901 | Ga0207688_10005559 | Ga0207688_100055596 | 123 |
| 456 | 3300025901 | Ga0207688_10047402 | Ga0207688_100474023 | 123 |
| 457 | 3300025903 | Ga0207680_10006421 | Ga0207680_100064213 | 123 |
| 458 | 3300025903 | Ga0207680_10188942 | Ga0207680_101889421 | 123 |
| 459 | 3300025903 | Ga0207680_10271437 | Ga0207680_102714373 | 123 |
| 460 | 3300025903 | Ga0207680_10307966 | Ga0207680_103079662 | 123 |
| 461 | 3300025905 | Ga0207685_10004631 | Ga0207685_100046313 | 123 |
| 462 | 3300025906 | Ga0207699_10239725 | Ga0207699_102397252 | 123 |
| 463 | 3300025906 | Ga0207699_10406395 | Ga0207699_104063951 | 123 |
| 464 | 3300025906 | Ga0207699_10431900 | Ga0207699_104319003 | 123 |
| 465 | 3300025907 | Ga0207645_10002605 | Ga0207645_100026056 | 123 |
| 466 | 3300025907 | Ga0207645_10003810 | Ga0207645_100038103 | 123 |
| 467 | 3300025907 | Ga0207645_10006174 | Ga0207645_100061744 | 123 |
| 468 | 3300025907 | Ga0207645_10008430 | Ga0207645_100084307 | 123 |
| 469 | 3300025907 | Ga0207645_10207312 | Ga0207645_102073122 | 123 |
| 470 | 3300025907 | Ga0207645_10251424 | Ga0207645_102514242 | 123 |
| 471 | 3300025910 | Ga0207684_10000512 | Ga0207684_100005126 | 123 |
| 472 | 3300025910 | Ga0207684_10014154 | Ga0207684_100141542 | 123 |
| 473 | 3300025910 | Ga0207684_10033430 | Ga0207684_100334303 | 123 |
| 474 | 3300025910 | Ga0207684_10034454 | Ga0207684_100344542 | 123 |
| 475 | 3300025910 | Ga0207684_10061461 | Ga0207684_100614612 | 123 |
| 476 | 3300025910 | Ga0207684_10112733 | Ga0207684_101127332 | 123 |
| 477 | 3300025910 | Ga0207684_10167899 | Ga0207684_101678992 | 123 |
| 478 | 3300025910 | Ga0207684_10268927 | Ga0207684_102689272 | 123 |
| 479 | 3300025910 | Ga0207684_10348086 | Ga0207684_103480862 | 123 |
| 480 | 3300025910 | Ga0207684_10349412 | Ga0207684_103494122 | 123 |
| 481 | 3300025910 | Ga0207684_11180421 | Ga0207684_111804211 | 123 |
| 482 | 3300025915 | Ga0207693_10002803 | Ga0207693_1000280310 | 123 |
| 483 | 3300025915 | Ga0207693_10006881 | Ga0207693_100068817 | 123 |
| 484 | 3300025915 | Ga0207693_10084846 | Ga0207693_100848463 | 123 |
| 485 | 3300025915 | Ga0207693_10176704 | Ga0207693_101767043 | 123 |
| 486 | 3300025915 | Ga0207693_10817970 | Ga0207693_108179701 | 123 |
| 487 | 3300025915 | Ga0207693_11159811 | Ga0207693_111598111 | 123 |
| 488 | 3300025915 | Ga0207693_11240295 | Ga0207693_112402951 | 123 |
| 489 | 3300025916 | Ga0207663_10017481 | Ga0207663_100174811 | 123 |
| 490 | 3300025916 | Ga0207663_10148145 | Ga0207663_101481452 | 123 |
| 491 | 3300025916 | Ga0207663_10216530 | Ga0207663_102165302 | 123 |
| 492 | 3300025918 | Ga0207662_10000945 | Ga0207662_100009455 | 123 |
| 493 | 3300025918 | Ga0207662_10047773 | Ga0207662_100477733 | 123 |
| 494 | 3300025919 | Ga0207657_10365876 | Ga0207657_103658762 | 123 |
| 495 | 3300025920 | Ga0207649_10125785 | Ga0207649_101257853 | 123 |
| 496 | 3300025920 | Ga0207649_10154040 | Ga0207649_101540403 | 123 |
| 497 | 3300025922 | Ga0207646_10000867 | Ga0207646_1000086716 | 123 |
| 498 | 3300025922 | Ga0207646_10000886 | Ga0207646_1000088620 | 123 |
| 499 | 3300025922 | Ga0207646_10001911 | Ga0207646_1000191116 | 123 |
| 500 | 3300025922 | Ga0207646_10002892 | Ga0207646_1000289217 | 123 |
| 501 | 3300025922 | Ga0207646_10034742 | Ga0207646_100347421 | 123 |
| 502 | 3300025922 | Ga0207646_10060147 | Ga0207646_100601473 | 123 |
| 503 | 3300025922 | Ga0207646_10118378 | Ga0207646_101183783 | 123 |
| 504 | 3300025922 | Ga0207646_10123706 | Ga0207646_101237062 | 123 |
| 505 | 3300025922 | Ga0207646_10176920 | Ga0207646_101769202 | 123 |
| 506 | 3300025922 | Ga0207646_10291201 | Ga0207646_102912013 | 123 |
| 507 | 3300025922 | Ga0207646_10718114 | Ga0207646_107181142 | 123 |
| 508 | 3300025923 | Ga0207681_10016600 | Ga0207681_100166004 | 123 |
| 509 | 3300025923 | Ga0207681_10050164 | Ga0207681_100501643 | 123 |
| 510 | 3300025923 | Ga0207681_10079647 | Ga0207681_100796473 | 123 |
| 511 | 3300025923 | Ga0207681_10155234 | Ga0207681_101552342 | 123 |
| 512 | 3300025923 | Ga0207681_10374400 | Ga0207681_103744002 | 123 |
| 513 | 3300025923 | Ga0207681_10466598 | Ga0207681_104665982 | 123 |
| 514 | 3300025923 | Ga0207681_11375964 | Ga0207681_113759642 | 123 |
| 515 | 3300025925 | Ga0207650_10017752 | Ga0207650_100177524 | 123 |
| 516 | 3300025925 | Ga0207650_10154679 | Ga0207650_101546792 | 123 |
| 517 | 3300025925 | Ga0207650_10166811 | Ga0207650_101668113 | 123 |
| 518 | 3300025925 | Ga0207650_10264960 | Ga0207650_102649603 | 123 |
| 519 | 3300025926 | Ga0207659_10028327 | Ga0207659_100283273 | 123 |
| 520 | 3300025926 | Ga0207659_10070328 | Ga0207659_100703281 | 123 |
| 521 | 3300025926 | Ga0207659_10371772 | Ga0207659_103717722 | 123 |
| 522 | 3300025926 | Ga0207659_10581183 | Ga0207659_105811832 | 123 |
| 523 | 3300025926 | Ga0207659_10616471 | Ga0207659_106164712 | 123 |
| 524 | 3300025927 | Ga0207687_10284550 | Ga0207687_102845502 | 123 |
| 525 | 3300025927 | Ga0207687_10585467 | Ga0207687_105854672 | 123 |
| 526 | 3300025928 | Ga0207700_10069860 | Ga0207700_100698604 | 123 |
| 527 | 3300025928 | Ga0207700_10461422 | Ga0207700_104614222 | 123 |
| 528 | 3300025928 | Ga0207700_10715148 | Ga0207700_107151482 | 123 |
| 529 | 3300025929 | Ga0207664_10024600 | Ga0207664_100246003 | 123 |
| 530 | 3300025929 | Ga0207664_10496140 | Ga0207664_104961401 | 123 |
| 531 | 3300025929 | Ga0207664_10571594 | Ga0207664_105715942 | 123 |
| 532 | 3300025929 | Ga0207664_11778334 | Ga0207664_117783341 | 123 |
| 533 | 3300025931 | Ga0207644_10007138 | Ga0207644_100071388 | 123 |
| 534 | 3300025931 | Ga0207644_10027555 | Ga0207644_100275553 | 123 |
| 535 | 3300025931 | Ga0207644_10069801 | Ga0207644_100698013 | 123 |
| 536 | 3300025931 | Ga0207644_10248883 | Ga0207644_102488832 | 123 |
| 537 | 3300025931 | Ga0207644_10598501 | Ga0207644_105985011 | 123 |
| 538 | 3300025931 | Ga0207644_10917940 | Ga0207644_109179402 | 123 |
| 539 | 3300025932 | Ga0207690_10082845 | Ga0207690_100828452 | 123 |
| 540 | 3300025933 | Ga0207706_10006839 | Ga0207706_100068394 | 123 |
| 541 | 3300025933 | Ga0207706_10061535 | Ga0207706_100615353 | 123 |
| 542 | 3300025933 | Ga0207706_10081605 | Ga0207706_100816053 | 123 |
| 543 | 3300025933 | Ga0207706_10324860 | Ga0207706_103248602 | 123 |
| 544 | 3300025934 | Ga0207686_11525856 | Ga0207686_115258561 | 123 |
| 545 | 3300025936 | Ga0207670_10031452 | Ga0207670_100314522 | 123 |
| 546 | 3300025936 | Ga0207670_10435773 | Ga0207670_104357732 | 123 |
| 547 | 3300025937 | Ga0207669_10005902 | Ga0207669_100059022 | 123 |
| 548 | 3300025937 | Ga0207669_10087161 | Ga0207669_100871613 | 123 |
| 549 | 3300025937 | Ga0207669_10501506 | Ga0207669_105015062 | 123 |
| 550 | 3300025938 | Ga0207704_10045848 | Ga0207704_100458481 | 123 |
| 551 | 3300025939 | Ga0207665_10018571 | Ga0207665_100185713 | 123 |
| 552 | 3300025939 | Ga0207665_10251758 | Ga0207665_102517582 | 123 |
| 553 | 3300025939 | Ga0207665_10474236 | Ga0207665_104742362 | 123 |
| 554 | 3300025939 | Ga0207665_10491871 | Ga0207665_104918712 | 123 |
| 555 | 3300025939 | Ga0207665_10928460 | Ga0207665_109284601 | 123 |
| 556 | 3300025940 | Ga0207691_10000359 | Ga0207691_1000035925 | 123 |
| 557 | 3300025940 | Ga0207691_10009486 | Ga0207691_100094865 | 123 |
| 558 | 3300025940 | Ga0207691_10012453 | Ga0207691_100124536 | 123 |
| 559 | 3300025940 | Ga0207691_10317650 | Ga0207691_103176502 | 123 |
| 560 | 3300025940 | Ga0207691_10446375 | Ga0207691_104463753 | 123 |
| 561 | 3300025942 | Ga0207689_10148811 | Ga0207689_101488112 | 123 |
| 562 | 3300025945 | Ga0207679_10679974 | Ga0207679_106799741 | 123 |
| 563 | 3300025945 | Ga0207679_10976237 | Ga0207679_109762372 | 123 |
| 564 | 3300025960 | Ga0207651_10038807 | Ga0207651_100388074 | 123 |
| 565 | 3300025960 | Ga0207651_10240895 | Ga0207651_102408952 | 123 |
| 566 | 3300025960 | Ga0207651_10455286 | Ga0207651_104552862 | 123 |
| 567 | 3300025960 | Ga0207651_10838701 | Ga0207651_108387012 | 123 |
| 568 | 3300025961 | Ga0207712_10493412 | Ga0207712_104934121 | 123 |
| 569 | 3300025972 | Ga0207668_10008896 | Ga0207668_100088963 | 123 |
| 570 | 3300025972 | Ga0207668_10027804 | Ga0207668_100278044 | 123 |
| 571 | 3300025981 | Ga0207640_10404204 | Ga0207640_104042042 | 123 |
| 572 | 3300025986 | Ga0207658_10008876 | Ga0207658_100088763 | 123 |
| 573 | 3300025986 | Ga0207658_10063811 | Ga0207658_100638113 | 123 |
| 574 | 3300025986 | Ga0207658_10128896 | Ga0207658_101288961 | 123 |
| 575 | 3300025986 | Ga0207658_10481745 | Ga0207658_104817452 | 123 |
| 576 | 3300025986 | Ga0207658_10679299 | Ga0207658_106792992 | 123 |
| 577 | 3300025986 | Ga0207658_11020472 | Ga0207658_110204721 | 123 |
| 578 | 3300026023 | Ga0207677_10020424 | Ga0207677_100204244 | 123 |
| 579 | 3300026023 | Ga0207677_10096548 | Ga0207677_100965484 | 123 |
| 580 | 3300026023 | Ga0207677_10176597 | Ga0207677_101765973 | 123 |
| 581 | 3300026023 | Ga0207677_10699263 | Ga0207677_106992632 | 123 |
| 582 | 3300026023 | Ga0207677_12141467 | Ga0207677_121414671 | 123 |
| 583 | 3300026035 | Ga0207703_10106139 | Ga0207703_101061393 | 123 |
| 584 | 3300026035 | Ga0207703_11201859 | Ga0207703_112018592 | 123 |
| 585 | 3300026067 | Ga0207678_10378439 | Ga0207678_103784391 | 123 |
| 586 | 3300026075 | Ga0207708_11940245 | Ga0207708_119402451 | 123 |
| 587 | 3300026078 | Ga0207702_10184631 | Ga0207702_101846313 | 123 |
| 588 | 3300026088 | Ga0207641_10299412 | Ga0207641_102994123 | 123 |
| 589 | 3300026088 | Ga0207641_10783864 | Ga0207641_107838642 | 123 |
| 590 | 3300026089 | Ga0207648_10018637 | Ga0207648_100186374 | 123 |
| 591 | 3300026089 | Ga0207648_10460703 | Ga0207648_104607032 | 123 |
| 592 | 3300026089 | Ga0207648_10652873 | Ga0207648_106528733 | 123 |
| 593 | 3300026121 | Ga0207683_10012367 | Ga0207683_100123672 | 123 |
| 594 | 3300026121 | Ga0207683_10013698 | Ga0207683_100136985 | 123 |
| 595 | 3300026121 | Ga0207683_10032322 | Ga0207683_100323223 | 123 |
| 596 | 3300026121 | Ga0207683_10294756 | Ga0207683_102947563 | 123 |
| 597 | 3300026121 | Ga0207683_11307893 | Ga0207683_113078931 | 123 |
| 598 | 3300028379 | Ga0268266_10057819 | Ga0268266_100578194 | 123 |
| 599 | 3300028379 | Ga0268266_11280071 | Ga0268266_112800711 | 123 |
| 600 | 3300028380 | Ga0268265_10035776 | Ga0268265_100357761 | 123 |
| 601 | 3300028380 | Ga0268265_10575238 | Ga0268265_105752381 | 123 |
| 602 | 3300028381 | Ga0268264_10039849 | Ga0268264_100398491 | 123 |
| 603 | 3300028381 | Ga0268264_10109586 | Ga0268264_101095863 | 123 |
| 604 | 3300028381 | Ga0268264_10194804 | Ga0268264_101948043 | 123 |
| 605 | 3300028381 | Ga0268264_10428633 | Ga0268264_104286333 | 123 |
| 606 | 3300035083 | Ga0373926_0288722 | Ga0373926_0288722_101_472 | 123 |
| 607 | 3300035089 | Ga0373944_0069141 | Ga0373944_0069141_419_790 | 123 |
| 608 | 3300035092 | Ga0373952_0115351 | Ga0373952_0115351_103_498 | 123 |
| 609 | 3300035112 | Ga0373932_0036941 | Ga0373932_0036941_765_1160 | 123 |
| 610 | 3300035113 | Ga0373936_0141022 | Ga0373936_0141022_631_1002 | 123 |
| 611 | 3300035116 | Ga0373945_0042416 | Ga0373945_0042416_345_716 | 123 |
| 612 | 3300035116 | Ga0373945_0259138 | Ga0373945_0259138_292_663 | 123 |
| 613 | 3300035120 | Ga0373957_0101746 | Ga0373957_0101746_642_1013 | 123 |
| 614 | 3300035121 | Ga0373960_0408785 | Ga0373960_0408785_55_426 | 123 |
| 615 | 3300035170 | Ga0373943_0034253 | Ga0373943_0034253_488_859 | 123 |
| 616 | 3300035170 | Ga0373943_0083297 | Ga0373943_0083297_584_955 | 123 |
| 617 | 3300035170 | Ga0373943_0117825 | Ga0373943_0117825_576_947 | 123 |
| 618 | 3300035170 | Ga0373943_0453708 | Ga0373943_0453708_237_608 | 123 |
| 619 | 3300035171 | Ga0373946_0026488 | Ga0373946_0026488_1298_1669 | 123 |
| 620 | 3300035171 | Ga0373946_0094100 | Ga0373946_0094100_281_652 | 123 |
| 621 | 3300035171 | Ga0373946_0155725 | Ga0373946_0155725_342_713 | 123 |
| 622 | 3300035171 | Ga0373946_0231915 | Ga0373946_0231915_19_390 | 123 |
| 623 | 3300035207 | Ga0373942_0083786 | Ga0373942_0083786_182_577 | 123 |
| 624 | 3300035242 | Ga0373962_0064213 | Ga0373962_0064213_274_645 | 123 |
| 625 | 3300035410 | Ga0373924_0026918 | Ga0373924_0026918_1777_2148 | 123 |
| 626 | 3300035691 | Ga0373931_0159019 | Ga0373931_0159019_726_1097 | 123 |
| 627 | 3300035692 | Ga0373935_0011921 | Ga0373935_0011921_2393_2764 | 123 |
| 628 | 3300035692 | Ga0373935_0036113 | Ga0373935_0036113_906_1277 | 123 |
| 629 | 3300035695 | Ga0373927_0172607 | Ga0373927_0172607_311_682 | 123 |
| 630 | 3300035695 | Ga0373927_0226595 | Ga0373927_0226595_504_875 | 123 |
| 631 | 3300035724 | Ga0373933_0046231 | Ga0373933_0046231_599_970 | 123 |
| 632 | 3300035724 | Ga0373933_0326097 | Ga0373933_0326097_459_830 | 123 |
| 633 | 3300035725 | Ga0373947_0209072 | Ga0373947_0209072_576_947 | 123 |
| 634 | 3300035725 | Ga0373947_0260135 | Ga0373947_0260135_398_769 | 123 |
| 635 | 3300035725 | Ga0373947_0284911 | Ga0373947_0284911_710_1081 | 123 |
| 636 | 3300035725 | Ga0373947_0666333 | Ga0373947_0666333_278_649 | 123 |
| 637 | 3300035725 | Ga0373947_0850368 | Ga0373947_0850368_34_408 | 123 |
| 638 | 3300036401 | Ga0373937_0464194 | Ga0373937_0464194_457_828 | 123 |
| 639 | 3300037068 | Ga0373925_0169652 | Ga0373925_0169652_483_854 | 123 |
| 640 | 3300037068 | Ga0373925_0287180 | Ga0373925_0287180_485_856 | 123 |
| 641 | 3300037068 | Ga0373925_0389321 | Ga0373925_0389321_434_808 | 123 |
| 642 | 3300037068 | Ga0373925_1123116 | Ga0373925_1123116_105_476 | 123 |
| 643 | 3300037418 | Ga0395900_0003547 | Ga0395900_0003547_3215_3586 | 123 |
| 644 | 3300037418 | Ga0395900_0057428 | Ga0395900_0057428_1144_1515 | 123 |
| 645 | 3300037466 | Ga0395898_0358826 | Ga0395898_0358826_586_957 | 123 |
| 646 | 3300037853 | Ga0436364_0630572 | Ga0436364_0630572_649_1020 | 123 |
| 647 | 3300038443 | Ga0395901_0410491 | Ga0395901_0410491_222_593 | 123 |
| 648 | 3300038443 | Ga0395901_0445695 | Ga0395901_0445695_108_479 | 123 |
| 649 | 3300039437 | Ga0436365_0539406 | Ga0436365_0539406_21187_21564 | 123 |
| 650 | 3300039437 | Ga0436365_0612721 | Ga0436365_0612721_117_488 | 123 |
| 651 | 3300039438 | Ga0436360_0157154 | Ga0436360_0157154_275_652 | 123 |
| 652 | 3300039438 | Ga0436360_0491936 | Ga0436360_0491936_2759_3136 | 123 |
| 653 | 3300039438 | Ga0436360_0976560 | Ga0436360_0976560_278_655 | 123 |
| 654 | 3300039438 | Ga0436360_0980270 | Ga0436360_0980270_51_428 | 123 |
| 655 | 3300039438 | Ga0436360_1363807 | Ga0436360_1363807_1189_1566 | 123 |
| 656 | 3300039447 | Ga0436361_0018337 | Ga0436361_0018337_451_828 | 123 |
| 657 | 3300039447 | Ga0436361_0062883 | Ga0436361_0062883_3043_3420 | 123 |
| 658 | 3300039447 | Ga0436361_0343340 | Ga0436361_0343340_1107_1484 | 123 |
| 659 | 3300039447 | Ga0436361_0730313 | Ga0436361_0730313_1378_1755 | 123 |
| 660 | 3300039450 | Ga0436363_0323230 | Ga0436363_0323230_196_567 | 123 |
| 661 | 3300039453 | Ga0436362_0569913 | Ga0436362_0569913_1127_1504 | 123 |
| 662 | 3300041486 | Ga0451807_0006777 | Ga0451807_0006777_217_588 | 123 |
| 663 | 3300042011 | Ga0439454_026515 | Ga0439454_026515_83_454 | 123 |
| 664 | 3300042461 | Ga0439460_0276531 | Ga0439460_0276531_54_425 | 123 |
| 665 | 3300045051 | Ga0451576_0055316 | Ga0451576_0055316_1469_1840 | 123 |
| 666 | 3300045976 | Ga0466967_0403167 | Ga0466967_0403167_40_411 | 123 |
| 667 | 3300046454 | Ga0495592_0385448 | Ga0495592_0385448_229_600 | 123 |
| 668 | 3300046454 | Ga0495592_0389030 | Ga0495592_0389030_39_410 | 123 |
| 669 | 3300046472 | Ga0495580_0149757 | Ga0495580_0149757_29_400 | 123 |
| 670 | 3300046472 | Ga0495580_1042377 | Ga0495580_1042377_132_503 | 123 |
| 671 | 3300046473 | Ga0495582_0341799 | Ga0495582_0341799_465_836 | 123 |
| 672 | 3300046491 | Ga0495584_0224426 | Ga0495584_0224426_155_526 | 123 |
| 673 | 3300046516 | Ga0495628_0060024 | Ga0495628_0060024_2144_2515 | 123 |
| 674 | 3300046517 | Ga0495630_0067865 | Ga0495630_0067865_1506_1877 | 123 |
| 675 | 3300046518 | Ga0495631_0084372 | Ga0495631_0084372_303_674 | 123 |
| 676 | 3300046528 | Ga0495642_0062660 | Ga0495642_0062660_142_513 | 123 |
| 677 | 3300046533 | Ga0495640_0735045 | Ga0495640_0735045_11_382 | 123 |
| 678 | 3300046537 | Ga0495598_0022524 | Ga0495598_0022524_907_1278 | 123 |
| 679 | 3300046537 | Ga0495598_0308012 | Ga0495598_0308012_220_591 | 123 |
| 680 | 3300046539 | Ga0495621_0187951 | Ga0495621_0187951_221_592 | 123 |
| 681 | 3300046558 | Ga0495633_0218432 | Ga0495633_0218432_50_421 | 123 |
| 682 | 3300046615 | Ga0495656_0150027 | Ga0495656_0150027_517_888 | 123 |
| 683 | 3300046616 | Ga0495668_0833707 | Ga0495668_0833707_60_431 | 123 |
| 684 | 3300046642 | Ga0495634_0619317 | Ga0495634_0619317_232_603 | 123 |
| 685 | 3300046663 | Ga0495635_0192153 | Ga0495635_0192153_879_1250 | 123 |
| 686 | 3300046664 | Ga0495659_0137339 | Ga0495659_0137339_442_813 | 123 |
| 687 | 3300046664 | Ga0495659_0503685 | Ga0495659_0503685_148_519 | 123 |
| 688 | 3300046678 | Ga0495599_0304051 | Ga0495599_0304051_457_828 | 123 |
| 689 | 3300046683 | Ga0495658_0027939 | Ga0495658_0027939_1923_2294 | 123 |
| 690 | 3300046684 | Ga0495669_0002765 | Ga0495669_0002765_6287_6658 | 123 |
| 691 | 3300046684 | Ga0495669_0156673 | Ga0495669_0156673_62_433 | 123 |
| 692 | 3300046689 | Ga0495613_0099670 | Ga0495613_0099670_1391_1762 | 123 |
| 693 | 3300046794 | Ga0495589_0199558 | Ga0495589_0199558_67_438 | 123 |
| 694 | 3300047315 | Ga0495581_0657122 | Ga0495581_0657122_16_387 | 123 |
| 695 | 3300047322 | Ga0495680_1032619 | Ga0495680_1032619_85_456 | 123 |
| 696 | 3300047444 | Ga0495675_0430537 | Ga0495675_0430537_256_627 | 123 |
| 697 | 3300048903 | Ga0496100_0309917 | Ga0496100_0309917_627_998 | 123 |
| 698 | 3300048903 | Ga0496100_0983501 | Ga0496100_0983501_225_596 | 123 |
| 699 | 3300048904 | Ga0496101_0094852 | Ga0496101_0094852_621_992 | 123 |
| 700 | 3300048904 | Ga0496101_0182486 | Ga0496101_0182486_804_1199 | 123 |
| 701 | 3300048904 | Ga0496101_1051513 | Ga0496101_1051513_84_455 | 123 |
| 702 | 3300048905 | Ga0496102_0033083 | Ga0496102_0033083_2386_2781 | 123 |
| 703 | 3300048906 | Ga0496103_0040065 | Ga0496103_0040065_1452_1847 | 123 |
| 704 | 3300048907 | Ga0496104_0127527 | Ga0496104_0127527_2016_2387 | 123 |
| 705 | 3300048907 | Ga0496104_0178570 | Ga0496104_0178570_652_1023 | 123 |
| 706 | 3300048907 | Ga0496104_0245678 | Ga0496104_0245678_961_1332 | 123 |
| 707 | 3300048908 | Ga0496105_0195273 | Ga0496105_0195273_877_1272 | 123 |
| 708 | 3300048909 | Ga0496106_0091747 | Ga0496106_0091747_1271_1642 | 123 |
| 709 | 3300048909 | Ga0496106_0893711 | Ga0496106_0893711_222_593 | 123 |
| 710 | 3300048910 | Ga0496107_0164224 | Ga0496107_0164224_390_785 | 123 |
| 711 | 3300048910 | Ga0496107_0745762 | Ga0496107_0745762_248_619 | 123 |
| 712 | 3300048911 | Ga0496108_0198354 | Ga0496108_0198354_672_1043 | 123 |
| 713 | 3300048911 | Ga0496108_0384407 | Ga0496108_0384407_443_814 | 123 |
| 714 | 3300048911 | Ga0496108_0384710 | Ga0496108_0384710_232_603 | 123 |
| 715 | 3300048911 | Ga0496108_0933165 | Ga0496108_0933165_162_533 | 123 |
| 716 | 3300048911 | Ga0496108_1275031 | Ga0496108_1275031_206_601 | 123 |
| 717 | 3300048912 | Ga0496109_0036809 | Ga0496109_0036809_2944_3339 | 123 |
| 718 | 3300048912 | Ga0496109_0112051 | Ga0496109_0112051_406_777 | 123 |
| 719 | 3300048912 | Ga0496109_0488656 | Ga0496109_0488656_369_764 | 123 |
| 720 | 3300048912 | Ga0496109_0552898 | Ga0496109_0552898_150_521 | 123 |
| 721 | 3300048913 | Ga0496110_0121994 | Ga0496110_0121994_307_678 | 123 |
| 722 | 3300048913 | Ga0496110_0695532 | Ga0496110_0695532_112_483 | 123 |
| 723 | 3300048913 | Ga0496110_0945213 | Ga0496110_0945213_139_510 | 123 |
| 724 | 3300048915 | Ga0496112_0006431 | Ga0496112_0006431_8155_8526 | 123 |
| 725 | 3300048915 | Ga0496112_0056570 | Ga0496112_0056570_2176_2547 | 123 |
| 726 | 3300048915 | Ga0496112_0099578 | Ga0496112_0099578_2200_2571 | 123 |
| 727 | 3300048915 | Ga0496112_0126861 | Ga0496112_0126861_912_1283 | 123 |
| 728 | 3300048915 | Ga0496112_0235761 | Ga0496112_0235761_1091_1486 | 123 |
| 729 | 3300048915 | Ga0496112_0326252 | Ga0496112_0326252_139_510 | 123 |
| 730 | 3300048916 | Ga0496113_0262774 | Ga0496113_0262774_56_427 | 123 |
| 731 | 3300048916 | Ga0496113_0327648 | Ga0496113_0327648_377_772 | 123 |
| 732 | 3300048916 | Ga0496113_0844117 | Ga0496113_0844117_125_496 | 123 |
| 733 | 3300048917 | Ga0496114_0010794 | Ga0496114_0010794_1299_1670 | 123 |
| 734 | 3300048917 | Ga0496114_0320613 | Ga0496114_0320613_15_410 | 123 |
| 735 | 3300048918 | Ga0496115_0001268 | Ga0496115_0001268_2560_2931 | 123 |
| 736 | 3300048918 | Ga0496115_0071714 | Ga0496115_0071714_2239_2634 | 123 |
| 737 | 3300050507 | nmdc:mga05p37_225729_c1 | nmdc:mga05p37_225729_c1_86_481 | 123 |
| 738 | 3300050508 | nmdc:mga09592_846550_c1 | nmdc:mga09592_846550_c1_104_499 | 123 |
| 739 | 3300050510 | nmdc:mga06r32_1355312_c1 | nmdc:mga06r32_1355312_c1_181_576 | 123 |
| 740 | 3300050512 | nmdc:mga0n895_1824332_c1 | nmdc:mga0n895_1824332_c1_103_495 | 123 |
| 741 | 3300050513 | nmdc:mga0rr50_251146_c1 | nmdc:mga0rr50_251146_c1_1022_1417 | 123 |
| 742 | 3300050514 | nmdc:mga08x19_25054_c1 | nmdc:mga08x19_25054_c1_150_521 | 123 |
| 743 | 3300050514 | nmdc:mga08x19_742534_c1 | nmdc:mga08x19_742534_c1_54_428 | 123 |
| 744 | 3300050515 | nmdc:mga0a205_332786_c1 | nmdc:mga0a205_332786_c1_839_1210 | 123 |
| 745 | 3300050515 | nmdc:mga0a205_619889_c1 | nmdc:mga0a205_619889_c1_190_561 | 123 |
| 746 | 3300053085 | Ga0495619_0053326 | Ga0495619_0053326_1973_2344 | 123 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar