F478849

General Info

Members Datasets Scaffolds Average Seq Length
746 298 1492 130

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10000308|Ga0081455_1000030813
Length 157
Sequence VLCRSNQIRDPLRTEHREPAAVREDAAMGFDQYHEPANELPAQTRTFARLCASLTEEAEAIGWYEQRLAVEPDNQARAIMRDAQGEEFKHFCMDLEFLLRRSSLWREIAQGILFQEGDIVEHGEEAEEEAVEGAAARGAPLPGTTSLGIGGLRGSRA

Samples

Sample ID Description Type Environment
1 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
9 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
17 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
23 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
24 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
31 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
60 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
61 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
62 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
63 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
67 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
68 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
72 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
73 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
74 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
75 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
77 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
78 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
79 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
80 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
85 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
86 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
87 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
88 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
89 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
90 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
91 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
92 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
93 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
96 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
97 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
101 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
102 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
163 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
164 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
165 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
166 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
167 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
168 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
169 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
170 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
171 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
172 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
173 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
174 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
175 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
176 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
177 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
178 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
179 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
180 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
181 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
182 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
183 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
184 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
185 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
186 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
187 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
188 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
189 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
190 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
191 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
192 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
193 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
194 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
195 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
196 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
197 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
198 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
199 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
200 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
201 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
202 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
203 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
204 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
205 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
206 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
207 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
208 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
209 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
213 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
218 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
219 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
220 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
221 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
222 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
223 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
224 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
225 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
226 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
227 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
228 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
229 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
230 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
231 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
232 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
233 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
234 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
235 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
236 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
237 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
238 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
239 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
240 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
241 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
242 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
243 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
244 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
245 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
246 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
247 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
248 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
249 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
250 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
251 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
252 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
253 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
254 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
255 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
256 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
257 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
258 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
259 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
260 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
261 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
262 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
263 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
264 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
265 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
266 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
267 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
268 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
269 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
270 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
271 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
272 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
273 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
274 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
275 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
276 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
277 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
278 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
279 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
280 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
281 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
282 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
283 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
284 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
285 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
286 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
287 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
288 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
289 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
290 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
291 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
292 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
293 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
294 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
295 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
296 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
297 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
298 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0.27
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.21
Nodule 0
Rhizoplane 12.33
Rhizosphere 80.83
Stem 0
Stem Tuber 0
Unclassified 2.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081455_10000308 3300005937 Bacteria 64439
2 Ga0070683_100641325 3300005329 Bacteria 1017
3 Ga0070690_100556943 3300005330 Bacteria 865
4 Ga0068869_101677972 3300005334 Bacteria 567
5 Ga0070680_100140757 3300005336 Unclassified 2023
6 Ga0070680_100502314 3300005336 Bacteria 1038
7 Ga0070682_100021571 3300005337 Bacteria 3804
8 Ga0070682_100523627 3300005337 Bacteria 923
9 Ga0068868_100015592 3300005338 Bacteria 5625
10 Ga0068868_100209982 3300005338 Bacteria 1627
11 Ga0070660_100001712 3300005339 Bacteria 15036
12 Ga0070689_100093363 3300005340 Bacteria 2375
13 Ga0070689_101138466 3300005340 Bacteria 698
14 Ga0070689_101427351 3300005340 Bacteria 626
15 Ga0070687_100302207 3300005343 Bacteria 1016
16 Ga0070692_10899696 3300005345 Bacteria 612
17 Ga0070692_11252502 3300005345 Bacteria 530
18 Ga0070668_100085040 3300005347 Bacteria 2486
19 Ga0070668_101133606 3300005347 Bacteria 707
20 Ga0070675_100084558 3300005354 Bacteria 2650
21 Ga0070674_100107874 3300005356 Unclassified 2040
22 Ga0070674_100195615 3300005356 Bacteria 1558
23 Ga0070674_101938085 3300005356 Bacteria 536
24 Ga0070673_100236899 3300005364 Bacteria 1585
25 Ga0070688_100357307 3300005365 Bacteria 1071
26 Ga0070659_100225473 3300005366 Bacteria 1548
27 Ga0070667_100137630 3300005367 Bacteria 2136
28 Ga0070667_100510294 3300005367 Bacteria 1103
29 Ga0070709_10002742 3300005434 Bacteria 9529
30 Ga0070709_11057607 3300005434 Bacteria 648
31 Ga0070714_100017027 3300005435 Bacteria 5882
32 Ga0070714_100419448 3300005435 Bacteria 1267
33 Ga0070714_100679193 3300005435 Bacteria 993
34 Ga0070713_100032812 3300005436 Bacteria 4151
35 Ga0070713_100145960 3300005436 Bacteria 2100
36 Ga0070713_100334376 3300005436 Bacteria 1402
37 Ga0070710_10023651 3300005437 Bacteria 3231
38 Ga0070701_10229530 3300005438 Bacteria 1111
39 Ga0070701_10913834 3300005438 Bacteria 607
40 Ga0070711_100010812 3300005439 Bacteria 5658
41 Ga0070711_100073590 3300005439 Bacteria 2414
42 Ga0070711_100174304 3300005439 Bacteria 1642
43 Ga0070711_100460376 3300005439 Bacteria 1042
44 Ga0070711_100921456 3300005439 Bacteria 746
45 Ga0070711_101156425 3300005439 Bacteria 668
46 Ga0070705_100058122 3300005440 Bacteria 2285
47 Ga0070705_100635060 3300005440 Bacteria 830
48 Ga0070694_100244465 3300005444 Bacteria 1355
49 Ga0070694_100526448 3300005444 Bacteria 944
50 Ga0070678_100016645 3300005456 Bacteria 4709
51 Ga0070678_100018115 3300005456 Bacteria 4557
52 Ga0070678_100087157 3300005456 Bacteria 2383
53 Ga0070662_100072943 3300005457 Bacteria 2536
54 Ga0070681_10021715 3300005458 Bacteria 6437
55 Ga0070681_10120478 3300005458 Bacteria 2559
56 Ga0070681_10142135 3300005458 Unclassified 2329
57 Ga0070685_10238679 3300005466 Bacteria 1199
58 Ga0070685_11075663 3300005466 Bacteria 607
59 Ga0070706_100299312 3300005467 Bacteria 1501
60 Ga0070679_100090331 3300005530 Unclassified 3051
61 Ga0070679_100664653 3300005530 Bacteria 985
62 Ga0070679_101475541 3300005530 Bacteria 627
63 Ga0070684_100089595 3300005535 Bacteria 2734
64 Ga0070684_100727356 3300005535 Bacteria 926
65 Ga0068853_100157856 3300005539 Bacteria 2045
66 Ga0070672_100127867 3300005543 Bacteria 2086
67 Ga0070672_100610267 3300005543 Bacteria 951
68 Ga0070686_100075235 3300005544 Bacteria 2221
69 Ga0070686_100396875 3300005544 Bacteria 1048
70 Ga0070686_101307581 3300005544 Bacteria 606
71 Ga0070695_100266060 3300005545 Bacteria 1254
72 Ga0070695_100497964 3300005545 Bacteria 942
73 Ga0070695_100525422 3300005545 Bacteria 919
74 Ga0070696_100126202 3300005546 Bacteria 1857
75 Ga0070696_100198414 3300005546 Bacteria 1497
76 Ga0070696_100440109 3300005546 Bacteria 1027
77 Ga0070696_100565644 3300005546 Bacteria 913
78 Ga0070693_100050546 3300005547 Bacteria 2377
79 Ga0070693_100091175 3300005547 Unclassified 1837
80 Ga0070693_100153215 3300005547 Bacteria 1462
81 Ga0070665_100321810 3300005548 Bacteria 1551
82 Ga0070665_101056621 3300005548 Bacteria 824
83 Ga0070704_100580510 3300005549 Bacteria 983
84 Ga0068855_100003269 3300005563 Bacteria 19833
85 Ga0070664_100569373 3300005564 Bacteria 1049
86 Ga0068857_100921075 3300005577 Bacteria 839
87 Ga0068854_100273245 3300005578 Bacteria 1358
88 Ga0068856_100006836 3300005614 Bacteria 11163
89 Ga0070702_100018115 3300005615 Bacteria 3647
90 Ga0070702_100157895 3300005615 Bacteria 1463
91 Ga0068852_100320657 3300005616 Bacteria 1505
92 Ga0068859_100167967 3300005617 Bacteria 2274
93 Ga0068859_100176905 3300005617 Bacteria 2216
94 Ga0068859_100403545 3300005617 Bacteria 1463
95 Ga0068859_100418975 3300005617 Bacteria 1435
96 Ga0068864_100118598 3300005618 Bacteria 2363
97 Ga0068864_100347454 3300005618 Bacteria 1399
98 Ga0068866_10462906 3300005718 Bacteria 832
99 Ga0068861_100979030 3300005719 Bacteria 806
100 Ga0068861_101682398 3300005719 Bacteria 627
101 Ga0068863_100055895 3300005841 Bacteria 3737
102 Ga0068863_102213702 3300005841 Bacteria 560
103 Ga0068858_100039036 3300005842 Bacteria 4404
104 Ga0068858_100608894 3300005842 Bacteria 1060
105 Ga0068858_100623620 3300005842 Bacteria 1047
106 Ga0068860_100071313 3300005843 Bacteria 3302
107 Ga0068860_100509019 3300005843 Bacteria 1203
108 Ga0081455_10349718 3300005937 Bacteria 1043
109 Ga0081538_10108433 3300005981 Unclassified 1371
110 Ga0081540_1201161 3300005983 Bacteria 724
111 Ga0070717_10036474 3300006028 Bacteria 3987
112 Ga0070717_10220871 3300006028 Bacteria 1665
113 Ga0070717_10446339 3300006028 Bacteria 1165
114 Ga0075365_10000319 3300006038 Bacteria 16990
115 Ga0075365_10009698 3300006038 Bacteria 5557
116 Ga0075365_10164062 3300006038 Bacteria 1549
117 Ga0075364_10032686 3300006051 Bacteria 3346
118 Ga0070715_10030099 3300006163 Bacteria 2192
119 Ga0070715_10180591 3300006163 Bacteria 1058
120 Ga0070716_100013589 3300006173 Bacteria 4153
121 Ga0070716_100515606 3300006173 Bacteria 885
122 Ga0070712_100004281 3300006175 Bacteria 8788
123 Ga0070712_100014072 3300006175 Bacteria 5130
124 Ga0070712_100031477 3300006175 Bacteria 3575
125 Ga0070712_100147599 3300006175 Bacteria 1802
126 Ga0070712_100501201 3300006175 Bacteria 1018
127 Ga0097621_100772033 3300006237 Bacteria 889
128 Ga0068871_100037316 3300006358 Bacteria 3874
129 Ga0068871_100133863 3300006358 Bacteria 2104
130 Ga0068871_101219480 3300006358 Bacteria 706
131 Ga0075428_100329278 3300006844 Bacteria 1641
132 Ga0075431_100004271 3300006847 Bacteria 13992
133 Ga0075431_100103680 3300006847 Bacteria 2936
134 Ga0075431_100746780 3300006847 Bacteria 954
135 Ga0075433_10138173 3300006852 Bacteria 2166
136 Ga0075433_10182741 3300006852 Bacteria 1866
137 Ga0075433_10361111 3300006852 Bacteria 1283
138 Ga0075434_100000531 3300006871 Bacteria 29081
139 Ga0075434_100034784 3300006871 Bacteria 4978
140 Ga0075434_100349331 3300006871 Bacteria 1500
141 Ga0075434_101083286 3300006871 Bacteria 815
142 Ga0075434_101771213 3300006871 Bacteria 625
143 Ga0068865_100236121 3300006881 Bacteria 1437
144 Ga0068865_100374128 3300006881 Unclassified 1160
145 Ga0068865_100854314 3300006881 Bacteria 789
146 Ga0075436_100195991 3300006914 Bacteria 1430
147 Ga0097620_100167967 3300006931 Bacteria 2274
148 Ga0097620_100176903 3300006931 Bacteria 2216
149 Ga0097620_100403550 3300006931 Bacteria 1463
150 Ga0097620_100418948 3300006931 Bacteria 1435
151 Ga0075435_100005171 3300007076 Bacteria 9074
152 Ga0075435_100011401 3300007076 Bacteria 6537
153 Ga0075435_100018820 3300007076 Bacteria 5262
154 Ga0075435_100302890 3300007076 Bacteria 1367
155 Ga0105240_10221746 3300009093 Bacteria 2202
156 Ga0111539_10022378 3300009094 Bacteria 7767
157 Ga0111539_11244326 3300009094 Bacteria 864
158 Ga0105245_10000665 3300009098 Bacteria 31126
159 Ga0105245_10025506 3300009098 Bacteria 5199
160 Ga0105245_10079335 3300009098 Bacteria 2997
161 Ga0105245_10133944 3300009098 Bacteria 2327
162 Ga0105245_10369737 3300009098 Bacteria 1425
163 Ga0105245_11022307 3300009098 Bacteria 871
164 Ga0105245_11303405 3300009098 Bacteria 775
165 Ga0105247_10013260 3300009101 Bacteria 4946
166 Ga0105247_10028241 3300009101 Bacteria 3394
167 Ga0105247_10295412 3300009101 Bacteria 1122
168 Ga0114129_10178047 3300009147 Bacteria 2895
169 Ga0114129_10588335 3300009147 Bacteria 1443
170 Ga0105243_10012210 3300009148 Bacteria 6494
171 Ga0105243_10090726 3300009148 Bacteria 2515
172 Ga0105243_10228754 3300009148 Bacteria 1648
173 Ga0105243_10258900 3300009148 Bacteria 1557
174 Ga0105243_10490796 3300009148 Bacteria 1161
175 Ga0105243_11110036 3300009148 Bacteria 800
176 Ga0105241_10094742 3300009174 Bacteria 2362
177 Ga0105241_10643320 3300009174 Bacteria 962
178 Ga0105241_11058874 3300009174 Bacteria 762
179 Ga0105242_10013347 3300009176 Bacteria 6346
180 Ga0105242_10191583 3300009176 Bacteria 1810
181 Ga0105242_10297302 3300009176 Unclassified 1472
182 Ga0105242_10763498 3300009176 Bacteria 953
183 Ga0105242_11577059 3300009176 Bacteria 689
184 Ga0105248_10096431 3300009177 Bacteria 3331
185 Ga0105248_10162800 3300009177 Bacteria 2516
186 Ga0105248_10387839 3300009177 Bacteria 1573
187 Ga0105248_10717301 3300009177 Bacteria 1128
188 Ga0105237_10988400 3300009545 Bacteria 848
189 Ga0105237_11206087 3300009545 Bacteria 763
190 Ga0105237_12469543 3300009545 Bacteria 530
191 Ga0105238_10216249 3300009551 Bacteria 1892
192 Ga0105238_11806344 3300009551 Bacteria 643
193 Ga0105249_10274113 3300009553 Bacteria 1682
194 Ga0105249_10317565 3300009553 Bacteria 1568
195 Ga0105249_10622567 3300009553 Bacteria 1135
196 Ga0105249_10709280 3300009553 Bacteria 1066
197 Ga0105239_10076263 3300010375 Bacteria 3687
198 Ga0105239_10579134 3300010375 Bacteria 1279
199 Ga0105239_12045561 3300010375 Bacteria 665
200 Ga0105246_10031397 3300011119 Bacteria 3515
201 Ga0105246_10146148 3300011119 Bacteria 1784
202 Ga0105246_11584577 3300011119 Bacteria 618
203 Ga0157369_11096937 3300013105 Bacteria 814
204 Ga0157374_10002739 3300013296 Bacteria 14799
205 Ga0157378_10010605 3300013297 Bacteria 8054
206 Ga0157378_12010069 3300013297 Bacteria 628
207 Ga0157378_12323206 3300013297 Bacteria 588
208 Ga0163162_10101405 3300013306 Bacteria 2970
209 Ga0163162_10874957 3300013306 Bacteria 1013
210 Ga0157372_10077265 3300013307 Bacteria 3760
211 Ga0157372_10114001 3300013307 Bacteria 3098
212 Ga0157375_10092142 3300013308 Bacteria 3094
213 Ga0157375_10121499 3300013308 Bacteria 2722
214 Ga0157375_10278878 3300013308 Bacteria 1834
215 Ga0157375_10688916 3300013308 Bacteria 1176
216 Ga0163163_10057901 3300014325 Bacteria 3832
217 Ga0163163_10091209 3300014325 Bacteria 3061
218 Ga0163163_10592684 3300014325 Bacteria 1172
219 Ga0163163_10649863 3300014325 Bacteria 1118
220 Ga0163163_12862586 3300014325 Bacteria 538
221 Ga0157379_10003193 3300014968 Bacteria 13886
222 Ga0157379_10010804 3300014968 Bacteria 7961
223 Ga0157379_10668853 3300014968 Bacteria 973
224 Ga0157376_10038619 3300014969 Bacteria 3886
225 Ga0157376_10139814 3300014969 Bacteria 2171
226 Ga0157376_10246665 3300014969 Bacteria 1666
227 Ga0206350_11023473 3300020080 Bacteria 761
228 Ga0213874_10132468 3300021377 Bacteria 857
229 Ga0213876_10007969 3300021384 Bacteria 5745
230 Ga0213876_10010219 3300021384 Bacteria 5041
231 Ga0213876_10010409 3300021384 Bacteria 4994
232 Ga0213876_10142719 3300021384 Bacteria 1273
233 Ga0213876_10194536 3300021384 Bacteria 1078
234 Ga0213876_10249144 3300021384 Bacteria 944
235 Ga0213875_10011940 3300021388 Bacteria 4305
236 Ga0213875_10021263 3300021388 Bacteria 3109
237 Ga0213875_10044864 3300021388 Bacteria 2076
238 Ga0213871_10185101 3300021441 Bacteria 645
239 Ga0224712_10644824 3300022467 Bacteria 519
240 Ga0207682_10051703 3300025893 Bacteria 1702
241 Ga0207692_10011831 3300025898 Bacteria 3730
242 Ga0207692_10751657 3300025898 Bacteria 635
243 Ga0207642_10137261 3300025899 Bacteria 1284
244 Ga0207642_10354390 3300025899 Bacteria 867
245 Ga0207642_10464580 3300025899 Bacteria 769
246 Ga0207710_10014244 3300025900 Bacteria 3350
247 Ga0207710_10029198 3300025900 Bacteria 2398
248 Ga0207710_10254550 3300025900 Bacteria 879
249 Ga0207688_10002499 3300025901 Bacteria 9902
250 Ga0207688_10092746 3300025901 Bacteria 1736
251 Ga0207688_10140297 3300025901 Bacteria 1422
252 Ga0207680_10090509 3300025903 Bacteria 1945
253 Ga0207685_10125732 3300025905 Bacteria 1132
254 Ga0207699_10007919 3300025906 Bacteria 5214
255 Ga0207643_10510856 3300025908 Bacteria 769
256 Ga0207643_10853498 3300025908 Bacteria 590
257 Ga0207684_10214736 3300025910 Bacteria 1660
258 Ga0207654_10090351 3300025911 Bacteria 1865
259 Ga0207654_10431617 3300025911 Bacteria 921
260 Ga0207654_10697264 3300025911 Bacteria 729
261 Ga0207707_10082715 3300025912 Bacteria 2803
262 Ga0207707_10099510 3300025912 Bacteria 2541
263 Ga0207707_10469564 3300025912 Unclassified 1075
264 Ga0207707_11081317 3300025912 Bacteria 655
265 Ga0207695_10292003 3300025913 Bacteria 1522
266 Ga0207671_10222845 3300025914 Bacteria 1478
267 Ga0207693_10004813 3300025915 Bacteria 11356
268 Ga0207693_10028260 3300025915 Bacteria 4431
269 Ga0207663_10012494 3300025916 Bacteria 4592
270 Ga0207663_10042341 3300025916 Bacteria 2782
271 Ga0207663_10225414 3300025916 Bacteria 1366
272 Ga0207663_10560121 3300025916 Bacteria 894
273 Ga0207663_10954485 3300025916 Bacteria 687
274 Ga0207663_11575038 3300025916 Bacteria 529
275 Ga0207660_10041529 3300025917 Bacteria 3223
276 Ga0207660_10692359 3300025917 Bacteria 831
277 Ga0207662_10180578 3300025918 Bacteria 1358
278 Ga0207657_10000487 3300025919 Bacteria 41908
279 Ga0207652_10305651 3300025921 Unclassified 1435
280 Ga0207652_10379928 3300025921 Bacteria 1275
281 Ga0207694_10016325 3300025924 Bacteria 5605
282 Ga0207650_10180110 3300025925 Bacteria 1684
283 Ga0207659_10107099 3300025926 Bacteria 2118
284 Ga0207687_10000138 3300025927 Bacteria 48809
285 Ga0207687_10369111 3300025927 Bacteria 1173
286 Ga0207687_10406429 3300025927 Bacteria 1121
287 Ga0207687_11185221 3300025927 Bacteria 656
288 Ga0207687_11884360 3300025927 Bacteria 511
289 Ga0207700_10350115 3300025928 Bacteria 1286
290 Ga0207664_10003343 3300025929 Bacteria 10662
291 Ga0207664_10677180 3300025929 Bacteria 927
292 Ga0207664_10707925 3300025929 Bacteria 905
293 Ga0207664_10870474 3300025929 Bacteria 809
294 Ga0207664_11082071 3300025929 Bacteria 717
295 Ga0207644_10053056 3300025931 Bacteria 2917
296 Ga0207690_10241676 3300025932 Bacteria 1391
297 Ga0207706_10055712 3300025933 Bacteria 3486
298 Ga0207686_10104513 3300025934 Bacteria 1897
299 Ga0207686_10256841 3300025934 Bacteria 1279
300 Ga0207709_10023097 3300025935 Bacteria 3536
301 Ga0207709_10042019 3300025935 Unclassified 2747
302 Ga0207709_10427330 3300025935 Bacteria 1019
303 Ga0207670_10115525 3300025936 Bacteria 1941
304 Ga0207669_10024539 3300025937 Bacteria 3242
305 Ga0207669_10222543 3300025937 Bacteria 1386
306 Ga0207704_10112452 3300025938 Bacteria 1844
307 Ga0207704_10322406 3300025938 Bacteria 1192
308 Ga0207665_10050597 3300025939 Bacteria 2794
309 Ga0207665_10343937 3300025939 Bacteria 1125
310 Ga0207665_10476094 3300025939 Bacteria 961
311 Ga0207691_10156351 3300025940 Bacteria 2002
312 Ga0207691_11566282 3300025940 Bacteria 537
313 Ga0207711_10089760 3300025941 Bacteria 2700
314 Ga0207689_10028089 3300025942 Bacteria 4706
315 Ga0207661_10075883 3300025944 Bacteria 2760
316 Ga0207661_10337810 3300025944 Bacteria 1357
317 Ga0207679_11483041 3300025945 Bacteria 622
318 Ga0207667_10006618 3300025949 Bacteria 14009
319 Ga0207651_10317687 3300025960 Bacteria 1301
320 Ga0207651_10806457 3300025960 Bacteria 832
321 Ga0207712_10016010 3300025961 Bacteria 4847
322 Ga0207712_10617452 3300025961 Bacteria 939
323 Ga0207668_10050454 3300025972 Bacteria 2868
324 Ga0207640_10192257 3300025981 Bacteria 1539
325 Ga0207658_10600805 3300025986 Bacteria 988
326 Ga0207677_10001777 3300026023 Bacteria 11380
327 Ga0207677_10144239 3300026023 Bacteria 1828
328 Ga0207677_11452603 3300026023 Bacteria 633
329 Ga0207703_10106369 3300026035 Bacteria 2386
330 Ga0207703_10117892 3300026035 Bacteria 2275
331 Ga0207703_10257556 3300026035 Bacteria 1576
332 Ga0207703_10521000 3300026035 Bacteria 1118
333 Ga0207703_11651818 3300026035 Bacteria 616
334 Ga0207639_10220196 3300026041 Bacteria 1639
335 Ga0207708_10359834 3300026075 Bacteria 1196
336 Ga0207702_10036111 3300026078 Bacteria 4133
337 Ga0207702_10270109 3300026078 Bacteria 1604
338 Ga0207702_11922275 3300026078 Bacteria 583
339 Ga0207641_10032071 3300026088 Bacteria 4362
340 Ga0207641_11542860 3300026088 Bacteria 666
341 Ga0207676_10056905 3300026095 Bacteria 3077
342 Ga0207676_10671765 3300026095 Bacteria 1001
343 Ga0207675_100209339 3300026118 Unclassified 1875
344 Ga0207675_101318248 3300026118 Bacteria 742
345 Ga0207683_10000640 3300026121 Bacteria 32015
346 Ga0207683_10026048 3300026121 Bacteria 5050
347 Ga0207683_10057986 3300026121 Bacteria 3399
348 Ga0207683_10903997 3300026121 Bacteria 820
349 Ga0207683_11251503 3300026121 Bacteria 687
350 Ga0207698_10163395 3300026142 Bacteria 1951
351 Ga0268266_10147507 3300028379 Bacteria 2117
352 Ga0268266_10496636 3300028379 Bacteria 1165
353 Ga0268265_10409242 3300028380 Bacteria 1256
354 Ga0268264_10086215 3300028381 Bacteria 2697
355 Ga0268264_10717080 3300028381 Bacteria 994
356 Ga0307413_10186950 3300031824 Bacteria 1483
357 Ga0307410_11341844 3300031852 Bacteria 626
358 Ga0307407_10403307 3300031903 Bacteria 981
359 Ga0307409_100011270 3300031995 Bacteria 5624
360 Ga0307409_101261237 3300031995 Bacteria 763
361 Ga0307416_101060357 3300032002 Bacteria 914
362 Ga0307416_101624426 3300032002 Bacteria 751
363 Ga0307414_11418793 3300032004 Bacteria 645
364 Ga0307411_10023115 3300032005 Bacteria 3675
365 Ga0307415_100467834 3300032126 Bacteria 1094
366 Ga0307415_101082301 3300032126 Bacteria 749
367 Ga0373948_0221973 3300034817 Bacteria 500
368 Ga0373926_0074740 3300035083 Bacteria 1248
369 Ga0373944_0020359 3300035089 Bacteria 1910
370 Ga0373951_0160108 3300035091 Bacteria 636
371 Ga0373936_0140519 3300035113 Bacteria 1042
372 Ga0373936_0143713 3300035113 Bacteria 1031
373 Ga0373945_0004510 3300035116 Bacteria 4425
374 Ga0373953_0019294 3300035117 Bacteria 2535
375 Ga0373956_0092533 3300035119 Bacteria 1396
376 Ga0373957_0285390 3300035120 Bacteria 698
377 Ga0373960_0028298 3300035121 Bacteria 1546
378 Ga0373943_0003852 3300035170 Bacteria 6822
379 Ga0373943_0140352 3300035170 Bacteria 1301
380 Ga0373946_0020965 3300035171 Bacteria 2530
381 Ga0373955_0103271 3300035172 Bacteria 1639
382 Ga0373924_0079571 3300035410 Bacteria 1392
383 Ga0373931_0126456 3300035691 Bacteria 1467
384 Ga0373935_0020312 3300035692 Bacteria 4056
385 Ga0373935_0582267 3300035692 Bacteria 817
386 Ga0373927_0004810 3300035695 Bacteria 9388
387 Ga0373947_0036735 3300035725 Bacteria 2905
388 Ga0373947_0088831 3300035725 Bacteria 1924
389 Ga0373947_0748865 3300035725 Bacteria 667
390 Ga0373937_0062608 3300036401 Bacteria 3420
391 Ga0373937_0143415 3300036401 Bacteria 2235
392 Ga0373937_0224205 3300036401 Bacteria 1769
393 Ga0373925_0007582 3300037068 Bacteria 7903
394 Ga0373925_0050822 3300037068 Bacteria 3093
395 Ga0373925_0402346 3300037068 Bacteria 1117
396 Ga0395899_0003570 3300037312 Bacteria 12314
397 Ga0395899_0005242 3300037312 Bacteria 10076
398 Ga0395899_0025670 3300037312 Bacteria 4447
399 Ga0395900_0002355 3300037418 Bacteria 20917
400 Ga0395900_0056067 3300037418 Unclassified 4057
401 Ga0395900_0061773 3300037418 Bacteria 3851
402 Ga0395900_0075069 3300037418 Bacteria 3475
403 Ga0395900_1919625 3300037418 Bacteria 503
404 Ga0395898_0019366 3300037466 Bacteria 6927
405 Ga0395898_0036692 3300037466 Bacteria 4866
406 Ga0395898_0085227 3300037466 Unclassified 3045
407 Ga0395905_0017107 3300037471 Bacteria 6886
408 Ga0395905_0017882 3300037471 Bacteria 6735
409 Ga0395905_0024819 3300037471 Bacteria 5657
410 Ga0395905_0250239 3300037471 Bacteria 1655
411 Ga0395905_0432365 3300037471 Bacteria 1213
412 Ga0395905_1734995 3300037471 Bacteria 530
413 Ga0436364_0072421 3300037853 Bacteria 8091
414 Ga0436364_0280144 3300037853 Bacteria 536
415 Ga0436364_0351046 3300037853 Bacteria 4276
416 Ga0436364_0991341 3300037853 Bacteria 7429
417 Ga0436364_1110005 3300037853 Bacteria 2234
418 Ga0436364_1193056 3300037853 Bacteria 1332
419 Ga0436364_1219229 3300037853 Bacteria 4585
420 Ga0436364_1258901 3300037853 Bacteria 902
421 Ga0395901_0001878 3300038443 Bacteria 21664
422 Ga0395901_0026964 3300038443 Bacteria 5899
423 Ga0395901_0082725 3300038443 Bacteria 3354
424 Ga0395901_0464673 3300038443 Bacteria 1292
425 Ga0395901_0940804 3300038443 Bacteria 843
426 Ga0436365_0157247 3300039437 Bacteria 20207
427 Ga0436365_0184729 3300039437 Bacteria 53150
428 Ga0436365_0277032 3300039437 Bacteria 6794
429 Ga0436365_0322109 3300039437 Bacteria 558
430 Ga0436365_0731811 3300039437 Bacteria 3067
431 Ga0436365_0759179 3300039437 Bacteria 8029
432 Ga0436365_1166248 3300039437 Bacteria 1388
433 Ga0436365_1457575 3300039437 Bacteria 2258
434 Ga0436360_0915763 3300039438 Bacteria 1008
435 Ga0436360_0918404 3300039438 Bacteria 1342
436 Ga0436361_0379949 3300039447 Bacteria 2072
437 Ga0436363_0055614 3300039450 Bacteria 9587
438 Ga0436363_0168990 3300039450 Bacteria 860
439 Ga0436363_0327345 3300039450 Bacteria 1607
440 Ga0436363_0460142 3300039450 Bacteria 663
441 Ga0436363_0505584 3300039450 Bacteria 636
442 Ga0436363_0691770 3300039450 Bacteria 2239
443 Ga0436363_0894241 3300039450 Bacteria 6042
444 Ga0436363_0985761 3300039450 Bacteria 902
445 Ga0436363_0997417 3300039450 Bacteria 861
446 Ga0436363_1045939 3300039450 Bacteria 1369
447 Ga0436363_1160288 3300039450 Bacteria 1144
448 Ga0436363_1311197 3300039450 Bacteria 652
449 Ga0436363_1650657 3300039450 Bacteria 687
450 Ga0436362_0465213 3300039453 Bacteria 734
451 Ga0436362_0610266 3300039453 Bacteria 1218
452 Ga0436362_0740478 3300039453 Bacteria 2986
453 Ga0436362_0899815 3300039453 Bacteria 2977
454 Ga0436362_1263123 3300039453 Bacteria 1874
455 Ga0451835_0870825 3300041492 Bacteria 508
456 Ga0451853_0659814 3300041512 Bacteria 1990
457 Ga0451853_3125719 3300041512 Bacteria 2658
458 Ga0466969_0155825 3300044656 Bacteria 1051
459 Ga0466966_0365095 3300044684 Bacteria 867
460 Ga0466966_0409103 3300044684 Bacteria 815
461 Ga0466966_0553451 3300044684 Bacteria 692
462 Ga0466966_0945767 3300044684 Bacteria 520
463 Ga0466961_0244883 3300044693 Bacteria 1101
464 Ga0466961_0309498 3300044693 Bacteria 964
465 Ga0466963_0003843 3300044694 Bacteria 8661
466 Ga0466963_0016075 3300044694 Bacteria 4648
467 Ga0466963_0243442 3300044694 Bacteria 1261
468 Ga0466964_0026243 3300044706 Bacteria 2280
469 Ga0466964_0535536 3300044706 Bacteria 634
470 Ga0466971_0034627 3300044719 Bacteria 2263
471 Ga0466971_0101398 3300044719 Bacteria 1323
472 Ga0466968_0022185 3300044735 Bacteria 2579
473 Ga0466968_0578682 3300044735 Bacteria 565
474 Ga0466970_0349315 3300044765 Bacteria 839
475 Ga0466957_0004367 3300044842 Bacteria 7865
476 Ga0466957_0063606 3300044842 Bacteria 2268
477 Ga0466957_0183958 3300044842 Bacteria 1366
478 Ga0466960_0125254 3300044901 Bacteria 1350
479 Ga0466960_0326076 3300044901 Bacteria 871
480 Ga0466959_0023410 3300045049 Bacteria 4570
481 Ga0466959_0090146 3300045049 Bacteria 2203
482 Ga0466959_0103235 3300045049 Bacteria 2040
483 Ga0466959_0128366 3300045049 Bacteria 1798
484 Ga0466959_0297427 3300045049 Bacteria 1106
485 Ga0466959_1081707 3300045049 Bacteria 533
486 Ga0466958_0061085 3300045836 Bacteria 2295
487 Ga0466958_0116328 3300045836 Bacteria 1671
488 Ga0466958_0168372 3300045836 Bacteria 1387
489 Ga0466958_0359086 3300045836 Bacteria 938
490 Ga0466958_0428562 3300045836 Bacteria 855
491 Ga0466967_0000913 3300045976 Bacteria 15849
492 Ga0466967_0085240 3300045976 Bacteria 2860
493 Ga0466967_0106177 3300045976 Bacteria 2574
494 Ga0466967_0114819 3300045976 Bacteria 2479
495 Ga0466967_0321535 3300045976 Bacteria 1492
496 Ga0466967_0365660 3300045976 Bacteria 1398
497 Ga0466967_0491022 3300045976 Bacteria 1204
498 Ga0466967_0600594 3300045976 Bacteria 1086
499 Ga0466967_1239462 3300045976 Bacteria 743
500 Ga0466967_1294299 3300045976 Bacteria 726
501 Ga0466967_1488961 3300045976 Bacteria 674
502 Ga0466967_1797728 3300045976 Bacteria 610
503 Ga0466967_2287616 3300045976 Bacteria 536
504 Ga0495592_0028320 3300046454 Bacteria 4244
505 Ga0495603_0024216 3300046455 Bacteria 3671
506 Ga0495603_0363652 3300046455 Bacteria 830
507 Ga0495603_0379475 3300046455 Bacteria 810
508 Ga0495629_0007380 3300046459 Bacteria 8105
509 Ga0495641_0026161 3300046461 Bacteria 2851
510 Ga0495641_0047840 3300046461 Bacteria 1962
511 Ga0495641_0085876 3300046461 Bacteria 1408
512 Ga0495651_0030394 3300046462 Bacteria 4212
513 Ga0495653_0011373 3300046463 Bacteria 7272
514 Ga0495653_0015978 3300046463 Bacteria 6118
515 Ga0495580_0043230 3300046472 Bacteria 3207
516 Ga0495582_0329027 3300046473 Bacteria 879
517 Ga0495639_0008728 3300046475 Bacteria 4347
518 Ga0495639_0623940 3300046475 Bacteria 555
519 Ga0495662_0000608 3300046476 Bacteria 16568
520 Ga0495662_0519570 3300046476 Bacteria 584
521 Ga0495664_0031387 3300046477 Bacteria 3114
522 Ga0495664_0149518 3300046477 Bacteria 1417
523 Ga0495594_0047834 3300046499 Bacteria 2349
524 Ga0495594_0091763 3300046499 Bacteria 1702
525 Ga0495608_0009777 3300046511 Bacteria 6692
526 Ga0495608_0029399 3300046511 Bacteria 3727
527 Ga0495608_0596514 3300046511 Bacteria 663
528 Ga0495616_0475317 3300046513 Bacteria 503
529 Ga0495618_0135522 3300046514 Bacteria 1575
530 Ga0495618_0142182 3300046514 Bacteria 1534
531 Ga0495628_0242955 3300046516 Bacteria 1346
532 Ga0495630_0019350 3300046517 Bacteria 5003
533 Ga0495630_0221859 3300046517 Bacteria 1443
534 Ga0495630_0502703 3300046517 Bacteria 929
535 Ga0495630_0528884 3300046517 Bacteria 904
536 Ga0495666_0012915 3300046526 Bacteria 4162
537 Ga0495652_0031721 3300046529 Bacteria 4624
538 Ga0495665_0067510 3300046531 Bacteria 1887
539 Ga0495665_0089567 3300046531 Bacteria 1616
540 Ga0495640_0005209 3300046533 Bacteria 10333
541 Ga0495640_0145741 3300046533 Bacteria 1523
542 Ga0495640_0156372 3300046533 Bacteria 1463
543 Ga0495640_0205061 3300046533 Bacteria 1248
544 Ga0495586_0047206 3300046535 Bacteria 2324
545 Ga0495587_0023303 3300046536 Bacteria 3804
546 Ga0495645_0041226 3300046543 Bacteria 3367
547 Ga0495622_0047319 3300046557 Bacteria 1999
548 Ga0495667_0005634 3300046559 Bacteria 8465
549 Ga0495667_0019978 3300046559 Bacteria 4517
550 Ga0495667_0048967 3300046559 Bacteria 2790
551 Ga0495634_0002813 3300046642 Bacteria 14298
552 Ga0495634_0045770 3300046642 Bacteria 2956
553 Ga0495634_0181735 3300046642 Bacteria 1316
554 Ga0495635_0001991 3300046663 Bacteria 13873
555 Ga0495635_0034025 3300046663 Bacteria 3535
556 Ga0495635_0571426 3300046663 Bacteria 740
557 Ga0495588_0002352 3300046674 Bacteria 8093
558 Ga0495588_0151403 3300046674 Bacteria 1226
559 Ga0495588_0304976 3300046674 Bacteria 838
560 Ga0495657_0001586 3300046675 Bacteria 19540
561 Ga0495657_0032220 3300046675 Bacteria 3659
562 Ga0495657_0116407 3300046675 Bacteria 1688
563 Ga0495599_0273235 3300046678 Bacteria 1025
564 Ga0495623_0228309 3300046679 Bacteria 1057
565 Ga0495623_0254724 3300046679 Bacteria 985
566 Ga0495646_0003087 3300046680 Bacteria 10334
567 Ga0495647_0013156 3300046681 Bacteria 2862
568 Ga0495647_0063679 3300046681 Bacteria 1461
569 Ga0495647_0098127 3300046681 Bacteria 1210
570 Ga0495658_0001040 3300046683 Bacteria 14670
571 Ga0495658_0985388 3300046683 Bacteria 538
572 Ga0495624_0002913 3300046690 Bacteria 12792
573 Ga0495600_0005584 3300046809 Bacteria 7596
574 Ga0495600_0107754 3300046809 Bacteria 1815
575 Ga0495600_0328779 3300046809 Unclassified 960
576 Ga0495581_0008134 3300047315 Bacteria 6074
577 Ga0495581_0037716 3300047315 Bacteria 2798
578 Ga0495604_0013131 3300047317 Bacteria 6597
579 Ga0495604_0092922 3300047317 Bacteria 2233
580 Ga0495674_0023061 3300047319 Bacteria 5735
581 Ga0495674_0114855 3300047319 Bacteria 2279
582 Ga0495674_0260960 3300047319 Bacteria 1423
583 Ga0495676_0000612 3300047321 Bacteria 29546
584 Ga0495676_0021114 3300047321 Bacteria 5698
585 Ga0495676_0113883 3300047321 Bacteria 1979
586 Ga0495676_0119985 3300047321 Bacteria 1914
587 Ga0495676_0259793 3300047321 Bacteria 1182
588 Ga0495680_0014240 3300047322 Bacteria 6896
589 Ga0495680_0018876 3300047322 Bacteria 5840
590 Ga0495680_0391534 3300047322 Bacteria 961
591 Ga0495675_0010748 3300047444 Bacteria 5732
592 Ga0495675_0450677 3300047444 Bacteria 744
593 Ga0495673_0336765 3300047469 Bacteria 535
594 Ga0495684_0001726 3300047471 Bacteria 17588
595 Ga0495593_0006302 3300047673 Bacteria 6959
596 Ga0495593_0056195 3300047673 Bacteria 2070
597 Ga0495593_0148525 3300047673 Unclassified 1186
598 Ga0495602_0008806 3300048088 Bacteria 10525
599 Ga0495602_0038007 3300048088 Bacteria 4457
600 Ga0495602_0178572 3300048088 Bacteria 1640
601 Ga0495602_0526350 3300048088 Unclassified 823
602 Ga0495614_0012293 3300048089 Bacteria 3760
603 Ga0496100_0007788 3300048903 Bacteria 5939
604 Ga0496100_0012431 3300048903 Bacteria 4880
605 Ga0496100_0066004 3300048903 Bacteria 2399
606 Ga0496100_0135613 3300048903 Bacteria 1738
607 Ga0496100_0193097 3300048903 Bacteria 1479
608 Ga0496100_0290179 3300048903 Bacteria 1222
609 Ga0496100_0735341 3300048903 Bacteria 771
610 Ga0496101_0000889 3300048904 Bacteria 17599
611 Ga0496101_0006710 3300048904 Bacteria 7422
612 Ga0496101_0032490 3300048904 Bacteria 3674
613 Ga0496101_0065123 3300048904 Bacteria 2656
614 Ga0496101_0115790 3300048904 Bacteria 2022
615 Ga0496102_0002474 3300048905 Bacteria 15769
616 Ga0496102_0031229 3300048905 Bacteria 4776
617 Ga0496102_0065248 3300048905 Bacteria 3336
618 Ga0496102_0151371 3300048905 Bacteria 2180
619 Ga0496102_0290065 3300048905 Bacteria 1542
620 Ga0496102_1275120 3300048905 Bacteria 654
621 Ga0496102_1597540 3300048905 Bacteria 570
622 Ga0496103_0002724 3300048906 Bacteria 11020
623 Ga0496103_0005915 3300048906 Bacteria 7312
624 Ga0496103_0017287 3300048906 Bacteria 4315
625 Ga0496103_0181147 3300048906 Bacteria 1354
626 Ga0496103_0220146 3300048906 Bacteria 1221
627 Ga0496104_0005490 3300048907 Bacteria 11106
628 Ga0496104_0007627 3300048907 Bacteria 9581
629 Ga0496104_0075439 3300048907 Bacteria 3211
630 Ga0496104_0140881 3300048907 Bacteria 2316
631 Ga0496104_0293230 3300048907 Bacteria 1539
632 Ga0496104_0319291 3300048907 Bacteria 1466
633 Ga0496104_0849241 3300048907 Bacteria 818
634 Ga0496105_0008271 3300048908 Bacteria 8090
635 Ga0496105_0010912 3300048908 Bacteria 7157
636 Ga0496105_0043371 3300048908 Bacteria 3710
637 Ga0496105_0164977 3300048908 Bacteria 1817
638 Ga0496106_0001965 3300048909 Bacteria 15454
639 Ga0496106_0002646 3300048909 Bacteria 13322
640 Ga0496106_0053307 3300048909 Bacteria 3054
641 Ga0496106_0054793 3300048909 Bacteria 3013
642 Ga0496106_0056385 3300048909 Bacteria 2970
643 Ga0496106_0178713 3300048909 Bacteria 1684
644 Ga0496106_0607755 3300048909 Bacteria 875
645 Ga0496106_0946044 3300048909 Bacteria 679
646 Ga0496107_0000334 3300048910 Bacteria 25483
647 Ga0496107_0001253 3300048910 Bacteria 15541
648 Ga0496107_0001480 3300048910 Bacteria 14533
649 Ga0496107_0040092 3300048910 Bacteria 3360
650 Ga0496107_0075109 3300048910 Bacteria 2460
651 Ga0496107_0081256 3300048910 Bacteria 2363
652 Ga0496107_0190879 3300048910 Bacteria 1522
653 Ga0496107_1052354 3300048910 Bacteria 589
654 Ga0496108_0000291 3300048911 Bacteria 43199
655 Ga0496108_0087665 3300048911 Bacteria 2643
656 Ga0496108_0146372 3300048911 Bacteria 2037
657 Ga0496108_0191793 3300048911 Bacteria 1771
658 Ga0496108_0412024 3300048911 Bacteria 1180
659 Ga0496108_0776773 3300048911 Bacteria 827
660 Ga0496108_1720017 3300048911 Bacteria 516
661 Ga0496109_0002610 3300048912 Bacteria 15109
662 Ga0496109_0022454 3300048912 Bacteria 5589
663 Ga0496109_0099665 3300048912 Bacteria 2695
664 Ga0496109_0201445 3300048912 Bacteria 1871
665 Ga0496109_0404284 3300048912 Bacteria 1290
666 Ga0496109_0570790 3300048912 Bacteria 1066
667 Ga0496110_0000510 3300048913 Bacteria 26372
668 Ga0496110_0051687 3300048913 Bacteria 3611
669 Ga0496110_0135229 3300048913 Bacteria 2227
670 Ga0496110_0403948 3300048913 Bacteria 1245
671 Ga0496110_1310796 3300048913 Bacteria 633
672 Ga0496110_1681011 3300048913 Bacteria 545
673 Ga0496111_0000517 3300048914 Bacteria 19933
674 Ga0496111_0146541 3300048914 Bacteria 1750
675 Ga0496112_0007065 3300048915 Bacteria 9919
676 Ga0496112_0010082 3300048915 Bacteria 8556
677 Ga0496112_0348723 3300048915 Bacteria 1423
678 Ga0496112_0465555 3300048915 Bacteria 1201
679 Ga0496112_0673556 3300048915 Bacteria 963
680 Ga0496113_0000190 3300048916 Bacteria 27916
681 Ga0496113_0067195 3300048916 Bacteria 2717
682 Ga0496113_0300431 3300048916 Bacteria 1285
683 Ga0496113_0885861 3300048916 Bacteria 706
684 Ga0496114_0008548 3300048917 Bacteria 8115
685 Ga0496114_0011880 3300048917 Bacteria 6969
686 Ga0496114_0025448 3300048917 Bacteria 4838
687 Ga0496114_0129170 3300048917 Bacteria 2180
688 Ga0496114_0309346 3300048917 Bacteria 1395
689 Ga0496114_1039147 3300048917 Bacteria 703
690 Ga0496115_0018143 3300048918 Bacteria 5395
691 Ga0496115_0022414 3300048918 Bacteria 4892
692 Ga0496115_0148531 3300048918 Bacteria 1935
693 Ga0496115_0190694 3300048918 Bacteria 1693
694 Ga0496115_0206784 3300048918 Bacteria 1621
695 Ga0501041_1043705 3300049577 Bacteria 526
696 Ga0501069_0082038 3300049585 Bacteria 1817
697 nmdc:mga00v17_29339_c1 3300050491 Bacteria 3228
698 nmdc:mga0yw44_108572_c1 3300050492 Bacteria 1776
699 nmdc:mga0yw44_20902_c1 3300050492 Bacteria 3643
700 nmdc:mga0yw44_342852_c1 3300050492 Bacteria 1005
701 nmdc:mga06z11_776509_c1 3300050494 Bacteria 584
702 nmdc:mga05p37_1493091_c1 3300050507 Bacteria 673
703 nmdc:mga05p37_569270_c1 3300050507 Unclassified 1285
704 nmdc:mga05p37_671424_c1 3300050507 Bacteria 1157
705 nmdc:mga05p37_738370_c1 3300050507 Bacteria 617
706 nmdc:mga09592_1358852_c1 3300050508 Bacteria 582
707 nmdc:mga06r32_1075589_c1 3300050510 Bacteria 754
708 nmdc:mga06r32_1493081_c1 3300050510 Bacteria 616
709 nmdc:mga06r32_218215_c1 3300050510 Bacteria 1895
710 nmdc:mga06r32_3111_c1 3300050510 Bacteria 14857
711 nmdc:mga06r32_504883_c1 3300050510 Bacteria 1186
712 nmdc:mga08y16_68097_c1 3300050511 Bacteria 3712
713 nmdc:mga0n895_13031_c1 3300050512 Bacteria 7481
714 nmdc:mga0n895_1632883_c1 3300050512 Bacteria 608
715 nmdc:mga0n895_395233_c1 3300050512 Bacteria 1398
716 nmdc:mga0n895_451060_c1 3300050512 Bacteria 1299
717 nmdc:mga0n895_681579_c1 3300050512 Unclassified 1025
718 nmdc:mga0rr50_104796_c1 3300050513 Bacteria 2228
719 nmdc:mga0rr50_240679_c1 3300050513 Bacteria 1500
720 nmdc:mga0rr50_329_c1 3300050513 Bacteria 25831
721 nmdc:mga0rr50_386883_c1 3300050513 Bacteria 1180
722 nmdc:mga0rr50_792897_c1 3300050513 Bacteria 808
723 nmdc:mga08x19_10156_c1 3300050514 Bacteria 5649
724 nmdc:mga0a205_155881_c1 3300050515 Bacteria 2182
725 nmdc:mga0a205_224966_c1 3300050515 Bacteria 1761
726 Ga0495601_0004490 3300053077 Bacteria 8063
727 Ga0495601_0089149 3300053077 Bacteria 1983
728 Ga0495601_0312002 3300053077 Bacteria 1024
729 Ga0495601_1077272 3300053077 Bacteria 503
730 Ga0495612_0040674 3300053078 Bacteria 1894
731 Ga0495612_0084456 3300053078 Bacteria 1337
732 Ga0495612_0197239 3300053078 Bacteria 887
733 Ga0495612_0487475 3300053078 Bacteria 565
734 Ga0495655_0031152 3300053083 Bacteria 1296
735 Ga0495595_0001546 3300053084 Bacteria 8976
736 Ga0495595_0002456 3300053084 Bacteria 7246
737 Ga0495595_0200670 3300053084 Bacteria 993
738 Ga0495595_0256489 3300053084 Bacteria 876
739 Ga0495619_0012634 3300053085 Bacteria 5315
740 Ga0495619_0028685 3300053085 Bacteria 3591
741 Ga0495619_0029991 3300053085 Bacteria 3519
742 Ga0495619_0081121 3300053085 Bacteria 2184
743 Ga0495619_0103994 3300053085 Bacteria 1935
744 Ga0495619_0132453 3300053085 Unclassified 1714
745 Ga0466962_0175644 3300061719 Bacteria 1043
746 Ga0466962_0293789 3300061719 Bacteria 803
747 Ga0081455_10000308
748 Ga0070683_100641325
749 Ga0070690_100556943
750 Ga0068869_101677972
751 Ga0070680_100140757
752 Ga0070680_100502314
753 Ga0070682_100021571
754 Ga0070682_100523627
755 Ga0068868_100015592
756 Ga0068868_100209982
757 Ga0070660_100001712
758 Ga0070689_100093363
759 Ga0070689_101138466
760 Ga0070689_101427351
761 Ga0070687_100302207
762 Ga0070692_10899696
763 Ga0070692_11252502
764 Ga0070668_100085040
765 Ga0070668_101133606
766 Ga0070675_100084558
767 Ga0070674_100107874
768 Ga0070674_100195615
769 Ga0070674_101938085
770 Ga0070673_100236899
771 Ga0070688_100357307
772 Ga0070659_100225473
773 Ga0070667_100137630
774 Ga0070667_100510294
775 Ga0070709_10002742
776 Ga0070709_11057607
777 Ga0070714_100017027
778 Ga0070714_100419448
779 Ga0070714_100679193
780 Ga0070713_100032812
781 Ga0070713_100145960
782 Ga0070713_100334376
783 Ga0070710_10023651
784 Ga0070701_10229530
785 Ga0070701_10913834
786 Ga0070711_100010812
787 Ga0070711_100073590
788 Ga0070711_100174304
789 Ga0070711_100460376
790 Ga0070711_100921456
791 Ga0070711_101156425
792 Ga0070705_100058122
793 Ga0070705_100635060
794 Ga0070694_100244465
795 Ga0070694_100526448
796 Ga0070678_100016645
797 Ga0070678_100018115
798 Ga0070678_100087157
799 Ga0070662_100072943
800 Ga0070681_10021715
801 Ga0070681_10120478
802 Ga0070681_10142135
803 Ga0070685_10238679
804 Ga0070685_11075663
805 Ga0070706_100299312
806 Ga0070679_100090331
807 Ga0070679_100664653
808 Ga0070679_101475541
809 Ga0070684_100089595
810 Ga0070684_100727356
811 Ga0068853_100157856
812 Ga0070672_100127867
813 Ga0070672_100610267
814 Ga0070686_100075235
815 Ga0070686_100396875
816 Ga0070686_101307581
817 Ga0070695_100266060
818 Ga0070695_100497964
819 Ga0070695_100525422
820 Ga0070696_100126202
821 Ga0070696_100198414
822 Ga0070696_100440109
823 Ga0070696_100565644
824 Ga0070693_100050546
825 Ga0070693_100091175
826 Ga0070693_100153215
827 Ga0070665_100321810
828 Ga0070665_101056621
829 Ga0070704_100580510
830 Ga0068855_100003269
831 Ga0070664_100569373
832 Ga0068857_100921075
833 Ga0068854_100273245
834 Ga0068856_100006836
835 Ga0070702_100018115
836 Ga0070702_100157895
837 Ga0068852_100320657
838 Ga0068859_100167967
839 Ga0068859_100176905
840 Ga0068859_100403545
841 Ga0068859_100418975
842 Ga0068864_100118598
843 Ga0068864_100347454
844 Ga0068866_10462906
845 Ga0068861_100979030
846 Ga0068861_101682398
847 Ga0068863_100055895
848 Ga0068863_102213702
849 Ga0068858_100039036
850 Ga0068858_100608894
851 Ga0068858_100623620
852 Ga0068860_100071313
853 Ga0068860_100509019
854 Ga0081455_10349718
855 Ga0081538_10108433
856 Ga0081540_1201161
857 Ga0070717_10036474
858 Ga0070717_10220871
859 Ga0070717_10446339
860 Ga0075365_10000319
861 Ga0075365_10009698
862 Ga0075365_10164062
863 Ga0075364_10032686
864 Ga0070715_10030099
865 Ga0070715_10180591
866 Ga0070716_100013589
867 Ga0070716_100515606
868 Ga0070712_100004281
869 Ga0070712_100014072
870 Ga0070712_100031477
871 Ga0070712_100147599
872 Ga0070712_100501201
873 Ga0097621_100772033
874 Ga0068871_100037316
875 Ga0068871_100133863
876 Ga0068871_101219480
877 Ga0075428_100329278
878 Ga0075431_100004271
879 Ga0075431_100103680
880 Ga0075431_100746780
881 Ga0075433_10138173
882 Ga0075433_10182741
883 Ga0075433_10361111
884 Ga0075434_100000531
885 Ga0075434_100034784
886 Ga0075434_100349331
887 Ga0075434_101083286
888 Ga0075434_101771213
889 Ga0068865_100236121
890 Ga0068865_100374128
891 Ga0068865_100854314
892 Ga0075436_100195991
893 Ga0097620_100167967
894 Ga0097620_100176903
895 Ga0097620_100403550
896 Ga0097620_100418948
897 Ga0075435_100005171
898 Ga0075435_100011401
899 Ga0075435_100018820
900 Ga0075435_100302890
901 Ga0105240_10221746
902 Ga0111539_10022378
903 Ga0111539_11244326
904 Ga0105245_10000665
905 Ga0105245_10025506
906 Ga0105245_10079335
907 Ga0105245_10133944
908 Ga0105245_10369737
909 Ga0105245_11022307
910 Ga0105245_11303405
911 Ga0105247_10013260
912 Ga0105247_10028241
913 Ga0105247_10295412
914 Ga0114129_10178047
915 Ga0114129_10588335
916 Ga0105243_10012210
917 Ga0105243_10090726
918 Ga0105243_10228754
919 Ga0105243_10258900
920 Ga0105243_10490796
921 Ga0105243_11110036
922 Ga0105241_10094742
923 Ga0105241_10643320
924 Ga0105241_11058874
925 Ga0105242_10013347
926 Ga0105242_10191583
927 Ga0105242_10297302
928 Ga0105242_10763498
929 Ga0105242_11577059
930 Ga0105248_10096431
931 Ga0105248_10162800
932 Ga0105248_10387839
933 Ga0105248_10717301
934 Ga0105237_10988400
935 Ga0105237_11206087
936 Ga0105237_12469543
937 Ga0105238_10216249
938 Ga0105238_11806344
939 Ga0105249_10274113
940 Ga0105249_10317565
941 Ga0105249_10622567
942 Ga0105249_10709280
943 Ga0105239_10076263
944 Ga0105239_10579134
945 Ga0105239_12045561
946 Ga0105246_10031397
947 Ga0105246_10146148
948 Ga0105246_11584577
949 Ga0157369_11096937
950 Ga0157374_10002739
951 Ga0157378_10010605
952 Ga0157378_12010069
953 Ga0157378_12323206
954 Ga0163162_10101405
955 Ga0163162_10874957
956 Ga0157372_10077265
957 Ga0157372_10114001
958 Ga0157375_10092142
959 Ga0157375_10121499
960 Ga0157375_10278878
961 Ga0157375_10688916
962 Ga0163163_10057901
963 Ga0163163_10091209
964 Ga0163163_10592684
965 Ga0163163_10649863
966 Ga0163163_12862586
967 Ga0157379_10003193
968 Ga0157379_10010804
969 Ga0157379_10668853
970 Ga0157376_10038619
971 Ga0157376_10139814
972 Ga0157376_10246665
973 Ga0206350_11023473
974 Ga0213874_10132468
975 Ga0213876_10007969
976 Ga0213876_10010219
977 Ga0213876_10010409
978 Ga0213876_10142719
979 Ga0213876_10194536
980 Ga0213876_10249144
981 Ga0213875_10011940
982 Ga0213875_10021263
983 Ga0213875_10044864
984 Ga0213871_10185101
985 Ga0224712_10644824
986 Ga0207682_10051703
987 Ga0207692_10011831
988 Ga0207692_10751657
989 Ga0207642_10137261
990 Ga0207642_10354390
991 Ga0207642_10464580
992 Ga0207710_10014244
993 Ga0207710_10029198
994 Ga0207710_10254550
995 Ga0207688_10002499
996 Ga0207688_10092746
997 Ga0207688_10140297
998 Ga0207680_10090509
999 Ga0207685_10125732
1000 Ga0207699_10007919
1001 Ga0207643_10510856
1002 Ga0207643_10853498
1003 Ga0207684_10214736
1004 Ga0207654_10090351
1005 Ga0207654_10431617
1006 Ga0207654_10697264
1007 Ga0207707_10082715
1008 Ga0207707_10099510
1009 Ga0207707_10469564
1010 Ga0207707_11081317
1011 Ga0207695_10292003
1012 Ga0207671_10222845
1013 Ga0207693_10004813
1014 Ga0207693_10028260
1015 Ga0207663_10012494
1016 Ga0207663_10042341
1017 Ga0207663_10225414
1018 Ga0207663_10560121
1019 Ga0207663_10954485
1020 Ga0207663_11575038
1021 Ga0207660_10041529
1022 Ga0207660_10692359
1023 Ga0207662_10180578
1024 Ga0207657_10000487
1025 Ga0207652_10305651
1026 Ga0207652_10379928
1027 Ga0207694_10016325
1028 Ga0207650_10180110
1029 Ga0207659_10107099
1030 Ga0207687_10000138
1031 Ga0207687_10369111
1032 Ga0207687_10406429
1033 Ga0207687_11185221
1034 Ga0207687_11884360
1035 Ga0207700_10350115
1036 Ga0207664_10003343
1037 Ga0207664_10677180
1038 Ga0207664_10707925
1039 Ga0207664_10870474
1040 Ga0207664_11082071
1041 Ga0207644_10053056
1042 Ga0207690_10241676
1043 Ga0207706_10055712
1044 Ga0207686_10104513
1045 Ga0207686_10256841
1046 Ga0207709_10023097
1047 Ga0207709_10042019
1048 Ga0207709_10427330
1049 Ga0207670_10115525
1050 Ga0207669_10024539
1051 Ga0207669_10222543
1052 Ga0207704_10112452
1053 Ga0207704_10322406
1054 Ga0207665_10050597
1055 Ga0207665_10343937
1056 Ga0207665_10476094
1057 Ga0207691_10156351
1058 Ga0207691_11566282
1059 Ga0207711_10089760
1060 Ga0207689_10028089
1061 Ga0207661_10075883
1062 Ga0207661_10337810
1063 Ga0207679_11483041
1064 Ga0207667_10006618
1065 Ga0207651_10317687
1066 Ga0207651_10806457
1067 Ga0207712_10016010
1068 Ga0207712_10617452
1069 Ga0207668_10050454
1070 Ga0207640_10192257
1071 Ga0207658_10600805
1072 Ga0207677_10001777
1073 Ga0207677_10144239
1074 Ga0207677_11452603
1075 Ga0207703_10106369
1076 Ga0207703_10117892
1077 Ga0207703_10257556
1078 Ga0207703_10521000
1079 Ga0207703_11651818
1080 Ga0207639_10220196
1081 Ga0207708_10359834
1082 Ga0207702_10036111
1083 Ga0207702_10270109
1084 Ga0207702_11922275
1085 Ga0207641_10032071
1086 Ga0207641_11542860
1087 Ga0207676_10056905
1088 Ga0207676_10671765
1089 Ga0207675_100209339
1090 Ga0207675_101318248
1091 Ga0207683_10000640
1092 Ga0207683_10026048
1093 Ga0207683_10057986
1094 Ga0207683_10903997
1095 Ga0207683_11251503
1096 Ga0207698_10163395
1097 Ga0268266_10147507
1098 Ga0268266_10496636
1099 Ga0268265_10409242
1100 Ga0268264_10086215
1101 Ga0268264_10717080
1102 Ga0307413_10186950
1103 Ga0307410_11341844
1104 Ga0307407_10403307
1105 Ga0307409_100011270
1106 Ga0307409_101261237
1107 Ga0307416_101060357
1108 Ga0307416_101624426
1109 Ga0307414_11418793
1110 Ga0307411_10023115
1111 Ga0307415_100467834
1112 Ga0307415_101082301
1113 Ga0373948_0221973
1114 Ga0373926_0074740
1115 Ga0373944_0020359
1116 Ga0373951_0160108
1117 Ga0373936_0140519
1118 Ga0373936_0143713
1119 Ga0373945_0004510
1120 Ga0373953_0019294
1121 Ga0373956_0092533
1122 Ga0373957_0285390
1123 Ga0373960_0028298
1124 Ga0373943_0003852
1125 Ga0373943_0140352
1126 Ga0373946_0020965
1127 Ga0373955_0103271
1128 Ga0373924_0079571
1129 Ga0373931_0126456
1130 Ga0373935_0020312
1131 Ga0373935_0582267
1132 Ga0373927_0004810
1133 Ga0373947_0036735
1134 Ga0373947_0088831
1135 Ga0373947_0748865
1136 Ga0373937_0062608
1137 Ga0373937_0143415
1138 Ga0373937_0224205
1139 Ga0373925_0007582
1140 Ga0373925_0050822
1141 Ga0373925_0402346
1142 Ga0395899_0003570
1143 Ga0395899_0005242
1144 Ga0395899_0025670
1145 Ga0395900_0002355
1146 Ga0395900_0056067
1147 Ga0395900_0061773
1148 Ga0395900_0075069
1149 Ga0395900_1919625
1150 Ga0395898_0019366
1151 Ga0395898_0036692
1152 Ga0395898_0085227
1153 Ga0395905_0017107
1154 Ga0395905_0017882
1155 Ga0395905_0024819
1156 Ga0395905_0250239
1157 Ga0395905_0432365
1158 Ga0395905_1734995
1159 Ga0436364_0072421
1160 Ga0436364_0280144
1161 Ga0436364_0351046
1162 Ga0436364_0991341
1163 Ga0436364_1110005
1164 Ga0436364_1193056
1165 Ga0436364_1219229
1166 Ga0436364_1258901
1167 Ga0395901_0001878
1168 Ga0395901_0026964
1169 Ga0395901_0082725
1170 Ga0395901_0464673
1171 Ga0395901_0940804
1172 Ga0436365_0157247
1173 Ga0436365_0184729
1174 Ga0436365_0277032
1175 Ga0436365_0322109
1176 Ga0436365_0731811
1177 Ga0436365_0759179
1178 Ga0436365_1166248
1179 Ga0436365_1457575
1180 Ga0436360_0915763
1181 Ga0436360_0918404
1182 Ga0436361_0379949
1183 Ga0436363_0055614
1184 Ga0436363_0168990
1185 Ga0436363_0327345
1186 Ga0436363_0460142
1187 Ga0436363_0505584
1188 Ga0436363_0691770
1189 Ga0436363_0894241
1190 Ga0436363_0985761
1191 Ga0436363_0997417
1192 Ga0436363_1045939
1193 Ga0436363_1160288
1194 Ga0436363_1311197
1195 Ga0436363_1650657
1196 Ga0436362_0465213
1197 Ga0436362_0610266
1198 Ga0436362_0740478
1199 Ga0436362_0899815
1200 Ga0436362_1263123
1201 Ga0451835_0870825
1202 Ga0451853_0659814
1203 Ga0451853_3125719
1204 Ga0466969_0155825
1205 Ga0466966_0365095
1206 Ga0466966_0409103
1207 Ga0466966_0553451
1208 Ga0466966_0945767
1209 Ga0466961_0244883
1210 Ga0466961_0309498
1211 Ga0466963_0003843
1212 Ga0466963_0016075
1213 Ga0466963_0243442
1214 Ga0466964_0026243
1215 Ga0466964_0535536
1216 Ga0466971_0034627
1217 Ga0466971_0101398
1218 Ga0466968_0022185
1219 Ga0466968_0578682
1220 Ga0466970_0349315
1221 Ga0466957_0004367
1222 Ga0466957_0063606
1223 Ga0466957_0183958
1224 Ga0466960_0125254
1225 Ga0466960_0326076
1226 Ga0466959_0023410
1227 Ga0466959_0090146
1228 Ga0466959_0103235
1229 Ga0466959_0128366
1230 Ga0466959_0297427
1231 Ga0466959_1081707
1232 Ga0466958_0061085
1233 Ga0466958_0116328
1234 Ga0466958_0168372
1235 Ga0466958_0359086
1236 Ga0466958_0428562
1237 Ga0466967_0000913
1238 Ga0466967_0085240
1239 Ga0466967_0106177
1240 Ga0466967_0114819
1241 Ga0466967_0321535
1242 Ga0466967_0365660
1243 Ga0466967_0491022
1244 Ga0466967_0600594
1245 Ga0466967_1239462
1246 Ga0466967_1294299
1247 Ga0466967_1488961
1248 Ga0466967_1797728
1249 Ga0466967_2287616
1250 Ga0495592_0028320
1251 Ga0495603_0024216
1252 Ga0495603_0363652
1253 Ga0495603_0379475
1254 Ga0495629_0007380
1255 Ga0495641_0026161
1256 Ga0495641_0047840
1257 Ga0495641_0085876
1258 Ga0495651_0030394
1259 Ga0495653_0011373
1260 Ga0495653_0015978
1261 Ga0495580_0043230
1262 Ga0495582_0329027
1263 Ga0495639_0008728
1264 Ga0495639_0623940
1265 Ga0495662_0000608
1266 Ga0495662_0519570
1267 Ga0495664_0031387
1268 Ga0495664_0149518
1269 Ga0495594_0047834
1270 Ga0495594_0091763
1271 Ga0495608_0009777
1272 Ga0495608_0029399
1273 Ga0495608_0596514
1274 Ga0495616_0475317
1275 Ga0495618_0135522
1276 Ga0495618_0142182
1277 Ga0495628_0242955
1278 Ga0495630_0019350
1279 Ga0495630_0221859
1280 Ga0495630_0502703
1281 Ga0495630_0528884
1282 Ga0495666_0012915
1283 Ga0495652_0031721
1284 Ga0495665_0067510
1285 Ga0495665_0089567
1286 Ga0495640_0005209
1287 Ga0495640_0145741
1288 Ga0495640_0156372
1289 Ga0495640_0205061
1290 Ga0495586_0047206
1291 Ga0495587_0023303
1292 Ga0495645_0041226
1293 Ga0495622_0047319
1294 Ga0495667_0005634
1295 Ga0495667_0019978
1296 Ga0495667_0048967
1297 Ga0495634_0002813
1298 Ga0495634_0045770
1299 Ga0495634_0181735
1300 Ga0495635_0001991
1301 Ga0495635_0034025
1302 Ga0495635_0571426
1303 Ga0495588_0002352
1304 Ga0495588_0151403
1305 Ga0495588_0304976
1306 Ga0495657_0001586
1307 Ga0495657_0032220
1308 Ga0495657_0116407
1309 Ga0495599_0273235
1310 Ga0495623_0228309
1311 Ga0495623_0254724
1312 Ga0495646_0003087
1313 Ga0495647_0013156
1314 Ga0495647_0063679
1315 Ga0495647_0098127
1316 Ga0495658_0001040
1317 Ga0495658_0985388
1318 Ga0495624_0002913
1319 Ga0495600_0005584
1320 Ga0495600_0107754
1321 Ga0495600_0328779
1322 Ga0495581_0008134
1323 Ga0495581_0037716
1324 Ga0495604_0013131
1325 Ga0495604_0092922
1326 Ga0495674_0023061
1327 Ga0495674_0114855
1328 Ga0495674_0260960
1329 Ga0495676_0000612
1330 Ga0495676_0021114
1331 Ga0495676_0113883
1332 Ga0495676_0119985
1333 Ga0495676_0259793
1334 Ga0495680_0014240
1335 Ga0495680_0018876
1336 Ga0495680_0391534
1337 Ga0495675_0010748
1338 Ga0495675_0450677
1339 Ga0495673_0336765
1340 Ga0495684_0001726
1341 Ga0495593_0006302
1342 Ga0495593_0056195
1343 Ga0495593_0148525
1344 Ga0495602_0008806
1345 Ga0495602_0038007
1346 Ga0495602_0178572
1347 Ga0495602_0526350
1348 Ga0495614_0012293
1349 Ga0496100_0007788
1350 Ga0496100_0012431
1351 Ga0496100_0066004
1352 Ga0496100_0135613
1353 Ga0496100_0193097
1354 Ga0496100_0290179
1355 Ga0496100_0735341
1356 Ga0496101_0000889
1357 Ga0496101_0006710
1358 Ga0496101_0032490
1359 Ga0496101_0065123
1360 Ga0496101_0115790
1361 Ga0496102_0002474
1362 Ga0496102_0031229
1363 Ga0496102_0065248
1364 Ga0496102_0151371
1365 Ga0496102_0290065
1366 Ga0496102_1275120
1367 Ga0496102_1597540
1368 Ga0496103_0002724
1369 Ga0496103_0005915
1370 Ga0496103_0017287
1371 Ga0496103_0181147
1372 Ga0496103_0220146
1373 Ga0496104_0005490
1374 Ga0496104_0007627
1375 Ga0496104_0075439
1376 Ga0496104_0140881
1377 Ga0496104_0293230
1378 Ga0496104_0319291
1379 Ga0496104_0849241
1380 Ga0496105_0008271
1381 Ga0496105_0010912
1382 Ga0496105_0043371
1383 Ga0496105_0164977
1384 Ga0496106_0001965
1385 Ga0496106_0002646
1386 Ga0496106_0053307
1387 Ga0496106_0054793
1388 Ga0496106_0056385
1389 Ga0496106_0178713
1390 Ga0496106_0607755
1391 Ga0496106_0946044
1392 Ga0496107_0000334
1393 Ga0496107_0001253
1394 Ga0496107_0001480
1395 Ga0496107_0040092
1396 Ga0496107_0075109
1397 Ga0496107_0081256
1398 Ga0496107_0190879
1399 Ga0496107_1052354
1400 Ga0496108_0000291
1401 Ga0496108_0087665
1402 Ga0496108_0146372
1403 Ga0496108_0191793
1404 Ga0496108_0412024
1405 Ga0496108_0776773
1406 Ga0496108_1720017
1407 Ga0496109_0002610
1408 Ga0496109_0022454
1409 Ga0496109_0099665
1410 Ga0496109_0201445
1411 Ga0496109_0404284
1412 Ga0496109_0570790
1413 Ga0496110_0000510
1414 Ga0496110_0051687
1415 Ga0496110_0135229
1416 Ga0496110_0403948
1417 Ga0496110_1310796
1418 Ga0496110_1681011
1419 Ga0496111_0000517
1420 Ga0496111_0146541
1421 Ga0496112_0007065
1422 Ga0496112_0010082
1423 Ga0496112_0348723
1424 Ga0496112_0465555
1425 Ga0496112_0673556
1426 Ga0496113_0000190
1427 Ga0496113_0067195
1428 Ga0496113_0300431
1429 Ga0496113_0885861
1430 Ga0496114_0008548
1431 Ga0496114_0011880
1432 Ga0496114_0025448
1433 Ga0496114_0129170
1434 Ga0496114_0309346
1435 Ga0496114_1039147
1436 Ga0496115_0018143
1437 Ga0496115_0022414
1438 Ga0496115_0148531
1439 Ga0496115_0190694
1440 Ga0496115_0206784
1441 Ga0501041_1043705
1442 Ga0501069_0082038
1443 nmdc:mga00v17_29339_c1
1444 nmdc:mga0yw44_108572_c1
1445 nmdc:mga0yw44_20902_c1
1446 nmdc:mga0yw44_342852_c1
1447 nmdc:mga06z11_776509_c1
1448 nmdc:mga05p37_1493091_c1
1449 nmdc:mga05p37_569270_c1
1450 nmdc:mga05p37_671424_c1
1451 nmdc:mga05p37_738370_c1
1452 nmdc:mga09592_1358852_c1
1453 nmdc:mga06r32_1075589_c1
1454 nmdc:mga06r32_1493081_c1
1455 nmdc:mga06r32_218215_c1
1456 nmdc:mga06r32_3111_c1
1457 nmdc:mga06r32_504883_c1
1458 nmdc:mga08y16_68097_c1
1459 nmdc:mga0n895_13031_c1
1460 nmdc:mga0n895_1632883_c1
1461 nmdc:mga0n895_395233_c1
1462 nmdc:mga0n895_451060_c1
1463 nmdc:mga0n895_681579_c1
1464 nmdc:mga0rr50_104796_c1
1465 nmdc:mga0rr50_240679_c1
1466 nmdc:mga0rr50_329_c1
1467 nmdc:mga0rr50_386883_c1
1468 nmdc:mga0rr50_792897_c1
1469 nmdc:mga08x19_10156_c1
1470 nmdc:mga0a205_155881_c1
1471 nmdc:mga0a205_224966_c1
1472 Ga0495601_0004490
1473 Ga0495601_0089149
1474 Ga0495601_0312002
1475 Ga0495601_1077272
1476 Ga0495612_0040674
1477 Ga0495612_0084456
1478 Ga0495612_0197239
1479 Ga0495612_0487475
1480 Ga0495655_0031152
1481 Ga0495595_0001546
1482 Ga0495595_0002456
1483 Ga0495595_0200670
1484 Ga0495595_0256489
1485 Ga0495619_0012634
1486 Ga0495619_0028685
1487 Ga0495619_0029991
1488 Ga0495619_0081121
1489 Ga0495619_0103994
1490 Ga0495619_0132453
1491 Ga0466962_0175644
1492 Ga0466962_0293789

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF22277

EncFtn-like

EncFtn-like

32

116

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
4r42-assembly1.cif.gz_A-2 crystal structure of katb, a manganese catalase from anabaena pcc7120 0.9817 19 71
4r42-assembly1.cif.gz_C-2 crystal structure of katb, a manganese catalase from anabaena pcc7120 0.9813 19 71
4r42-assembly1.cif.gz_B-2 crystal structure of katb, a manganese catalase from anabaena pcc7120 0.9802 19 71
6j42-assembly1.cif.gz_B-2 crystal structure of wild type katb, a manganese catalase from anabaena 0.9782 19 71
6j42-assembly1.cif.gz_A crystal structure of wild type katb, a manganese catalase from anabaena 0.9778 19 75
ID Description Score Start End Superfamily
af_Q4D315_1583_2097_3.40.850.10 Alpha Beta;3-Layer(aba) Sandwich;Kinesin;Kinesin motor domain 0.9863 23 71 3.40.850.10
4r42B01 Mainly Alpha;Up-down Bundle;Ferritin;Ferritin, core subunit, four-helix bundle 0.9802 19 71 1.20.1260.10
af_A4IDC8_170_281_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.9696 23 66 1.25.10.10
5c39B00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.9694 22 67 1.20.5.420
1mftA00 Mainly Alpha;Up-down Bundle;Single alpha-helices involved in coiled-coils or other helix-helix interfaces;Immunoglobulin FC, subunit C 0.9585 22 70 1.20.5.420
ID Description Score Start End GO Terms
AF-A0A0Q7TRS6-F1-model_v4 Uncharacterized protein 0.9689 13 103 GO:0006879
GO:0046872
GO:0140737
AF-A0A0Q1B3K1-F1-model_v4 Ferritin 0.96 7 76 GO:0006879
GO:0046872
AF-A0A1I4TLA5-F1-model_v4 Protein FliT 0.9559 12 92 GO:0006879
GO:0046872
AF-A0A7W4V185-F1-model_v4 Uncharacterized protein 0.9537 25 103 GO:0006879
GO:0046872
GO:0140737
AF-A0A3C1KJ85-F1-model_v4 Ferritin 0.9521 8 92 GO:0004322
GO:0006879
GO:0046872
GO:0140737

Map