F478700

General Info

Members Datasets Scaffolds Average Seq Length
743 337 715 256

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0022613|Ga0466965_0022613_1511_2389
Length 292
Sequence MGTTYGTVGSNRASGGARWSRTQMGTIDDVPDRKRVDWKRAARRVLYPAYEARVVRRLPPDRIPQHIGVMLDGNRRWARAVGADTAHGHRAGAANIEPLLGWCEEVGVEVVTLWLLSTDNLNRPEQELDELLTIIVEAVDSLALQGRWRLHPVGALDLLPDEVTARLKAAEEATTDVDGLLVNVAVGYGGRREIADAVRSLLQEKAGSGMTLEELAETIDVDHIAEHLYTRGQPDPDLVIRTSGEQRLGGFLLWQSAQSEFYFCEAYWPDFRRVDFLRAVRAYAQRERRFGS

Samples

Sample ID Description Type Environment
1 2643221561 Nocardioides sp. Root151 Isolate Unclassified
2 2643221576 Nocardioides sp. Root614 Isolate Unclassified
3 2643221590 Nocardioides sp. Root682 Isolate Unclassified
4 2643221615 Nocardioides sp. Root224 Isolate Unclassified
5 2643221617 Nocardioides sp. Root79 Isolate Unclassified
6 2643221620 Nocardioides sp. Root240 Isolate Unclassified
7 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
8 2643221679 Angustibacter sp. Root456 Isolate Unclassified
9 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
10 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
11 2643221696 Nocardioides sp. Root140 Isolate Unclassified
12 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
13 2675903060 Nonomuraea wenchangensis CGMCC 4.5598 Isolate Rhizosphere
14 2738541305 Nocardioides sp. CF167 Isolate Unclassified
15 2784132109 Dermacoccus sp. DS28 SAI-028 Isolate Unclassified
16 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
17 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
18 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
19 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
20 2873314349 Sphaerisporangium siamense DSM 45784 Isolate Rhizosphere
21 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
22 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
23 2891395885 Microbispora catharanthi CR1-09 Isolate Unclassified
24 2891554331 Microbispora sp. CL1-1 Isolate Unclassified
25 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
26 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
27 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
28 3001889506 Janibacter sp. YIM B02568 Isolate Unclassified
29 3300000549 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled Metagenome Rhizosphere
30 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
31 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
32 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
33 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
34 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
35 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
36 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
37 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
47 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
48 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
49 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
50 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
51 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
52 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
61 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
62 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
63 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
64 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
67 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
75 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
79 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
94 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
95 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
97 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
98 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
100 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
101 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
102 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
103 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
104 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
105 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
106 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
162 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
163 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
166 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
167 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
168 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
169 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
175 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
176 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
177 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
178 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
179 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
180 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
181 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
182 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
183 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
184 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
185 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
186 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
187 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
188 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
189 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
190 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
191 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
192 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
193 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
194 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
195 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
196 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
197 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
198 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
199 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
200 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
201 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
202 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
203 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
204 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
205 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
206 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
207 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
208 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
209 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
210 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
211 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
212 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
213 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
214 3300042120 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 Metagenome Rhizosphere
215 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
216 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
217 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
218 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
219 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
220 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
221 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
222 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
223 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
224 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
225 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
226 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
227 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
228 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
229 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
230 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
231 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
232 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
233 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
234 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
235 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
238 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
239 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
240 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
241 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
242 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
243 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
244 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
245 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
246 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
247 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
248 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
249 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
250 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
251 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
252 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
253 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
254 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
255 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
256 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
257 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
258 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
259 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
260 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
261 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
262 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
263 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
264 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
265 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
266 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
267 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
268 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
269 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
270 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
271 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
272 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
273 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
274 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
275 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
276 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
277 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
278 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
279 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
283 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
284 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
285 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
286 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
287 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
288 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
291 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
292 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
293 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
294 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
295 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
296 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
297 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
298 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
299 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
300 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
301 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
302 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
303 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
304 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
305 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
306 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
307 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
308 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
309 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
310 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
311 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
312 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
313 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
314 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
315 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
316 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
317 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
318 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
319 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
320 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
321 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
322 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
323 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
324 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
325 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
326 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
327 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
328 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
329 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
330 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
331 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
332 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
333 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
334 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
335 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
336 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
337 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 95.96
Metatranscriptomes 0.27
Isolates 3.77

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 6.86
Nodule 0
Rhizoplane 6.73
Rhizosphere 80.89
Stem 0
Stem Tuber 0
Unclassified 5.25

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJQas_1002189 3300000549 Bacteria 2758
2 JGI24741J21665_1019401 3300001915 Bacteria 1078
3 JGI24738J21930_10010635 3300002075 Bacteria 2043
4 JGI25406J46586_10039621 3300003203 Bacteria 1677
5 rootH2_10117484 3300003320 Bacteria 2231
6 JGI25407J50210_10025897 3300003373 Bacteria 1521
7 JGI25407J50210_10060802 3300003373 Bacteria 949
8 Ga0070658_10000469 3300005327 Bacteria 34916
9 Ga0070658_10091178 3300005327 Bacteria 2512
10 Ga0070683_100279893 3300005329 Bacteria 1587
11 Ga0070683_100283284 3300005329 Bacteria 1577
12 Ga0070683_100411581 3300005329 Bacteria 1290
13 Ga0070690_100101642 3300005330 Bacteria 1907
14 Ga0070680_100576975 3300005336 Bacteria 965
15 Ga0070682_100042536 3300005337 Bacteria 2805
16 Ga0070682_100276155 3300005337 Bacteria 1223
17 Ga0068868_100140853 3300005338 Bacteria 1980
18 Ga0070660_100019819 3300005339 Bacteria 4934
19 Ga0070660_100256202 3300005339 Bacteria 1428
20 Ga0070660_100340625 3300005339 Bacteria 1234
21 Ga0070689_100633132 3300005340 Bacteria 929
22 Ga0070691_10020570 3300005341 Bacteria 3049
23 Ga0070692_10011405 3300005345 Bacteria 4078
24 Ga0070692_10215938 3300005345 Bacteria 1131
25 Ga0070668_100604435 3300005347 Bacteria 960
26 Ga0070675_100084521 3300005354 Bacteria 2651
27 Ga0070674_100006352 3300005356 Bacteria 6890
28 Ga0070659_100013002 3300005366 Bacteria 6188
29 Ga0070659_100158161 3300005366 Bacteria 1852
30 Ga0070667_100023486 3300005367 Bacteria 5116
31 Ga0070709_10001220 3300005434 Bacteria 14103
32 Ga0070714_100059948 3300005435 Bacteria 3264
33 Ga0070713_100021022 3300005436 Bacteria 5011
34 Ga0070701_10002932 3300005438 Bacteria 6659
35 Ga0070711_100324554 3300005439 Bacteria 1231
36 Ga0070705_100264110 3300005440 Bacteria 1216
37 Ga0070700_100012171 3300005441 Bacteria 4791
38 Ga0070700_100064019 3300005441 Bacteria 2327
39 Ga0070663_100034144 3300005455 Bacteria 3521
40 Ga0070678_100032787 3300005456 Bacteria 3599
41 Ga0070662_100004379 3300005457 Bacteria 8922
42 Ga0068867_100007476 3300005459 Bacteria 7726
43 Ga0068867_100321400 3300005459 Bacteria 1282
44 Ga0070685_10004791 3300005466 Bacteria 6852
45 Ga0070698_100002013 3300005471 Bacteria 22580
46 Ga0070679_100474124 3300005530 Bacteria 1196
47 Ga0070684_100083840 3300005535 Bacteria 2825
48 Ga0070684_100295550 3300005535 Bacteria 1486
49 Ga0070672_100008593 3300005543 Bacteria 6993
50 Ga0070696_100004312 3300005546 Bacteria 9482
51 Ga0070696_100184379 3300005546 Bacteria 1550
52 Ga0070693_100320887 3300005547 Bacteria 1051
53 Ga0070664_100370958 3300005564 Bacteria 1305
54 Ga0068857_100481591 3300005577 Bacteria 1163
55 Ga0068856_100039423 3300005614 Bacteria 4638
56 Ga0070702_100126457 3300005615 Bacteria 1608
57 Ga0068852_100012448 3300005616 Bacteria 6461
58 Ga0068852_100261803 3300005616 Bacteria 1661
59 Ga0068861_100006622 3300005719 Bacteria 7904
60 Ga0068861_100014873 3300005719 Bacteria 5468
61 Ga0068861_100192866 3300005719 Bacteria 1704
62 Ga0068861_100377907 3300005719 Bacteria 1251
63 Ga0081455_10065105 3300005937 Bacteria 3050
64 Ga0081455_10088495 3300005937 Bacteria 2516
65 Ga0081538_10000954 3300005981 Bacteria 30995
66 Ga0081538_10004151 3300005981 Bacteria 13439
67 Ga0081538_10012738 3300005981 Bacteria 6717
68 Ga0081538_10013828 3300005981 Bacteria 6367
69 Ga0081538_10015454 3300005981 Bacteria 5904
70 Ga0081538_10017756 3300005981 Bacteria 5382
71 Ga0081538_10019528 3300005981 Bacteria 5031
72 Ga0081538_10038702 3300005981 Bacteria 3072
73 Ga0081538_10078350 3300005981 Bacteria 1774
74 Ga0081540_1067638 3300005983 Bacteria 1668
75 Ga0081539_10006160 3300005985 Bacteria 11672
76 Ga0081539_10018108 3300005985 Bacteria 4905
77 Ga0081539_10059757 3300005985 Bacteria 2096
78 Ga0081539_10094888 3300005985 Bacteria 1534
79 Ga0075365_10051936 3300006038 Bacteria 2709
80 Ga0075365_10080934 3300006038 Bacteria 2199
81 Ga0075365_10098781 3300006038 Bacteria 1997
82 Ga0075365_10103746 3300006038 Bacteria 1949
83 Ga0075365_10110613 3300006038 Bacteria 1888
84 Ga0075365_10208750 3300006038 Bacteria 1369
85 Ga0075368_10009626 3300006042 Bacteria 3478
86 Ga0075368_10045500 3300006042 Bacteria 1734
87 Ga0075363_100016401 3300006048 Bacteria 3658
88 Ga0075363_100017106 3300006048 Bacteria 3590
89 Ga0075363_100021849 3300006048 Bacteria 3229
90 Ga0075363_100031776 3300006048 Bacteria 2739
91 Ga0075363_100113672 3300006048 Bacteria 1507
92 Ga0075364_10008434 3300006051 Bacteria 6159
93 Ga0075364_10015981 3300006051 Bacteria 4661
94 Ga0075364_10085842 3300006051 Bacteria 2085
95 Ga0075432_10016682 3300006058 Bacteria 2507
96 Ga0070712_100090192 3300006175 Bacteria 2244
97 Ga0075362_10001895 3300006177 Bacteria 6864
98 Ga0075367_10056006 3300006178 Bacteria 2341
99 Ga0075367_10073487 3300006178 Bacteria 2060
100 Ga0075367_10166369 3300006178 Bacteria 1372
101 Ga0075370_10006757 3300006353 Bacteria 5793
102 Ga0075370_10019564 3300006353 Bacteria 3690
103 Ga0075430_100002720 3300006846 Bacteria 14758
104 Ga0075431_100201056 3300006847 Bacteria 2039
105 Ga0075433_10065962 3300006852 Bacteria 3175
106 Ga0075434_100048569 3300006871 Bacteria 4210
107 Ga0075429_100043597 3300006880 Bacteria 3904
108 Ga0068865_100001987 3300006881 Bacteria 12070
109 Ga0068865_100375091 3300006881 Bacteria 1159
110 Ga0105251_10054791 3300009011 Bacteria 1892
111 Ga0105240_10106628 3300009093 Bacteria 3398
112 Ga0111539_10503688 3300009094 Bacteria 1410
113 Ga0111539_10534065 3300009094 Bacteria 1366
114 Ga0105245_10056391 3300009098 Bacteria 3531
115 Ga0105245_10348850 3300009098 Bacteria 1466
116 Ga0105247_10007081 3300009101 Bacteria 6889
117 Ga0114129_10030977 3300009147 Bacteria 7565
118 Ga0114129_10105667 3300009147 Bacteria 3890
119 Ga0114129_10140668 3300009147 Bacteria 3308
120 Ga0114129_10277820 3300009147 Bacteria 2239
121 Ga0105243_10005795 3300009148 Bacteria 9589
122 Ga0105243_10068730 3300009148 Bacteria 2856
123 Ga0105243_10128699 3300009148 Bacteria 2145
124 Ga0105243_10358211 3300009148 Bacteria 1342
125 Ga0105241_10006049 3300009174 Bacteria 8923
126 Ga0105242_10007216 3300009176 Bacteria 8571
127 Ga0105242_10067430 3300009176 Bacteria 2958
128 Ga0105248_10013985 3300009177 Bacteria 8830
129 Ga0105248_10129953 3300009177 Bacteria 2841
130 Ga0105248_10466412 3300009177 Bacteria 1423
131 Ga0105237_10043607 3300009545 Bacteria 4518
132 Ga0105237_10069261 3300009545 Bacteria 3523
133 Ga0105238_10086487 3300009551 Bacteria 3122
134 Ga0105238_10162392 3300009551 Bacteria 2210
135 Ga0105238_10172988 3300009551 Bacteria 2136
136 Ga0105238_10545754 3300009551 Bacteria 1163
137 Ga0105249_10006439 3300009553 Bacteria 10210
138 Ga0105249_10046304 3300009553 Bacteria 3958
139 Ga0105249_10593027 3300009553 Bacteria 1162
140 Ga0105249_10612095 3300009553 Bacteria 1145
141 Ga0105028_107759 3300009993 Bacteria 1122
142 Ga0105239_10026886 3300010375 Bacteria 6333
143 Ga0105239_10132743 3300010375 Bacteria 2771
144 Ga0105239_10366285 3300010375 Bacteria 1628
145 Ga0105246_10000926 3300011119 Bacteria 16776
146 Ga0105246_10204796 3300011119 Bacteria 1536
147 Ga0157373_10188337 3300013100 Bacteria 1454
148 Ga0157371_10077677 3300013102 Bacteria 2351
149 Ga0157370_10262021 3300013104 Bacteria 1598
150 Ga0157370_10349525 3300013104 Bacteria 1363
151 Ga0157369_10041564 3300013105 Bacteria 5017
152 Ga0157369_10092325 3300013105 Bacteria 3231
153 Ga0157374_10007768 3300013296 Bacteria 9154
154 Ga0157378_10039016 3300013297 Bacteria 4211
155 Ga0157378_10796364 3300013297 Bacteria 971
156 Ga0163162_10021242 3300013306 Bacteria 6388
157 Ga0163162_10049063 3300013306 Bacteria 4230
158 Ga0163162_10209049 3300013306 Bacteria 2081
159 Ga0163162_10275536 3300013306 Bacteria 1814
160 Ga0157372_10019262 3300013307 Bacteria 7349
161 Ga0157372_10054992 3300013307 Bacteria 4443
162 Ga0157372_10194758 3300013307 Bacteria 2348
163 Ga0157372_10248947 3300013307 Bacteria 2062
164 Ga0157372_10350539 3300013307 Bacteria 1720
165 Ga0157375_10039056 3300013308 Bacteria 4564
166 Ga0157375_10054282 3300013308 Bacteria 3946
167 Ga0157375_10112420 3300013308 Bacteria 2824
168 Ga0157375_10153340 3300013308 Bacteria 2441
169 Ga0157375_10189411 3300013308 Bacteria 2211
170 Ga0157375_10199974 3300013308 Bacteria 2154
171 Ga0157375_11223943 3300013308 Bacteria 881
172 Ga0163163_10062499 3300014325 Bacteria 3690
173 Ga0163163_10140551 3300014325 Bacteria 2457
174 Ga0157380_10453591 3300014326 Bacteria 1232
175 Ga0182008_10143697 3300014497 Bacteria 1195
176 Ga0157377_10003538 3300014745 Bacteria 7073
177 Ga0157377_10162204 3300014745 Bacteria 1391
178 Ga0163161_10107753 3300017792 Bacteria 2080
179 Ga0163161_10299420 3300017792 Bacteria 1266
180 Ga0206354_11252387 3300020081 Bacteria 1054
181 Ga0206353_11164138 3300020082 Bacteria 1950
182 Ga0207642_10130525 3300025899 Bacteria 1310
183 Ga0207699_10008934 3300025906 Bacteria 4969
184 Ga0207643_10001431 3300025908 Bacteria 13685
185 Ga0207643_10316754 3300025908 Bacteria 973
186 Ga0207705_10257717 3300025909 Bacteria 1331
187 Ga0207705_10468337 3300025909 Bacteria 978
188 Ga0207705_10542902 3300025909 Bacteria 904
189 Ga0207671_10153124 3300025914 Bacteria 1782
190 Ga0207693_10103059 3300025915 Bacteria 2238
191 Ga0207663_10225579 3300025916 Bacteria 1366
192 Ga0207657_10223573 3300025919 Bacteria 1507
193 Ga0207652_10070296 3300025921 Bacteria 3040
194 Ga0207694_10109108 3300025924 Bacteria 2200
195 Ga0207659_10033133 3300025926 Bacteria 3552
196 Ga0207687_10020856 3300025927 Bacteria 4348
197 Ga0207687_10080223 3300025927 Bacteria 2355
198 Ga0207700_10013738 3300025928 Bacteria 5282
199 Ga0207664_10058004 3300025929 Bacteria 3079
200 Ga0207664_10072434 3300025929 Bacteria 2778
201 Ga0207690_10056742 3300025932 Bacteria 2643
202 Ga0207690_10060370 3300025932 Bacteria 2573
203 Ga0207690_10079345 3300025932 Bacteria 2287
204 Ga0207706_10005862 3300025933 Bacteria 11429
205 Ga0207706_10419015 3300025933 Bacteria 1160
206 Ga0207686_10057719 3300025934 Bacteria 2445
207 Ga0207686_10226037 3300025934 Bacteria 1354
208 Ga0207709_10017730 3300025935 Bacteria 3979
209 Ga0207709_10161812 3300025935 Bacteria 1562
210 Ga0207670_10053678 3300025936 Bacteria 2716
211 Ga0207669_10030136 3300025937 Bacteria 3011
212 Ga0207704_10145864 3300025938 Bacteria 1662
213 Ga0207704_10202251 3300025938 Bacteria 1455
214 Ga0207691_10002825 3300025940 Bacteria 16922
215 Ga0207661_10265492 3300025944 Bacteria 1530
216 Ga0207661_10445981 3300025944 Bacteria 1178
217 Ga0207661_10642024 3300025944 Bacteria 975
218 Ga0207679_10343453 3300025945 Bacteria 1299
219 Ga0207667_10492430 3300025949 Bacteria 1244
220 Ga0207668_10052079 3300025972 Bacteria 2831
221 Ga0207668_10066969 3300025972 Bacteria 2548
222 Ga0207640_10169122 3300025981 Bacteria 1627
223 Ga0207677_10090687 3300026023 Bacteria 2222
224 Ga0207678_10055206 3300026067 Bacteria 3422
225 Ga0207708_10001532 3300026075 Bacteria 17212
226 Ga0207708_10091474 3300026075 Bacteria 2346
227 Ga0207702_10009452 3300026078 Bacteria 8189
228 Ga0207648_10002911 3300026089 Bacteria 18120
229 Ga0207648_10188014 3300026089 Bacteria 1829
230 Ga0207676_10120967 3300026095 Bacteria 2208
231 Ga0207674_10183392 3300026116 Bacteria 2044
232 Ga0207675_100001939 3300026118 Bacteria 20656
233 Ga0207675_100034967 3300026118 Bacteria 4685
234 Ga0207675_100378937 3300026118 Bacteria 1391
235 Ga0207683_10033590 3300026121 Bacteria 4457
236 Ga0207683_10046075 3300026121 Bacteria 3814
237 Ga0207683_10199258 3300026121 Bacteria 1819
238 Ga0209813_10008237 3300027866 Bacteria 2626
239 Ga0209813_10009163 3300027866 Bacteria 2523
240 Ga0207428_10000433 3300027907 Bacteria 51410
241 Ga0207428_10083230 3300027907 Bacteria 2496
242 Ga0265334_10001366 3300028573 Bacteria 11771
243 Ga0265340_10007568 3300031247 Bacteria 5893
244 Ga0265339_10031105 3300031249 Bacteria 3018
245 Ga0307408_100039897 3300031548 Bacteria 3322
246 Ga0307408_100053725 3300031548 Bacteria 2910
247 Ga0307408_100081356 3300031548 Bacteria 2421
248 Ga0316579_10000156 3300031691 Bacteria 19325
249 Ga0316579_10105926 3300031691 Bacteria 1348
250 Ga0316579_10160014 3300031691 Bacteria 1088
251 Ga0265342_10030328 3300031712 Bacteria 3352
252 Ga0316576_10022296 3300031727 Bacteria 4396
253 Ga0316576_10024186 3300031727 Bacteria 4240
254 Ga0316576_10046366 3300031727 Bacteria 3145
255 Ga0316576_10092348 3300031727 Bacteria 2255
256 Ga0316576_10255064 3300031727 Bacteria 1316
257 Ga0307405_10011341 3300031731 Bacteria 4665
258 Ga0307405_10125675 3300031731 Bacteria 1763
259 Ga0307405_10134290 3300031731 Bacteria 1715
260 Ga0307405_10144624 3300031731 Bacteria 1663
261 Ga0307413_10040157 3300031824 Bacteria 2728
262 Ga0307413_10093534 3300031824 Bacteria 1965
263 Ga0307410_10021327 3300031852 Bacteria 3983
264 Ga0307410_10071656 3300031852 Bacteria 2404
265 Ga0307410_10114266 3300031852 Bacteria 1958
266 Ga0307406_10012216 3300031901 Bacteria 4893
267 Ga0307406_10016200 3300031901 Bacteria 4326
268 Ga0307406_10112736 3300031901 Bacteria 1875
269 Ga0307407_10006812 3300031903 Bacteria 5121
270 Ga0307407_10036769 3300031903 Bacteria 2701
271 Ga0307407_10059245 3300031903 Bacteria 2229
272 Ga0307407_10131963 3300031903 Bacteria 1599
273 Ga0307412_10024506 3300031911 Bacteria 3725
274 Ga0307412_10048224 3300031911 Bacteria 2800
275 Ga0307412_10196345 3300031911 Bacteria 1529
276 Ga0307409_100006642 3300031995 Bacteria 6826
277 Ga0307409_100009275 3300031995 Bacteria 6036
278 Ga0307409_100010345 3300031995 Bacteria 5794
279 Ga0307409_100020155 3300031995 Bacteria 4537
280 Ga0307409_100033847 3300031995 Bacteria 3724
281 Ga0307409_100125352 3300031995 Bacteria 2183
282 Ga0307409_100141422 3300031995 Bacteria 2074
283 Ga0307409_100189200 3300031995 Bacteria 1830
284 Ga0307409_100220069 3300031995 Bacteria 1713
285 Ga0307409_100242183 3300031995 Bacteria 1643
286 Ga0307409_100247067 3300031995 Bacteria 1629
287 Ga0307409_100654302 3300031995 Bacteria 1045
288 Ga0307416_100002366 3300032002 Bacteria 10794
289 Ga0307416_100008910 3300032002 Bacteria 6519
290 Ga0307416_100010351 3300032002 Bacteria 6155
291 Ga0307416_100010961 3300032002 Bacteria 6016
292 Ga0307416_100017783 3300032002 Bacteria 4986
293 Ga0307416_100063687 3300032002 Bacteria 3021
294 Ga0307416_100084277 3300032002 Bacteria 2700
295 Ga0307416_100268103 3300032002 Bacteria 1674
296 Ga0307416_100495143 3300032002 Bacteria 1285
297 Ga0307414_10137266 3300032004 Bacteria 1909
298 Ga0307414_10445988 3300032004 Bacteria 1134
299 Ga0307411_10006600 3300032005 Bacteria 5822
300 Ga0307411_10111605 3300032005 Bacteria 1958
301 Ga0307411_10185180 3300032005 Bacteria 1584
302 Ga0307411_10683644 3300032005 Bacteria 892
303 Ga0307415_100000133 3300032126 Bacteria 32344
304 Ga0307415_100004206 3300032126 Bacteria 7434
305 Ga0307415_100005648 3300032126 Bacteria 6661
306 Ga0307415_100007567 3300032126 Bacteria 5948
307 Ga0307415_100012603 3300032126 Bacteria 4895
308 Ga0307415_100013045 3300032126 Bacteria 4834
309 Ga0307415_100015987 3300032126 Bacteria 4458
310 Ga0307415_100253545 3300032126 Bacteria 1431
311 Ga0316580_10059742 3300032139 Bacteria 1171
312 Ga0316574_0000590 3300035398 Bacteria 15049
313 Ga0316574_0080599 3300035398 Bacteria 2066
314 Ga0316574_0185225 3300035398 Bacteria 1339
315 Ga0373931_0358648 3300035691 Bacteria 914
316 Ga0316582_0151835 3300036647 Bacteria 1566
317 Ga0316582_0328911 3300036647 Bacteria 1051
318 Ga0316584_0000239 3300036712 Bacteria 27354
319 Ga0316584_0012516 3300036712 Bacteria 5984
320 Ga0316584_0045996 3300036712 Bacteria 3259
321 Ga0316584_0408351 3300036712 Bacteria 966
322 Ga0395899_0010482 3300037312 Bacteria 7098
323 Ga0395899_0100863 3300037312 Bacteria 2084
324 Ga0395899_0233695 3300037312 Bacteria 1268
325 Ga0395900_0187972 3300037418 Bacteria 2096
326 Ga0395900_0224816 3300037418 Bacteria 1890
327 Ga0395898_0072331 3300037466 Bacteria 3331
328 Ga0395898_0079593 3300037466 Bacteria 3161
329 Ga0395898_0192499 3300037466 Bacteria 1949
330 Ga0395898_0348558 3300037466 Bacteria 1412
331 Ga0395905_0289329 3300037471 Bacteria 1525
332 Ga0395905_0758747 3300037471 Bacteria 873
333 Ga0395905_0913942 3300037471 Bacteria 781
334 Ga0436364_0700221 3300037853 Bacteria 1309
335 Ga0436364_1514249 3300037853 Bacteria 2592
336 Ga0395901_0053961 3300038443 Bacteria 4177
337 Ga0395901_0058989 3300038443 Bacteria 3992
338 Ga0395901_0164790 3300038443 Bacteria 2327
339 Ga0395901_0180146 3300038443 Bacteria 2216
340 Ga0395901_0199018 3300038443 Bacteria 2100
341 Ga0395901_0293332 3300038443 Bacteria 1687
342 Ga0395901_0317018 3300038443 Bacteria 1614
343 Ga0395901_0467780 3300038443 Bacteria 1287
344 Ga0395901_0538061 3300038443 Bacteria 1185
345 Ga0395901_0603070 3300038443 Bacteria 1107
346 Ga0400485_04221 3300038735 Bacteria 54088
347 Ga0400486_29215 3300038742 Bacteria 140932
348 Ga0439436_0070438 3300041404 Bacteria 975
349 Ga0439438_045483 3300041405 Bacteria 1129
350 Ga0439466_0058509 3300041411 Bacteria 1247
351 Ga0439465_0057245 3300041413 Bacteria 1286
352 Ga0451789_0493370 3300041443 Bacteria 2434
353 Ga0451793_0112958 3300041452 Bacteria 1890
354 Ga0451797_0393491 3300041453 Bacteria 4131
355 Ga0451797_1210202 3300041453 Bacteria 1340
356 Ga0451833_1221655 3300041491 Bacteria 1920
357 Ga0451841_0871602 3300041498 Bacteria 2125
358 Ga0451843_0604577 3300041509 Bacteria 5309
359 Ga0439431_0000830 3300041997 Bacteria 6662
360 Ga0439442_015704 3300042002 Bacteria 1561
361 Ga0439445_0005878 3300042004 Bacteria 2807
362 Ga0439448_0087018 3300042005 Bacteria 1053
363 Ga0439432_017990 3300042006 Bacteria 2367
364 Ga0439450_000083 3300042008 Bacteria 9362
365 Ga0439450_016147 3300042008 Bacteria 1539
366 Ga0439454_006273 3300042011 Bacteria 1455
367 Ga0439455_0006749 3300042012 Bacteria 2398
368 Ga0439457_012504 3300042014 Bacteria 1913
369 Ga0439457_028728 3300042014 Bacteria 1231
370 Ga0439463_000209 3300042016 Bacteria 15866
371 Ga0439463_015598 3300042016 Bacteria 1879
372 Ga0439463_024791 3300042016 Bacteria 1503
373 Ga0450917_005623 3300042120 Bacteria 935
374 Ga0450888_003486 3300042126 Bacteria 1597
375 Ga0450905_002810 3300042142 Bacteria 2259
376 Ga0439458_0003066 3300042157 Bacteria 3982
377 Ga0439458_0054295 3300042157 Bacteria 992
378 Ga0439434_0012312 3300042435 Bacteria 2531
379 Ga0439444_0001594 3300042437 Bacteria 2987
380 Ga0439464_0009244 3300042439 Bacteria 2592
381 Ga0439460_0001259 3300042461 Bacteria 5958
382 Ga0450916_000488 3300042530 Bacteria 3458
383 Ga0439440_0000290 3300042993 Bacteria 8188
384 Ga0439440_0014636 3300042993 Bacteria 1695
385 Ga0466972_0009071 3300044658 Bacteria 4996
386 Ga0466972_0021964 3300044658 Bacteria 3179
387 Ga0466972_0095696 3300044658 Bacteria 1407
388 Ga0466972_0097430 3300044658 Bacteria 1393
389 Ga0466965_0012831 3300044683 Bacteria 3944
390 Ga0466965_0021164 3300044683 Bacteria 3129
391 Ga0466965_0022613 3300044683 Bacteria 3031
392 Ga0466966_0083137 3300044684 Bacteria 1992
393 Ga0466966_0250380 3300044684 Bacteria 1067
394 Ga0466961_0024622 3300044693 Bacteria 3872
395 Ga0466961_0053405 3300044693 Bacteria 2578
396 Ga0466961_0058546 3300044693 Bacteria 2451
397 Ga0466961_0073191 3300044693 Bacteria 2173
398 Ga0466961_0073745 3300044693 Bacteria 2164
399 Ga0466961_0178995 3300044693 Bacteria 1317
400 Ga0466963_0057082 3300044694 Bacteria 2599
401 Ga0466963_0120276 3300044694 Bacteria 1807
402 Ga0466963_0152941 3300044694 Bacteria 1603
403 Ga0466963_0215411 3300044694 Bacteria 1344
404 Ga0466963_0280046 3300044694 Bacteria 1172
405 Ga0466964_0008479 3300044706 Bacteria 3864
406 Ga0466964_0102654 3300044706 Bacteria 1263
407 Ga0466971_0003441 3300044719 Bacteria 6765
408 Ga0466968_0039768 3300044735 Bacteria 1980
409 Ga0466968_0192689 3300044735 Bacteria 952
410 Ga0466970_0009457 3300044765 Bacteria 4928
411 Ga0466970_0043911 3300044765 Bacteria 2380
412 Ga0466970_0216536 3300044765 Bacteria 1068
413 Ga0466970_0290141 3300044765 Bacteria 921
414 Ga0466957_0005119 3300044842 Bacteria 7324
415 Ga0466957_0038169 3300044842 Bacteria 2893
416 Ga0466957_0423076 3300044842 Bacteria 914
417 Ga0466960_0008485 3300044901 Bacteria 4210
418 Ga0466960_0015508 3300044901 Bacteria 3285
419 Ga0466960_0017249 3300044901 Bacteria 3144
420 Ga0466960_0026629 3300044901 Bacteria 2629
421 Ga0466960_0029524 3300044901 Bacteria 2517
422 Ga0466960_0032392 3300044901 Bacteria 2419
423 Ga0466960_0053248 3300044901 Bacteria 1960
424 Ga0466960_0087577 3300044901 Bacteria 1581
425 Ga0466960_0149563 3300044901 Bacteria 1246
426 Ga0466960_0206025 3300044901 Bacteria 1076
427 Ga0466959_0194724 3300045049 Bacteria 1413
428 Ga0466958_0017261 3300045836 Bacteria 4169
429 Ga0466967_0018178 3300045976 Bacteria 5610
430 Ga0466967_0020018 3300045976 Bacteria 5397
431 Ga0466967_0028283 3300045976 Bacteria 4679
432 Ga0466967_0055151 3300045976 Bacteria 3501
433 Ga0466967_0071078 3300045976 Bacteria 3115
434 Ga0466967_0093943 3300045976 Bacteria 2730
435 Ga0466967_0123847 3300045976 Bacteria 2392
436 Ga0466967_0181081 3300045976 Bacteria 1988
437 Ga0466967_0331707 3300045976 Bacteria 1469
438 Ga0495592_0356854 3300046454 Bacteria 936
439 Ga0495641_0041890 3300046461 Bacteria 2125
440 Ga0495584_0058973 3300046491 Bacteria 1931
441 Ga0495607_0136351 3300046501 Bacteria 1271
442 Ga0495644_0046394 3300046523 Bacteria 1633
443 Ga0495587_0326833 3300046536 Bacteria 856
444 Ga0495598_0073100 3300046537 Bacteria 1084
445 Ga0495621_0113821 3300046539 Bacteria 1040
446 Ga0495645_0207262 3300046543 Bacteria 1326
447 Ga0495667_0281409 3300046559 Bacteria 1056
448 Ga0495656_0025302 3300046615 Bacteria 2352
449 Ga0495635_0109735 3300046663 Bacteria 1885
450 Ga0495599_0161886 3300046678 Bacteria 1383
451 Ga0495658_0303899 3300046683 Bacteria 1009
452 Ga0495671_0067940 3300046692 Bacteria 1753
453 Ga0495676_0043903 3300047321 Bacteria 3654
454 Ga0495680_0056581 3300047322 Bacteria 3036
455 Ga0495679_102658 3300047446 Bacteria 793
456 Ga0496100_0068871 3300048903 Bacteria 2355
457 Ga0496101_0030690 3300048904 Bacteria 3772
458 Ga0496101_0119204 3300048904 Bacteria 1994
459 Ga0496101_0404010 3300048904 Bacteria 1076
460 Ga0496102_0011896 3300048905 Bacteria 7512
461 Ga0496102_0054566 3300048905 Bacteria 3644
462 Ga0496103_0026509 3300048906 Bacteria 3508
463 Ga0496104_0006523 3300048907 Bacteria 10262
464 Ga0496104_0086041 3300048907 Bacteria 3001
465 Ga0496104_0110681 3300048907 Bacteria 2633
466 Ga0496105_0010138 3300048908 Bacteria 7401
467 Ga0496105_0028430 3300048908 Bacteria 4571
468 Ga0496106_0000592 3300048909 Bacteria 25928
469 Ga0496106_0010113 3300048909 Bacteria 6967
470 Ga0496106_0229749 3300048909 Bacteria 1481
471 Ga0496106_0434975 3300048909 Bacteria 1054
472 Ga0496107_0037764 3300048910 Bacteria 3466
473 Ga0496107_0078784 3300048910 Bacteria 2401
474 Ga0496108_0055617 3300048911 Bacteria 3323
475 Ga0496108_0058637 3300048911 Bacteria 3236
476 Ga0496108_0086748 3300048911 Bacteria 2657
477 Ga0496108_0275244 3300048911 Bacteria 1465
478 Ga0496108_0288305 3300048911 Bacteria 1429
479 Ga0496109_0032171 3300048912 Bacteria 4713
480 Ga0496109_0039577 3300048912 Bacteria 4268
481 Ga0496110_0024686 3300048913 Bacteria 5126
482 Ga0496110_0034423 3300048913 Bacteria 4387
483 Ga0496110_0060048 3300048913 Bacteria 3353
484 Ga0496110_0069775 3300048913 Bacteria 3113
485 Ga0496110_0083115 3300048913 Bacteria 2856
486 Ga0496110_0184840 3300048913 Bacteria 1892
487 Ga0496110_0207935 3300048913 Bacteria 1779
488 Ga0496110_0239915 3300048913 Bacteria 1649
489 Ga0496111_0025463 3300048914 Bacteria 4174
490 Ga0496111_0040524 3300048914 Bacteria 3341
491 Ga0496111_0100081 3300048914 Bacteria 2129
492 Ga0496111_0187020 3300048914 Bacteria 1540
493 Ga0496111_0306303 3300048914 Bacteria 1177
494 Ga0496112_0051712 3300048915 Bacteria 4030
495 Ga0496112_0475557 3300048915 Bacteria 1186
496 Ga0496113_0032131 3300048916 Bacteria 3813
497 Ga0496113_0077586 3300048916 Bacteria 2540
498 Ga0496114_0046582 3300048917 Bacteria 3603
499 Ga0496114_0177977 3300048917 Bacteria 1856
500 Ga0496114_0287603 3300048917 Bacteria 1450
501 Ga0496114_0304826 3300048917 Bacteria 1406
502 Ga0496117_0029969 3300048920 Bacteria 4183
503 Ga0496118_0152418 3300048921 Bacteria 1444
504 Ga0496118_0269411 3300048921 Bacteria 955
505 Ga0496119_0034913 3300048922 Bacteria 3302
506 Ga0496119_0112151 3300048922 Bacteria 1512
507 Ga0496122_0003466 3300048925 Bacteria 20749
508 Ga0496124_0050516 3300048927 Bacteria 3543
509 Ga0496125_0000015 3300048928 Bacteria 516648
510 Ga0496125_0000913 3300048928 Bacteria 46575
511 Ga0496126_0195300 3300048929 Bacteria 1712
512 Ga0501031_0003225 3300049568 Bacteria 10476
513 Ga0501031_0059071 3300049568 Bacteria 2499
514 Ga0501031_0170806 3300049568 Bacteria 1421
515 Ga0501031_0199473 3300049568 Bacteria 1306
516 Ga0501031_0385810 3300049568 Bacteria 906
517 Ga0501032_0010375 3300049569 Bacteria 6718
518 Ga0501032_0026571 3300049569 Bacteria 3979
519 Ga0501033_0000653 3300049570 Bacteria 32031
520 Ga0501033_0007950 3300049570 Bacteria 8215
521 Ga0501033_0060471 3300049570 Bacteria 2795
522 Ga0501033_0391102 3300049570 Bacteria 971
523 Ga0501034_0033211 3300049571 Bacteria 5237
524 Ga0501034_0046532 3300049571 Bacteria 4383
525 Ga0501034_0247426 3300049571 Bacteria 1728
526 Ga0501036_0003680 3300049572 Bacteria 12270
527 Ga0501036_0012468 3300049572 Bacteria 7046
528 Ga0501036_0037661 3300049572 Bacteria 4091
529 Ga0501036_0041193 3300049572 Bacteria 3908
530 Ga0501036_0053829 3300049572 Bacteria 3407
531 Ga0501036_0056573 3300049572 Bacteria 3323
532 Ga0501036_0253642 3300049572 Bacteria 1474
533 Ga0501037_0006501 3300049573 Bacteria 8550
534 Ga0501037_0018913 3300049573 Bacteria 5078
535 Ga0501037_0580623 3300049573 Bacteria 754
536 Ga0501038_0000456 3300049574 Bacteria 35724
537 Ga0501038_0003592 3300049574 Bacteria 14438
538 Ga0501038_0004992 3300049574 Bacteria 12322
539 Ga0501038_0095345 3300049574 Bacteria 2485
540 Ga0501038_0182993 3300049574 Bacteria 1690
541 Ga0501038_0358796 3300049574 Bacteria 1134
542 Ga0501038_0437196 3300049574 Bacteria 1008
543 Ga0501039_0002751 3300049575 Bacteria 13113
544 Ga0501039_0003077 3300049575 Bacteria 12478
545 Ga0501039_0025643 3300049575 Bacteria 4531
546 Ga0501039_0078889 3300049575 Bacteria 2561
547 Ga0501039_0150821 3300049575 Bacteria 1826
548 Ga0501039_0532356 3300049575 Bacteria 922
549 Ga0501040_0002301 3300049576 Bacteria 12280
550 Ga0501040_0002316 3300049576 Bacteria 12231
551 Ga0501040_0014941 3300049576 Bacteria 5127
552 Ga0501040_0138020 3300049576 Bacteria 1716
553 Ga0501041_0000438 3300049577 Bacteria 21095
554 Ga0501041_0017558 3300049577 Bacteria 4258
555 Ga0501041_0026479 3300049577 Bacteria 3489
556 Ga0501041_0041547 3300049577 Bacteria 2793
557 Ga0501042_0001107 3300049578 Bacteria 15503
558 Ga0501042_0003246 3300049578 Bacteria 10169
559 Ga0501042_0030426 3300049578 Bacteria 3812
560 Ga0501042_0042313 3300049578 Bacteria 3242
561 Ga0501042_0055188 3300049578 Bacteria 2835
562 Ga0501042_0087028 3300049578 Bacteria 2241
563 Ga0501042_0236168 3300049578 Bacteria 1319
564 Ga0501042_0597007 3300049578 Bacteria 803
565 Ga0501043_0004024 3300049579 Bacteria 12021
566 Ga0501043_0018068 3300049579 Bacteria 5531
567 Ga0501043_0221078 3300049579 Bacteria 1465
568 Ga0501043_0251411 3300049579 Bacteria 1361
569 Ga0501046_0000721 3300049580 Bacteria 31964
570 Ga0501046_0001166 3300049580 Bacteria 25571
571 Ga0501046_0017196 3300049580 Bacteria 6043
572 Ga0501046_0050259 3300049580 Bacteria 3294
573 Ga0501046_0053494 3300049580 Bacteria 3179
574 Ga0501046_0114170 3300049580 Bacteria 2061
575 Ga0501046_0138566 3300049580 Bacteria 1842
576 Ga0501047_0000236 3300049581 Bacteria 65453
577 Ga0501047_0013180 3300049581 Bacteria 7829
578 Ga0501047_0089865 3300049581 Bacteria 2948
579 Ga0501047_0107535 3300049581 Bacteria 2670
580 Ga0501048_0000920 3300049582 Bacteria 21650
581 Ga0501048_0003693 3300049582 Bacteria 11661
582 Ga0501048_0022061 3300049582 Bacteria 4659
583 Ga0501048_0099333 3300049582 Bacteria 2053
584 Ga0501048_0423204 3300049582 Bacteria 953
585 Ga0501067_0013732 3300049583 Bacteria 4485
586 Ga0501067_0019236 3300049583 Bacteria 3779
587 Ga0501067_0020313 3300049583 Bacteria 3676
588 Ga0501067_0079975 3300049583 Bacteria 1811
589 Ga0501067_0169876 3300049583 Bacteria 1215
590 Ga0501069_0087714 3300049585 Bacteria 1758
591 Ga0501070_0008079 3300049586 Bacteria 8906
592 Ga0501070_0037862 3300049586 Bacteria 4025
593 Ga0501070_0115889 3300049586 Bacteria 2213
594 Ga0501070_0220925 3300049586 Bacteria 1554
595 Ga0501071_0012541 3300049587 Bacteria 5751
596 Ga0501071_0057219 3300049587 Bacteria 2817
597 Ga0501071_0068348 3300049587 Bacteria 2585
598 Ga0501071_0316691 3300049587 Bacteria 1184
599 Ga0501072_0001219 3300049588 Bacteria 19209
600 Ga0501072_0016009 3300049588 Bacteria 5751
601 Ga0501072_0042617 3300049588 Bacteria 3565
602 Ga0501072_0186820 3300049588 Bacteria 1653
603 Ga0501073_0092822 3300049589 Bacteria 2098
604 Ga0501073_0196955 3300049589 Bacteria 1393
605 Ga0501073_0240709 3300049589 Bacteria 1250
606 Ga0501074_0001096 3300049590 Bacteria 17703
607 Ga0501074_0005515 3300049590 Bacteria 9103
608 Ga0501074_0055852 3300049590 Bacteria 2845
609 Ga0501074_0064035 3300049590 Bacteria 2648
610 Ga0501074_0080750 3300049590 Bacteria 2332
611 Ga0501074_0190107 3300049590 Bacteria 1464
612 Ga0501075_0001417 3300049591 Bacteria 15619
613 Ga0501075_0677382 3300049591 Bacteria 786
614 Ga0501076_0005339 3300049592 Bacteria 9227
615 Ga0501076_0018992 3300049592 Bacteria 5245
616 Ga0501076_0025085 3300049592 Bacteria 4611
617 Ga0501076_0034576 3300049592 Bacteria 3951
618 Ga0501076_0048098 3300049592 Bacteria 3372
619 Ga0501076_0761039 3300049592 Bacteria 799
620 Ga0501077_0000877 3300049593 Bacteria 18136
621 Ga0501077_0048762 3300049593 Bacteria 2691
622 Ga0501077_0073195 3300049593 Bacteria 2171
623 Ga0501077_0340116 3300049593 Bacteria 957
624 Ga0501079_0001493 3300049741 Bacteria 16559
625 Ga0501079_0039736 3300049741 Bacteria 3629
626 Ga0501079_0052977 3300049741 Bacteria 3131
627 Ga0501079_0089339 3300049741 Bacteria 2386
628 Ga0501080_0104205 3300049742 Bacteria 2631
629 Ga0501080_0163873 3300049742 Bacteria 2052
630 Ga0501080_0626070 3300049742 Bacteria 954
631 Ga0501080_0746138 3300049742 Bacteria 861
632 Ga0501081_0043087 3300049743 Bacteria 3095
633 Ga0501081_0055072 3300049743 Bacteria 2748
634 Ga0501081_0226335 3300049743 Bacteria 1361
635 Ga0501083_0010423 3300049744 Bacteria 6541
636 Ga0501083_0046450 3300049744 Bacteria 2936
637 Ga0501083_0115052 3300049744 Bacteria 1766
638 Ga0501035_0025283 3300049822 Bacteria 5443
639 Ga0501035_0059019 3300049822 Bacteria 3417
640 Ga0501035_0080543 3300049822 Bacteria 2875
641 Ga0501035_0121174 3300049822 Bacteria 2286
642 Ga0501044_0007319 3300049823 Bacteria 12132
643 Ga0501044_0020945 3300049823 Bacteria 6982
644 Ga0501044_0306110 3300049823 Bacteria 1516
645 Ga0501045_0002730 3300049824 Bacteria 12054
646 Ga0501045_0059178 3300049824 Bacteria 2806
647 Ga0501045_0120449 3300049824 Bacteria 1948
648 Ga0501045_0189286 3300049824 Bacteria 1534
649 Ga0501045_0218829 3300049824 Bacteria 1418
650 Ga0501045_0392250 3300049824 Bacteria 1033
651 nmdc:mga03n38_1401_c1 3300050490 Bacteria 6865
652 nmdc:mga03n38_2386_c1 3300050490 Bacteria 5793
653 nmdc:mga00v17_109942_c1 3300050491 Bacteria 1748
654 nmdc:mga00v17_146187_c1 3300050491 Bacteria 1517
655 nmdc:mga00v17_18632_c1 3300050491 Bacteria 3947
656 nmdc:mga00v17_29950_c1 3300050491 Bacteria 3197
657 nmdc:mga00v17_6019_c1 3300050491 Bacteria 6418
658 nmdc:mga00v17_82957_c1 3300050491 Bacteria 2004
659 nmdc:mga0yw44_246264_c1 3300050492 Bacteria 1189
660 nmdc:mga0yw44_24694_c1 3300050492 Bacteria 3405
661 nmdc:mga0yw44_277034_c1 3300050492 Bacteria 1121
662 nmdc:mga0yw44_35004_c1 3300050492 Bacteria 2948
663 nmdc:mga0yw44_4727_c1 3300050492 Bacteria 6303
664 nmdc:mga0yw44_92517_c1 3300050492 Bacteria 1914
665 nmdc:mga06z11_55509_c1 3300050494 Bacteria 2046
666 nmdc:mga06z11_56935_c1 3300050494 Bacteria 2024
667 nmdc:mga06z11_62633_c1 3300050494 Bacteria 1944
668 nmdc:mga04h51_13797_c1 3300050495 Bacteria 2296
669 nmdc:mga04h51_6972_c1 3300050495 Bacteria 2961
670 nmdc:mga07m45_14063_c1 3300050496 Bacteria 4257
671 nmdc:mga07m45_18291_c1 3300050496 Bacteria 3454
672 nmdc:mga07m45_60490_c1 3300050496 Bacteria 2144
673 nmdc:mga05p37_168741_c1 3300050507 Bacteria 2670
674 nmdc:mga05p37_249168_c1 3300050507 Bacteria 2131
675 nmdc:mga05p37_7716_c1 3300050507 Bacteria 12700
676 nmdc:mga09592_179183_c1 3300050508 Bacteria 1833
677 nmdc:mga09592_19936_c1 3300050508 Bacteria 5509
678 nmdc:mga0qj67_19945_c1 3300050509 Bacteria 5130
679 nmdc:mga06r32_293029_c1 3300050510 Bacteria 1614
680 nmdc:mga06r32_435850_c1 3300050510 Bacteria 1291
681 nmdc:mga06r32_456209_c1 3300050510 Bacteria 1258
682 nmdc:mga08y16_116701_c1 3300050511 Bacteria 2779
683 nmdc:mga08y16_25926_c1 3300050511 Bacteria 6185
684 nmdc:mga0n895_2193_c1 3300050512 Bacteria 15106
685 nmdc:mga0n895_23064_c1 3300050512 Bacteria 5845
686 nmdc:mga0rr50_148051_c1 3300050513 Bacteria 1895
687 nmdc:mga0rr50_453337_c1 3300050513 Bacteria 1087
688 nmdc:mga08x19_235272_c1 3300050514 Bacteria 1262
689 nmdc:mga0a205_117672_c1 3300050515 Bacteria 2556
690 nmdc:mga0a205_1568_c1 3300050515 Bacteria 19587
691 nmdc:mga0a205_195310_c1 3300050515 Bacteria 1915
692 Ga0495601_0043276 3300053077 Bacteria 2828
693 Ga0495612_0052657 3300053078 Bacteria 1675
694 Ga0500644_0000054 3300053088 Bacteria 69110
695 Ga0500641_0034407 3300053096 Bacteria 2017
696 Ga0500556_0000446 3300053104 Bacteria 29406
697 Ga0500593_001296 3300053117 Bacteria 9030
698 Ga0500573_0007156 3300053140 Bacteria 6072
699 Ga0501084_0003502 3300054114 Bacteria 12761
700 Ga0501084_0006488 3300054114 Bacteria 9619
701 Ga0501084_0007608 3300054114 Bacteria 8932
702 Ga0501084_0252134 3300054114 Bacteria 1490
703 Ga0590075_043158 3300059424 Bacteria 1153
704 Ga0590075_044096 3300059424 Bacteria 1141
705 Ga0590077_002079 3300059426 Bacteria 4384
706 Ga0501082_0000550 3300060353 Bacteria 33364
707 Ga0501082_0006458 3300060353 Bacteria 10168
708 Ga0501082_0007866 3300060353 Bacteria 9199
709 Ga0501082_0048486 3300060353 Bacteria 3660
710 Ga0501082_0068553 3300060353 Bacteria 3054
711 Ga0466962_0003384 3300061719 Bacteria 7591
712 Ga0466962_0021546 3300061719 Bacteria 3094
713 Ga0530510_0001653 3300061734 Bacteria 15078
714 Ga0530510_0021895 3300061734 Bacteria 4550
715 Ga0530510_0343419 3300061734 Bacteria 1121

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100633132 Ga0070689_1006331321 208
2 3300025936 Ga0207670_10053678 Ga0207670_100536781 208
3 3300046454 Ga0495592_0356854 Ga0495592_0356854_11_682 209
4 3300037471 Ga0395905_0758747 Ga0395905_0758747_23_700 223
5 3300047446 Ga0495679_102658 Ga0495679_102658_13_699 224
6 3300005434 Ga0070709_10001220 Ga0070709_100012204 230
7 3300005436 Ga0070713_100021022 Ga0070713_1000210225 230
8 3300006175 Ga0070712_100090192 Ga0070712_1000901922 230
9 3300025906 Ga0207699_10008934 Ga0207699_100089345 230
10 3300025915 Ga0207693_10103059 Ga0207693_101030591 230
11 3300025916 Ga0207663_10225579 Ga0207663_102255791 230
12 3300025928 Ga0207700_10013738 Ga0207700_100137382 230
13 3300025929 Ga0207664_10072434 Ga0207664_100724342 230
14 3300037853 Ga0436364_1514249 Ga0436364_1514249_1517_2290 230
15 3300009551 Ga0105238_10545754 Ga0105238_105457542 231
16 3300013308 Ga0157375_10199974 Ga0157375_101999742 231
17 3300035691 Ga0373931_0358648 Ga0373931_0358648_125_880 231
18 3300046536 Ga0495587_0326833 Ga0495587_0326833_40_795 231
19 3300046663 Ga0495635_0109735 Ga0495635_0109735_1046_1801 231
20 3300047322 Ga0495680_0056581 Ga0495680_0056581_1467_2222 231
21 3300048913 Ga0496110_0069775 Ga0496110_0069775_1319_2074 231
22 3300050490 nmdc:mga03n38_2386_c1 nmdc:mga03n38_2386_c1_4669_5373 234
23 3300050491 nmdc:mga00v17_6019_c1 nmdc:mga00v17_6019_c1_837_1541 234
24 3300050496 nmdc:mga07m45_60490_c1 nmdc:mga07m45_60490_c1_1061_1765 234
25 iso_pu_bacteria 2643221617 2644102800 234
26 iso_pu_bacteria 2643221620 2644118462 234
27 3300049573 Ga0501037_0580623 Ga0501037_0580623_20_727 235
28 3300005983 Ga0081540_1067638 Ga0081540_10676381 237
29 3300006038 Ga0075365_10110613 Ga0075365_101106132 238
30 3300006048 Ga0075363_100017106 Ga0075363_1000171062 238
31 3300006048 Ga0075363_100113672 Ga0075363_1001136722 238
32 3300006051 Ga0075364_10015981 Ga0075364_100159811 238
33 3300006051 Ga0075364_10085842 Ga0075364_100858421 238
34 3300037418 Ga0395900_0187972 Ga0395900_0187972_188_904 238
35 3300037466 Ga0395898_0348558 Ga0395898_0348558_410_1126 238
36 3300037471 Ga0395905_0913942 Ga0395905_0913942_29_745 238
37 3300038443 Ga0395901_0164790 Ga0395901_0164790_340_1056 238
38 3300044842 Ga0466957_0423076 Ga0466957_0423076_187_903 238
39 3300050496 nmdc:mga07m45_14063_c1 nmdc:mga07m45_14063_c1_2705_3421 238
40 3300053088 Ga0500644_0000054 Ga0500644_0000054_55542_56258 238
41 3300053140 Ga0500573_0007156 Ga0500573_0007156_1633_2349 238
42 3300005441 Ga0070700_100064019 Ga0070700_1000640192 239
43 3300031731 Ga0307405_10134290 Ga0307405_101342902 239
44 3300031903 Ga0307407_10006812 Ga0307407_100068122 239
45 3300031995 Ga0307409_100010345 Ga0307409_1000103454 239
46 3300031995 Ga0307409_100033847 Ga0307409_1000338473 239
47 3300032002 Ga0307416_100017783 Ga0307416_1000177833 239
48 3300032002 Ga0307416_100084277 Ga0307416_1000842772 239
49 3300032004 Ga0307414_10137266 Ga0307414_101372662 239
50 3300044693 Ga0466961_0073191 Ga0466961_0073191_19_738 239
51 3300044901 Ga0466960_0008485 Ga0466960_0008485_2475_3194 239
52 3300045976 Ga0466967_0071078 Ga0466967_0071078_881_1600 239
53 3300046543 Ga0495645_0207262 Ga0495645_0207262_194_955 239
54 3300046678 Ga0495599_0161886 Ga0495599_0161886_448_1209 239
55 3300048929 Ga0496126_0195300 Ga0496126_0195300_920_1639 239
56 3300049578 Ga0501042_0236168 Ga0501042_0236168_20_739 239
57 3300049824 Ga0501045_0218829 Ga0501045_0218829_117_836 239
58 3300025908 Ga0207643_10316754 Ga0207643_103167541 243
59 iso_pu_bacteria 2643221615 2644093435 243
60 iso_pu_bacteria 2643221657 2644323045 243
61 3300003373 JGI25407J50210_10025897 JGI25407J50210_100258972 244
62 3300005614 Ga0068856_100039423 Ga0068856_1000394235 244
63 3300005981 Ga0081538_10000954 Ga0081538_1000095418 244
64 3300005981 Ga0081538_10004151 Ga0081538_1000415110 244
65 3300009011 Ga0105251_10054791 Ga0105251_100547912 244
66 3300009093 Ga0105240_10106628 Ga0105240_101066282 244
67 3300009094 Ga0111539_10534065 Ga0111539_105340652 244
68 3300009101 Ga0105247_10007081 Ga0105247_100070812 244
69 3300009147 Ga0114129_10140668 Ga0114129_101406683 244
70 3300009174 Ga0105241_10006049 Ga0105241_100060496 244
71 3300009177 Ga0105248_10466412 Ga0105248_104664122 244
72 3300009545 Ga0105237_10043607 Ga0105237_100436072 244
73 3300009551 Ga0105238_10086487 Ga0105238_100864874 244
74 3300011119 Ga0105246_10000926 Ga0105246_100009268 244
75 3300013100 Ga0157373_10188337 Ga0157373_101883372 244
76 3300013102 Ga0157371_10077677 Ga0157371_100776772 244
77 3300013104 Ga0157370_10262021 Ga0157370_102620212 244
78 3300013105 Ga0157369_10092325 Ga0157369_100923252 244
79 3300013296 Ga0157374_10007768 Ga0157374_100077689 244
80 3300013297 Ga0157378_10796364 Ga0157378_107963641 244
81 3300013308 Ga0157375_10054282 Ga0157375_100542823 244
82 3300014497 Ga0182008_10143697 Ga0182008_101436972 244
83 3300014745 Ga0157377_10162204 Ga0157377_101622042 244
84 3300026078 Ga0207702_10009452 Ga0207702_100094524 244
85 3300042016 Ga0439463_024791 Ga0439463_024791_447_1187 244
86 3300042157 Ga0439458_0003066 Ga0439458_0003066_157_897 244
87 3300044694 Ga0466963_0152941 Ga0466963_0152941_531_1271 244
88 3300045976 Ga0466967_0181081 Ga0466967_0181081_1188_1928 244
89 3300048904 Ga0496101_0030690 Ga0496101_0030690_2583_3323 244
90 3300048905 Ga0496102_0011896 Ga0496102_0011896_2771_3511 244
91 3300048907 Ga0496104_0006523 Ga0496104_0006523_9013_9753 244
92 3300048908 Ga0496105_0010138 Ga0496105_0010138_5461_6201 244
93 3300048909 Ga0496106_0010113 Ga0496106_0010113_1350_2090 244
94 3300048910 Ga0496107_0078784 Ga0496107_0078784_121_861 244
95 3300048911 Ga0496108_0275244 Ga0496108_0275244_315_1055 244
96 3300048913 Ga0496110_0024686 Ga0496110_0024686_2281_3021 244
97 3300048914 Ga0496111_0306303 Ga0496111_0306303_258_998 244
98 3300049568 Ga0501031_0059071 Ga0501031_0059071_819_1619 244
99 3300049570 Ga0501033_0060471 Ga0501033_0060471_861_1661 244
100 3300049572 Ga0501036_0056573 Ga0501036_0056573_558_1358 244
101 3300049574 Ga0501038_0004992 Ga0501038_0004992_1665_2465 244
102 3300049575 Ga0501039_0078889 Ga0501039_0078889_930_1730 244
103 3300049576 Ga0501040_0138020 Ga0501040_0138020_661_1461 244
104 3300049580 Ga0501046_0138566 Ga0501046_0138566_391_1191 244
105 3300049582 Ga0501048_0099333 Ga0501048_0099333_841_1641 244
106 3300049590 Ga0501074_0001096 Ga0501074_0001096_7394_8194 244
107 3300049592 Ga0501076_0048098 Ga0501076_0048098_635_1435 244
108 3300049741 Ga0501079_0039736 Ga0501079_0039736_2009_2809 244
109 3300049743 Ga0501081_0043087 Ga0501081_0043087_1534_2334 244
110 3300049744 Ga0501083_0115052 Ga0501083_0115052_643_1443 244
111 3300049824 Ga0501045_0120449 Ga0501045_0120449_550_1350 244
112 3300050507 nmdc:mga05p37_168741_c1 nmdc:mga05p37_168741_c1_148_888 244
113 3300050508 nmdc:mga09592_179183_c1 nmdc:mga09592_179183_c1_383_1123 244
114 3300050510 nmdc:mga06r32_293029_c1 nmdc:mga06r32_293029_c1_249_989 244
115 3300050512 nmdc:mga0n895_2193_c1 nmdc:mga0n895_2193_c1_3092_3832 244
116 3300050513 nmdc:mga0rr50_148051_c1 nmdc:mga0rr50_148051_c1_765_1505 244
117 3300050514 nmdc:mga08x19_235272_c1 nmdc:mga08x19_235272_c1_340_1080 244
118 3300050515 nmdc:mga0a205_1568_c1 nmdc:mga0a205_1568_c1_12980_13720 244
119 3300054114 Ga0501084_0006488 Ga0501084_0006488_1178_1978 244
120 3300060353 Ga0501082_0007866 Ga0501082_0007866_6314_7114 244
121 3300005981 Ga0081538_10078350 Ga0081538_100783503 245
122 3300037466 Ga0395898_0192499 Ga0395898_0192499_823_1599 245
123 3300038443 Ga0395901_0053961 Ga0395901_0053961_2649_3425 245
124 3300038443 Ga0395901_0058989 Ga0395901_0058989_1435_2211 245
125 3300038443 Ga0395901_0199018 Ga0395901_0199018_347_1123 245
126 iso_pu_bacteria 2891395885 2891397077 246
127 3300005329 Ga0070683_100283284 Ga0070683_1002832842 247
128 3300005337 Ga0070682_100276155 Ga0070682_1002761552 247
129 3300005616 Ga0068852_100261803 Ga0068852_1002618032 247
130 3300005985 Ga0081539_10018108 Ga0081539_100181082 247
131 3300006038 Ga0075365_10080934 Ga0075365_100809342 247
132 3300009098 Ga0105245_10056391 Ga0105245_100563914 247
133 3300009176 Ga0105242_10067430 Ga0105242_100674301 247
134 3300009551 Ga0105238_10162392 Ga0105238_101623922 247
135 3300009553 Ga0105249_10593027 Ga0105249_105930272 247
136 3300010375 Ga0105239_10132743 Ga0105239_101327432 247
137 3300013306 Ga0163162_10275536 Ga0163162_102755362 247
138 3300013308 Ga0157375_10039056 Ga0157375_100390562 247
139 3300013308 Ga0157375_10112420 Ga0157375_101124202 247
140 3300014325 Ga0163163_10140551 Ga0163163_101405512 247
141 3300025927 Ga0207687_10080223 Ga0207687_100802234 247
142 3300025934 Ga0207686_10057719 Ga0207686_100577192 247
143 3300048904 Ga0496101_0119204 Ga0496101_0119204_1222_1965 247
144 3300048908 Ga0496105_0028430 Ga0496105_0028430_1736_2479 247
145 3300048911 Ga0496108_0086748 Ga0496108_0086748_667_1410 247
146 3300048913 Ga0496110_0184840 Ga0496110_0184840_1126_1869 247
147 3300048914 Ga0496111_0025463 Ga0496111_0025463_1699_2442 247
148 3300048915 Ga0496112_0051712 Ga0496112_0051712_1806_2549 247
149 3300048916 Ga0496113_0032131 Ga0496113_0032131_2887_3630 247
150 3300048917 Ga0496114_0046582 Ga0496114_0046582_1141_1884 247
151 3300049577 Ga0501041_0017558 Ga0501041_0017558_1389_2189 247
152 3300049742 Ga0501080_0746138 Ga0501080_0746138_26_769 247
153 3300050491 nmdc:mga00v17_82957_c1 nmdc:mga00v17_82957_c1_797_1540 247
154 3300053104 Ga0500556_0000446 Ga0500556_0000446_21235_21978 247
155 3300053117 Ga0500593_001296 Ga0500593_001296_6206_6949 247
156 iso_pu_bacteria 3001889506 3001892178 247
157 3300009094 Ga0111539_10503688 Ga0111539_105036882 248
158 3300009148 Ga0105243_10358211 Ga0105243_103582111 248
159 3300025945 Ga0207679_10343453 Ga0207679_103434531 248
160 3300026075 Ga0207708_10091474 Ga0207708_100914742 248
161 3300026118 Ga0207675_100034967 Ga0207675_1000349676 248
162 3300026121 Ga0207683_10033590 Ga0207683_100335904 248
163 3300027907 Ga0207428_10083230 Ga0207428_100832304 248
164 3300031911 Ga0307412_10024506 Ga0307412_100245062 248
165 3300032002 Ga0307416_100063687 Ga0307416_1000636874 248
166 3300037853 Ga0436364_0700221 Ga0436364_0700221_100_846 248
167 3300041443 Ga0451789_0493370 Ga0451789_0493370_1412_2164 248
168 3300041452 Ga0451793_0112958 Ga0451793_0112958_851_1603 248
169 3300041453 Ga0451797_0393491 Ga0451797_0393491_51_803 248
170 3300041491 Ga0451833_1221655 Ga0451833_1221655_292_1044 248
171 3300041498 Ga0451841_0871602 Ga0451841_0871602_43_795 248
172 3300041509 Ga0451843_0604577 Ga0451843_0604577_1053_1805 248
173 3300044694 Ga0466963_0120276 Ga0466963_0120276_457_1203 248
174 3300049568 Ga0501031_0385810 Ga0501031_0385810_15_761 248
175 3300049578 Ga0501042_0597007 Ga0501042_0597007_23_769 248
176 3300049592 Ga0501076_0761039 Ga0501076_0761039_42_788 248
177 3300049742 Ga0501080_0626070 Ga0501080_0626070_133_879 248
178 iso_pu_bacteria 2675903060 2676492937 248
179 iso_pu_bacteria 2873314349 2873316776 248
180 iso_pu_bacteria 2891554331 2891558095 248
181 iso_pu_bacteria 2643221679 2644444606 249
182 iso_pu_bacteria 2643221690 2644505062 249
183 iso_pu_bacteria 2643221694 2644527390 249
184 iso_pu_bacteria 2643221722 2644667545 249
185 iso_pu_bacteria 2811994880 2812362318 249
186 iso_pu_bacteria 2884994152 2884994378 249
187 iso_pu_bacteria 2887443736 2887446042 249
188 iso_pu_bacteria 2932431166 2932433111 249
189 iso_pu_bacteria 2784132109 2784472928 250
190 3300005455 Ga0070663_100034144 Ga0070663_1000341444 251
191 3300025932 Ga0207690_10060370 Ga0207690_100603702 251
192 3300026067 Ga0207678_10055206 Ga0207678_100552062 251
193 3300031731 Ga0307405_10144624 Ga0307405_101446241 251
194 3300031995 Ga0307409_100247067 Ga0307409_1002470672 251
195 3300032126 Ga0307415_100012603 Ga0307415_1000126034 251
196 3300038443 Ga0395901_0603070 Ga0395901_0603070_266_1060 251
197 3300048921 Ga0496118_0269411 Ga0496118_0269411_188_943 251
198 3300048922 Ga0496119_0112151 Ga0496119_0112151_611_1366 251
199 3300048928 Ga0496125_0000913 Ga0496125_0000913_32027_32782 251
200 3300049570 Ga0501033_0391102 Ga0501033_0391102_115_876 251
201 3300049572 Ga0501036_0253642 Ga0501036_0253642_599_1354 251
202 3300049574 Ga0501038_0437196 Ga0501038_0437196_152_907 251
203 3300049575 Ga0501039_0150821 Ga0501039_0150821_632_1387 251
204 3300049576 Ga0501040_0014941 Ga0501040_0014941_3806_4561 251
205 3300049577 Ga0501041_0041547 Ga0501041_0041547_1965_2720 251
206 3300049578 Ga0501042_0030426 Ga0501042_0030426_1412_2167 251
207 3300049580 Ga0501046_0114170 Ga0501046_0114170_336_1091 251
208 3300049587 Ga0501071_0068348 Ga0501071_0068348_148_903 251
209 3300049588 Ga0501072_0016009 Ga0501072_0016009_4112_4867 251
210 3300049591 Ga0501075_0677382 Ga0501075_0677382_21_776 251
211 3300049592 Ga0501076_0034576 Ga0501076_0034576_1444_2199 251
212 3300049593 Ga0501077_0073195 Ga0501077_0073195_1315_2070 251
213 3300049742 Ga0501080_0104205 Ga0501080_0104205_590_1345 251
214 3300049743 Ga0501081_0055072 Ga0501081_0055072_1618_2373 251
215 3300049824 Ga0501045_0059178 Ga0501045_0059178_848_1603 251
216 3300060353 Ga0501082_0068553 Ga0501082_0068553_185_940 251
217 3300061734 Ga0530510_0021895 Ga0530510_0021895_3036_3791 251
218 3300003320 rootH2_10117484 rootH2_101174842 252
219 3300006038 Ga0075365_10208750 Ga0075365_102087502 252
220 3300009147 Ga0114129_10030977 Ga0114129_100309779 252
221 3300050507 nmdc:mga05p37_249168_c1 nmdc:mga05p37_249168_c1_272_1045 252
222 3300053096 Ga0500641_0034407 Ga0500641_0034407_639_1400 252
223 3300001915 JGI24741J21665_1019401 JGI24741J21665_10194011 253
224 3300003203 JGI25406J46586_10039621 JGI25406J46586_100396213 253
225 3300003373 JGI25407J50210_10060802 JGI25407J50210_100608021 253
226 3300005327 Ga0070658_10000469 Ga0070658_1000046912 253
227 3300005329 Ga0070683_100279893 Ga0070683_1002798931 253
228 3300005336 Ga0070680_100576975 Ga0070680_1005769751 253
229 3300005339 Ga0070660_100256202 Ga0070660_1002562022 253
230 3300005347 Ga0070668_100604435 Ga0070668_1006044351 253
231 3300005367 Ga0070667_100023486 Ga0070667_1000234866 253
232 3300005439 Ga0070711_100324554 Ga0070711_1003245542 253
233 3300005440 Ga0070705_100264110 Ga0070705_1002641102 253
234 3300005456 Ga0070678_100032787 Ga0070678_1000327871 253
235 3300005457 Ga0070662_100004379 Ga0070662_1000043795 253
236 3300005459 Ga0068867_100321400 Ga0068867_1003214001 253
237 3300005535 Ga0070684_100083840 Ga0070684_1000838402 253
238 3300005546 Ga0070696_100004312 Ga0070696_1000043121 253
239 3300005546 Ga0070696_100184379 Ga0070696_1001843792 253
240 3300005615 Ga0070702_100126457 Ga0070702_1001264571 253
241 3300005719 Ga0068861_100006622 Ga0068861_1000066226 253
242 3300005719 Ga0068861_100192866 Ga0068861_1001928662 253
243 3300005937 Ga0081455_10065105 Ga0081455_100651054 253
244 3300005981 Ga0081538_10012738 Ga0081538_100127383 253
245 3300005981 Ga0081538_10013828 Ga0081538_100138284 253
246 3300005981 Ga0081538_10017756 Ga0081538_100177567 253
247 3300005981 Ga0081538_10019528 Ga0081538_100195284 253
248 3300005981 Ga0081538_10038702 Ga0081538_100387023 253
249 3300005985 Ga0081539_10006160 Ga0081539_100061609 253
250 3300005985 Ga0081539_10059757 Ga0081539_100597572 253
251 3300006847 Ga0075431_100201056 Ga0075431_1002010563 253
252 3300006881 Ga0068865_100375091 Ga0068865_1003750911 253
253 3300009147 Ga0114129_10277820 Ga0114129_102778202 253
254 3300009148 Ga0105243_10068730 Ga0105243_100687303 253
255 3300009148 Ga0105243_10128699 Ga0105243_101286991 253
256 3300009176 Ga0105242_10007216 Ga0105242_100072166 253
257 3300009177 Ga0105248_10129953 Ga0105248_101299531 253
258 3300009551 Ga0105238_10172988 Ga0105238_101729882 253
259 3300009553 Ga0105249_10006439 Ga0105249_1000643910 253
260 3300009553 Ga0105249_10046304 Ga0105249_100463042 253
261 3300009553 Ga0105249_10612095 Ga0105249_106120951 253
262 3300009993 Ga0105028_107759 Ga0105028_1077591 253
263 3300011119 Ga0105246_10204796 Ga0105246_102047962 253
264 3300013104 Ga0157370_10349525 Ga0157370_103495252 253
265 3300013105 Ga0157369_10041564 Ga0157369_100415642 253
266 3300013297 Ga0157378_10039016 Ga0157378_100390162 253
267 3300013306 Ga0163162_10021242 Ga0163162_100212423 253
268 3300013306 Ga0163162_10049063 Ga0163162_100490634 253
269 3300013306 Ga0163162_10209049 Ga0163162_102090493 253
270 3300013307 Ga0157372_10019262 Ga0157372_100192628 253
271 3300013307 Ga0157372_10054992 Ga0157372_100549925 253
272 3300013307 Ga0157372_10248947 Ga0157372_102489472 253
273 3300013308 Ga0157375_10153340 Ga0157375_101533401 253
274 3300013308 Ga0157375_10189411 Ga0157375_101894112 253
275 3300013308 Ga0157375_11223943 Ga0157375_112239431 253
276 3300017792 Ga0163161_10107753 Ga0163161_101077532 253
277 3300017792 Ga0163161_10299420 Ga0163161_102994202 253
278 3300020081 Ga0206354_11252387 Ga0206354_112523871 253
279 3300025899 Ga0207642_10130525 Ga0207642_101305252 253
280 3300025909 Ga0207705_10468337 Ga0207705_104683371 253
281 3300025919 Ga0207657_10223573 Ga0207657_102235731 253
282 3300025924 Ga0207694_10109108 Ga0207694_101091084 253
283 3300025927 Ga0207687_10020856 Ga0207687_100208563 253
284 3300025933 Ga0207706_10005862 Ga0207706_100058626 253
285 3300025934 Ga0207686_10226037 Ga0207686_102260372 253
286 3300025935 Ga0207709_10017730 Ga0207709_100177301 253
287 3300025938 Ga0207704_10202251 Ga0207704_102022512 253
288 3300025972 Ga0207668_10052079 Ga0207668_100520792 253
289 3300026089 Ga0207648_10188014 Ga0207648_101880142 253
290 3300026118 Ga0207675_100001939 Ga0207675_10000193914 253
291 3300028573 Ga0265334_10001366 Ga0265334_100013663 253
292 3300031247 Ga0265340_10007568 Ga0265340_100075685 253
293 3300031249 Ga0265339_10031105 Ga0265339_100311052 253
294 3300031548 Ga0307408_100039897 Ga0307408_1000398973 253
295 3300031548 Ga0307408_100053725 Ga0307408_1000537253 253
296 3300031548 Ga0307408_100081356 Ga0307408_1000813563 253
297 3300031691 Ga0316579_10000156 Ga0316579_1000015615 253
298 3300031691 Ga0316579_10105926 Ga0316579_101059261 253
299 3300031691 Ga0316579_10160014 Ga0316579_101600141 253
300 3300031712 Ga0265342_10030328 Ga0265342_100303283 253
301 3300031727 Ga0316576_10022296 Ga0316576_100222962 253
302 3300031727 Ga0316576_10024186 Ga0316576_100241865 253
303 3300031727 Ga0316576_10046366 Ga0316576_100463663 253
304 3300031727 Ga0316576_10092348 Ga0316576_100923482 253
305 3300031727 Ga0316576_10255064 Ga0316576_102550642 253
306 3300031731 Ga0307405_10011341 Ga0307405_100113413 253
307 3300031824 Ga0307413_10040157 Ga0307413_100401572 253
308 3300031824 Ga0307413_10093534 Ga0307413_100935342 253
309 3300031852 Ga0307410_10021327 Ga0307410_100213271 253
310 3300031852 Ga0307410_10071656 Ga0307410_100716563 253
311 3300031852 Ga0307410_10114266 Ga0307410_101142662 253
312 3300031901 Ga0307406_10012216 Ga0307406_100122163 253
313 3300031901 Ga0307406_10016200 Ga0307406_100162003 253
314 3300031901 Ga0307406_10112736 Ga0307406_101127362 253
315 3300031903 Ga0307407_10059245 Ga0307407_100592453 253
316 3300031903 Ga0307407_10131963 Ga0307407_101319632 253
317 3300031911 Ga0307412_10048224 Ga0307412_100482244 253
318 3300031995 Ga0307409_100006642 Ga0307409_1000066424 253
319 3300031995 Ga0307409_100020155 Ga0307409_1000201553 253
320 3300031995 Ga0307409_100125352 Ga0307409_1001253522 253
321 3300031995 Ga0307409_100141422 Ga0307409_1001414222 253
322 3300031995 Ga0307409_100189200 Ga0307409_1001892002 253
323 3300031995 Ga0307409_100220069 Ga0307409_1002200692 253
324 3300031995 Ga0307409_100242183 Ga0307409_1002421832 253
325 3300032002 Ga0307416_100008910 Ga0307416_1000089103 253
326 3300032002 Ga0307416_100010351 Ga0307416_1000103517 253
327 3300032002 Ga0307416_100010961 Ga0307416_1000109614 253
328 3300032002 Ga0307416_100495143 Ga0307416_1004951432 253
329 3300032004 Ga0307414_10445988 Ga0307414_104459882 253
330 3300032005 Ga0307411_10006600 Ga0307411_100066003 253
331 3300032005 Ga0307411_10111605 Ga0307411_101116052 253
332 3300032005 Ga0307411_10185180 Ga0307411_101851802 253
333 3300032126 Ga0307415_100004206 Ga0307415_1000042068 253
334 3300032126 Ga0307415_100005648 Ga0307415_1000056485 253
335 3300032126 Ga0307415_100007567 Ga0307415_1000075673 253
336 3300032126 Ga0307415_100013045 Ga0307415_1000130454 253
337 3300032126 Ga0307415_100253545 Ga0307415_1002535452 253
338 3300032139 Ga0316580_10059742 Ga0316580_100597422 253
339 3300035398 Ga0316574_0000590 Ga0316574_0000590_7710_8471 253
340 3300035398 Ga0316574_0080599 Ga0316574_0080599_237_998 253
341 3300035398 Ga0316574_0185225 Ga0316574_0185225_550_1311 253
342 3300036647 Ga0316582_0151835 Ga0316582_0151835_187_948 253
343 3300036647 Ga0316582_0328911 Ga0316582_0328911_62_823 253
344 3300036712 Ga0316584_0000239 Ga0316584_0000239_22831_23592 253
345 3300036712 Ga0316584_0012516 Ga0316584_0012516_4043_4804 253
346 3300036712 Ga0316584_0045996 Ga0316584_0045996_1079_1840 253
347 3300036712 Ga0316584_0408351 Ga0316584_0408351_161_922 253
348 3300037312 Ga0395899_0010482 Ga0395899_0010482_888_1649 253
349 3300037312 Ga0395899_0233695 Ga0395899_0233695_132_908 253
350 3300037418 Ga0395900_0224816 Ga0395900_0224816_208_984 253
351 3300037466 Ga0395898_0072331 Ga0395898_0072331_1967_2743 253
352 3300037471 Ga0395905_0289329 Ga0395905_0289329_210_986 253
353 3300038443 Ga0395901_0317018 Ga0395901_0317018_675_1451 253
354 3300038443 Ga0395901_0467780 Ga0395901_0467780_256_1032 253
355 3300038735 Ga0400485_04221 Ga0400485_04221_43356_44117 253
356 3300038742 Ga0400486_29215 Ga0400486_29215_31992_32753 253
357 3300042005 Ga0439448_0087018 Ga0439448_0087018_85_861 253
358 3300042006 Ga0439432_017990 Ga0439432_017990_1534_2295 253
359 3300042008 Ga0439450_000083 Ga0439450_000083_4495_5271 253
360 3300042008 Ga0439450_016147 Ga0439450_016147_362_1138 253
361 3300042011 Ga0439454_006273 Ga0439454_006273_654_1430 253
362 3300042012 Ga0439455_0006749 Ga0439455_0006749_993_1769 253
363 3300042014 Ga0439457_012504 Ga0439457_012504_822_1583 253
364 3300042014 Ga0439457_028728 Ga0439457_028728_420_1181 253
365 3300042016 Ga0439463_000209 Ga0439463_000209_871_1647 253
366 3300042016 Ga0439463_015598 Ga0439463_015598_865_1641 253
367 3300042120 Ga0450917_005623 Ga0450917_005623_77_853 253
368 3300042126 Ga0450888_003486 Ga0450888_003486_755_1531 253
369 3300042142 Ga0450905_002810 Ga0450905_002810_736_1512 253
370 3300042157 Ga0439458_0054295 Ga0439458_0054295_154_930 253
371 3300042437 Ga0439444_0001594 Ga0439444_0001594_923_1699 253
372 3300042439 Ga0439464_0009244 Ga0439464_0009244_657_1433 253
373 3300042461 Ga0439460_0001259 Ga0439460_0001259_4376_5152 253
374 3300042530 Ga0450916_000488 Ga0450916_000488_195_971 253
375 3300042993 Ga0439440_0000290 Ga0439440_0000290_4059_4835 253
376 3300042993 Ga0439440_0014636 Ga0439440_0014636_625_1401 253
377 3300044693 Ga0466961_0073745 Ga0466961_0073745_858_1625 253
378 3300044693 Ga0466961_0178995 Ga0466961_0178995_514_1281 253
379 3300044842 Ga0466957_0038169 Ga0466957_0038169_1011_1778 253
380 3300044901 Ga0466960_0029524 Ga0466960_0029524_897_1664 253
381 3300045976 Ga0466967_0093943 Ga0466967_0093943_139_900 253
382 3300046461 Ga0495641_0041890 Ga0495641_0041890_798_1568 253
383 3300046491 Ga0495584_0058973 Ga0495584_0058973_1084_1860 253
384 3300046501 Ga0495607_0136351 Ga0495607_0136351_112_888 253
385 3300046523 Ga0495644_0046394 Ga0495644_0046394_710_1486 253
386 3300046537 Ga0495598_0073100 Ga0495598_0073100_105_881 253
387 3300046539 Ga0495621_0113821 Ga0495621_0113821_70_846 253
388 3300046559 Ga0495667_0281409 Ga0495667_0281409_259_1020 253
389 3300046615 Ga0495656_0025302 Ga0495656_0025302_613_1389 253
390 3300046683 Ga0495658_0303899 Ga0495658_0303899_61_822 253
391 3300046692 Ga0495671_0067940 Ga0495671_0067940_60_836 253
392 3300047321 Ga0495676_0043903 Ga0495676_0043903_1065_1826 253
393 3300048903 Ga0496100_0068871 Ga0496100_0068871_209_970 253
394 3300048904 Ga0496101_0404010 Ga0496101_0404010_146_907 253
395 3300048907 Ga0496104_0110681 Ga0496104_0110681_1502_2272 253
396 3300048911 Ga0496108_0055617 Ga0496108_0055617_690_1460 253
397 3300048911 Ga0496108_0288305 Ga0496108_0288305_128_889 253
398 3300048912 Ga0496109_0039577 Ga0496109_0039577_1050_1820 253
399 3300048913 Ga0496110_0083115 Ga0496110_0083115_1663_2433 253
400 3300048913 Ga0496110_0239915 Ga0496110_0239915_514_1275 253
401 3300048914 Ga0496111_0040524 Ga0496111_0040524_18_779 253
402 3300048914 Ga0496111_0100081 Ga0496111_0100081_389_1159 253
403 3300048917 Ga0496114_0287603 Ga0496114_0287603_323_1093 253
404 3300048917 Ga0496114_0304826 Ga0496114_0304826_416_1177 253
405 3300048920 Ga0496117_0029969 Ga0496117_0029969_1254_2015 253
406 3300048921 Ga0496118_0152418 Ga0496118_0152418_66_827 253
407 3300048922 Ga0496119_0034913 Ga0496119_0034913_1379_2140 253
408 3300048925 Ga0496122_0003466 Ga0496122_0003466_10957_11718 253
409 3300048927 Ga0496124_0050516 Ga0496124_0050516_1762_2523 253
410 3300048928 Ga0496125_0000015 Ga0496125_0000015_192731_193492 253
411 3300049568 Ga0501031_0003225 Ga0501031_0003225_2272_3048 253
412 3300049569 Ga0501032_0010375 Ga0501032_0010375_1519_2295 253
413 3300049570 Ga0501033_0007950 Ga0501033_0007950_320_1096 253
414 3300049572 Ga0501036_0003680 Ga0501036_0003680_10427_11203 253
415 3300049572 Ga0501036_0012468 Ga0501036_0012468_5331_6107 253
416 3300049573 Ga0501037_0006501 Ga0501037_0006501_2528_3304 253
417 3300049574 Ga0501038_0000456 Ga0501038_0000456_10037_10813 253
418 3300049575 Ga0501039_0002751 Ga0501039_0002751_11443_12219 253
419 3300049575 Ga0501039_0003077 Ga0501039_0003077_1394_2170 253
420 3300049576 Ga0501040_0002301 Ga0501040_0002301_1068_1844 253
421 3300049576 Ga0501040_0002316 Ga0501040_0002316_10516_11292 253
422 3300049577 Ga0501041_0000438 Ga0501041_0000438_6306_7082 253
423 3300049577 Ga0501041_0026479 Ga0501041_0026479_2341_3117 253
424 3300049578 Ga0501042_0001107 Ga0501042_0001107_10576_11352 253
425 3300049578 Ga0501042_0003246 Ga0501042_0003246_1411_2187 253
426 3300049579 Ga0501043_0018068 Ga0501043_0018068_3816_4592 253
427 3300049580 Ga0501046_0000721 Ga0501046_0000721_7282_8058 253
428 3300049580 Ga0501046_0053494 Ga0501046_0053494_910_1686 253
429 3300049582 Ga0501048_0000920 Ga0501048_0000920_13547_14323 253
430 3300049582 Ga0501048_0003693 Ga0501048_0003693_1068_1844 253
431 3300049583 Ga0501067_0169876 Ga0501067_0169876_364_1140 253
432 3300049585 Ga0501069_0087714 Ga0501069_0087714_235_1011 253
433 3300049586 Ga0501070_0115889 Ga0501070_0115889_876_1652 253
434 3300049586 Ga0501070_0220925 Ga0501070_0220925_227_1003 253
435 3300049587 Ga0501071_0012541 Ga0501071_0012541_933_1709 253
436 3300049587 Ga0501071_0057219 Ga0501071_0057219_1060_1836 253
437 3300049588 Ga0501072_0001219 Ga0501072_0001219_8082_8858 253
438 3300049588 Ga0501072_0042617 Ga0501072_0042617_2371_3147 253
439 3300049589 Ga0501073_0092822 Ga0501073_0092822_1054_1830 253
440 3300049589 Ga0501073_0240709 Ga0501073_0240709_256_1032 253
441 3300049590 Ga0501074_0005515 Ga0501074_0005515_3620_4396 253
442 3300049590 Ga0501074_0080750 Ga0501074_0080750_622_1398 253
443 3300049591 Ga0501075_0001417 Ga0501075_0001417_4846_5622 253
444 3300049592 Ga0501076_0005339 Ga0501076_0005339_7551_8327 253
445 3300049592 Ga0501076_0025085 Ga0501076_0025085_939_1715 253
446 3300049593 Ga0501077_0000877 Ga0501077_0000877_10407_11183 253
447 3300049593 Ga0501077_0048762 Ga0501077_0048762_989_1765 253
448 3300049741 Ga0501079_0001493 Ga0501079_0001493_1059_1835 253
449 3300049742 Ga0501080_0163873 Ga0501080_0163873_880_1656 253
450 3300049744 Ga0501083_0046450 Ga0501083_0046450_719_1495 253
451 3300049822 Ga0501035_0059019 Ga0501035_0059019_1037_1813 253
452 3300049823 Ga0501044_0007319 Ga0501044_0007319_10193_10969 253
453 3300049824 Ga0501045_0002730 Ga0501045_0002730_9833_10609 253
454 3300050510 nmdc:mga06r32_435850_c1 nmdc:mga06r32_435850_c1_487_1263 253
455 3300050515 nmdc:mga0a205_195310_c1 nmdc:mga0a205_195310_c1_882_1658 253
456 3300054114 Ga0501084_0003502 Ga0501084_0003502_10931_11707 253
457 3300054114 Ga0501084_0007608 Ga0501084_0007608_722_1498 253
458 3300059424 Ga0590075_043158 Ga0590075_043158_37_813 253
459 3300059424 Ga0590075_044096 Ga0590075_044096_136_912 253
460 3300059426 Ga0590077_002079 Ga0590077_002079_78_854 253
461 3300060353 Ga0501082_0000550 Ga0501082_0000550_10603_11379 253
462 3300060353 Ga0501082_0048486 Ga0501082_0048486_1046_1822 253
463 3300061719 Ga0466962_0021546 Ga0466962_0021546_2073_2840 253
464 3300061734 Ga0530510_0001653 Ga0530510_0001653_10407_11183 253
465 iso_pu_bacteria 2811994874 2812331620 253
466 3300005327 Ga0070658_10091178 Ga0070658_100911781 254
467 3300005530 Ga0070679_100474124 Ga0070679_1004741241 254
468 3300009098 Ga0105245_10348850 Ga0105245_103488501 254
469 3300025909 Ga0207705_10257717 Ga0207705_102577173 254
470 3300025921 Ga0207652_10070296 Ga0207652_100702961 254
471 3300038443 Ga0395901_0538061 Ga0395901_0538061_223_990 254
472 3300041453 Ga0451797_1210202 Ga0451797_1210202_155_922 254
473 3300048909 Ga0496106_0229749 Ga0496106_0229749_332_1096 254
474 3300049572 Ga0501036_0053829 Ga0501036_0053829_1704_2471 254
475 3300049574 Ga0501038_0003592 Ga0501038_0003592_7218_7985 254
476 3300049580 Ga0501046_0050259 Ga0501046_0050259_1017_1784 254
477 3300049581 Ga0501047_0013180 Ga0501047_0013180_2491_3258 254
478 3300049583 Ga0501067_0020313 Ga0501067_0020313_1785_2552 254
479 3300049590 Ga0501074_0190107 Ga0501074_0190107_613_1380 254
480 3300049744 Ga0501083_0010423 Ga0501083_0010423_2851_3618 254
481 3300049822 Ga0501035_0025283 Ga0501035_0025283_1663_2430 254
482 3300060353 Ga0501082_0006458 Ga0501082_0006458_5324_6091 254
483 iso_pu_bacteria 2643221561 2643824012 254
484 iso_pu_bacteria 2643221696 2644533288 254
485 iso_pu_bacteria 2855386786 2855389415 254
486 iso_pu_bacteria 2857481737 2857484163 254
487 3300048913 Ga0496110_0207935 Ga0496110_0207935_803_1570 255
488 iso_pu_bacteria 2984576629 2984579731 255
489 iso_pu_bacteria 2990256926 2990257337 255
490 3300050492 nmdc:mga0yw44_246264_c1 nmdc:mga0yw44_246264_c1_190_960 256
491 3300050492 nmdc:mga0yw44_92517_c1 nmdc:mga0yw44_92517_c1_832_1602 256
492 3300005981 Ga0081538_10015454 Ga0081538_100154545 257
493 3300006038 Ga0075365_10051936 Ga0075365_100519363 257
494 3300006038 Ga0075365_10098781 Ga0075365_100987812 257
495 3300006038 Ga0075365_10103746 Ga0075365_101037462 257
496 3300006042 Ga0075368_10009626 Ga0075368_100096263 257
497 3300006042 Ga0075368_10045500 Ga0075368_100455002 257
498 3300006048 Ga0075363_100016401 Ga0075363_1000164012 257
499 3300006048 Ga0075363_100021849 Ga0075363_1000218492 257
500 3300006048 Ga0075363_100031776 Ga0075363_1000317762 257
501 3300006051 Ga0075364_10008434 Ga0075364_100084342 257
502 3300006177 Ga0075362_10001895 Ga0075362_100018955 257
503 3300006178 Ga0075367_10056006 Ga0075367_100560062 257
504 3300006178 Ga0075367_10073487 Ga0075367_100734872 257
505 3300006178 Ga0075367_10166369 Ga0075367_101663692 257
506 3300006353 Ga0075370_10006757 Ga0075370_100067573 257
507 3300006353 Ga0075370_10019564 Ga0075370_100195642 257
508 3300027866 Ga0209813_10008237 Ga0209813_100082372 257
509 3300027866 Ga0209813_10009163 Ga0209813_100091632 257
510 3300038443 Ga0395901_0293332 Ga0395901_0293332_183_956 257
511 3300044658 Ga0466972_0097430 Ga0466972_0097430_573_1346 257
512 3300044683 Ga0466965_0012831 Ga0466965_0012831_1462_2235 257
513 3300044693 Ga0466961_0058546 Ga0466961_0058546_1363_2136 257
514 3300044735 Ga0466968_0192689 Ga0466968_0192689_91_864 257
515 3300044765 Ga0466970_0216536 Ga0466970_0216536_264_1037 257
516 3300044901 Ga0466960_0017249 Ga0466960_0017249_1058_1831 257
517 3300044901 Ga0466960_0032392 Ga0466960_0032392_357_1130 257
518 3300045976 Ga0466967_0020018 Ga0466967_0020018_2679_3491 257
519 3300045976 Ga0466967_0331707 Ga0466967_0331707_80_853 257
520 3300049578 Ga0501042_0055188 Ga0501042_0055188_28_801 257
521 3300049578 Ga0501042_0087028 Ga0501042_0087028_1451_2224 257
522 3300049581 Ga0501047_0000236 Ga0501047_0000236_29100_29894 257
523 3300049583 Ga0501067_0079975 Ga0501067_0079975_902_1717 257
524 3300049587 Ga0501071_0316691 Ga0501071_0316691_139_954 257
525 3300049590 Ga0501074_0055852 Ga0501074_0055852_1247_2020 257
526 3300049590 Ga0501074_0064035 Ga0501074_0064035_613_1386 257
527 3300049592 Ga0501076_0018992 Ga0501076_0018992_1779_2552 257
528 3300049593 Ga0501077_0340116 Ga0501077_0340116_47_820 257
529 3300049741 Ga0501079_0052977 Ga0501079_0052977_1747_2520 257
530 3300049741 Ga0501079_0089339 Ga0501079_0089339_1576_2349 257
531 3300049743 Ga0501081_0226335 Ga0501081_0226335_198_1013 257
532 3300049822 Ga0501035_0080543 Ga0501035_0080543_1078_1851 257
533 3300049824 Ga0501045_0189286 Ga0501045_0189286_602_1417 257
534 3300050490 nmdc:mga03n38_1401_c1 nmdc:mga03n38_1401_c1_5493_6266 257
535 3300050491 nmdc:mga00v17_109942_c1 nmdc:mga00v17_109942_c1_782_1555 257
536 3300050491 nmdc:mga00v17_146187_c1 nmdc:mga00v17_146187_c1_565_1338 257
537 3300050491 nmdc:mga00v17_18632_c1 nmdc:mga00v17_18632_c1_294_1067 257
538 3300050492 nmdc:mga0yw44_24694_c1 nmdc:mga0yw44_24694_c1_1052_1825 257
539 3300050492 nmdc:mga0yw44_277034_c1 nmdc:mga0yw44_277034_c1_204_986 257
540 3300050492 nmdc:mga0yw44_35004_c1 nmdc:mga0yw44_35004_c1_1769_2542 257
541 3300050492 nmdc:mga0yw44_4727_c1 nmdc:mga0yw44_4727_c1_4717_5490 257
542 3300050494 nmdc:mga06z11_55509_c1 nmdc:mga06z11_55509_c1_626_1399 257
543 3300050494 nmdc:mga06z11_56935_c1 nmdc:mga06z11_56935_c1_132_905 257
544 3300050494 nmdc:mga06z11_62633_c1 nmdc:mga06z11_62633_c1_777_1550 257
545 3300050495 nmdc:mga04h51_13797_c1 nmdc:mga04h51_13797_c1_660_1433 257
546 3300050495 nmdc:mga04h51_6972_c1 nmdc:mga04h51_6972_c1_1344_2117 257
547 3300050496 nmdc:mga07m45_18291_c1 nmdc:mga07m45_18291_c1_1607_2380 257
548 3300054114 Ga0501084_0252134 Ga0501084_0252134_99_914 257
549 iso_pu_bacteria 2643221576 2643889960 257
550 iso_pu_bacteria 2643221590 2643959016 257
551 iso_pu_bacteria 2738541305 2738870483 257
552 3300000549 LJQas_1002189 LJQas_10021893 258
553 3300002075 JGI24738J21930_10010635 JGI24738J21930_100106351 258
554 3300005329 Ga0070683_100411581 Ga0070683_1004115811 258
555 3300005330 Ga0070690_100101642 Ga0070690_1001016422 258
556 3300005337 Ga0070682_100042536 Ga0070682_1000425363 258
557 3300005338 Ga0068868_100140853 Ga0068868_1001408532 258
558 3300005339 Ga0070660_100019819 Ga0070660_1000198192 258
559 3300005339 Ga0070660_100340625 Ga0070660_1003406251 258
560 3300005341 Ga0070691_10020570 Ga0070691_100205704 258
561 3300005345 Ga0070692_10011405 Ga0070692_100114052 258
562 3300005345 Ga0070692_10215938 Ga0070692_102159381 258
563 3300005354 Ga0070675_100084521 Ga0070675_1000845212 258
564 3300005356 Ga0070674_100006352 Ga0070674_1000063525 258
565 3300005366 Ga0070659_100013002 Ga0070659_1000130025 258
566 3300005366 Ga0070659_100158161 Ga0070659_1001581612 258
567 3300005435 Ga0070714_100059948 Ga0070714_1000599482 258
568 3300005438 Ga0070701_10002932 Ga0070701_100029325 258
569 3300005441 Ga0070700_100012171 Ga0070700_1000121712 258
570 3300005459 Ga0068867_100007476 Ga0068867_1000074763 258
571 3300005466 Ga0070685_10004791 Ga0070685_100047913 258
572 3300005471 Ga0070698_100002013 Ga0070698_1000020133 258
573 3300005535 Ga0070684_100295550 Ga0070684_1002955502 258
574 3300005543 Ga0070672_100008593 Ga0070672_1000085933 258
575 3300005547 Ga0070693_100320887 Ga0070693_1003208871 258
576 3300005564 Ga0070664_100370958 Ga0070664_1003709582 258
577 3300005577 Ga0068857_100481591 Ga0068857_1004815911 258
578 3300005616 Ga0068852_100012448 Ga0068852_1000124485 258
579 3300005719 Ga0068861_100014873 Ga0068861_1000148733 258
580 3300005719 Ga0068861_100377907 Ga0068861_1003779072 258
581 3300005937 Ga0081455_10088495 Ga0081455_100884953 258
582 3300005985 Ga0081539_10094888 Ga0081539_100948882 258
583 3300006058 Ga0075432_10016682 Ga0075432_100166823 258
584 3300006846 Ga0075430_100002720 Ga0075430_1000027209 258
585 3300006852 Ga0075433_10065962 Ga0075433_100659623 258
586 3300006871 Ga0075434_100048569 Ga0075434_1000485695 258
587 3300006880 Ga0075429_100043597 Ga0075429_1000435972 258
588 3300006881 Ga0068865_100001987 Ga0068865_10000198713 258
589 3300009147 Ga0114129_10105667 Ga0114129_101056672 258
590 3300009148 Ga0105243_10005795 Ga0105243_100057958 258
591 3300009177 Ga0105248_10013985 Ga0105248_100139856 258
592 3300009545 Ga0105237_10069261 Ga0105237_100692612 258
593 3300010375 Ga0105239_10026886 Ga0105239_100268863 258
594 3300010375 Ga0105239_10366285 Ga0105239_103662851 258
595 3300013307 Ga0157372_10194758 Ga0157372_101947582 258
596 3300013307 Ga0157372_10350539 Ga0157372_103505392 258
597 3300014325 Ga0163163_10062499 Ga0163163_100624994 258
598 3300014326 Ga0157380_10453591 Ga0157380_104535911 258
599 3300014745 Ga0157377_10003538 Ga0157377_100035386 258
600 3300020082 Ga0206353_11164138 Ga0206353_111641382 258
601 3300025908 Ga0207643_10001431 Ga0207643_100014314 258
602 3300025909 Ga0207705_10542902 Ga0207705_105429021 258
603 3300025914 Ga0207671_10153124 Ga0207671_101531242 258
604 3300025926 Ga0207659_10033133 Ga0207659_100331332 258
605 3300025929 Ga0207664_10058004 Ga0207664_100580042 258
606 3300025932 Ga0207690_10056742 Ga0207690_100567422 258
607 3300025932 Ga0207690_10079345 Ga0207690_100793452 258
608 3300025933 Ga0207706_10419015 Ga0207706_104190151 258
609 3300025935 Ga0207709_10161812 Ga0207709_101618122 258
610 3300025937 Ga0207669_10030136 Ga0207669_100301362 258
611 3300025938 Ga0207704_10145864 Ga0207704_101458642 258
612 3300025940 Ga0207691_10002825 Ga0207691_1000282516 258
613 3300025944 Ga0207661_10265492 Ga0207661_102654922 258
614 3300025944 Ga0207661_10445981 Ga0207661_104459812 258
615 3300025944 Ga0207661_10642024 Ga0207661_106420241 258
616 3300025949 Ga0207667_10492430 Ga0207667_104924302 258
617 3300025972 Ga0207668_10066969 Ga0207668_100669692 258
618 3300025981 Ga0207640_10169122 Ga0207640_101691222 258
619 3300026023 Ga0207677_10090687 Ga0207677_100906872 258
620 3300026075 Ga0207708_10001532 Ga0207708_100015325 258
621 3300026089 Ga0207648_10002911 Ga0207648_100029113 258
622 3300026095 Ga0207676_10120967 Ga0207676_101209672 258
623 3300026116 Ga0207674_10183392 Ga0207674_101833921 258
624 3300026118 Ga0207675_100378937 Ga0207675_1003789371 258
625 3300026121 Ga0207683_10046075 Ga0207683_100460753 258
626 3300026121 Ga0207683_10199258 Ga0207683_101992582 258
627 3300027907 Ga0207428_10000433 Ga0207428_1000043333 258
628 3300031731 Ga0307405_10125675 Ga0307405_101256752 258
629 3300031903 Ga0307407_10036769 Ga0307407_100367692 258
630 3300031911 Ga0307412_10196345 Ga0307412_101963452 258
631 3300031995 Ga0307409_100009275 Ga0307409_1000092752 258
632 3300031995 Ga0307409_100654302 Ga0307409_1006543022 258
633 3300032002 Ga0307416_100002366 Ga0307416_1000023664 258
634 3300032002 Ga0307416_100268103 Ga0307416_1002681032 258
635 3300032005 Ga0307411_10683644 Ga0307411_106836441 258
636 3300032126 Ga0307415_100000133 Ga0307415_1000001338 258
637 3300032126 Ga0307415_100015987 Ga0307415_1000159872 258
638 3300037312 Ga0395899_0100863 Ga0395899_0100863_372_1148 258
639 3300037466 Ga0395898_0079593 Ga0395898_0079593_829_1605 258
640 3300038443 Ga0395901_0180146 Ga0395901_0180146_1425_2201 258
641 3300041404 Ga0439436_0070438 Ga0439436_0070438_110_886 258
642 3300041405 Ga0439438_045483 Ga0439438_045483_11_787 258
643 3300041411 Ga0439466_0058509 Ga0439466_0058509_212_988 258
644 3300041413 Ga0439465_0057245 Ga0439465_0057245_422_1198 258
645 3300041997 Ga0439431_0000830 Ga0439431_0000830_2353_3129 258
646 3300042002 Ga0439442_015704 Ga0439442_015704_325_1101 258
647 3300042004 Ga0439445_0005878 Ga0439445_0005878_1690_2466 258
648 3300042435 Ga0439434_0012312 Ga0439434_0012312_1698_2474 258
649 3300044658 Ga0466972_0009071 Ga0466972_0009071_2594_3403 258
650 3300044658 Ga0466972_0021964 Ga0466972_0021964_1654_2430 258
651 3300044658 Ga0466972_0095696 Ga0466972_0095696_207_983 258
652 3300044683 Ga0466965_0021164 Ga0466965_0021164_479_1255 258
653 3300044683 Ga0466965_0022613 Ga0466965_0022613_1511_2389 258
654 3300044684 Ga0466966_0083137 Ga0466966_0083137_703_1479 258
655 3300044684 Ga0466966_0250380 Ga0466966_0250380_199_993 258
656 3300044693 Ga0466961_0024622 Ga0466961_0024622_1892_2719 258
657 3300044693 Ga0466961_0053405 Ga0466961_0053405_615_1493 258
658 3300044694 Ga0466963_0057082 Ga0466963_0057082_493_1269 258
659 3300044694 Ga0466963_0215411 Ga0466963_0215411_87_863 258
660 3300044694 Ga0466963_0280046 Ga0466963_0280046_164_973 258
661 3300044706 Ga0466964_0008479 Ga0466964_0008479_2431_3309 258
662 3300044706 Ga0466964_0102654 Ga0466964_0102654_446_1222 258
663 3300044719 Ga0466971_0003441 Ga0466971_0003441_4837_5715 258
664 3300044735 Ga0466968_0039768 Ga0466968_0039768_632_1408 258
665 3300044765 Ga0466970_0009457 Ga0466970_0009457_3030_3839 258
666 3300044765 Ga0466970_0043911 Ga0466970_0043911_179_955 258
667 3300044765 Ga0466970_0290141 Ga0466970_0290141_12_845 258
668 3300044842 Ga0466957_0005119 Ga0466957_0005119_4034_4912 258
669 3300044901 Ga0466960_0015508 Ga0466960_0015508_635_1468 258
670 3300044901 Ga0466960_0026629 Ga0466960_0026629_675_1451 258
671 3300044901 Ga0466960_0053248 Ga0466960_0053248_439_1224 258
672 3300044901 Ga0466960_0087577 Ga0466960_0087577_754_1563 258
673 3300044901 Ga0466960_0149563 Ga0466960_0149563_51_827 258
674 3300044901 Ga0466960_0206025 Ga0466960_0206025_15_791 258
675 3300045049 Ga0466959_0194724 Ga0466959_0194724_554_1381 258
676 3300045836 Ga0466958_0017261 Ga0466958_0017261_1325_2203 258
677 3300045976 Ga0466967_0018178 Ga0466967_0018178_767_1576 258
678 3300045976 Ga0466967_0028283 Ga0466967_0028283_1452_2228 258
679 3300045976 Ga0466967_0055151 Ga0466967_0055151_1755_2531 258
680 3300045976 Ga0466967_0123847 Ga0466967_0123847_530_1306 258
681 3300048905 Ga0496102_0054566 Ga0496102_0054566_912_1697 258
682 3300048906 Ga0496103_0026509 Ga0496103_0026509_1692_2477 258
683 3300048907 Ga0496104_0086041 Ga0496104_0086041_672_1457 258
684 3300048909 Ga0496106_0000592 Ga0496106_0000592_2072_2857 258
685 3300048909 Ga0496106_0434975 Ga0496106_0434975_227_1003 258
686 3300048910 Ga0496107_0037764 Ga0496107_0037764_2083_2868 258
687 3300048911 Ga0496108_0058637 Ga0496108_0058637_1557_2342 258
688 3300048912 Ga0496109_0032171 Ga0496109_0032171_2587_3417 258
689 3300048913 Ga0496110_0034423 Ga0496110_0034423_3300_4085 258
690 3300048913 Ga0496110_0060048 Ga0496110_0060048_117_905 258
691 3300048914 Ga0496111_0187020 Ga0496111_0187020_513_1340 258
692 3300048915 Ga0496112_0475557 Ga0496112_0475557_135_920 258
693 3300048916 Ga0496113_0077586 Ga0496113_0077586_1049_1834 258
694 3300048917 Ga0496114_0177977 Ga0496114_0177977_512_1369 258
695 3300049568 Ga0501031_0170806 Ga0501031_0170806_216_992 258
696 3300049568 Ga0501031_0199473 Ga0501031_0199473_261_1049 258
697 3300049569 Ga0501032_0026571 Ga0501032_0026571_2007_2783 258
698 3300049570 Ga0501033_0000653 Ga0501033_0000653_13907_14683 258
699 3300049571 Ga0501034_0033211 Ga0501034_0033211_2687_3463 258
700 3300049571 Ga0501034_0046532 Ga0501034_0046532_2446_3222 258
701 3300049571 Ga0501034_0247426 Ga0501034_0247426_115_891 258
702 3300049572 Ga0501036_0037661 Ga0501036_0037661_837_1613 258
703 3300049572 Ga0501036_0041193 Ga0501036_0041193_2170_2946 258
704 3300049573 Ga0501037_0018913 Ga0501037_0018913_1441_2217 258
705 3300049574 Ga0501038_0095345 Ga0501038_0095345_887_1663 258
706 3300049574 Ga0501038_0182993 Ga0501038_0182993_375_1202 258
707 3300049574 Ga0501038_0358796 Ga0501038_0358796_21_797 258
708 3300049575 Ga0501039_0025643 Ga0501039_0025643_1988_2764 258
709 3300049575 Ga0501039_0532356 Ga0501039_0532356_112_888 258
710 3300049578 Ga0501042_0042313 Ga0501042_0042313_747_1523 258
711 3300049579 Ga0501043_0004024 Ga0501043_0004024_4583_5359 258
712 3300049579 Ga0501043_0221078 Ga0501043_0221078_165_941 258
713 3300049579 Ga0501043_0251411 Ga0501043_0251411_277_1053 258
714 3300049580 Ga0501046_0001166 Ga0501046_0001166_3201_3977 258
715 3300049580 Ga0501046_0017196 Ga0501046_0017196_838_1614 258
716 3300049581 Ga0501047_0089865 Ga0501047_0089865_434_1210 258
717 3300049581 Ga0501047_0107535 Ga0501047_0107535_1022_1798 258
718 3300049582 Ga0501048_0022061 Ga0501048_0022061_3232_4008 258
719 3300049582 Ga0501048_0423204 Ga0501048_0423204_70_846 258
720 3300049583 Ga0501067_0013732 Ga0501067_0013732_2730_3506 258
721 3300049583 Ga0501067_0019236 Ga0501067_0019236_2808_3593 258
722 3300049586 Ga0501070_0008079 Ga0501070_0008079_7122_7898 258
723 3300049586 Ga0501070_0037862 Ga0501070_0037862_1302_2078 258
724 3300049588 Ga0501072_0186820 Ga0501072_0186820_737_1564 258
725 3300049589 Ga0501073_0196955 Ga0501073_0196955_116_892 258
726 3300049822 Ga0501035_0121174 Ga0501035_0121174_951_1727 258
727 3300049823 Ga0501044_0020945 Ga0501044_0020945_3576_4352 258
728 3300049823 Ga0501044_0306110 Ga0501044_0306110_460_1236 258
729 3300049824 Ga0501045_0392250 Ga0501045_0392250_159_986 258
730 3300050491 nmdc:mga00v17_29950_c1 nmdc:mga00v17_29950_c1_112_888 258
731 3300050507 nmdc:mga05p37_7716_c1 nmdc:mga05p37_7716_c1_7967_8770 258
732 3300050508 nmdc:mga09592_19936_c1 nmdc:mga09592_19936_c1_2105_2908 258
733 3300050509 nmdc:mga0qj67_19945_c1 nmdc:mga0qj67_19945_c1_1071_1874 258
734 3300050510 nmdc:mga06r32_456209_c1 nmdc:mga06r32_456209_c1_241_1044 258
735 3300050511 nmdc:mga08y16_116701_c1 nmdc:mga08y16_116701_c1_100_978 258
736 3300050511 nmdc:mga08y16_25926_c1 nmdc:mga08y16_25926_c1_326_1129 258
737 3300050512 nmdc:mga0n895_23064_c1 nmdc:mga0n895_23064_c1_1641_2444 258
738 3300050513 nmdc:mga0rr50_453337_c1 nmdc:mga0rr50_453337_c1_269_1054 258
739 3300050515 nmdc:mga0a205_117672_c1 nmdc:mga0a205_117672_c1_1586_2389 258
740 3300053077 Ga0495601_0043276 Ga0495601_0043276_1546_2334 258
741 3300053078 Ga0495612_0052657 Ga0495612_0052657_722_1510 258
742 3300061719 Ga0466962_0003384 Ga0466962_0003384_2845_3723 258
743 3300061734 Ga0530510_0343419 Ga0530510_0343419_132_908 258

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01255

Prenyltransf

Putative undecaprenyl diphosphate synthase

70

291

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5hxo-assembly1.cif.gz_A crystal structure of z,z-farnesyl diphosphate synthase with d71m, e75a and h103y mutants 0.8823 29 252
5hxn-assembly1.cif.gz_A-2 crystal structure of z,z-farnesyl diphosphate synthase (d71m and e75a mutants) from the wild tomato solanum habrochaites 0.8806 29 253
5hxo-assembly1.cif.gz_A crystal structure of z,z-farnesyl diphosphate synthase with d71m, e75a and h103y mutants 0.8786 29 252
5hxp-assembly1.cif.gz_A crystal structure of z,z-farnesyl diphosphate synthase (d71m, e75a and h103y mutants) complexed with ipp 0.8782 24 257
5ygk-assembly1.cif.gz_A crystal structure of a synthase from streptomyces sp. cl190 with dmaspp 0.8765 33 249
ID Description Score Start End Superfamily
5hxoA00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.8823 29 252 3.40.1180.10
5hxoA00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.8786 29 252 3.40.1180.10
af_Q58767_31_280_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.8609 14 258 3.40.1180.10
5hc7A00 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.858 27 252 3.40.1180.10
af_K7KA63_68_310_3.40.1180.10 Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like 0.8578 24 257 3.40.1180.10
ID Description Score Start End GO Terms
AF-A0A6G3X3Y9-F1-model_v4 Isoprenyl transferase 0.9805 75 151 GO:0005886
GO:0016094
GO:0033850
GO:0045547
AF-A0A202DGC7-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase 0.9493 29 155 GO:0016094
GO:0045547
AF-A0A524KN88-F1-model_v4 Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) 0.9475 29 155 GO:0008834
GO:0016094
GO:0045547
AF-A0A2S9REF4-F1-model_v4 deleted 0.9359 24 156
AF-A0A6G3X3Y9-F1-model_v4 Isoprenyl transferase 0.9329 75 151 GO:0005886
GO:0016094
GO:0033850
GO:0045547

Feature Viewer

pLDDT pTM Quality
90.66 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map