F478700
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 743 | 337 | 715 | 256 |
Family's Representative Sequence
| Representative Sequence | 3300044683|Ga0466965_0022613|Ga0466965_0022613_1511_2389 |
| Length | 292 |
| Sequence | MGTTYGTVGSNRASGGARWSRTQMGTIDDVPDRKRVDWKRAARRVLYPAYEARVVRRLPPDRIPQHIGVMLDGNRRWARAVGADTAHGHRAGAANIEPLLGWCEEVGVEVVTLWLLSTDNLNRPEQELDELLTIIVEAVDSLALQGRWRLHPVGALDLLPDEVTARLKAAEEATTDVDGLLVNVAVGYGGRREIADAVRSLLQEKAGSGMTLEELAETIDVDHIAEHLYTRGQPDPDLVIRTSGEQRLGGFLLWQSAQSEFYFCEAYWPDFRRVDFLRAVRAYAQRERRFGS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221561 | Nocardioides sp. Root151 | Isolate | Unclassified |
| 2 | 2643221576 | Nocardioides sp. Root614 | Isolate | Unclassified |
| 3 | 2643221590 | Nocardioides sp. Root682 | Isolate | Unclassified |
| 4 | 2643221615 | Nocardioides sp. Root224 | Isolate | Unclassified |
| 5 | 2643221617 | Nocardioides sp. Root79 | Isolate | Unclassified |
| 6 | 2643221620 | Nocardioides sp. Root240 | Isolate | Unclassified |
| 7 | 2643221657 | Nocardioides sp. Root1257 | Isolate | Unclassified |
| 8 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 9 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 10 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 11 | 2643221696 | Nocardioides sp. Root140 | Isolate | Unclassified |
| 12 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 13 | 2675903060 | Nonomuraea wenchangensis CGMCC 4.5598 | Isolate | Rhizosphere |
| 14 | 2738541305 | Nocardioides sp. CF167 | Isolate | Unclassified |
| 15 | 2784132109 | Dermacoccus sp. DS28 SAI-028 | Isolate | Unclassified |
| 16 | 2811994874 | Nocardioides sp. SLBN-35 | Isolate | Unclassified |
| 17 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 18 | 2855386786 | Nocardioides ferulae EGI 63112 | Isolate | Unclassified |
| 19 | 2857481737 | Nocardioides sp. R-74106 | Isolate | Unclassified |
| 20 | 2873314349 | Sphaerisporangium siamense DSM 45784 | Isolate | Rhizosphere |
| 21 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 22 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 23 | 2891395885 | Microbispora catharanthi CR1-09 | Isolate | Unclassified |
| 24 | 2891554331 | Microbispora sp. CL1-1 | Isolate | Unclassified |
| 25 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 26 | 2984576629 | Nocardioides zeae SORGH_AS913 | Isolate | Aerial Root |
| 27 | 2990256926 | Nocardioides zeae SORGH_AS885 | Isolate | Aerial Root |
| 28 | 3001889506 | Janibacter sp. YIM B02568 | Isolate | Unclassified |
| 29 | 3300000549 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJQ_Illumina_Assembled | Metagenome | Rhizosphere |
| 30 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 31 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 32 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 33 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 34 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 35 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 41 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 43 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 61 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 64 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 65 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 75 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 79 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 80 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 88 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 89 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 90 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 91 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009993 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 121 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 162 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 163 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 167 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 168 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 175 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 176 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 177 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 178 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 179 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 180 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 181 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 182 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 183 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 184 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 185 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 186 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 187 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 188 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 189 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 190 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 191 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 192 | 3300038735 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 | Metagenome | Unclassified |
| 193 | 3300038742 | Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 | Metagenome | Unclassified |
| 194 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 195 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 196 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 197 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 198 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 199 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 200 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 201 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 202 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 203 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 204 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 205 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 206 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 207 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 208 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 209 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 210 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 211 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 212 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 213 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 214 | 3300042120 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_082316_2192 | Metagenome | Rhizosphere |
| 215 | 3300042126 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 | Metagenome | Rhizosphere |
| 216 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 217 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 218 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 219 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 220 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 221 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 222 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 223 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 224 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 225 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 226 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 227 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 228 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 229 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 230 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 231 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 232 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 233 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 234 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 235 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 236 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 237 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 238 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 257 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 258 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 259 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 260 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 261 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 262 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 263 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 264 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 265 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 266 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 267 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 268 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 269 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 270 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 271 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 272 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 273 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 274 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 275 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 276 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 277 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 278 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 279 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 280 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 281 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 282 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 283 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 284 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 285 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 286 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 287 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 291 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 292 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 293 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 296 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 297 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 298 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 299 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 300 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 301 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 302 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 303 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 304 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 305 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 306 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 307 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 308 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 309 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 310 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 311 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 312 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 313 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 314 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 315 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 316 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 317 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 318 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 319 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 320 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 321 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 322 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 323 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 324 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 325 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 328 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 329 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 330 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 331 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 332 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 333 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 334 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 335 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 336 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 337 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 95.96 |
| Metatranscriptomes | 0.27 |
| Isolates | 3.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 6.86 |
| Nodule | 0 |
| Rhizoplane | 6.73 |
| Rhizosphere | 80.89 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.25 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJQas_1002189 | 3300000549 | Bacteria | 2758 |
| 2 | JGI24741J21665_1019401 | 3300001915 | Bacteria | 1078 |
| 3 | JGI24738J21930_10010635 | 3300002075 | Bacteria | 2043 |
| 4 | JGI25406J46586_10039621 | 3300003203 | Bacteria | 1677 |
| 5 | rootH2_10117484 | 3300003320 | Bacteria | 2231 |
| 6 | JGI25407J50210_10025897 | 3300003373 | Bacteria | 1521 |
| 7 | JGI25407J50210_10060802 | 3300003373 | Bacteria | 949 |
| 8 | Ga0070658_10000469 | 3300005327 | Bacteria | 34916 |
| 9 | Ga0070658_10091178 | 3300005327 | Bacteria | 2512 |
| 10 | Ga0070683_100279893 | 3300005329 | Bacteria | 1587 |
| 11 | Ga0070683_100283284 | 3300005329 | Bacteria | 1577 |
| 12 | Ga0070683_100411581 | 3300005329 | Bacteria | 1290 |
| 13 | Ga0070690_100101642 | 3300005330 | Bacteria | 1907 |
| 14 | Ga0070680_100576975 | 3300005336 | Bacteria | 965 |
| 15 | Ga0070682_100042536 | 3300005337 | Bacteria | 2805 |
| 16 | Ga0070682_100276155 | 3300005337 | Bacteria | 1223 |
| 17 | Ga0068868_100140853 | 3300005338 | Bacteria | 1980 |
| 18 | Ga0070660_100019819 | 3300005339 | Bacteria | 4934 |
| 19 | Ga0070660_100256202 | 3300005339 | Bacteria | 1428 |
| 20 | Ga0070660_100340625 | 3300005339 | Bacteria | 1234 |
| 21 | Ga0070689_100633132 | 3300005340 | Bacteria | 929 |
| 22 | Ga0070691_10020570 | 3300005341 | Bacteria | 3049 |
| 23 | Ga0070692_10011405 | 3300005345 | Bacteria | 4078 |
| 24 | Ga0070692_10215938 | 3300005345 | Bacteria | 1131 |
| 25 | Ga0070668_100604435 | 3300005347 | Bacteria | 960 |
| 26 | Ga0070675_100084521 | 3300005354 | Bacteria | 2651 |
| 27 | Ga0070674_100006352 | 3300005356 | Bacteria | 6890 |
| 28 | Ga0070659_100013002 | 3300005366 | Bacteria | 6188 |
| 29 | Ga0070659_100158161 | 3300005366 | Bacteria | 1852 |
| 30 | Ga0070667_100023486 | 3300005367 | Bacteria | 5116 |
| 31 | Ga0070709_10001220 | 3300005434 | Bacteria | 14103 |
| 32 | Ga0070714_100059948 | 3300005435 | Bacteria | 3264 |
| 33 | Ga0070713_100021022 | 3300005436 | Bacteria | 5011 |
| 34 | Ga0070701_10002932 | 3300005438 | Bacteria | 6659 |
| 35 | Ga0070711_100324554 | 3300005439 | Bacteria | 1231 |
| 36 | Ga0070705_100264110 | 3300005440 | Bacteria | 1216 |
| 37 | Ga0070700_100012171 | 3300005441 | Bacteria | 4791 |
| 38 | Ga0070700_100064019 | 3300005441 | Bacteria | 2327 |
| 39 | Ga0070663_100034144 | 3300005455 | Bacteria | 3521 |
| 40 | Ga0070678_100032787 | 3300005456 | Bacteria | 3599 |
| 41 | Ga0070662_100004379 | 3300005457 | Bacteria | 8922 |
| 42 | Ga0068867_100007476 | 3300005459 | Bacteria | 7726 |
| 43 | Ga0068867_100321400 | 3300005459 | Bacteria | 1282 |
| 44 | Ga0070685_10004791 | 3300005466 | Bacteria | 6852 |
| 45 | Ga0070698_100002013 | 3300005471 | Bacteria | 22580 |
| 46 | Ga0070679_100474124 | 3300005530 | Bacteria | 1196 |
| 47 | Ga0070684_100083840 | 3300005535 | Bacteria | 2825 |
| 48 | Ga0070684_100295550 | 3300005535 | Bacteria | 1486 |
| 49 | Ga0070672_100008593 | 3300005543 | Bacteria | 6993 |
| 50 | Ga0070696_100004312 | 3300005546 | Bacteria | 9482 |
| 51 | Ga0070696_100184379 | 3300005546 | Bacteria | 1550 |
| 52 | Ga0070693_100320887 | 3300005547 | Bacteria | 1051 |
| 53 | Ga0070664_100370958 | 3300005564 | Bacteria | 1305 |
| 54 | Ga0068857_100481591 | 3300005577 | Bacteria | 1163 |
| 55 | Ga0068856_100039423 | 3300005614 | Bacteria | 4638 |
| 56 | Ga0070702_100126457 | 3300005615 | Bacteria | 1608 |
| 57 | Ga0068852_100012448 | 3300005616 | Bacteria | 6461 |
| 58 | Ga0068852_100261803 | 3300005616 | Bacteria | 1661 |
| 59 | Ga0068861_100006622 | 3300005719 | Bacteria | 7904 |
| 60 | Ga0068861_100014873 | 3300005719 | Bacteria | 5468 |
| 61 | Ga0068861_100192866 | 3300005719 | Bacteria | 1704 |
| 62 | Ga0068861_100377907 | 3300005719 | Bacteria | 1251 |
| 63 | Ga0081455_10065105 | 3300005937 | Bacteria | 3050 |
| 64 | Ga0081455_10088495 | 3300005937 | Bacteria | 2516 |
| 65 | Ga0081538_10000954 | 3300005981 | Bacteria | 30995 |
| 66 | Ga0081538_10004151 | 3300005981 | Bacteria | 13439 |
| 67 | Ga0081538_10012738 | 3300005981 | Bacteria | 6717 |
| 68 | Ga0081538_10013828 | 3300005981 | Bacteria | 6367 |
| 69 | Ga0081538_10015454 | 3300005981 | Bacteria | 5904 |
| 70 | Ga0081538_10017756 | 3300005981 | Bacteria | 5382 |
| 71 | Ga0081538_10019528 | 3300005981 | Bacteria | 5031 |
| 72 | Ga0081538_10038702 | 3300005981 | Bacteria | 3072 |
| 73 | Ga0081538_10078350 | 3300005981 | Bacteria | 1774 |
| 74 | Ga0081540_1067638 | 3300005983 | Bacteria | 1668 |
| 75 | Ga0081539_10006160 | 3300005985 | Bacteria | 11672 |
| 76 | Ga0081539_10018108 | 3300005985 | Bacteria | 4905 |
| 77 | Ga0081539_10059757 | 3300005985 | Bacteria | 2096 |
| 78 | Ga0081539_10094888 | 3300005985 | Bacteria | 1534 |
| 79 | Ga0075365_10051936 | 3300006038 | Bacteria | 2709 |
| 80 | Ga0075365_10080934 | 3300006038 | Bacteria | 2199 |
| 81 | Ga0075365_10098781 | 3300006038 | Bacteria | 1997 |
| 82 | Ga0075365_10103746 | 3300006038 | Bacteria | 1949 |
| 83 | Ga0075365_10110613 | 3300006038 | Bacteria | 1888 |
| 84 | Ga0075365_10208750 | 3300006038 | Bacteria | 1369 |
| 85 | Ga0075368_10009626 | 3300006042 | Bacteria | 3478 |
| 86 | Ga0075368_10045500 | 3300006042 | Bacteria | 1734 |
| 87 | Ga0075363_100016401 | 3300006048 | Bacteria | 3658 |
| 88 | Ga0075363_100017106 | 3300006048 | Bacteria | 3590 |
| 89 | Ga0075363_100021849 | 3300006048 | Bacteria | 3229 |
| 90 | Ga0075363_100031776 | 3300006048 | Bacteria | 2739 |
| 91 | Ga0075363_100113672 | 3300006048 | Bacteria | 1507 |
| 92 | Ga0075364_10008434 | 3300006051 | Bacteria | 6159 |
| 93 | Ga0075364_10015981 | 3300006051 | Bacteria | 4661 |
| 94 | Ga0075364_10085842 | 3300006051 | Bacteria | 2085 |
| 95 | Ga0075432_10016682 | 3300006058 | Bacteria | 2507 |
| 96 | Ga0070712_100090192 | 3300006175 | Bacteria | 2244 |
| 97 | Ga0075362_10001895 | 3300006177 | Bacteria | 6864 |
| 98 | Ga0075367_10056006 | 3300006178 | Bacteria | 2341 |
| 99 | Ga0075367_10073487 | 3300006178 | Bacteria | 2060 |
| 100 | Ga0075367_10166369 | 3300006178 | Bacteria | 1372 |
| 101 | Ga0075370_10006757 | 3300006353 | Bacteria | 5793 |
| 102 | Ga0075370_10019564 | 3300006353 | Bacteria | 3690 |
| 103 | Ga0075430_100002720 | 3300006846 | Bacteria | 14758 |
| 104 | Ga0075431_100201056 | 3300006847 | Bacteria | 2039 |
| 105 | Ga0075433_10065962 | 3300006852 | Bacteria | 3175 |
| 106 | Ga0075434_100048569 | 3300006871 | Bacteria | 4210 |
| 107 | Ga0075429_100043597 | 3300006880 | Bacteria | 3904 |
| 108 | Ga0068865_100001987 | 3300006881 | Bacteria | 12070 |
| 109 | Ga0068865_100375091 | 3300006881 | Bacteria | 1159 |
| 110 | Ga0105251_10054791 | 3300009011 | Bacteria | 1892 |
| 111 | Ga0105240_10106628 | 3300009093 | Bacteria | 3398 |
| 112 | Ga0111539_10503688 | 3300009094 | Bacteria | 1410 |
| 113 | Ga0111539_10534065 | 3300009094 | Bacteria | 1366 |
| 114 | Ga0105245_10056391 | 3300009098 | Bacteria | 3531 |
| 115 | Ga0105245_10348850 | 3300009098 | Bacteria | 1466 |
| 116 | Ga0105247_10007081 | 3300009101 | Bacteria | 6889 |
| 117 | Ga0114129_10030977 | 3300009147 | Bacteria | 7565 |
| 118 | Ga0114129_10105667 | 3300009147 | Bacteria | 3890 |
| 119 | Ga0114129_10140668 | 3300009147 | Bacteria | 3308 |
| 120 | Ga0114129_10277820 | 3300009147 | Bacteria | 2239 |
| 121 | Ga0105243_10005795 | 3300009148 | Bacteria | 9589 |
| 122 | Ga0105243_10068730 | 3300009148 | Bacteria | 2856 |
| 123 | Ga0105243_10128699 | 3300009148 | Bacteria | 2145 |
| 124 | Ga0105243_10358211 | 3300009148 | Bacteria | 1342 |
| 125 | Ga0105241_10006049 | 3300009174 | Bacteria | 8923 |
| 126 | Ga0105242_10007216 | 3300009176 | Bacteria | 8571 |
| 127 | Ga0105242_10067430 | 3300009176 | Bacteria | 2958 |
| 128 | Ga0105248_10013985 | 3300009177 | Bacteria | 8830 |
| 129 | Ga0105248_10129953 | 3300009177 | Bacteria | 2841 |
| 130 | Ga0105248_10466412 | 3300009177 | Bacteria | 1423 |
| 131 | Ga0105237_10043607 | 3300009545 | Bacteria | 4518 |
| 132 | Ga0105237_10069261 | 3300009545 | Bacteria | 3523 |
| 133 | Ga0105238_10086487 | 3300009551 | Bacteria | 3122 |
| 134 | Ga0105238_10162392 | 3300009551 | Bacteria | 2210 |
| 135 | Ga0105238_10172988 | 3300009551 | Bacteria | 2136 |
| 136 | Ga0105238_10545754 | 3300009551 | Bacteria | 1163 |
| 137 | Ga0105249_10006439 | 3300009553 | Bacteria | 10210 |
| 138 | Ga0105249_10046304 | 3300009553 | Bacteria | 3958 |
| 139 | Ga0105249_10593027 | 3300009553 | Bacteria | 1162 |
| 140 | Ga0105249_10612095 | 3300009553 | Bacteria | 1145 |
| 141 | Ga0105028_107759 | 3300009993 | Bacteria | 1122 |
| 142 | Ga0105239_10026886 | 3300010375 | Bacteria | 6333 |
| 143 | Ga0105239_10132743 | 3300010375 | Bacteria | 2771 |
| 144 | Ga0105239_10366285 | 3300010375 | Bacteria | 1628 |
| 145 | Ga0105246_10000926 | 3300011119 | Bacteria | 16776 |
| 146 | Ga0105246_10204796 | 3300011119 | Bacteria | 1536 |
| 147 | Ga0157373_10188337 | 3300013100 | Bacteria | 1454 |
| 148 | Ga0157371_10077677 | 3300013102 | Bacteria | 2351 |
| 149 | Ga0157370_10262021 | 3300013104 | Bacteria | 1598 |
| 150 | Ga0157370_10349525 | 3300013104 | Bacteria | 1363 |
| 151 | Ga0157369_10041564 | 3300013105 | Bacteria | 5017 |
| 152 | Ga0157369_10092325 | 3300013105 | Bacteria | 3231 |
| 153 | Ga0157374_10007768 | 3300013296 | Bacteria | 9154 |
| 154 | Ga0157378_10039016 | 3300013297 | Bacteria | 4211 |
| 155 | Ga0157378_10796364 | 3300013297 | Bacteria | 971 |
| 156 | Ga0163162_10021242 | 3300013306 | Bacteria | 6388 |
| 157 | Ga0163162_10049063 | 3300013306 | Bacteria | 4230 |
| 158 | Ga0163162_10209049 | 3300013306 | Bacteria | 2081 |
| 159 | Ga0163162_10275536 | 3300013306 | Bacteria | 1814 |
| 160 | Ga0157372_10019262 | 3300013307 | Bacteria | 7349 |
| 161 | Ga0157372_10054992 | 3300013307 | Bacteria | 4443 |
| 162 | Ga0157372_10194758 | 3300013307 | Bacteria | 2348 |
| 163 | Ga0157372_10248947 | 3300013307 | Bacteria | 2062 |
| 164 | Ga0157372_10350539 | 3300013307 | Bacteria | 1720 |
| 165 | Ga0157375_10039056 | 3300013308 | Bacteria | 4564 |
| 166 | Ga0157375_10054282 | 3300013308 | Bacteria | 3946 |
| 167 | Ga0157375_10112420 | 3300013308 | Bacteria | 2824 |
| 168 | Ga0157375_10153340 | 3300013308 | Bacteria | 2441 |
| 169 | Ga0157375_10189411 | 3300013308 | Bacteria | 2211 |
| 170 | Ga0157375_10199974 | 3300013308 | Bacteria | 2154 |
| 171 | Ga0157375_11223943 | 3300013308 | Bacteria | 881 |
| 172 | Ga0163163_10062499 | 3300014325 | Bacteria | 3690 |
| 173 | Ga0163163_10140551 | 3300014325 | Bacteria | 2457 |
| 174 | Ga0157380_10453591 | 3300014326 | Bacteria | 1232 |
| 175 | Ga0182008_10143697 | 3300014497 | Bacteria | 1195 |
| 176 | Ga0157377_10003538 | 3300014745 | Bacteria | 7073 |
| 177 | Ga0157377_10162204 | 3300014745 | Bacteria | 1391 |
| 178 | Ga0163161_10107753 | 3300017792 | Bacteria | 2080 |
| 179 | Ga0163161_10299420 | 3300017792 | Bacteria | 1266 |
| 180 | Ga0206354_11252387 | 3300020081 | Bacteria | 1054 |
| 181 | Ga0206353_11164138 | 3300020082 | Bacteria | 1950 |
| 182 | Ga0207642_10130525 | 3300025899 | Bacteria | 1310 |
| 183 | Ga0207699_10008934 | 3300025906 | Bacteria | 4969 |
| 184 | Ga0207643_10001431 | 3300025908 | Bacteria | 13685 |
| 185 | Ga0207643_10316754 | 3300025908 | Bacteria | 973 |
| 186 | Ga0207705_10257717 | 3300025909 | Bacteria | 1331 |
| 187 | Ga0207705_10468337 | 3300025909 | Bacteria | 978 |
| 188 | Ga0207705_10542902 | 3300025909 | Bacteria | 904 |
| 189 | Ga0207671_10153124 | 3300025914 | Bacteria | 1782 |
| 190 | Ga0207693_10103059 | 3300025915 | Bacteria | 2238 |
| 191 | Ga0207663_10225579 | 3300025916 | Bacteria | 1366 |
| 192 | Ga0207657_10223573 | 3300025919 | Bacteria | 1507 |
| 193 | Ga0207652_10070296 | 3300025921 | Bacteria | 3040 |
| 194 | Ga0207694_10109108 | 3300025924 | Bacteria | 2200 |
| 195 | Ga0207659_10033133 | 3300025926 | Bacteria | 3552 |
| 196 | Ga0207687_10020856 | 3300025927 | Bacteria | 4348 |
| 197 | Ga0207687_10080223 | 3300025927 | Bacteria | 2355 |
| 198 | Ga0207700_10013738 | 3300025928 | Bacteria | 5282 |
| 199 | Ga0207664_10058004 | 3300025929 | Bacteria | 3079 |
| 200 | Ga0207664_10072434 | 3300025929 | Bacteria | 2778 |
| 201 | Ga0207690_10056742 | 3300025932 | Bacteria | 2643 |
| 202 | Ga0207690_10060370 | 3300025932 | Bacteria | 2573 |
| 203 | Ga0207690_10079345 | 3300025932 | Bacteria | 2287 |
| 204 | Ga0207706_10005862 | 3300025933 | Bacteria | 11429 |
| 205 | Ga0207706_10419015 | 3300025933 | Bacteria | 1160 |
| 206 | Ga0207686_10057719 | 3300025934 | Bacteria | 2445 |
| 207 | Ga0207686_10226037 | 3300025934 | Bacteria | 1354 |
| 208 | Ga0207709_10017730 | 3300025935 | Bacteria | 3979 |
| 209 | Ga0207709_10161812 | 3300025935 | Bacteria | 1562 |
| 210 | Ga0207670_10053678 | 3300025936 | Bacteria | 2716 |
| 211 | Ga0207669_10030136 | 3300025937 | Bacteria | 3011 |
| 212 | Ga0207704_10145864 | 3300025938 | Bacteria | 1662 |
| 213 | Ga0207704_10202251 | 3300025938 | Bacteria | 1455 |
| 214 | Ga0207691_10002825 | 3300025940 | Bacteria | 16922 |
| 215 | Ga0207661_10265492 | 3300025944 | Bacteria | 1530 |
| 216 | Ga0207661_10445981 | 3300025944 | Bacteria | 1178 |
| 217 | Ga0207661_10642024 | 3300025944 | Bacteria | 975 |
| 218 | Ga0207679_10343453 | 3300025945 | Bacteria | 1299 |
| 219 | Ga0207667_10492430 | 3300025949 | Bacteria | 1244 |
| 220 | Ga0207668_10052079 | 3300025972 | Bacteria | 2831 |
| 221 | Ga0207668_10066969 | 3300025972 | Bacteria | 2548 |
| 222 | Ga0207640_10169122 | 3300025981 | Bacteria | 1627 |
| 223 | Ga0207677_10090687 | 3300026023 | Bacteria | 2222 |
| 224 | Ga0207678_10055206 | 3300026067 | Bacteria | 3422 |
| 225 | Ga0207708_10001532 | 3300026075 | Bacteria | 17212 |
| 226 | Ga0207708_10091474 | 3300026075 | Bacteria | 2346 |
| 227 | Ga0207702_10009452 | 3300026078 | Bacteria | 8189 |
| 228 | Ga0207648_10002911 | 3300026089 | Bacteria | 18120 |
| 229 | Ga0207648_10188014 | 3300026089 | Bacteria | 1829 |
| 230 | Ga0207676_10120967 | 3300026095 | Bacteria | 2208 |
| 231 | Ga0207674_10183392 | 3300026116 | Bacteria | 2044 |
| 232 | Ga0207675_100001939 | 3300026118 | Bacteria | 20656 |
| 233 | Ga0207675_100034967 | 3300026118 | Bacteria | 4685 |
| 234 | Ga0207675_100378937 | 3300026118 | Bacteria | 1391 |
| 235 | Ga0207683_10033590 | 3300026121 | Bacteria | 4457 |
| 236 | Ga0207683_10046075 | 3300026121 | Bacteria | 3814 |
| 237 | Ga0207683_10199258 | 3300026121 | Bacteria | 1819 |
| 238 | Ga0209813_10008237 | 3300027866 | Bacteria | 2626 |
| 239 | Ga0209813_10009163 | 3300027866 | Bacteria | 2523 |
| 240 | Ga0207428_10000433 | 3300027907 | Bacteria | 51410 |
| 241 | Ga0207428_10083230 | 3300027907 | Bacteria | 2496 |
| 242 | Ga0265334_10001366 | 3300028573 | Bacteria | 11771 |
| 243 | Ga0265340_10007568 | 3300031247 | Bacteria | 5893 |
| 244 | Ga0265339_10031105 | 3300031249 | Bacteria | 3018 |
| 245 | Ga0307408_100039897 | 3300031548 | Bacteria | 3322 |
| 246 | Ga0307408_100053725 | 3300031548 | Bacteria | 2910 |
| 247 | Ga0307408_100081356 | 3300031548 | Bacteria | 2421 |
| 248 | Ga0316579_10000156 | 3300031691 | Bacteria | 19325 |
| 249 | Ga0316579_10105926 | 3300031691 | Bacteria | 1348 |
| 250 | Ga0316579_10160014 | 3300031691 | Bacteria | 1088 |
| 251 | Ga0265342_10030328 | 3300031712 | Bacteria | 3352 |
| 252 | Ga0316576_10022296 | 3300031727 | Bacteria | 4396 |
| 253 | Ga0316576_10024186 | 3300031727 | Bacteria | 4240 |
| 254 | Ga0316576_10046366 | 3300031727 | Bacteria | 3145 |
| 255 | Ga0316576_10092348 | 3300031727 | Bacteria | 2255 |
| 256 | Ga0316576_10255064 | 3300031727 | Bacteria | 1316 |
| 257 | Ga0307405_10011341 | 3300031731 | Bacteria | 4665 |
| 258 | Ga0307405_10125675 | 3300031731 | Bacteria | 1763 |
| 259 | Ga0307405_10134290 | 3300031731 | Bacteria | 1715 |
| 260 | Ga0307405_10144624 | 3300031731 | Bacteria | 1663 |
| 261 | Ga0307413_10040157 | 3300031824 | Bacteria | 2728 |
| 262 | Ga0307413_10093534 | 3300031824 | Bacteria | 1965 |
| 263 | Ga0307410_10021327 | 3300031852 | Bacteria | 3983 |
| 264 | Ga0307410_10071656 | 3300031852 | Bacteria | 2404 |
| 265 | Ga0307410_10114266 | 3300031852 | Bacteria | 1958 |
| 266 | Ga0307406_10012216 | 3300031901 | Bacteria | 4893 |
| 267 | Ga0307406_10016200 | 3300031901 | Bacteria | 4326 |
| 268 | Ga0307406_10112736 | 3300031901 | Bacteria | 1875 |
| 269 | Ga0307407_10006812 | 3300031903 | Bacteria | 5121 |
| 270 | Ga0307407_10036769 | 3300031903 | Bacteria | 2701 |
| 271 | Ga0307407_10059245 | 3300031903 | Bacteria | 2229 |
| 272 | Ga0307407_10131963 | 3300031903 | Bacteria | 1599 |
| 273 | Ga0307412_10024506 | 3300031911 | Bacteria | 3725 |
| 274 | Ga0307412_10048224 | 3300031911 | Bacteria | 2800 |
| 275 | Ga0307412_10196345 | 3300031911 | Bacteria | 1529 |
| 276 | Ga0307409_100006642 | 3300031995 | Bacteria | 6826 |
| 277 | Ga0307409_100009275 | 3300031995 | Bacteria | 6036 |
| 278 | Ga0307409_100010345 | 3300031995 | Bacteria | 5794 |
| 279 | Ga0307409_100020155 | 3300031995 | Bacteria | 4537 |
| 280 | Ga0307409_100033847 | 3300031995 | Bacteria | 3724 |
| 281 | Ga0307409_100125352 | 3300031995 | Bacteria | 2183 |
| 282 | Ga0307409_100141422 | 3300031995 | Bacteria | 2074 |
| 283 | Ga0307409_100189200 | 3300031995 | Bacteria | 1830 |
| 284 | Ga0307409_100220069 | 3300031995 | Bacteria | 1713 |
| 285 | Ga0307409_100242183 | 3300031995 | Bacteria | 1643 |
| 286 | Ga0307409_100247067 | 3300031995 | Bacteria | 1629 |
| 287 | Ga0307409_100654302 | 3300031995 | Bacteria | 1045 |
| 288 | Ga0307416_100002366 | 3300032002 | Bacteria | 10794 |
| 289 | Ga0307416_100008910 | 3300032002 | Bacteria | 6519 |
| 290 | Ga0307416_100010351 | 3300032002 | Bacteria | 6155 |
| 291 | Ga0307416_100010961 | 3300032002 | Bacteria | 6016 |
| 292 | Ga0307416_100017783 | 3300032002 | Bacteria | 4986 |
| 293 | Ga0307416_100063687 | 3300032002 | Bacteria | 3021 |
| 294 | Ga0307416_100084277 | 3300032002 | Bacteria | 2700 |
| 295 | Ga0307416_100268103 | 3300032002 | Bacteria | 1674 |
| 296 | Ga0307416_100495143 | 3300032002 | Bacteria | 1285 |
| 297 | Ga0307414_10137266 | 3300032004 | Bacteria | 1909 |
| 298 | Ga0307414_10445988 | 3300032004 | Bacteria | 1134 |
| 299 | Ga0307411_10006600 | 3300032005 | Bacteria | 5822 |
| 300 | Ga0307411_10111605 | 3300032005 | Bacteria | 1958 |
| 301 | Ga0307411_10185180 | 3300032005 | Bacteria | 1584 |
| 302 | Ga0307411_10683644 | 3300032005 | Bacteria | 892 |
| 303 | Ga0307415_100000133 | 3300032126 | Bacteria | 32344 |
| 304 | Ga0307415_100004206 | 3300032126 | Bacteria | 7434 |
| 305 | Ga0307415_100005648 | 3300032126 | Bacteria | 6661 |
| 306 | Ga0307415_100007567 | 3300032126 | Bacteria | 5948 |
| 307 | Ga0307415_100012603 | 3300032126 | Bacteria | 4895 |
| 308 | Ga0307415_100013045 | 3300032126 | Bacteria | 4834 |
| 309 | Ga0307415_100015987 | 3300032126 | Bacteria | 4458 |
| 310 | Ga0307415_100253545 | 3300032126 | Bacteria | 1431 |
| 311 | Ga0316580_10059742 | 3300032139 | Bacteria | 1171 |
| 312 | Ga0316574_0000590 | 3300035398 | Bacteria | 15049 |
| 313 | Ga0316574_0080599 | 3300035398 | Bacteria | 2066 |
| 314 | Ga0316574_0185225 | 3300035398 | Bacteria | 1339 |
| 315 | Ga0373931_0358648 | 3300035691 | Bacteria | 914 |
| 316 | Ga0316582_0151835 | 3300036647 | Bacteria | 1566 |
| 317 | Ga0316582_0328911 | 3300036647 | Bacteria | 1051 |
| 318 | Ga0316584_0000239 | 3300036712 | Bacteria | 27354 |
| 319 | Ga0316584_0012516 | 3300036712 | Bacteria | 5984 |
| 320 | Ga0316584_0045996 | 3300036712 | Bacteria | 3259 |
| 321 | Ga0316584_0408351 | 3300036712 | Bacteria | 966 |
| 322 | Ga0395899_0010482 | 3300037312 | Bacteria | 7098 |
| 323 | Ga0395899_0100863 | 3300037312 | Bacteria | 2084 |
| 324 | Ga0395899_0233695 | 3300037312 | Bacteria | 1268 |
| 325 | Ga0395900_0187972 | 3300037418 | Bacteria | 2096 |
| 326 | Ga0395900_0224816 | 3300037418 | Bacteria | 1890 |
| 327 | Ga0395898_0072331 | 3300037466 | Bacteria | 3331 |
| 328 | Ga0395898_0079593 | 3300037466 | Bacteria | 3161 |
| 329 | Ga0395898_0192499 | 3300037466 | Bacteria | 1949 |
| 330 | Ga0395898_0348558 | 3300037466 | Bacteria | 1412 |
| 331 | Ga0395905_0289329 | 3300037471 | Bacteria | 1525 |
| 332 | Ga0395905_0758747 | 3300037471 | Bacteria | 873 |
| 333 | Ga0395905_0913942 | 3300037471 | Bacteria | 781 |
| 334 | Ga0436364_0700221 | 3300037853 | Bacteria | 1309 |
| 335 | Ga0436364_1514249 | 3300037853 | Bacteria | 2592 |
| 336 | Ga0395901_0053961 | 3300038443 | Bacteria | 4177 |
| 337 | Ga0395901_0058989 | 3300038443 | Bacteria | 3992 |
| 338 | Ga0395901_0164790 | 3300038443 | Bacteria | 2327 |
| 339 | Ga0395901_0180146 | 3300038443 | Bacteria | 2216 |
| 340 | Ga0395901_0199018 | 3300038443 | Bacteria | 2100 |
| 341 | Ga0395901_0293332 | 3300038443 | Bacteria | 1687 |
| 342 | Ga0395901_0317018 | 3300038443 | Bacteria | 1614 |
| 343 | Ga0395901_0467780 | 3300038443 | Bacteria | 1287 |
| 344 | Ga0395901_0538061 | 3300038443 | Bacteria | 1185 |
| 345 | Ga0395901_0603070 | 3300038443 | Bacteria | 1107 |
| 346 | Ga0400485_04221 | 3300038735 | Bacteria | 54088 |
| 347 | Ga0400486_29215 | 3300038742 | Bacteria | 140932 |
| 348 | Ga0439436_0070438 | 3300041404 | Bacteria | 975 |
| 349 | Ga0439438_045483 | 3300041405 | Bacteria | 1129 |
| 350 | Ga0439466_0058509 | 3300041411 | Bacteria | 1247 |
| 351 | Ga0439465_0057245 | 3300041413 | Bacteria | 1286 |
| 352 | Ga0451789_0493370 | 3300041443 | Bacteria | 2434 |
| 353 | Ga0451793_0112958 | 3300041452 | Bacteria | 1890 |
| 354 | Ga0451797_0393491 | 3300041453 | Bacteria | 4131 |
| 355 | Ga0451797_1210202 | 3300041453 | Bacteria | 1340 |
| 356 | Ga0451833_1221655 | 3300041491 | Bacteria | 1920 |
| 357 | Ga0451841_0871602 | 3300041498 | Bacteria | 2125 |
| 358 | Ga0451843_0604577 | 3300041509 | Bacteria | 5309 |
| 359 | Ga0439431_0000830 | 3300041997 | Bacteria | 6662 |
| 360 | Ga0439442_015704 | 3300042002 | Bacteria | 1561 |
| 361 | Ga0439445_0005878 | 3300042004 | Bacteria | 2807 |
| 362 | Ga0439448_0087018 | 3300042005 | Bacteria | 1053 |
| 363 | Ga0439432_017990 | 3300042006 | Bacteria | 2367 |
| 364 | Ga0439450_000083 | 3300042008 | Bacteria | 9362 |
| 365 | Ga0439450_016147 | 3300042008 | Bacteria | 1539 |
| 366 | Ga0439454_006273 | 3300042011 | Bacteria | 1455 |
| 367 | Ga0439455_0006749 | 3300042012 | Bacteria | 2398 |
| 368 | Ga0439457_012504 | 3300042014 | Bacteria | 1913 |
| 369 | Ga0439457_028728 | 3300042014 | Bacteria | 1231 |
| 370 | Ga0439463_000209 | 3300042016 | Bacteria | 15866 |
| 371 | Ga0439463_015598 | 3300042016 | Bacteria | 1879 |
| 372 | Ga0439463_024791 | 3300042016 | Bacteria | 1503 |
| 373 | Ga0450917_005623 | 3300042120 | Bacteria | 935 |
| 374 | Ga0450888_003486 | 3300042126 | Bacteria | 1597 |
| 375 | Ga0450905_002810 | 3300042142 | Bacteria | 2259 |
| 376 | Ga0439458_0003066 | 3300042157 | Bacteria | 3982 |
| 377 | Ga0439458_0054295 | 3300042157 | Bacteria | 992 |
| 378 | Ga0439434_0012312 | 3300042435 | Bacteria | 2531 |
| 379 | Ga0439444_0001594 | 3300042437 | Bacteria | 2987 |
| 380 | Ga0439464_0009244 | 3300042439 | Bacteria | 2592 |
| 381 | Ga0439460_0001259 | 3300042461 | Bacteria | 5958 |
| 382 | Ga0450916_000488 | 3300042530 | Bacteria | 3458 |
| 383 | Ga0439440_0000290 | 3300042993 | Bacteria | 8188 |
| 384 | Ga0439440_0014636 | 3300042993 | Bacteria | 1695 |
| 385 | Ga0466972_0009071 | 3300044658 | Bacteria | 4996 |
| 386 | Ga0466972_0021964 | 3300044658 | Bacteria | 3179 |
| 387 | Ga0466972_0095696 | 3300044658 | Bacteria | 1407 |
| 388 | Ga0466972_0097430 | 3300044658 | Bacteria | 1393 |
| 389 | Ga0466965_0012831 | 3300044683 | Bacteria | 3944 |
| 390 | Ga0466965_0021164 | 3300044683 | Bacteria | 3129 |
| 391 | Ga0466965_0022613 | 3300044683 | Bacteria | 3031 |
| 392 | Ga0466966_0083137 | 3300044684 | Bacteria | 1992 |
| 393 | Ga0466966_0250380 | 3300044684 | Bacteria | 1067 |
| 394 | Ga0466961_0024622 | 3300044693 | Bacteria | 3872 |
| 395 | Ga0466961_0053405 | 3300044693 | Bacteria | 2578 |
| 396 | Ga0466961_0058546 | 3300044693 | Bacteria | 2451 |
| 397 | Ga0466961_0073191 | 3300044693 | Bacteria | 2173 |
| 398 | Ga0466961_0073745 | 3300044693 | Bacteria | 2164 |
| 399 | Ga0466961_0178995 | 3300044693 | Bacteria | 1317 |
| 400 | Ga0466963_0057082 | 3300044694 | Bacteria | 2599 |
| 401 | Ga0466963_0120276 | 3300044694 | Bacteria | 1807 |
| 402 | Ga0466963_0152941 | 3300044694 | Bacteria | 1603 |
| 403 | Ga0466963_0215411 | 3300044694 | Bacteria | 1344 |
| 404 | Ga0466963_0280046 | 3300044694 | Bacteria | 1172 |
| 405 | Ga0466964_0008479 | 3300044706 | Bacteria | 3864 |
| 406 | Ga0466964_0102654 | 3300044706 | Bacteria | 1263 |
| 407 | Ga0466971_0003441 | 3300044719 | Bacteria | 6765 |
| 408 | Ga0466968_0039768 | 3300044735 | Bacteria | 1980 |
| 409 | Ga0466968_0192689 | 3300044735 | Bacteria | 952 |
| 410 | Ga0466970_0009457 | 3300044765 | Bacteria | 4928 |
| 411 | Ga0466970_0043911 | 3300044765 | Bacteria | 2380 |
| 412 | Ga0466970_0216536 | 3300044765 | Bacteria | 1068 |
| 413 | Ga0466970_0290141 | 3300044765 | Bacteria | 921 |
| 414 | Ga0466957_0005119 | 3300044842 | Bacteria | 7324 |
| 415 | Ga0466957_0038169 | 3300044842 | Bacteria | 2893 |
| 416 | Ga0466957_0423076 | 3300044842 | Bacteria | 914 |
| 417 | Ga0466960_0008485 | 3300044901 | Bacteria | 4210 |
| 418 | Ga0466960_0015508 | 3300044901 | Bacteria | 3285 |
| 419 | Ga0466960_0017249 | 3300044901 | Bacteria | 3144 |
| 420 | Ga0466960_0026629 | 3300044901 | Bacteria | 2629 |
| 421 | Ga0466960_0029524 | 3300044901 | Bacteria | 2517 |
| 422 | Ga0466960_0032392 | 3300044901 | Bacteria | 2419 |
| 423 | Ga0466960_0053248 | 3300044901 | Bacteria | 1960 |
| 424 | Ga0466960_0087577 | 3300044901 | Bacteria | 1581 |
| 425 | Ga0466960_0149563 | 3300044901 | Bacteria | 1246 |
| 426 | Ga0466960_0206025 | 3300044901 | Bacteria | 1076 |
| 427 | Ga0466959_0194724 | 3300045049 | Bacteria | 1413 |
| 428 | Ga0466958_0017261 | 3300045836 | Bacteria | 4169 |
| 429 | Ga0466967_0018178 | 3300045976 | Bacteria | 5610 |
| 430 | Ga0466967_0020018 | 3300045976 | Bacteria | 5397 |
| 431 | Ga0466967_0028283 | 3300045976 | Bacteria | 4679 |
| 432 | Ga0466967_0055151 | 3300045976 | Bacteria | 3501 |
| 433 | Ga0466967_0071078 | 3300045976 | Bacteria | 3115 |
| 434 | Ga0466967_0093943 | 3300045976 | Bacteria | 2730 |
| 435 | Ga0466967_0123847 | 3300045976 | Bacteria | 2392 |
| 436 | Ga0466967_0181081 | 3300045976 | Bacteria | 1988 |
| 437 | Ga0466967_0331707 | 3300045976 | Bacteria | 1469 |
| 438 | Ga0495592_0356854 | 3300046454 | Bacteria | 936 |
| 439 | Ga0495641_0041890 | 3300046461 | Bacteria | 2125 |
| 440 | Ga0495584_0058973 | 3300046491 | Bacteria | 1931 |
| 441 | Ga0495607_0136351 | 3300046501 | Bacteria | 1271 |
| 442 | Ga0495644_0046394 | 3300046523 | Bacteria | 1633 |
| 443 | Ga0495587_0326833 | 3300046536 | Bacteria | 856 |
| 444 | Ga0495598_0073100 | 3300046537 | Bacteria | 1084 |
| 445 | Ga0495621_0113821 | 3300046539 | Bacteria | 1040 |
| 446 | Ga0495645_0207262 | 3300046543 | Bacteria | 1326 |
| 447 | Ga0495667_0281409 | 3300046559 | Bacteria | 1056 |
| 448 | Ga0495656_0025302 | 3300046615 | Bacteria | 2352 |
| 449 | Ga0495635_0109735 | 3300046663 | Bacteria | 1885 |
| 450 | Ga0495599_0161886 | 3300046678 | Bacteria | 1383 |
| 451 | Ga0495658_0303899 | 3300046683 | Bacteria | 1009 |
| 452 | Ga0495671_0067940 | 3300046692 | Bacteria | 1753 |
| 453 | Ga0495676_0043903 | 3300047321 | Bacteria | 3654 |
| 454 | Ga0495680_0056581 | 3300047322 | Bacteria | 3036 |
| 455 | Ga0495679_102658 | 3300047446 | Bacteria | 793 |
| 456 | Ga0496100_0068871 | 3300048903 | Bacteria | 2355 |
| 457 | Ga0496101_0030690 | 3300048904 | Bacteria | 3772 |
| 458 | Ga0496101_0119204 | 3300048904 | Bacteria | 1994 |
| 459 | Ga0496101_0404010 | 3300048904 | Bacteria | 1076 |
| 460 | Ga0496102_0011896 | 3300048905 | Bacteria | 7512 |
| 461 | Ga0496102_0054566 | 3300048905 | Bacteria | 3644 |
| 462 | Ga0496103_0026509 | 3300048906 | Bacteria | 3508 |
| 463 | Ga0496104_0006523 | 3300048907 | Bacteria | 10262 |
| 464 | Ga0496104_0086041 | 3300048907 | Bacteria | 3001 |
| 465 | Ga0496104_0110681 | 3300048907 | Bacteria | 2633 |
| 466 | Ga0496105_0010138 | 3300048908 | Bacteria | 7401 |
| 467 | Ga0496105_0028430 | 3300048908 | Bacteria | 4571 |
| 468 | Ga0496106_0000592 | 3300048909 | Bacteria | 25928 |
| 469 | Ga0496106_0010113 | 3300048909 | Bacteria | 6967 |
| 470 | Ga0496106_0229749 | 3300048909 | Bacteria | 1481 |
| 471 | Ga0496106_0434975 | 3300048909 | Bacteria | 1054 |
| 472 | Ga0496107_0037764 | 3300048910 | Bacteria | 3466 |
| 473 | Ga0496107_0078784 | 3300048910 | Bacteria | 2401 |
| 474 | Ga0496108_0055617 | 3300048911 | Bacteria | 3323 |
| 475 | Ga0496108_0058637 | 3300048911 | Bacteria | 3236 |
| 476 | Ga0496108_0086748 | 3300048911 | Bacteria | 2657 |
| 477 | Ga0496108_0275244 | 3300048911 | Bacteria | 1465 |
| 478 | Ga0496108_0288305 | 3300048911 | Bacteria | 1429 |
| 479 | Ga0496109_0032171 | 3300048912 | Bacteria | 4713 |
| 480 | Ga0496109_0039577 | 3300048912 | Bacteria | 4268 |
| 481 | Ga0496110_0024686 | 3300048913 | Bacteria | 5126 |
| 482 | Ga0496110_0034423 | 3300048913 | Bacteria | 4387 |
| 483 | Ga0496110_0060048 | 3300048913 | Bacteria | 3353 |
| 484 | Ga0496110_0069775 | 3300048913 | Bacteria | 3113 |
| 485 | Ga0496110_0083115 | 3300048913 | Bacteria | 2856 |
| 486 | Ga0496110_0184840 | 3300048913 | Bacteria | 1892 |
| 487 | Ga0496110_0207935 | 3300048913 | Bacteria | 1779 |
| 488 | Ga0496110_0239915 | 3300048913 | Bacteria | 1649 |
| 489 | Ga0496111_0025463 | 3300048914 | Bacteria | 4174 |
| 490 | Ga0496111_0040524 | 3300048914 | Bacteria | 3341 |
| 491 | Ga0496111_0100081 | 3300048914 | Bacteria | 2129 |
| 492 | Ga0496111_0187020 | 3300048914 | Bacteria | 1540 |
| 493 | Ga0496111_0306303 | 3300048914 | Bacteria | 1177 |
| 494 | Ga0496112_0051712 | 3300048915 | Bacteria | 4030 |
| 495 | Ga0496112_0475557 | 3300048915 | Bacteria | 1186 |
| 496 | Ga0496113_0032131 | 3300048916 | Bacteria | 3813 |
| 497 | Ga0496113_0077586 | 3300048916 | Bacteria | 2540 |
| 498 | Ga0496114_0046582 | 3300048917 | Bacteria | 3603 |
| 499 | Ga0496114_0177977 | 3300048917 | Bacteria | 1856 |
| 500 | Ga0496114_0287603 | 3300048917 | Bacteria | 1450 |
| 501 | Ga0496114_0304826 | 3300048917 | Bacteria | 1406 |
| 502 | Ga0496117_0029969 | 3300048920 | Bacteria | 4183 |
| 503 | Ga0496118_0152418 | 3300048921 | Bacteria | 1444 |
| 504 | Ga0496118_0269411 | 3300048921 | Bacteria | 955 |
| 505 | Ga0496119_0034913 | 3300048922 | Bacteria | 3302 |
| 506 | Ga0496119_0112151 | 3300048922 | Bacteria | 1512 |
| 507 | Ga0496122_0003466 | 3300048925 | Bacteria | 20749 |
| 508 | Ga0496124_0050516 | 3300048927 | Bacteria | 3543 |
| 509 | Ga0496125_0000015 | 3300048928 | Bacteria | 516648 |
| 510 | Ga0496125_0000913 | 3300048928 | Bacteria | 46575 |
| 511 | Ga0496126_0195300 | 3300048929 | Bacteria | 1712 |
| 512 | Ga0501031_0003225 | 3300049568 | Bacteria | 10476 |
| 513 | Ga0501031_0059071 | 3300049568 | Bacteria | 2499 |
| 514 | Ga0501031_0170806 | 3300049568 | Bacteria | 1421 |
| 515 | Ga0501031_0199473 | 3300049568 | Bacteria | 1306 |
| 516 | Ga0501031_0385810 | 3300049568 | Bacteria | 906 |
| 517 | Ga0501032_0010375 | 3300049569 | Bacteria | 6718 |
| 518 | Ga0501032_0026571 | 3300049569 | Bacteria | 3979 |
| 519 | Ga0501033_0000653 | 3300049570 | Bacteria | 32031 |
| 520 | Ga0501033_0007950 | 3300049570 | Bacteria | 8215 |
| 521 | Ga0501033_0060471 | 3300049570 | Bacteria | 2795 |
| 522 | Ga0501033_0391102 | 3300049570 | Bacteria | 971 |
| 523 | Ga0501034_0033211 | 3300049571 | Bacteria | 5237 |
| 524 | Ga0501034_0046532 | 3300049571 | Bacteria | 4383 |
| 525 | Ga0501034_0247426 | 3300049571 | Bacteria | 1728 |
| 526 | Ga0501036_0003680 | 3300049572 | Bacteria | 12270 |
| 527 | Ga0501036_0012468 | 3300049572 | Bacteria | 7046 |
| 528 | Ga0501036_0037661 | 3300049572 | Bacteria | 4091 |
| 529 | Ga0501036_0041193 | 3300049572 | Bacteria | 3908 |
| 530 | Ga0501036_0053829 | 3300049572 | Bacteria | 3407 |
| 531 | Ga0501036_0056573 | 3300049572 | Bacteria | 3323 |
| 532 | Ga0501036_0253642 | 3300049572 | Bacteria | 1474 |
| 533 | Ga0501037_0006501 | 3300049573 | Bacteria | 8550 |
| 534 | Ga0501037_0018913 | 3300049573 | Bacteria | 5078 |
| 535 | Ga0501037_0580623 | 3300049573 | Bacteria | 754 |
| 536 | Ga0501038_0000456 | 3300049574 | Bacteria | 35724 |
| 537 | Ga0501038_0003592 | 3300049574 | Bacteria | 14438 |
| 538 | Ga0501038_0004992 | 3300049574 | Bacteria | 12322 |
| 539 | Ga0501038_0095345 | 3300049574 | Bacteria | 2485 |
| 540 | Ga0501038_0182993 | 3300049574 | Bacteria | 1690 |
| 541 | Ga0501038_0358796 | 3300049574 | Bacteria | 1134 |
| 542 | Ga0501038_0437196 | 3300049574 | Bacteria | 1008 |
| 543 | Ga0501039_0002751 | 3300049575 | Bacteria | 13113 |
| 544 | Ga0501039_0003077 | 3300049575 | Bacteria | 12478 |
| 545 | Ga0501039_0025643 | 3300049575 | Bacteria | 4531 |
| 546 | Ga0501039_0078889 | 3300049575 | Bacteria | 2561 |
| 547 | Ga0501039_0150821 | 3300049575 | Bacteria | 1826 |
| 548 | Ga0501039_0532356 | 3300049575 | Bacteria | 922 |
| 549 | Ga0501040_0002301 | 3300049576 | Bacteria | 12280 |
| 550 | Ga0501040_0002316 | 3300049576 | Bacteria | 12231 |
| 551 | Ga0501040_0014941 | 3300049576 | Bacteria | 5127 |
| 552 | Ga0501040_0138020 | 3300049576 | Bacteria | 1716 |
| 553 | Ga0501041_0000438 | 3300049577 | Bacteria | 21095 |
| 554 | Ga0501041_0017558 | 3300049577 | Bacteria | 4258 |
| 555 | Ga0501041_0026479 | 3300049577 | Bacteria | 3489 |
| 556 | Ga0501041_0041547 | 3300049577 | Bacteria | 2793 |
| 557 | Ga0501042_0001107 | 3300049578 | Bacteria | 15503 |
| 558 | Ga0501042_0003246 | 3300049578 | Bacteria | 10169 |
| 559 | Ga0501042_0030426 | 3300049578 | Bacteria | 3812 |
| 560 | Ga0501042_0042313 | 3300049578 | Bacteria | 3242 |
| 561 | Ga0501042_0055188 | 3300049578 | Bacteria | 2835 |
| 562 | Ga0501042_0087028 | 3300049578 | Bacteria | 2241 |
| 563 | Ga0501042_0236168 | 3300049578 | Bacteria | 1319 |
| 564 | Ga0501042_0597007 | 3300049578 | Bacteria | 803 |
| 565 | Ga0501043_0004024 | 3300049579 | Bacteria | 12021 |
| 566 | Ga0501043_0018068 | 3300049579 | Bacteria | 5531 |
| 567 | Ga0501043_0221078 | 3300049579 | Bacteria | 1465 |
| 568 | Ga0501043_0251411 | 3300049579 | Bacteria | 1361 |
| 569 | Ga0501046_0000721 | 3300049580 | Bacteria | 31964 |
| 570 | Ga0501046_0001166 | 3300049580 | Bacteria | 25571 |
| 571 | Ga0501046_0017196 | 3300049580 | Bacteria | 6043 |
| 572 | Ga0501046_0050259 | 3300049580 | Bacteria | 3294 |
| 573 | Ga0501046_0053494 | 3300049580 | Bacteria | 3179 |
| 574 | Ga0501046_0114170 | 3300049580 | Bacteria | 2061 |
| 575 | Ga0501046_0138566 | 3300049580 | Bacteria | 1842 |
| 576 | Ga0501047_0000236 | 3300049581 | Bacteria | 65453 |
| 577 | Ga0501047_0013180 | 3300049581 | Bacteria | 7829 |
| 578 | Ga0501047_0089865 | 3300049581 | Bacteria | 2948 |
| 579 | Ga0501047_0107535 | 3300049581 | Bacteria | 2670 |
| 580 | Ga0501048_0000920 | 3300049582 | Bacteria | 21650 |
| 581 | Ga0501048_0003693 | 3300049582 | Bacteria | 11661 |
| 582 | Ga0501048_0022061 | 3300049582 | Bacteria | 4659 |
| 583 | Ga0501048_0099333 | 3300049582 | Bacteria | 2053 |
| 584 | Ga0501048_0423204 | 3300049582 | Bacteria | 953 |
| 585 | Ga0501067_0013732 | 3300049583 | Bacteria | 4485 |
| 586 | Ga0501067_0019236 | 3300049583 | Bacteria | 3779 |
| 587 | Ga0501067_0020313 | 3300049583 | Bacteria | 3676 |
| 588 | Ga0501067_0079975 | 3300049583 | Bacteria | 1811 |
| 589 | Ga0501067_0169876 | 3300049583 | Bacteria | 1215 |
| 590 | Ga0501069_0087714 | 3300049585 | Bacteria | 1758 |
| 591 | Ga0501070_0008079 | 3300049586 | Bacteria | 8906 |
| 592 | Ga0501070_0037862 | 3300049586 | Bacteria | 4025 |
| 593 | Ga0501070_0115889 | 3300049586 | Bacteria | 2213 |
| 594 | Ga0501070_0220925 | 3300049586 | Bacteria | 1554 |
| 595 | Ga0501071_0012541 | 3300049587 | Bacteria | 5751 |
| 596 | Ga0501071_0057219 | 3300049587 | Bacteria | 2817 |
| 597 | Ga0501071_0068348 | 3300049587 | Bacteria | 2585 |
| 598 | Ga0501071_0316691 | 3300049587 | Bacteria | 1184 |
| 599 | Ga0501072_0001219 | 3300049588 | Bacteria | 19209 |
| 600 | Ga0501072_0016009 | 3300049588 | Bacteria | 5751 |
| 601 | Ga0501072_0042617 | 3300049588 | Bacteria | 3565 |
| 602 | Ga0501072_0186820 | 3300049588 | Bacteria | 1653 |
| 603 | Ga0501073_0092822 | 3300049589 | Bacteria | 2098 |
| 604 | Ga0501073_0196955 | 3300049589 | Bacteria | 1393 |
| 605 | Ga0501073_0240709 | 3300049589 | Bacteria | 1250 |
| 606 | Ga0501074_0001096 | 3300049590 | Bacteria | 17703 |
| 607 | Ga0501074_0005515 | 3300049590 | Bacteria | 9103 |
| 608 | Ga0501074_0055852 | 3300049590 | Bacteria | 2845 |
| 609 | Ga0501074_0064035 | 3300049590 | Bacteria | 2648 |
| 610 | Ga0501074_0080750 | 3300049590 | Bacteria | 2332 |
| 611 | Ga0501074_0190107 | 3300049590 | Bacteria | 1464 |
| 612 | Ga0501075_0001417 | 3300049591 | Bacteria | 15619 |
| 613 | Ga0501075_0677382 | 3300049591 | Bacteria | 786 |
| 614 | Ga0501076_0005339 | 3300049592 | Bacteria | 9227 |
| 615 | Ga0501076_0018992 | 3300049592 | Bacteria | 5245 |
| 616 | Ga0501076_0025085 | 3300049592 | Bacteria | 4611 |
| 617 | Ga0501076_0034576 | 3300049592 | Bacteria | 3951 |
| 618 | Ga0501076_0048098 | 3300049592 | Bacteria | 3372 |
| 619 | Ga0501076_0761039 | 3300049592 | Bacteria | 799 |
| 620 | Ga0501077_0000877 | 3300049593 | Bacteria | 18136 |
| 621 | Ga0501077_0048762 | 3300049593 | Bacteria | 2691 |
| 622 | Ga0501077_0073195 | 3300049593 | Bacteria | 2171 |
| 623 | Ga0501077_0340116 | 3300049593 | Bacteria | 957 |
| 624 | Ga0501079_0001493 | 3300049741 | Bacteria | 16559 |
| 625 | Ga0501079_0039736 | 3300049741 | Bacteria | 3629 |
| 626 | Ga0501079_0052977 | 3300049741 | Bacteria | 3131 |
| 627 | Ga0501079_0089339 | 3300049741 | Bacteria | 2386 |
| 628 | Ga0501080_0104205 | 3300049742 | Bacteria | 2631 |
| 629 | Ga0501080_0163873 | 3300049742 | Bacteria | 2052 |
| 630 | Ga0501080_0626070 | 3300049742 | Bacteria | 954 |
| 631 | Ga0501080_0746138 | 3300049742 | Bacteria | 861 |
| 632 | Ga0501081_0043087 | 3300049743 | Bacteria | 3095 |
| 633 | Ga0501081_0055072 | 3300049743 | Bacteria | 2748 |
| 634 | Ga0501081_0226335 | 3300049743 | Bacteria | 1361 |
| 635 | Ga0501083_0010423 | 3300049744 | Bacteria | 6541 |
| 636 | Ga0501083_0046450 | 3300049744 | Bacteria | 2936 |
| 637 | Ga0501083_0115052 | 3300049744 | Bacteria | 1766 |
| 638 | Ga0501035_0025283 | 3300049822 | Bacteria | 5443 |
| 639 | Ga0501035_0059019 | 3300049822 | Bacteria | 3417 |
| 640 | Ga0501035_0080543 | 3300049822 | Bacteria | 2875 |
| 641 | Ga0501035_0121174 | 3300049822 | Bacteria | 2286 |
| 642 | Ga0501044_0007319 | 3300049823 | Bacteria | 12132 |
| 643 | Ga0501044_0020945 | 3300049823 | Bacteria | 6982 |
| 644 | Ga0501044_0306110 | 3300049823 | Bacteria | 1516 |
| 645 | Ga0501045_0002730 | 3300049824 | Bacteria | 12054 |
| 646 | Ga0501045_0059178 | 3300049824 | Bacteria | 2806 |
| 647 | Ga0501045_0120449 | 3300049824 | Bacteria | 1948 |
| 648 | Ga0501045_0189286 | 3300049824 | Bacteria | 1534 |
| 649 | Ga0501045_0218829 | 3300049824 | Bacteria | 1418 |
| 650 | Ga0501045_0392250 | 3300049824 | Bacteria | 1033 |
| 651 | nmdc:mga03n38_1401_c1 | 3300050490 | Bacteria | 6865 |
| 652 | nmdc:mga03n38_2386_c1 | 3300050490 | Bacteria | 5793 |
| 653 | nmdc:mga00v17_109942_c1 | 3300050491 | Bacteria | 1748 |
| 654 | nmdc:mga00v17_146187_c1 | 3300050491 | Bacteria | 1517 |
| 655 | nmdc:mga00v17_18632_c1 | 3300050491 | Bacteria | 3947 |
| 656 | nmdc:mga00v17_29950_c1 | 3300050491 | Bacteria | 3197 |
| 657 | nmdc:mga00v17_6019_c1 | 3300050491 | Bacteria | 6418 |
| 658 | nmdc:mga00v17_82957_c1 | 3300050491 | Bacteria | 2004 |
| 659 | nmdc:mga0yw44_246264_c1 | 3300050492 | Bacteria | 1189 |
| 660 | nmdc:mga0yw44_24694_c1 | 3300050492 | Bacteria | 3405 |
| 661 | nmdc:mga0yw44_277034_c1 | 3300050492 | Bacteria | 1121 |
| 662 | nmdc:mga0yw44_35004_c1 | 3300050492 | Bacteria | 2948 |
| 663 | nmdc:mga0yw44_4727_c1 | 3300050492 | Bacteria | 6303 |
| 664 | nmdc:mga0yw44_92517_c1 | 3300050492 | Bacteria | 1914 |
| 665 | nmdc:mga06z11_55509_c1 | 3300050494 | Bacteria | 2046 |
| 666 | nmdc:mga06z11_56935_c1 | 3300050494 | Bacteria | 2024 |
| 667 | nmdc:mga06z11_62633_c1 | 3300050494 | Bacteria | 1944 |
| 668 | nmdc:mga04h51_13797_c1 | 3300050495 | Bacteria | 2296 |
| 669 | nmdc:mga04h51_6972_c1 | 3300050495 | Bacteria | 2961 |
| 670 | nmdc:mga07m45_14063_c1 | 3300050496 | Bacteria | 4257 |
| 671 | nmdc:mga07m45_18291_c1 | 3300050496 | Bacteria | 3454 |
| 672 | nmdc:mga07m45_60490_c1 | 3300050496 | Bacteria | 2144 |
| 673 | nmdc:mga05p37_168741_c1 | 3300050507 | Bacteria | 2670 |
| 674 | nmdc:mga05p37_249168_c1 | 3300050507 | Bacteria | 2131 |
| 675 | nmdc:mga05p37_7716_c1 | 3300050507 | Bacteria | 12700 |
| 676 | nmdc:mga09592_179183_c1 | 3300050508 | Bacteria | 1833 |
| 677 | nmdc:mga09592_19936_c1 | 3300050508 | Bacteria | 5509 |
| 678 | nmdc:mga0qj67_19945_c1 | 3300050509 | Bacteria | 5130 |
| 679 | nmdc:mga06r32_293029_c1 | 3300050510 | Bacteria | 1614 |
| 680 | nmdc:mga06r32_435850_c1 | 3300050510 | Bacteria | 1291 |
| 681 | nmdc:mga06r32_456209_c1 | 3300050510 | Bacteria | 1258 |
| 682 | nmdc:mga08y16_116701_c1 | 3300050511 | Bacteria | 2779 |
| 683 | nmdc:mga08y16_25926_c1 | 3300050511 | Bacteria | 6185 |
| 684 | nmdc:mga0n895_2193_c1 | 3300050512 | Bacteria | 15106 |
| 685 | nmdc:mga0n895_23064_c1 | 3300050512 | Bacteria | 5845 |
| 686 | nmdc:mga0rr50_148051_c1 | 3300050513 | Bacteria | 1895 |
| 687 | nmdc:mga0rr50_453337_c1 | 3300050513 | Bacteria | 1087 |
| 688 | nmdc:mga08x19_235272_c1 | 3300050514 | Bacteria | 1262 |
| 689 | nmdc:mga0a205_117672_c1 | 3300050515 | Bacteria | 2556 |
| 690 | nmdc:mga0a205_1568_c1 | 3300050515 | Bacteria | 19587 |
| 691 | nmdc:mga0a205_195310_c1 | 3300050515 | Bacteria | 1915 |
| 692 | Ga0495601_0043276 | 3300053077 | Bacteria | 2828 |
| 693 | Ga0495612_0052657 | 3300053078 | Bacteria | 1675 |
| 694 | Ga0500644_0000054 | 3300053088 | Bacteria | 69110 |
| 695 | Ga0500641_0034407 | 3300053096 | Bacteria | 2017 |
| 696 | Ga0500556_0000446 | 3300053104 | Bacteria | 29406 |
| 697 | Ga0500593_001296 | 3300053117 | Bacteria | 9030 |
| 698 | Ga0500573_0007156 | 3300053140 | Bacteria | 6072 |
| 699 | Ga0501084_0003502 | 3300054114 | Bacteria | 12761 |
| 700 | Ga0501084_0006488 | 3300054114 | Bacteria | 9619 |
| 701 | Ga0501084_0007608 | 3300054114 | Bacteria | 8932 |
| 702 | Ga0501084_0252134 | 3300054114 | Bacteria | 1490 |
| 703 | Ga0590075_043158 | 3300059424 | Bacteria | 1153 |
| 704 | Ga0590075_044096 | 3300059424 | Bacteria | 1141 |
| 705 | Ga0590077_002079 | 3300059426 | Bacteria | 4384 |
| 706 | Ga0501082_0000550 | 3300060353 | Bacteria | 33364 |
| 707 | Ga0501082_0006458 | 3300060353 | Bacteria | 10168 |
| 708 | Ga0501082_0007866 | 3300060353 | Bacteria | 9199 |
| 709 | Ga0501082_0048486 | 3300060353 | Bacteria | 3660 |
| 710 | Ga0501082_0068553 | 3300060353 | Bacteria | 3054 |
| 711 | Ga0466962_0003384 | 3300061719 | Bacteria | 7591 |
| 712 | Ga0466962_0021546 | 3300061719 | Bacteria | 3094 |
| 713 | Ga0530510_0001653 | 3300061734 | Bacteria | 15078 |
| 714 | Ga0530510_0021895 | 3300061734 | Bacteria | 4550 |
| 715 | Ga0530510_0343419 | 3300061734 | Bacteria | 1121 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005340 | Ga0070689_100633132 | Ga0070689_1006331321 | 208 |
| 2 | 3300025936 | Ga0207670_10053678 | Ga0207670_100536781 | 208 |
| 3 | 3300046454 | Ga0495592_0356854 | Ga0495592_0356854_11_682 | 209 |
| 4 | 3300037471 | Ga0395905_0758747 | Ga0395905_0758747_23_700 | 223 |
| 5 | 3300047446 | Ga0495679_102658 | Ga0495679_102658_13_699 | 224 |
| 6 | 3300005434 | Ga0070709_10001220 | Ga0070709_100012204 | 230 |
| 7 | 3300005436 | Ga0070713_100021022 | Ga0070713_1000210225 | 230 |
| 8 | 3300006175 | Ga0070712_100090192 | Ga0070712_1000901922 | 230 |
| 9 | 3300025906 | Ga0207699_10008934 | Ga0207699_100089345 | 230 |
| 10 | 3300025915 | Ga0207693_10103059 | Ga0207693_101030591 | 230 |
| 11 | 3300025916 | Ga0207663_10225579 | Ga0207663_102255791 | 230 |
| 12 | 3300025928 | Ga0207700_10013738 | Ga0207700_100137382 | 230 |
| 13 | 3300025929 | Ga0207664_10072434 | Ga0207664_100724342 | 230 |
| 14 | 3300037853 | Ga0436364_1514249 | Ga0436364_1514249_1517_2290 | 230 |
| 15 | 3300009551 | Ga0105238_10545754 | Ga0105238_105457542 | 231 |
| 16 | 3300013308 | Ga0157375_10199974 | Ga0157375_101999742 | 231 |
| 17 | 3300035691 | Ga0373931_0358648 | Ga0373931_0358648_125_880 | 231 |
| 18 | 3300046536 | Ga0495587_0326833 | Ga0495587_0326833_40_795 | 231 |
| 19 | 3300046663 | Ga0495635_0109735 | Ga0495635_0109735_1046_1801 | 231 |
| 20 | 3300047322 | Ga0495680_0056581 | Ga0495680_0056581_1467_2222 | 231 |
| 21 | 3300048913 | Ga0496110_0069775 | Ga0496110_0069775_1319_2074 | 231 |
| 22 | 3300050490 | nmdc:mga03n38_2386_c1 | nmdc:mga03n38_2386_c1_4669_5373 | 234 |
| 23 | 3300050491 | nmdc:mga00v17_6019_c1 | nmdc:mga00v17_6019_c1_837_1541 | 234 |
| 24 | 3300050496 | nmdc:mga07m45_60490_c1 | nmdc:mga07m45_60490_c1_1061_1765 | 234 |
| 25 | iso_pu_bacteria | 2643221617 | 2644102800 | 234 |
| 26 | iso_pu_bacteria | 2643221620 | 2644118462 | 234 |
| 27 | 3300049573 | Ga0501037_0580623 | Ga0501037_0580623_20_727 | 235 |
| 28 | 3300005983 | Ga0081540_1067638 | Ga0081540_10676381 | 237 |
| 29 | 3300006038 | Ga0075365_10110613 | Ga0075365_101106132 | 238 |
| 30 | 3300006048 | Ga0075363_100017106 | Ga0075363_1000171062 | 238 |
| 31 | 3300006048 | Ga0075363_100113672 | Ga0075363_1001136722 | 238 |
| 32 | 3300006051 | Ga0075364_10015981 | Ga0075364_100159811 | 238 |
| 33 | 3300006051 | Ga0075364_10085842 | Ga0075364_100858421 | 238 |
| 34 | 3300037418 | Ga0395900_0187972 | Ga0395900_0187972_188_904 | 238 |
| 35 | 3300037466 | Ga0395898_0348558 | Ga0395898_0348558_410_1126 | 238 |
| 36 | 3300037471 | Ga0395905_0913942 | Ga0395905_0913942_29_745 | 238 |
| 37 | 3300038443 | Ga0395901_0164790 | Ga0395901_0164790_340_1056 | 238 |
| 38 | 3300044842 | Ga0466957_0423076 | Ga0466957_0423076_187_903 | 238 |
| 39 | 3300050496 | nmdc:mga07m45_14063_c1 | nmdc:mga07m45_14063_c1_2705_3421 | 238 |
| 40 | 3300053088 | Ga0500644_0000054 | Ga0500644_0000054_55542_56258 | 238 |
| 41 | 3300053140 | Ga0500573_0007156 | Ga0500573_0007156_1633_2349 | 238 |
| 42 | 3300005441 | Ga0070700_100064019 | Ga0070700_1000640192 | 239 |
| 43 | 3300031731 | Ga0307405_10134290 | Ga0307405_101342902 | 239 |
| 44 | 3300031903 | Ga0307407_10006812 | Ga0307407_100068122 | 239 |
| 45 | 3300031995 | Ga0307409_100010345 | Ga0307409_1000103454 | 239 |
| 46 | 3300031995 | Ga0307409_100033847 | Ga0307409_1000338473 | 239 |
| 47 | 3300032002 | Ga0307416_100017783 | Ga0307416_1000177833 | 239 |
| 48 | 3300032002 | Ga0307416_100084277 | Ga0307416_1000842772 | 239 |
| 49 | 3300032004 | Ga0307414_10137266 | Ga0307414_101372662 | 239 |
| 50 | 3300044693 | Ga0466961_0073191 | Ga0466961_0073191_19_738 | 239 |
| 51 | 3300044901 | Ga0466960_0008485 | Ga0466960_0008485_2475_3194 | 239 |
| 52 | 3300045976 | Ga0466967_0071078 | Ga0466967_0071078_881_1600 | 239 |
| 53 | 3300046543 | Ga0495645_0207262 | Ga0495645_0207262_194_955 | 239 |
| 54 | 3300046678 | Ga0495599_0161886 | Ga0495599_0161886_448_1209 | 239 |
| 55 | 3300048929 | Ga0496126_0195300 | Ga0496126_0195300_920_1639 | 239 |
| 56 | 3300049578 | Ga0501042_0236168 | Ga0501042_0236168_20_739 | 239 |
| 57 | 3300049824 | Ga0501045_0218829 | Ga0501045_0218829_117_836 | 239 |
| 58 | 3300025908 | Ga0207643_10316754 | Ga0207643_103167541 | 243 |
| 59 | iso_pu_bacteria | 2643221615 | 2644093435 | 243 |
| 60 | iso_pu_bacteria | 2643221657 | 2644323045 | 243 |
| 61 | 3300003373 | JGI25407J50210_10025897 | JGI25407J50210_100258972 | 244 |
| 62 | 3300005614 | Ga0068856_100039423 | Ga0068856_1000394235 | 244 |
| 63 | 3300005981 | Ga0081538_10000954 | Ga0081538_1000095418 | 244 |
| 64 | 3300005981 | Ga0081538_10004151 | Ga0081538_1000415110 | 244 |
| 65 | 3300009011 | Ga0105251_10054791 | Ga0105251_100547912 | 244 |
| 66 | 3300009093 | Ga0105240_10106628 | Ga0105240_101066282 | 244 |
| 67 | 3300009094 | Ga0111539_10534065 | Ga0111539_105340652 | 244 |
| 68 | 3300009101 | Ga0105247_10007081 | Ga0105247_100070812 | 244 |
| 69 | 3300009147 | Ga0114129_10140668 | Ga0114129_101406683 | 244 |
| 70 | 3300009174 | Ga0105241_10006049 | Ga0105241_100060496 | 244 |
| 71 | 3300009177 | Ga0105248_10466412 | Ga0105248_104664122 | 244 |
| 72 | 3300009545 | Ga0105237_10043607 | Ga0105237_100436072 | 244 |
| 73 | 3300009551 | Ga0105238_10086487 | Ga0105238_100864874 | 244 |
| 74 | 3300011119 | Ga0105246_10000926 | Ga0105246_100009268 | 244 |
| 75 | 3300013100 | Ga0157373_10188337 | Ga0157373_101883372 | 244 |
| 76 | 3300013102 | Ga0157371_10077677 | Ga0157371_100776772 | 244 |
| 77 | 3300013104 | Ga0157370_10262021 | Ga0157370_102620212 | 244 |
| 78 | 3300013105 | Ga0157369_10092325 | Ga0157369_100923252 | 244 |
| 79 | 3300013296 | Ga0157374_10007768 | Ga0157374_100077689 | 244 |
| 80 | 3300013297 | Ga0157378_10796364 | Ga0157378_107963641 | 244 |
| 81 | 3300013308 | Ga0157375_10054282 | Ga0157375_100542823 | 244 |
| 82 | 3300014497 | Ga0182008_10143697 | Ga0182008_101436972 | 244 |
| 83 | 3300014745 | Ga0157377_10162204 | Ga0157377_101622042 | 244 |
| 84 | 3300026078 | Ga0207702_10009452 | Ga0207702_100094524 | 244 |
| 85 | 3300042016 | Ga0439463_024791 | Ga0439463_024791_447_1187 | 244 |
| 86 | 3300042157 | Ga0439458_0003066 | Ga0439458_0003066_157_897 | 244 |
| 87 | 3300044694 | Ga0466963_0152941 | Ga0466963_0152941_531_1271 | 244 |
| 88 | 3300045976 | Ga0466967_0181081 | Ga0466967_0181081_1188_1928 | 244 |
| 89 | 3300048904 | Ga0496101_0030690 | Ga0496101_0030690_2583_3323 | 244 |
| 90 | 3300048905 | Ga0496102_0011896 | Ga0496102_0011896_2771_3511 | 244 |
| 91 | 3300048907 | Ga0496104_0006523 | Ga0496104_0006523_9013_9753 | 244 |
| 92 | 3300048908 | Ga0496105_0010138 | Ga0496105_0010138_5461_6201 | 244 |
| 93 | 3300048909 | Ga0496106_0010113 | Ga0496106_0010113_1350_2090 | 244 |
| 94 | 3300048910 | Ga0496107_0078784 | Ga0496107_0078784_121_861 | 244 |
| 95 | 3300048911 | Ga0496108_0275244 | Ga0496108_0275244_315_1055 | 244 |
| 96 | 3300048913 | Ga0496110_0024686 | Ga0496110_0024686_2281_3021 | 244 |
| 97 | 3300048914 | Ga0496111_0306303 | Ga0496111_0306303_258_998 | 244 |
| 98 | 3300049568 | Ga0501031_0059071 | Ga0501031_0059071_819_1619 | 244 |
| 99 | 3300049570 | Ga0501033_0060471 | Ga0501033_0060471_861_1661 | 244 |
| 100 | 3300049572 | Ga0501036_0056573 | Ga0501036_0056573_558_1358 | 244 |
| 101 | 3300049574 | Ga0501038_0004992 | Ga0501038_0004992_1665_2465 | 244 |
| 102 | 3300049575 | Ga0501039_0078889 | Ga0501039_0078889_930_1730 | 244 |
| 103 | 3300049576 | Ga0501040_0138020 | Ga0501040_0138020_661_1461 | 244 |
| 104 | 3300049580 | Ga0501046_0138566 | Ga0501046_0138566_391_1191 | 244 |
| 105 | 3300049582 | Ga0501048_0099333 | Ga0501048_0099333_841_1641 | 244 |
| 106 | 3300049590 | Ga0501074_0001096 | Ga0501074_0001096_7394_8194 | 244 |
| 107 | 3300049592 | Ga0501076_0048098 | Ga0501076_0048098_635_1435 | 244 |
| 108 | 3300049741 | Ga0501079_0039736 | Ga0501079_0039736_2009_2809 | 244 |
| 109 | 3300049743 | Ga0501081_0043087 | Ga0501081_0043087_1534_2334 | 244 |
| 110 | 3300049744 | Ga0501083_0115052 | Ga0501083_0115052_643_1443 | 244 |
| 111 | 3300049824 | Ga0501045_0120449 | Ga0501045_0120449_550_1350 | 244 |
| 112 | 3300050507 | nmdc:mga05p37_168741_c1 | nmdc:mga05p37_168741_c1_148_888 | 244 |
| 113 | 3300050508 | nmdc:mga09592_179183_c1 | nmdc:mga09592_179183_c1_383_1123 | 244 |
| 114 | 3300050510 | nmdc:mga06r32_293029_c1 | nmdc:mga06r32_293029_c1_249_989 | 244 |
| 115 | 3300050512 | nmdc:mga0n895_2193_c1 | nmdc:mga0n895_2193_c1_3092_3832 | 244 |
| 116 | 3300050513 | nmdc:mga0rr50_148051_c1 | nmdc:mga0rr50_148051_c1_765_1505 | 244 |
| 117 | 3300050514 | nmdc:mga08x19_235272_c1 | nmdc:mga08x19_235272_c1_340_1080 | 244 |
| 118 | 3300050515 | nmdc:mga0a205_1568_c1 | nmdc:mga0a205_1568_c1_12980_13720 | 244 |
| 119 | 3300054114 | Ga0501084_0006488 | Ga0501084_0006488_1178_1978 | 244 |
| 120 | 3300060353 | Ga0501082_0007866 | Ga0501082_0007866_6314_7114 | 244 |
| 121 | 3300005981 | Ga0081538_10078350 | Ga0081538_100783503 | 245 |
| 122 | 3300037466 | Ga0395898_0192499 | Ga0395898_0192499_823_1599 | 245 |
| 123 | 3300038443 | Ga0395901_0053961 | Ga0395901_0053961_2649_3425 | 245 |
| 124 | 3300038443 | Ga0395901_0058989 | Ga0395901_0058989_1435_2211 | 245 |
| 125 | 3300038443 | Ga0395901_0199018 | Ga0395901_0199018_347_1123 | 245 |
| 126 | iso_pu_bacteria | 2891395885 | 2891397077 | 246 |
| 127 | 3300005329 | Ga0070683_100283284 | Ga0070683_1002832842 | 247 |
| 128 | 3300005337 | Ga0070682_100276155 | Ga0070682_1002761552 | 247 |
| 129 | 3300005616 | Ga0068852_100261803 | Ga0068852_1002618032 | 247 |
| 130 | 3300005985 | Ga0081539_10018108 | Ga0081539_100181082 | 247 |
| 131 | 3300006038 | Ga0075365_10080934 | Ga0075365_100809342 | 247 |
| 132 | 3300009098 | Ga0105245_10056391 | Ga0105245_100563914 | 247 |
| 133 | 3300009176 | Ga0105242_10067430 | Ga0105242_100674301 | 247 |
| 134 | 3300009551 | Ga0105238_10162392 | Ga0105238_101623922 | 247 |
| 135 | 3300009553 | Ga0105249_10593027 | Ga0105249_105930272 | 247 |
| 136 | 3300010375 | Ga0105239_10132743 | Ga0105239_101327432 | 247 |
| 137 | 3300013306 | Ga0163162_10275536 | Ga0163162_102755362 | 247 |
| 138 | 3300013308 | Ga0157375_10039056 | Ga0157375_100390562 | 247 |
| 139 | 3300013308 | Ga0157375_10112420 | Ga0157375_101124202 | 247 |
| 140 | 3300014325 | Ga0163163_10140551 | Ga0163163_101405512 | 247 |
| 141 | 3300025927 | Ga0207687_10080223 | Ga0207687_100802234 | 247 |
| 142 | 3300025934 | Ga0207686_10057719 | Ga0207686_100577192 | 247 |
| 143 | 3300048904 | Ga0496101_0119204 | Ga0496101_0119204_1222_1965 | 247 |
| 144 | 3300048908 | Ga0496105_0028430 | Ga0496105_0028430_1736_2479 | 247 |
| 145 | 3300048911 | Ga0496108_0086748 | Ga0496108_0086748_667_1410 | 247 |
| 146 | 3300048913 | Ga0496110_0184840 | Ga0496110_0184840_1126_1869 | 247 |
| 147 | 3300048914 | Ga0496111_0025463 | Ga0496111_0025463_1699_2442 | 247 |
| 148 | 3300048915 | Ga0496112_0051712 | Ga0496112_0051712_1806_2549 | 247 |
| 149 | 3300048916 | Ga0496113_0032131 | Ga0496113_0032131_2887_3630 | 247 |
| 150 | 3300048917 | Ga0496114_0046582 | Ga0496114_0046582_1141_1884 | 247 |
| 151 | 3300049577 | Ga0501041_0017558 | Ga0501041_0017558_1389_2189 | 247 |
| 152 | 3300049742 | Ga0501080_0746138 | Ga0501080_0746138_26_769 | 247 |
| 153 | 3300050491 | nmdc:mga00v17_82957_c1 | nmdc:mga00v17_82957_c1_797_1540 | 247 |
| 154 | 3300053104 | Ga0500556_0000446 | Ga0500556_0000446_21235_21978 | 247 |
| 155 | 3300053117 | Ga0500593_001296 | Ga0500593_001296_6206_6949 | 247 |
| 156 | iso_pu_bacteria | 3001889506 | 3001892178 | 247 |
| 157 | 3300009094 | Ga0111539_10503688 | Ga0111539_105036882 | 248 |
| 158 | 3300009148 | Ga0105243_10358211 | Ga0105243_103582111 | 248 |
| 159 | 3300025945 | Ga0207679_10343453 | Ga0207679_103434531 | 248 |
| 160 | 3300026075 | Ga0207708_10091474 | Ga0207708_100914742 | 248 |
| 161 | 3300026118 | Ga0207675_100034967 | Ga0207675_1000349676 | 248 |
| 162 | 3300026121 | Ga0207683_10033590 | Ga0207683_100335904 | 248 |
| 163 | 3300027907 | Ga0207428_10083230 | Ga0207428_100832304 | 248 |
| 164 | 3300031911 | Ga0307412_10024506 | Ga0307412_100245062 | 248 |
| 165 | 3300032002 | Ga0307416_100063687 | Ga0307416_1000636874 | 248 |
| 166 | 3300037853 | Ga0436364_0700221 | Ga0436364_0700221_100_846 | 248 |
| 167 | 3300041443 | Ga0451789_0493370 | Ga0451789_0493370_1412_2164 | 248 |
| 168 | 3300041452 | Ga0451793_0112958 | Ga0451793_0112958_851_1603 | 248 |
| 169 | 3300041453 | Ga0451797_0393491 | Ga0451797_0393491_51_803 | 248 |
| 170 | 3300041491 | Ga0451833_1221655 | Ga0451833_1221655_292_1044 | 248 |
| 171 | 3300041498 | Ga0451841_0871602 | Ga0451841_0871602_43_795 | 248 |
| 172 | 3300041509 | Ga0451843_0604577 | Ga0451843_0604577_1053_1805 | 248 |
| 173 | 3300044694 | Ga0466963_0120276 | Ga0466963_0120276_457_1203 | 248 |
| 174 | 3300049568 | Ga0501031_0385810 | Ga0501031_0385810_15_761 | 248 |
| 175 | 3300049578 | Ga0501042_0597007 | Ga0501042_0597007_23_769 | 248 |
| 176 | 3300049592 | Ga0501076_0761039 | Ga0501076_0761039_42_788 | 248 |
| 177 | 3300049742 | Ga0501080_0626070 | Ga0501080_0626070_133_879 | 248 |
| 178 | iso_pu_bacteria | 2675903060 | 2676492937 | 248 |
| 179 | iso_pu_bacteria | 2873314349 | 2873316776 | 248 |
| 180 | iso_pu_bacteria | 2891554331 | 2891558095 | 248 |
| 181 | iso_pu_bacteria | 2643221679 | 2644444606 | 249 |
| 182 | iso_pu_bacteria | 2643221690 | 2644505062 | 249 |
| 183 | iso_pu_bacteria | 2643221694 | 2644527390 | 249 |
| 184 | iso_pu_bacteria | 2643221722 | 2644667545 | 249 |
| 185 | iso_pu_bacteria | 2811994880 | 2812362318 | 249 |
| 186 | iso_pu_bacteria | 2884994152 | 2884994378 | 249 |
| 187 | iso_pu_bacteria | 2887443736 | 2887446042 | 249 |
| 188 | iso_pu_bacteria | 2932431166 | 2932433111 | 249 |
| 189 | iso_pu_bacteria | 2784132109 | 2784472928 | 250 |
| 190 | 3300005455 | Ga0070663_100034144 | Ga0070663_1000341444 | 251 |
| 191 | 3300025932 | Ga0207690_10060370 | Ga0207690_100603702 | 251 |
| 192 | 3300026067 | Ga0207678_10055206 | Ga0207678_100552062 | 251 |
| 193 | 3300031731 | Ga0307405_10144624 | Ga0307405_101446241 | 251 |
| 194 | 3300031995 | Ga0307409_100247067 | Ga0307409_1002470672 | 251 |
| 195 | 3300032126 | Ga0307415_100012603 | Ga0307415_1000126034 | 251 |
| 196 | 3300038443 | Ga0395901_0603070 | Ga0395901_0603070_266_1060 | 251 |
| 197 | 3300048921 | Ga0496118_0269411 | Ga0496118_0269411_188_943 | 251 |
| 198 | 3300048922 | Ga0496119_0112151 | Ga0496119_0112151_611_1366 | 251 |
| 199 | 3300048928 | Ga0496125_0000913 | Ga0496125_0000913_32027_32782 | 251 |
| 200 | 3300049570 | Ga0501033_0391102 | Ga0501033_0391102_115_876 | 251 |
| 201 | 3300049572 | Ga0501036_0253642 | Ga0501036_0253642_599_1354 | 251 |
| 202 | 3300049574 | Ga0501038_0437196 | Ga0501038_0437196_152_907 | 251 |
| 203 | 3300049575 | Ga0501039_0150821 | Ga0501039_0150821_632_1387 | 251 |
| 204 | 3300049576 | Ga0501040_0014941 | Ga0501040_0014941_3806_4561 | 251 |
| 205 | 3300049577 | Ga0501041_0041547 | Ga0501041_0041547_1965_2720 | 251 |
| 206 | 3300049578 | Ga0501042_0030426 | Ga0501042_0030426_1412_2167 | 251 |
| 207 | 3300049580 | Ga0501046_0114170 | Ga0501046_0114170_336_1091 | 251 |
| 208 | 3300049587 | Ga0501071_0068348 | Ga0501071_0068348_148_903 | 251 |
| 209 | 3300049588 | Ga0501072_0016009 | Ga0501072_0016009_4112_4867 | 251 |
| 210 | 3300049591 | Ga0501075_0677382 | Ga0501075_0677382_21_776 | 251 |
| 211 | 3300049592 | Ga0501076_0034576 | Ga0501076_0034576_1444_2199 | 251 |
| 212 | 3300049593 | Ga0501077_0073195 | Ga0501077_0073195_1315_2070 | 251 |
| 213 | 3300049742 | Ga0501080_0104205 | Ga0501080_0104205_590_1345 | 251 |
| 214 | 3300049743 | Ga0501081_0055072 | Ga0501081_0055072_1618_2373 | 251 |
| 215 | 3300049824 | Ga0501045_0059178 | Ga0501045_0059178_848_1603 | 251 |
| 216 | 3300060353 | Ga0501082_0068553 | Ga0501082_0068553_185_940 | 251 |
| 217 | 3300061734 | Ga0530510_0021895 | Ga0530510_0021895_3036_3791 | 251 |
| 218 | 3300003320 | rootH2_10117484 | rootH2_101174842 | 252 |
| 219 | 3300006038 | Ga0075365_10208750 | Ga0075365_102087502 | 252 |
| 220 | 3300009147 | Ga0114129_10030977 | Ga0114129_100309779 | 252 |
| 221 | 3300050507 | nmdc:mga05p37_249168_c1 | nmdc:mga05p37_249168_c1_272_1045 | 252 |
| 222 | 3300053096 | Ga0500641_0034407 | Ga0500641_0034407_639_1400 | 252 |
| 223 | 3300001915 | JGI24741J21665_1019401 | JGI24741J21665_10194011 | 253 |
| 224 | 3300003203 | JGI25406J46586_10039621 | JGI25406J46586_100396213 | 253 |
| 225 | 3300003373 | JGI25407J50210_10060802 | JGI25407J50210_100608021 | 253 |
| 226 | 3300005327 | Ga0070658_10000469 | Ga0070658_1000046912 | 253 |
| 227 | 3300005329 | Ga0070683_100279893 | Ga0070683_1002798931 | 253 |
| 228 | 3300005336 | Ga0070680_100576975 | Ga0070680_1005769751 | 253 |
| 229 | 3300005339 | Ga0070660_100256202 | Ga0070660_1002562022 | 253 |
| 230 | 3300005347 | Ga0070668_100604435 | Ga0070668_1006044351 | 253 |
| 231 | 3300005367 | Ga0070667_100023486 | Ga0070667_1000234866 | 253 |
| 232 | 3300005439 | Ga0070711_100324554 | Ga0070711_1003245542 | 253 |
| 233 | 3300005440 | Ga0070705_100264110 | Ga0070705_1002641102 | 253 |
| 234 | 3300005456 | Ga0070678_100032787 | Ga0070678_1000327871 | 253 |
| 235 | 3300005457 | Ga0070662_100004379 | Ga0070662_1000043795 | 253 |
| 236 | 3300005459 | Ga0068867_100321400 | Ga0068867_1003214001 | 253 |
| 237 | 3300005535 | Ga0070684_100083840 | Ga0070684_1000838402 | 253 |
| 238 | 3300005546 | Ga0070696_100004312 | Ga0070696_1000043121 | 253 |
| 239 | 3300005546 | Ga0070696_100184379 | Ga0070696_1001843792 | 253 |
| 240 | 3300005615 | Ga0070702_100126457 | Ga0070702_1001264571 | 253 |
| 241 | 3300005719 | Ga0068861_100006622 | Ga0068861_1000066226 | 253 |
| 242 | 3300005719 | Ga0068861_100192866 | Ga0068861_1001928662 | 253 |
| 243 | 3300005937 | Ga0081455_10065105 | Ga0081455_100651054 | 253 |
| 244 | 3300005981 | Ga0081538_10012738 | Ga0081538_100127383 | 253 |
| 245 | 3300005981 | Ga0081538_10013828 | Ga0081538_100138284 | 253 |
| 246 | 3300005981 | Ga0081538_10017756 | Ga0081538_100177567 | 253 |
| 247 | 3300005981 | Ga0081538_10019528 | Ga0081538_100195284 | 253 |
| 248 | 3300005981 | Ga0081538_10038702 | Ga0081538_100387023 | 253 |
| 249 | 3300005985 | Ga0081539_10006160 | Ga0081539_100061609 | 253 |
| 250 | 3300005985 | Ga0081539_10059757 | Ga0081539_100597572 | 253 |
| 251 | 3300006847 | Ga0075431_100201056 | Ga0075431_1002010563 | 253 |
| 252 | 3300006881 | Ga0068865_100375091 | Ga0068865_1003750911 | 253 |
| 253 | 3300009147 | Ga0114129_10277820 | Ga0114129_102778202 | 253 |
| 254 | 3300009148 | Ga0105243_10068730 | Ga0105243_100687303 | 253 |
| 255 | 3300009148 | Ga0105243_10128699 | Ga0105243_101286991 | 253 |
| 256 | 3300009176 | Ga0105242_10007216 | Ga0105242_100072166 | 253 |
| 257 | 3300009177 | Ga0105248_10129953 | Ga0105248_101299531 | 253 |
| 258 | 3300009551 | Ga0105238_10172988 | Ga0105238_101729882 | 253 |
| 259 | 3300009553 | Ga0105249_10006439 | Ga0105249_1000643910 | 253 |
| 260 | 3300009553 | Ga0105249_10046304 | Ga0105249_100463042 | 253 |
| 261 | 3300009553 | Ga0105249_10612095 | Ga0105249_106120951 | 253 |
| 262 | 3300009993 | Ga0105028_107759 | Ga0105028_1077591 | 253 |
| 263 | 3300011119 | Ga0105246_10204796 | Ga0105246_102047962 | 253 |
| 264 | 3300013104 | Ga0157370_10349525 | Ga0157370_103495252 | 253 |
| 265 | 3300013105 | Ga0157369_10041564 | Ga0157369_100415642 | 253 |
| 266 | 3300013297 | Ga0157378_10039016 | Ga0157378_100390162 | 253 |
| 267 | 3300013306 | Ga0163162_10021242 | Ga0163162_100212423 | 253 |
| 268 | 3300013306 | Ga0163162_10049063 | Ga0163162_100490634 | 253 |
| 269 | 3300013306 | Ga0163162_10209049 | Ga0163162_102090493 | 253 |
| 270 | 3300013307 | Ga0157372_10019262 | Ga0157372_100192628 | 253 |
| 271 | 3300013307 | Ga0157372_10054992 | Ga0157372_100549925 | 253 |
| 272 | 3300013307 | Ga0157372_10248947 | Ga0157372_102489472 | 253 |
| 273 | 3300013308 | Ga0157375_10153340 | Ga0157375_101533401 | 253 |
| 274 | 3300013308 | Ga0157375_10189411 | Ga0157375_101894112 | 253 |
| 275 | 3300013308 | Ga0157375_11223943 | Ga0157375_112239431 | 253 |
| 276 | 3300017792 | Ga0163161_10107753 | Ga0163161_101077532 | 253 |
| 277 | 3300017792 | Ga0163161_10299420 | Ga0163161_102994202 | 253 |
| 278 | 3300020081 | Ga0206354_11252387 | Ga0206354_112523871 | 253 |
| 279 | 3300025899 | Ga0207642_10130525 | Ga0207642_101305252 | 253 |
| 280 | 3300025909 | Ga0207705_10468337 | Ga0207705_104683371 | 253 |
| 281 | 3300025919 | Ga0207657_10223573 | Ga0207657_102235731 | 253 |
| 282 | 3300025924 | Ga0207694_10109108 | Ga0207694_101091084 | 253 |
| 283 | 3300025927 | Ga0207687_10020856 | Ga0207687_100208563 | 253 |
| 284 | 3300025933 | Ga0207706_10005862 | Ga0207706_100058626 | 253 |
| 285 | 3300025934 | Ga0207686_10226037 | Ga0207686_102260372 | 253 |
| 286 | 3300025935 | Ga0207709_10017730 | Ga0207709_100177301 | 253 |
| 287 | 3300025938 | Ga0207704_10202251 | Ga0207704_102022512 | 253 |
| 288 | 3300025972 | Ga0207668_10052079 | Ga0207668_100520792 | 253 |
| 289 | 3300026089 | Ga0207648_10188014 | Ga0207648_101880142 | 253 |
| 290 | 3300026118 | Ga0207675_100001939 | Ga0207675_10000193914 | 253 |
| 291 | 3300028573 | Ga0265334_10001366 | Ga0265334_100013663 | 253 |
| 292 | 3300031247 | Ga0265340_10007568 | Ga0265340_100075685 | 253 |
| 293 | 3300031249 | Ga0265339_10031105 | Ga0265339_100311052 | 253 |
| 294 | 3300031548 | Ga0307408_100039897 | Ga0307408_1000398973 | 253 |
| 295 | 3300031548 | Ga0307408_100053725 | Ga0307408_1000537253 | 253 |
| 296 | 3300031548 | Ga0307408_100081356 | Ga0307408_1000813563 | 253 |
| 297 | 3300031691 | Ga0316579_10000156 | Ga0316579_1000015615 | 253 |
| 298 | 3300031691 | Ga0316579_10105926 | Ga0316579_101059261 | 253 |
| 299 | 3300031691 | Ga0316579_10160014 | Ga0316579_101600141 | 253 |
| 300 | 3300031712 | Ga0265342_10030328 | Ga0265342_100303283 | 253 |
| 301 | 3300031727 | Ga0316576_10022296 | Ga0316576_100222962 | 253 |
| 302 | 3300031727 | Ga0316576_10024186 | Ga0316576_100241865 | 253 |
| 303 | 3300031727 | Ga0316576_10046366 | Ga0316576_100463663 | 253 |
| 304 | 3300031727 | Ga0316576_10092348 | Ga0316576_100923482 | 253 |
| 305 | 3300031727 | Ga0316576_10255064 | Ga0316576_102550642 | 253 |
| 306 | 3300031731 | Ga0307405_10011341 | Ga0307405_100113413 | 253 |
| 307 | 3300031824 | Ga0307413_10040157 | Ga0307413_100401572 | 253 |
| 308 | 3300031824 | Ga0307413_10093534 | Ga0307413_100935342 | 253 |
| 309 | 3300031852 | Ga0307410_10021327 | Ga0307410_100213271 | 253 |
| 310 | 3300031852 | Ga0307410_10071656 | Ga0307410_100716563 | 253 |
| 311 | 3300031852 | Ga0307410_10114266 | Ga0307410_101142662 | 253 |
| 312 | 3300031901 | Ga0307406_10012216 | Ga0307406_100122163 | 253 |
| 313 | 3300031901 | Ga0307406_10016200 | Ga0307406_100162003 | 253 |
| 314 | 3300031901 | Ga0307406_10112736 | Ga0307406_101127362 | 253 |
| 315 | 3300031903 | Ga0307407_10059245 | Ga0307407_100592453 | 253 |
| 316 | 3300031903 | Ga0307407_10131963 | Ga0307407_101319632 | 253 |
| 317 | 3300031911 | Ga0307412_10048224 | Ga0307412_100482244 | 253 |
| 318 | 3300031995 | Ga0307409_100006642 | Ga0307409_1000066424 | 253 |
| 319 | 3300031995 | Ga0307409_100020155 | Ga0307409_1000201553 | 253 |
| 320 | 3300031995 | Ga0307409_100125352 | Ga0307409_1001253522 | 253 |
| 321 | 3300031995 | Ga0307409_100141422 | Ga0307409_1001414222 | 253 |
| 322 | 3300031995 | Ga0307409_100189200 | Ga0307409_1001892002 | 253 |
| 323 | 3300031995 | Ga0307409_100220069 | Ga0307409_1002200692 | 253 |
| 324 | 3300031995 | Ga0307409_100242183 | Ga0307409_1002421832 | 253 |
| 325 | 3300032002 | Ga0307416_100008910 | Ga0307416_1000089103 | 253 |
| 326 | 3300032002 | Ga0307416_100010351 | Ga0307416_1000103517 | 253 |
| 327 | 3300032002 | Ga0307416_100010961 | Ga0307416_1000109614 | 253 |
| 328 | 3300032002 | Ga0307416_100495143 | Ga0307416_1004951432 | 253 |
| 329 | 3300032004 | Ga0307414_10445988 | Ga0307414_104459882 | 253 |
| 330 | 3300032005 | Ga0307411_10006600 | Ga0307411_100066003 | 253 |
| 331 | 3300032005 | Ga0307411_10111605 | Ga0307411_101116052 | 253 |
| 332 | 3300032005 | Ga0307411_10185180 | Ga0307411_101851802 | 253 |
| 333 | 3300032126 | Ga0307415_100004206 | Ga0307415_1000042068 | 253 |
| 334 | 3300032126 | Ga0307415_100005648 | Ga0307415_1000056485 | 253 |
| 335 | 3300032126 | Ga0307415_100007567 | Ga0307415_1000075673 | 253 |
| 336 | 3300032126 | Ga0307415_100013045 | Ga0307415_1000130454 | 253 |
| 337 | 3300032126 | Ga0307415_100253545 | Ga0307415_1002535452 | 253 |
| 338 | 3300032139 | Ga0316580_10059742 | Ga0316580_100597422 | 253 |
| 339 | 3300035398 | Ga0316574_0000590 | Ga0316574_0000590_7710_8471 | 253 |
| 340 | 3300035398 | Ga0316574_0080599 | Ga0316574_0080599_237_998 | 253 |
| 341 | 3300035398 | Ga0316574_0185225 | Ga0316574_0185225_550_1311 | 253 |
| 342 | 3300036647 | Ga0316582_0151835 | Ga0316582_0151835_187_948 | 253 |
| 343 | 3300036647 | Ga0316582_0328911 | Ga0316582_0328911_62_823 | 253 |
| 344 | 3300036712 | Ga0316584_0000239 | Ga0316584_0000239_22831_23592 | 253 |
| 345 | 3300036712 | Ga0316584_0012516 | Ga0316584_0012516_4043_4804 | 253 |
| 346 | 3300036712 | Ga0316584_0045996 | Ga0316584_0045996_1079_1840 | 253 |
| 347 | 3300036712 | Ga0316584_0408351 | Ga0316584_0408351_161_922 | 253 |
| 348 | 3300037312 | Ga0395899_0010482 | Ga0395899_0010482_888_1649 | 253 |
| 349 | 3300037312 | Ga0395899_0233695 | Ga0395899_0233695_132_908 | 253 |
| 350 | 3300037418 | Ga0395900_0224816 | Ga0395900_0224816_208_984 | 253 |
| 351 | 3300037466 | Ga0395898_0072331 | Ga0395898_0072331_1967_2743 | 253 |
| 352 | 3300037471 | Ga0395905_0289329 | Ga0395905_0289329_210_986 | 253 |
| 353 | 3300038443 | Ga0395901_0317018 | Ga0395901_0317018_675_1451 | 253 |
| 354 | 3300038443 | Ga0395901_0467780 | Ga0395901_0467780_256_1032 | 253 |
| 355 | 3300038735 | Ga0400485_04221 | Ga0400485_04221_43356_44117 | 253 |
| 356 | 3300038742 | Ga0400486_29215 | Ga0400486_29215_31992_32753 | 253 |
| 357 | 3300042005 | Ga0439448_0087018 | Ga0439448_0087018_85_861 | 253 |
| 358 | 3300042006 | Ga0439432_017990 | Ga0439432_017990_1534_2295 | 253 |
| 359 | 3300042008 | Ga0439450_000083 | Ga0439450_000083_4495_5271 | 253 |
| 360 | 3300042008 | Ga0439450_016147 | Ga0439450_016147_362_1138 | 253 |
| 361 | 3300042011 | Ga0439454_006273 | Ga0439454_006273_654_1430 | 253 |
| 362 | 3300042012 | Ga0439455_0006749 | Ga0439455_0006749_993_1769 | 253 |
| 363 | 3300042014 | Ga0439457_012504 | Ga0439457_012504_822_1583 | 253 |
| 364 | 3300042014 | Ga0439457_028728 | Ga0439457_028728_420_1181 | 253 |
| 365 | 3300042016 | Ga0439463_000209 | Ga0439463_000209_871_1647 | 253 |
| 366 | 3300042016 | Ga0439463_015598 | Ga0439463_015598_865_1641 | 253 |
| 367 | 3300042120 | Ga0450917_005623 | Ga0450917_005623_77_853 | 253 |
| 368 | 3300042126 | Ga0450888_003486 | Ga0450888_003486_755_1531 | 253 |
| 369 | 3300042142 | Ga0450905_002810 | Ga0450905_002810_736_1512 | 253 |
| 370 | 3300042157 | Ga0439458_0054295 | Ga0439458_0054295_154_930 | 253 |
| 371 | 3300042437 | Ga0439444_0001594 | Ga0439444_0001594_923_1699 | 253 |
| 372 | 3300042439 | Ga0439464_0009244 | Ga0439464_0009244_657_1433 | 253 |
| 373 | 3300042461 | Ga0439460_0001259 | Ga0439460_0001259_4376_5152 | 253 |
| 374 | 3300042530 | Ga0450916_000488 | Ga0450916_000488_195_971 | 253 |
| 375 | 3300042993 | Ga0439440_0000290 | Ga0439440_0000290_4059_4835 | 253 |
| 376 | 3300042993 | Ga0439440_0014636 | Ga0439440_0014636_625_1401 | 253 |
| 377 | 3300044693 | Ga0466961_0073745 | Ga0466961_0073745_858_1625 | 253 |
| 378 | 3300044693 | Ga0466961_0178995 | Ga0466961_0178995_514_1281 | 253 |
| 379 | 3300044842 | Ga0466957_0038169 | Ga0466957_0038169_1011_1778 | 253 |
| 380 | 3300044901 | Ga0466960_0029524 | Ga0466960_0029524_897_1664 | 253 |
| 381 | 3300045976 | Ga0466967_0093943 | Ga0466967_0093943_139_900 | 253 |
| 382 | 3300046461 | Ga0495641_0041890 | Ga0495641_0041890_798_1568 | 253 |
| 383 | 3300046491 | Ga0495584_0058973 | Ga0495584_0058973_1084_1860 | 253 |
| 384 | 3300046501 | Ga0495607_0136351 | Ga0495607_0136351_112_888 | 253 |
| 385 | 3300046523 | Ga0495644_0046394 | Ga0495644_0046394_710_1486 | 253 |
| 386 | 3300046537 | Ga0495598_0073100 | Ga0495598_0073100_105_881 | 253 |
| 387 | 3300046539 | Ga0495621_0113821 | Ga0495621_0113821_70_846 | 253 |
| 388 | 3300046559 | Ga0495667_0281409 | Ga0495667_0281409_259_1020 | 253 |
| 389 | 3300046615 | Ga0495656_0025302 | Ga0495656_0025302_613_1389 | 253 |
| 390 | 3300046683 | Ga0495658_0303899 | Ga0495658_0303899_61_822 | 253 |
| 391 | 3300046692 | Ga0495671_0067940 | Ga0495671_0067940_60_836 | 253 |
| 392 | 3300047321 | Ga0495676_0043903 | Ga0495676_0043903_1065_1826 | 253 |
| 393 | 3300048903 | Ga0496100_0068871 | Ga0496100_0068871_209_970 | 253 |
| 394 | 3300048904 | Ga0496101_0404010 | Ga0496101_0404010_146_907 | 253 |
| 395 | 3300048907 | Ga0496104_0110681 | Ga0496104_0110681_1502_2272 | 253 |
| 396 | 3300048911 | Ga0496108_0055617 | Ga0496108_0055617_690_1460 | 253 |
| 397 | 3300048911 | Ga0496108_0288305 | Ga0496108_0288305_128_889 | 253 |
| 398 | 3300048912 | Ga0496109_0039577 | Ga0496109_0039577_1050_1820 | 253 |
| 399 | 3300048913 | Ga0496110_0083115 | Ga0496110_0083115_1663_2433 | 253 |
| 400 | 3300048913 | Ga0496110_0239915 | Ga0496110_0239915_514_1275 | 253 |
| 401 | 3300048914 | Ga0496111_0040524 | Ga0496111_0040524_18_779 | 253 |
| 402 | 3300048914 | Ga0496111_0100081 | Ga0496111_0100081_389_1159 | 253 |
| 403 | 3300048917 | Ga0496114_0287603 | Ga0496114_0287603_323_1093 | 253 |
| 404 | 3300048917 | Ga0496114_0304826 | Ga0496114_0304826_416_1177 | 253 |
| 405 | 3300048920 | Ga0496117_0029969 | Ga0496117_0029969_1254_2015 | 253 |
| 406 | 3300048921 | Ga0496118_0152418 | Ga0496118_0152418_66_827 | 253 |
| 407 | 3300048922 | Ga0496119_0034913 | Ga0496119_0034913_1379_2140 | 253 |
| 408 | 3300048925 | Ga0496122_0003466 | Ga0496122_0003466_10957_11718 | 253 |
| 409 | 3300048927 | Ga0496124_0050516 | Ga0496124_0050516_1762_2523 | 253 |
| 410 | 3300048928 | Ga0496125_0000015 | Ga0496125_0000015_192731_193492 | 253 |
| 411 | 3300049568 | Ga0501031_0003225 | Ga0501031_0003225_2272_3048 | 253 |
| 412 | 3300049569 | Ga0501032_0010375 | Ga0501032_0010375_1519_2295 | 253 |
| 413 | 3300049570 | Ga0501033_0007950 | Ga0501033_0007950_320_1096 | 253 |
| 414 | 3300049572 | Ga0501036_0003680 | Ga0501036_0003680_10427_11203 | 253 |
| 415 | 3300049572 | Ga0501036_0012468 | Ga0501036_0012468_5331_6107 | 253 |
| 416 | 3300049573 | Ga0501037_0006501 | Ga0501037_0006501_2528_3304 | 253 |
| 417 | 3300049574 | Ga0501038_0000456 | Ga0501038_0000456_10037_10813 | 253 |
| 418 | 3300049575 | Ga0501039_0002751 | Ga0501039_0002751_11443_12219 | 253 |
| 419 | 3300049575 | Ga0501039_0003077 | Ga0501039_0003077_1394_2170 | 253 |
| 420 | 3300049576 | Ga0501040_0002301 | Ga0501040_0002301_1068_1844 | 253 |
| 421 | 3300049576 | Ga0501040_0002316 | Ga0501040_0002316_10516_11292 | 253 |
| 422 | 3300049577 | Ga0501041_0000438 | Ga0501041_0000438_6306_7082 | 253 |
| 423 | 3300049577 | Ga0501041_0026479 | Ga0501041_0026479_2341_3117 | 253 |
| 424 | 3300049578 | Ga0501042_0001107 | Ga0501042_0001107_10576_11352 | 253 |
| 425 | 3300049578 | Ga0501042_0003246 | Ga0501042_0003246_1411_2187 | 253 |
| 426 | 3300049579 | Ga0501043_0018068 | Ga0501043_0018068_3816_4592 | 253 |
| 427 | 3300049580 | Ga0501046_0000721 | Ga0501046_0000721_7282_8058 | 253 |
| 428 | 3300049580 | Ga0501046_0053494 | Ga0501046_0053494_910_1686 | 253 |
| 429 | 3300049582 | Ga0501048_0000920 | Ga0501048_0000920_13547_14323 | 253 |
| 430 | 3300049582 | Ga0501048_0003693 | Ga0501048_0003693_1068_1844 | 253 |
| 431 | 3300049583 | Ga0501067_0169876 | Ga0501067_0169876_364_1140 | 253 |
| 432 | 3300049585 | Ga0501069_0087714 | Ga0501069_0087714_235_1011 | 253 |
| 433 | 3300049586 | Ga0501070_0115889 | Ga0501070_0115889_876_1652 | 253 |
| 434 | 3300049586 | Ga0501070_0220925 | Ga0501070_0220925_227_1003 | 253 |
| 435 | 3300049587 | Ga0501071_0012541 | Ga0501071_0012541_933_1709 | 253 |
| 436 | 3300049587 | Ga0501071_0057219 | Ga0501071_0057219_1060_1836 | 253 |
| 437 | 3300049588 | Ga0501072_0001219 | Ga0501072_0001219_8082_8858 | 253 |
| 438 | 3300049588 | Ga0501072_0042617 | Ga0501072_0042617_2371_3147 | 253 |
| 439 | 3300049589 | Ga0501073_0092822 | Ga0501073_0092822_1054_1830 | 253 |
| 440 | 3300049589 | Ga0501073_0240709 | Ga0501073_0240709_256_1032 | 253 |
| 441 | 3300049590 | Ga0501074_0005515 | Ga0501074_0005515_3620_4396 | 253 |
| 442 | 3300049590 | Ga0501074_0080750 | Ga0501074_0080750_622_1398 | 253 |
| 443 | 3300049591 | Ga0501075_0001417 | Ga0501075_0001417_4846_5622 | 253 |
| 444 | 3300049592 | Ga0501076_0005339 | Ga0501076_0005339_7551_8327 | 253 |
| 445 | 3300049592 | Ga0501076_0025085 | Ga0501076_0025085_939_1715 | 253 |
| 446 | 3300049593 | Ga0501077_0000877 | Ga0501077_0000877_10407_11183 | 253 |
| 447 | 3300049593 | Ga0501077_0048762 | Ga0501077_0048762_989_1765 | 253 |
| 448 | 3300049741 | Ga0501079_0001493 | Ga0501079_0001493_1059_1835 | 253 |
| 449 | 3300049742 | Ga0501080_0163873 | Ga0501080_0163873_880_1656 | 253 |
| 450 | 3300049744 | Ga0501083_0046450 | Ga0501083_0046450_719_1495 | 253 |
| 451 | 3300049822 | Ga0501035_0059019 | Ga0501035_0059019_1037_1813 | 253 |
| 452 | 3300049823 | Ga0501044_0007319 | Ga0501044_0007319_10193_10969 | 253 |
| 453 | 3300049824 | Ga0501045_0002730 | Ga0501045_0002730_9833_10609 | 253 |
| 454 | 3300050510 | nmdc:mga06r32_435850_c1 | nmdc:mga06r32_435850_c1_487_1263 | 253 |
| 455 | 3300050515 | nmdc:mga0a205_195310_c1 | nmdc:mga0a205_195310_c1_882_1658 | 253 |
| 456 | 3300054114 | Ga0501084_0003502 | Ga0501084_0003502_10931_11707 | 253 |
| 457 | 3300054114 | Ga0501084_0007608 | Ga0501084_0007608_722_1498 | 253 |
| 458 | 3300059424 | Ga0590075_043158 | Ga0590075_043158_37_813 | 253 |
| 459 | 3300059424 | Ga0590075_044096 | Ga0590075_044096_136_912 | 253 |
| 460 | 3300059426 | Ga0590077_002079 | Ga0590077_002079_78_854 | 253 |
| 461 | 3300060353 | Ga0501082_0000550 | Ga0501082_0000550_10603_11379 | 253 |
| 462 | 3300060353 | Ga0501082_0048486 | Ga0501082_0048486_1046_1822 | 253 |
| 463 | 3300061719 | Ga0466962_0021546 | Ga0466962_0021546_2073_2840 | 253 |
| 464 | 3300061734 | Ga0530510_0001653 | Ga0530510_0001653_10407_11183 | 253 |
| 465 | iso_pu_bacteria | 2811994874 | 2812331620 | 253 |
| 466 | 3300005327 | Ga0070658_10091178 | Ga0070658_100911781 | 254 |
| 467 | 3300005530 | Ga0070679_100474124 | Ga0070679_1004741241 | 254 |
| 468 | 3300009098 | Ga0105245_10348850 | Ga0105245_103488501 | 254 |
| 469 | 3300025909 | Ga0207705_10257717 | Ga0207705_102577173 | 254 |
| 470 | 3300025921 | Ga0207652_10070296 | Ga0207652_100702961 | 254 |
| 471 | 3300038443 | Ga0395901_0538061 | Ga0395901_0538061_223_990 | 254 |
| 472 | 3300041453 | Ga0451797_1210202 | Ga0451797_1210202_155_922 | 254 |
| 473 | 3300048909 | Ga0496106_0229749 | Ga0496106_0229749_332_1096 | 254 |
| 474 | 3300049572 | Ga0501036_0053829 | Ga0501036_0053829_1704_2471 | 254 |
| 475 | 3300049574 | Ga0501038_0003592 | Ga0501038_0003592_7218_7985 | 254 |
| 476 | 3300049580 | Ga0501046_0050259 | Ga0501046_0050259_1017_1784 | 254 |
| 477 | 3300049581 | Ga0501047_0013180 | Ga0501047_0013180_2491_3258 | 254 |
| 478 | 3300049583 | Ga0501067_0020313 | Ga0501067_0020313_1785_2552 | 254 |
| 479 | 3300049590 | Ga0501074_0190107 | Ga0501074_0190107_613_1380 | 254 |
| 480 | 3300049744 | Ga0501083_0010423 | Ga0501083_0010423_2851_3618 | 254 |
| 481 | 3300049822 | Ga0501035_0025283 | Ga0501035_0025283_1663_2430 | 254 |
| 482 | 3300060353 | Ga0501082_0006458 | Ga0501082_0006458_5324_6091 | 254 |
| 483 | iso_pu_bacteria | 2643221561 | 2643824012 | 254 |
| 484 | iso_pu_bacteria | 2643221696 | 2644533288 | 254 |
| 485 | iso_pu_bacteria | 2855386786 | 2855389415 | 254 |
| 486 | iso_pu_bacteria | 2857481737 | 2857484163 | 254 |
| 487 | 3300048913 | Ga0496110_0207935 | Ga0496110_0207935_803_1570 | 255 |
| 488 | iso_pu_bacteria | 2984576629 | 2984579731 | 255 |
| 489 | iso_pu_bacteria | 2990256926 | 2990257337 | 255 |
| 490 | 3300050492 | nmdc:mga0yw44_246264_c1 | nmdc:mga0yw44_246264_c1_190_960 | 256 |
| 491 | 3300050492 | nmdc:mga0yw44_92517_c1 | nmdc:mga0yw44_92517_c1_832_1602 | 256 |
| 492 | 3300005981 | Ga0081538_10015454 | Ga0081538_100154545 | 257 |
| 493 | 3300006038 | Ga0075365_10051936 | Ga0075365_100519363 | 257 |
| 494 | 3300006038 | Ga0075365_10098781 | Ga0075365_100987812 | 257 |
| 495 | 3300006038 | Ga0075365_10103746 | Ga0075365_101037462 | 257 |
| 496 | 3300006042 | Ga0075368_10009626 | Ga0075368_100096263 | 257 |
| 497 | 3300006042 | Ga0075368_10045500 | Ga0075368_100455002 | 257 |
| 498 | 3300006048 | Ga0075363_100016401 | Ga0075363_1000164012 | 257 |
| 499 | 3300006048 | Ga0075363_100021849 | Ga0075363_1000218492 | 257 |
| 500 | 3300006048 | Ga0075363_100031776 | Ga0075363_1000317762 | 257 |
| 501 | 3300006051 | Ga0075364_10008434 | Ga0075364_100084342 | 257 |
| 502 | 3300006177 | Ga0075362_10001895 | Ga0075362_100018955 | 257 |
| 503 | 3300006178 | Ga0075367_10056006 | Ga0075367_100560062 | 257 |
| 504 | 3300006178 | Ga0075367_10073487 | Ga0075367_100734872 | 257 |
| 505 | 3300006178 | Ga0075367_10166369 | Ga0075367_101663692 | 257 |
| 506 | 3300006353 | Ga0075370_10006757 | Ga0075370_100067573 | 257 |
| 507 | 3300006353 | Ga0075370_10019564 | Ga0075370_100195642 | 257 |
| 508 | 3300027866 | Ga0209813_10008237 | Ga0209813_100082372 | 257 |
| 509 | 3300027866 | Ga0209813_10009163 | Ga0209813_100091632 | 257 |
| 510 | 3300038443 | Ga0395901_0293332 | Ga0395901_0293332_183_956 | 257 |
| 511 | 3300044658 | Ga0466972_0097430 | Ga0466972_0097430_573_1346 | 257 |
| 512 | 3300044683 | Ga0466965_0012831 | Ga0466965_0012831_1462_2235 | 257 |
| 513 | 3300044693 | Ga0466961_0058546 | Ga0466961_0058546_1363_2136 | 257 |
| 514 | 3300044735 | Ga0466968_0192689 | Ga0466968_0192689_91_864 | 257 |
| 515 | 3300044765 | Ga0466970_0216536 | Ga0466970_0216536_264_1037 | 257 |
| 516 | 3300044901 | Ga0466960_0017249 | Ga0466960_0017249_1058_1831 | 257 |
| 517 | 3300044901 | Ga0466960_0032392 | Ga0466960_0032392_357_1130 | 257 |
| 518 | 3300045976 | Ga0466967_0020018 | Ga0466967_0020018_2679_3491 | 257 |
| 519 | 3300045976 | Ga0466967_0331707 | Ga0466967_0331707_80_853 | 257 |
| 520 | 3300049578 | Ga0501042_0055188 | Ga0501042_0055188_28_801 | 257 |
| 521 | 3300049578 | Ga0501042_0087028 | Ga0501042_0087028_1451_2224 | 257 |
| 522 | 3300049581 | Ga0501047_0000236 | Ga0501047_0000236_29100_29894 | 257 |
| 523 | 3300049583 | Ga0501067_0079975 | Ga0501067_0079975_902_1717 | 257 |
| 524 | 3300049587 | Ga0501071_0316691 | Ga0501071_0316691_139_954 | 257 |
| 525 | 3300049590 | Ga0501074_0055852 | Ga0501074_0055852_1247_2020 | 257 |
| 526 | 3300049590 | Ga0501074_0064035 | Ga0501074_0064035_613_1386 | 257 |
| 527 | 3300049592 | Ga0501076_0018992 | Ga0501076_0018992_1779_2552 | 257 |
| 528 | 3300049593 | Ga0501077_0340116 | Ga0501077_0340116_47_820 | 257 |
| 529 | 3300049741 | Ga0501079_0052977 | Ga0501079_0052977_1747_2520 | 257 |
| 530 | 3300049741 | Ga0501079_0089339 | Ga0501079_0089339_1576_2349 | 257 |
| 531 | 3300049743 | Ga0501081_0226335 | Ga0501081_0226335_198_1013 | 257 |
| 532 | 3300049822 | Ga0501035_0080543 | Ga0501035_0080543_1078_1851 | 257 |
| 533 | 3300049824 | Ga0501045_0189286 | Ga0501045_0189286_602_1417 | 257 |
| 534 | 3300050490 | nmdc:mga03n38_1401_c1 | nmdc:mga03n38_1401_c1_5493_6266 | 257 |
| 535 | 3300050491 | nmdc:mga00v17_109942_c1 | nmdc:mga00v17_109942_c1_782_1555 | 257 |
| 536 | 3300050491 | nmdc:mga00v17_146187_c1 | nmdc:mga00v17_146187_c1_565_1338 | 257 |
| 537 | 3300050491 | nmdc:mga00v17_18632_c1 | nmdc:mga00v17_18632_c1_294_1067 | 257 |
| 538 | 3300050492 | nmdc:mga0yw44_24694_c1 | nmdc:mga0yw44_24694_c1_1052_1825 | 257 |
| 539 | 3300050492 | nmdc:mga0yw44_277034_c1 | nmdc:mga0yw44_277034_c1_204_986 | 257 |
| 540 | 3300050492 | nmdc:mga0yw44_35004_c1 | nmdc:mga0yw44_35004_c1_1769_2542 | 257 |
| 541 | 3300050492 | nmdc:mga0yw44_4727_c1 | nmdc:mga0yw44_4727_c1_4717_5490 | 257 |
| 542 | 3300050494 | nmdc:mga06z11_55509_c1 | nmdc:mga06z11_55509_c1_626_1399 | 257 |
| 543 | 3300050494 | nmdc:mga06z11_56935_c1 | nmdc:mga06z11_56935_c1_132_905 | 257 |
| 544 | 3300050494 | nmdc:mga06z11_62633_c1 | nmdc:mga06z11_62633_c1_777_1550 | 257 |
| 545 | 3300050495 | nmdc:mga04h51_13797_c1 | nmdc:mga04h51_13797_c1_660_1433 | 257 |
| 546 | 3300050495 | nmdc:mga04h51_6972_c1 | nmdc:mga04h51_6972_c1_1344_2117 | 257 |
| 547 | 3300050496 | nmdc:mga07m45_18291_c1 | nmdc:mga07m45_18291_c1_1607_2380 | 257 |
| 548 | 3300054114 | Ga0501084_0252134 | Ga0501084_0252134_99_914 | 257 |
| 549 | iso_pu_bacteria | 2643221576 | 2643889960 | 257 |
| 550 | iso_pu_bacteria | 2643221590 | 2643959016 | 257 |
| 551 | iso_pu_bacteria | 2738541305 | 2738870483 | 257 |
| 552 | 3300000549 | LJQas_1002189 | LJQas_10021893 | 258 |
| 553 | 3300002075 | JGI24738J21930_10010635 | JGI24738J21930_100106351 | 258 |
| 554 | 3300005329 | Ga0070683_100411581 | Ga0070683_1004115811 | 258 |
| 555 | 3300005330 | Ga0070690_100101642 | Ga0070690_1001016422 | 258 |
| 556 | 3300005337 | Ga0070682_100042536 | Ga0070682_1000425363 | 258 |
| 557 | 3300005338 | Ga0068868_100140853 | Ga0068868_1001408532 | 258 |
| 558 | 3300005339 | Ga0070660_100019819 | Ga0070660_1000198192 | 258 |
| 559 | 3300005339 | Ga0070660_100340625 | Ga0070660_1003406251 | 258 |
| 560 | 3300005341 | Ga0070691_10020570 | Ga0070691_100205704 | 258 |
| 561 | 3300005345 | Ga0070692_10011405 | Ga0070692_100114052 | 258 |
| 562 | 3300005345 | Ga0070692_10215938 | Ga0070692_102159381 | 258 |
| 563 | 3300005354 | Ga0070675_100084521 | Ga0070675_1000845212 | 258 |
| 564 | 3300005356 | Ga0070674_100006352 | Ga0070674_1000063525 | 258 |
| 565 | 3300005366 | Ga0070659_100013002 | Ga0070659_1000130025 | 258 |
| 566 | 3300005366 | Ga0070659_100158161 | Ga0070659_1001581612 | 258 |
| 567 | 3300005435 | Ga0070714_100059948 | Ga0070714_1000599482 | 258 |
| 568 | 3300005438 | Ga0070701_10002932 | Ga0070701_100029325 | 258 |
| 569 | 3300005441 | Ga0070700_100012171 | Ga0070700_1000121712 | 258 |
| 570 | 3300005459 | Ga0068867_100007476 | Ga0068867_1000074763 | 258 |
| 571 | 3300005466 | Ga0070685_10004791 | Ga0070685_100047913 | 258 |
| 572 | 3300005471 | Ga0070698_100002013 | Ga0070698_1000020133 | 258 |
| 573 | 3300005535 | Ga0070684_100295550 | Ga0070684_1002955502 | 258 |
| 574 | 3300005543 | Ga0070672_100008593 | Ga0070672_1000085933 | 258 |
| 575 | 3300005547 | Ga0070693_100320887 | Ga0070693_1003208871 | 258 |
| 576 | 3300005564 | Ga0070664_100370958 | Ga0070664_1003709582 | 258 |
| 577 | 3300005577 | Ga0068857_100481591 | Ga0068857_1004815911 | 258 |
| 578 | 3300005616 | Ga0068852_100012448 | Ga0068852_1000124485 | 258 |
| 579 | 3300005719 | Ga0068861_100014873 | Ga0068861_1000148733 | 258 |
| 580 | 3300005719 | Ga0068861_100377907 | Ga0068861_1003779072 | 258 |
| 581 | 3300005937 | Ga0081455_10088495 | Ga0081455_100884953 | 258 |
| 582 | 3300005985 | Ga0081539_10094888 | Ga0081539_100948882 | 258 |
| 583 | 3300006058 | Ga0075432_10016682 | Ga0075432_100166823 | 258 |
| 584 | 3300006846 | Ga0075430_100002720 | Ga0075430_1000027209 | 258 |
| 585 | 3300006852 | Ga0075433_10065962 | Ga0075433_100659623 | 258 |
| 586 | 3300006871 | Ga0075434_100048569 | Ga0075434_1000485695 | 258 |
| 587 | 3300006880 | Ga0075429_100043597 | Ga0075429_1000435972 | 258 |
| 588 | 3300006881 | Ga0068865_100001987 | Ga0068865_10000198713 | 258 |
| 589 | 3300009147 | Ga0114129_10105667 | Ga0114129_101056672 | 258 |
| 590 | 3300009148 | Ga0105243_10005795 | Ga0105243_100057958 | 258 |
| 591 | 3300009177 | Ga0105248_10013985 | Ga0105248_100139856 | 258 |
| 592 | 3300009545 | Ga0105237_10069261 | Ga0105237_100692612 | 258 |
| 593 | 3300010375 | Ga0105239_10026886 | Ga0105239_100268863 | 258 |
| 594 | 3300010375 | Ga0105239_10366285 | Ga0105239_103662851 | 258 |
| 595 | 3300013307 | Ga0157372_10194758 | Ga0157372_101947582 | 258 |
| 596 | 3300013307 | Ga0157372_10350539 | Ga0157372_103505392 | 258 |
| 597 | 3300014325 | Ga0163163_10062499 | Ga0163163_100624994 | 258 |
| 598 | 3300014326 | Ga0157380_10453591 | Ga0157380_104535911 | 258 |
| 599 | 3300014745 | Ga0157377_10003538 | Ga0157377_100035386 | 258 |
| 600 | 3300020082 | Ga0206353_11164138 | Ga0206353_111641382 | 258 |
| 601 | 3300025908 | Ga0207643_10001431 | Ga0207643_100014314 | 258 |
| 602 | 3300025909 | Ga0207705_10542902 | Ga0207705_105429021 | 258 |
| 603 | 3300025914 | Ga0207671_10153124 | Ga0207671_101531242 | 258 |
| 604 | 3300025926 | Ga0207659_10033133 | Ga0207659_100331332 | 258 |
| 605 | 3300025929 | Ga0207664_10058004 | Ga0207664_100580042 | 258 |
| 606 | 3300025932 | Ga0207690_10056742 | Ga0207690_100567422 | 258 |
| 607 | 3300025932 | Ga0207690_10079345 | Ga0207690_100793452 | 258 |
| 608 | 3300025933 | Ga0207706_10419015 | Ga0207706_104190151 | 258 |
| 609 | 3300025935 | Ga0207709_10161812 | Ga0207709_101618122 | 258 |
| 610 | 3300025937 | Ga0207669_10030136 | Ga0207669_100301362 | 258 |
| 611 | 3300025938 | Ga0207704_10145864 | Ga0207704_101458642 | 258 |
| 612 | 3300025940 | Ga0207691_10002825 | Ga0207691_1000282516 | 258 |
| 613 | 3300025944 | Ga0207661_10265492 | Ga0207661_102654922 | 258 |
| 614 | 3300025944 | Ga0207661_10445981 | Ga0207661_104459812 | 258 |
| 615 | 3300025944 | Ga0207661_10642024 | Ga0207661_106420241 | 258 |
| 616 | 3300025949 | Ga0207667_10492430 | Ga0207667_104924302 | 258 |
| 617 | 3300025972 | Ga0207668_10066969 | Ga0207668_100669692 | 258 |
| 618 | 3300025981 | Ga0207640_10169122 | Ga0207640_101691222 | 258 |
| 619 | 3300026023 | Ga0207677_10090687 | Ga0207677_100906872 | 258 |
| 620 | 3300026075 | Ga0207708_10001532 | Ga0207708_100015325 | 258 |
| 621 | 3300026089 | Ga0207648_10002911 | Ga0207648_100029113 | 258 |
| 622 | 3300026095 | Ga0207676_10120967 | Ga0207676_101209672 | 258 |
| 623 | 3300026116 | Ga0207674_10183392 | Ga0207674_101833921 | 258 |
| 624 | 3300026118 | Ga0207675_100378937 | Ga0207675_1003789371 | 258 |
| 625 | 3300026121 | Ga0207683_10046075 | Ga0207683_100460753 | 258 |
| 626 | 3300026121 | Ga0207683_10199258 | Ga0207683_101992582 | 258 |
| 627 | 3300027907 | Ga0207428_10000433 | Ga0207428_1000043333 | 258 |
| 628 | 3300031731 | Ga0307405_10125675 | Ga0307405_101256752 | 258 |
| 629 | 3300031903 | Ga0307407_10036769 | Ga0307407_100367692 | 258 |
| 630 | 3300031911 | Ga0307412_10196345 | Ga0307412_101963452 | 258 |
| 631 | 3300031995 | Ga0307409_100009275 | Ga0307409_1000092752 | 258 |
| 632 | 3300031995 | Ga0307409_100654302 | Ga0307409_1006543022 | 258 |
| 633 | 3300032002 | Ga0307416_100002366 | Ga0307416_1000023664 | 258 |
| 634 | 3300032002 | Ga0307416_100268103 | Ga0307416_1002681032 | 258 |
| 635 | 3300032005 | Ga0307411_10683644 | Ga0307411_106836441 | 258 |
| 636 | 3300032126 | Ga0307415_100000133 | Ga0307415_1000001338 | 258 |
| 637 | 3300032126 | Ga0307415_100015987 | Ga0307415_1000159872 | 258 |
| 638 | 3300037312 | Ga0395899_0100863 | Ga0395899_0100863_372_1148 | 258 |
| 639 | 3300037466 | Ga0395898_0079593 | Ga0395898_0079593_829_1605 | 258 |
| 640 | 3300038443 | Ga0395901_0180146 | Ga0395901_0180146_1425_2201 | 258 |
| 641 | 3300041404 | Ga0439436_0070438 | Ga0439436_0070438_110_886 | 258 |
| 642 | 3300041405 | Ga0439438_045483 | Ga0439438_045483_11_787 | 258 |
| 643 | 3300041411 | Ga0439466_0058509 | Ga0439466_0058509_212_988 | 258 |
| 644 | 3300041413 | Ga0439465_0057245 | Ga0439465_0057245_422_1198 | 258 |
| 645 | 3300041997 | Ga0439431_0000830 | Ga0439431_0000830_2353_3129 | 258 |
| 646 | 3300042002 | Ga0439442_015704 | Ga0439442_015704_325_1101 | 258 |
| 647 | 3300042004 | Ga0439445_0005878 | Ga0439445_0005878_1690_2466 | 258 |
| 648 | 3300042435 | Ga0439434_0012312 | Ga0439434_0012312_1698_2474 | 258 |
| 649 | 3300044658 | Ga0466972_0009071 | Ga0466972_0009071_2594_3403 | 258 |
| 650 | 3300044658 | Ga0466972_0021964 | Ga0466972_0021964_1654_2430 | 258 |
| 651 | 3300044658 | Ga0466972_0095696 | Ga0466972_0095696_207_983 | 258 |
| 652 | 3300044683 | Ga0466965_0021164 | Ga0466965_0021164_479_1255 | 258 |
| 653 | 3300044683 | Ga0466965_0022613 | Ga0466965_0022613_1511_2389 | 258 |
| 654 | 3300044684 | Ga0466966_0083137 | Ga0466966_0083137_703_1479 | 258 |
| 655 | 3300044684 | Ga0466966_0250380 | Ga0466966_0250380_199_993 | 258 |
| 656 | 3300044693 | Ga0466961_0024622 | Ga0466961_0024622_1892_2719 | 258 |
| 657 | 3300044693 | Ga0466961_0053405 | Ga0466961_0053405_615_1493 | 258 |
| 658 | 3300044694 | Ga0466963_0057082 | Ga0466963_0057082_493_1269 | 258 |
| 659 | 3300044694 | Ga0466963_0215411 | Ga0466963_0215411_87_863 | 258 |
| 660 | 3300044694 | Ga0466963_0280046 | Ga0466963_0280046_164_973 | 258 |
| 661 | 3300044706 | Ga0466964_0008479 | Ga0466964_0008479_2431_3309 | 258 |
| 662 | 3300044706 | Ga0466964_0102654 | Ga0466964_0102654_446_1222 | 258 |
| 663 | 3300044719 | Ga0466971_0003441 | Ga0466971_0003441_4837_5715 | 258 |
| 664 | 3300044735 | Ga0466968_0039768 | Ga0466968_0039768_632_1408 | 258 |
| 665 | 3300044765 | Ga0466970_0009457 | Ga0466970_0009457_3030_3839 | 258 |
| 666 | 3300044765 | Ga0466970_0043911 | Ga0466970_0043911_179_955 | 258 |
| 667 | 3300044765 | Ga0466970_0290141 | Ga0466970_0290141_12_845 | 258 |
| 668 | 3300044842 | Ga0466957_0005119 | Ga0466957_0005119_4034_4912 | 258 |
| 669 | 3300044901 | Ga0466960_0015508 | Ga0466960_0015508_635_1468 | 258 |
| 670 | 3300044901 | Ga0466960_0026629 | Ga0466960_0026629_675_1451 | 258 |
| 671 | 3300044901 | Ga0466960_0053248 | Ga0466960_0053248_439_1224 | 258 |
| 672 | 3300044901 | Ga0466960_0087577 | Ga0466960_0087577_754_1563 | 258 |
| 673 | 3300044901 | Ga0466960_0149563 | Ga0466960_0149563_51_827 | 258 |
| 674 | 3300044901 | Ga0466960_0206025 | Ga0466960_0206025_15_791 | 258 |
| 675 | 3300045049 | Ga0466959_0194724 | Ga0466959_0194724_554_1381 | 258 |
| 676 | 3300045836 | Ga0466958_0017261 | Ga0466958_0017261_1325_2203 | 258 |
| 677 | 3300045976 | Ga0466967_0018178 | Ga0466967_0018178_767_1576 | 258 |
| 678 | 3300045976 | Ga0466967_0028283 | Ga0466967_0028283_1452_2228 | 258 |
| 679 | 3300045976 | Ga0466967_0055151 | Ga0466967_0055151_1755_2531 | 258 |
| 680 | 3300045976 | Ga0466967_0123847 | Ga0466967_0123847_530_1306 | 258 |
| 681 | 3300048905 | Ga0496102_0054566 | Ga0496102_0054566_912_1697 | 258 |
| 682 | 3300048906 | Ga0496103_0026509 | Ga0496103_0026509_1692_2477 | 258 |
| 683 | 3300048907 | Ga0496104_0086041 | Ga0496104_0086041_672_1457 | 258 |
| 684 | 3300048909 | Ga0496106_0000592 | Ga0496106_0000592_2072_2857 | 258 |
| 685 | 3300048909 | Ga0496106_0434975 | Ga0496106_0434975_227_1003 | 258 |
| 686 | 3300048910 | Ga0496107_0037764 | Ga0496107_0037764_2083_2868 | 258 |
| 687 | 3300048911 | Ga0496108_0058637 | Ga0496108_0058637_1557_2342 | 258 |
| 688 | 3300048912 | Ga0496109_0032171 | Ga0496109_0032171_2587_3417 | 258 |
| 689 | 3300048913 | Ga0496110_0034423 | Ga0496110_0034423_3300_4085 | 258 |
| 690 | 3300048913 | Ga0496110_0060048 | Ga0496110_0060048_117_905 | 258 |
| 691 | 3300048914 | Ga0496111_0187020 | Ga0496111_0187020_513_1340 | 258 |
| 692 | 3300048915 | Ga0496112_0475557 | Ga0496112_0475557_135_920 | 258 |
| 693 | 3300048916 | Ga0496113_0077586 | Ga0496113_0077586_1049_1834 | 258 |
| 694 | 3300048917 | Ga0496114_0177977 | Ga0496114_0177977_512_1369 | 258 |
| 695 | 3300049568 | Ga0501031_0170806 | Ga0501031_0170806_216_992 | 258 |
| 696 | 3300049568 | Ga0501031_0199473 | Ga0501031_0199473_261_1049 | 258 |
| 697 | 3300049569 | Ga0501032_0026571 | Ga0501032_0026571_2007_2783 | 258 |
| 698 | 3300049570 | Ga0501033_0000653 | Ga0501033_0000653_13907_14683 | 258 |
| 699 | 3300049571 | Ga0501034_0033211 | Ga0501034_0033211_2687_3463 | 258 |
| 700 | 3300049571 | Ga0501034_0046532 | Ga0501034_0046532_2446_3222 | 258 |
| 701 | 3300049571 | Ga0501034_0247426 | Ga0501034_0247426_115_891 | 258 |
| 702 | 3300049572 | Ga0501036_0037661 | Ga0501036_0037661_837_1613 | 258 |
| 703 | 3300049572 | Ga0501036_0041193 | Ga0501036_0041193_2170_2946 | 258 |
| 704 | 3300049573 | Ga0501037_0018913 | Ga0501037_0018913_1441_2217 | 258 |
| 705 | 3300049574 | Ga0501038_0095345 | Ga0501038_0095345_887_1663 | 258 |
| 706 | 3300049574 | Ga0501038_0182993 | Ga0501038_0182993_375_1202 | 258 |
| 707 | 3300049574 | Ga0501038_0358796 | Ga0501038_0358796_21_797 | 258 |
| 708 | 3300049575 | Ga0501039_0025643 | Ga0501039_0025643_1988_2764 | 258 |
| 709 | 3300049575 | Ga0501039_0532356 | Ga0501039_0532356_112_888 | 258 |
| 710 | 3300049578 | Ga0501042_0042313 | Ga0501042_0042313_747_1523 | 258 |
| 711 | 3300049579 | Ga0501043_0004024 | Ga0501043_0004024_4583_5359 | 258 |
| 712 | 3300049579 | Ga0501043_0221078 | Ga0501043_0221078_165_941 | 258 |
| 713 | 3300049579 | Ga0501043_0251411 | Ga0501043_0251411_277_1053 | 258 |
| 714 | 3300049580 | Ga0501046_0001166 | Ga0501046_0001166_3201_3977 | 258 |
| 715 | 3300049580 | Ga0501046_0017196 | Ga0501046_0017196_838_1614 | 258 |
| 716 | 3300049581 | Ga0501047_0089865 | Ga0501047_0089865_434_1210 | 258 |
| 717 | 3300049581 | Ga0501047_0107535 | Ga0501047_0107535_1022_1798 | 258 |
| 718 | 3300049582 | Ga0501048_0022061 | Ga0501048_0022061_3232_4008 | 258 |
| 719 | 3300049582 | Ga0501048_0423204 | Ga0501048_0423204_70_846 | 258 |
| 720 | 3300049583 | Ga0501067_0013732 | Ga0501067_0013732_2730_3506 | 258 |
| 721 | 3300049583 | Ga0501067_0019236 | Ga0501067_0019236_2808_3593 | 258 |
| 722 | 3300049586 | Ga0501070_0008079 | Ga0501070_0008079_7122_7898 | 258 |
| 723 | 3300049586 | Ga0501070_0037862 | Ga0501070_0037862_1302_2078 | 258 |
| 724 | 3300049588 | Ga0501072_0186820 | Ga0501072_0186820_737_1564 | 258 |
| 725 | 3300049589 | Ga0501073_0196955 | Ga0501073_0196955_116_892 | 258 |
| 726 | 3300049822 | Ga0501035_0121174 | Ga0501035_0121174_951_1727 | 258 |
| 727 | 3300049823 | Ga0501044_0020945 | Ga0501044_0020945_3576_4352 | 258 |
| 728 | 3300049823 | Ga0501044_0306110 | Ga0501044_0306110_460_1236 | 258 |
| 729 | 3300049824 | Ga0501045_0392250 | Ga0501045_0392250_159_986 | 258 |
| 730 | 3300050491 | nmdc:mga00v17_29950_c1 | nmdc:mga00v17_29950_c1_112_888 | 258 |
| 731 | 3300050507 | nmdc:mga05p37_7716_c1 | nmdc:mga05p37_7716_c1_7967_8770 | 258 |
| 732 | 3300050508 | nmdc:mga09592_19936_c1 | nmdc:mga09592_19936_c1_2105_2908 | 258 |
| 733 | 3300050509 | nmdc:mga0qj67_19945_c1 | nmdc:mga0qj67_19945_c1_1071_1874 | 258 |
| 734 | 3300050510 | nmdc:mga06r32_456209_c1 | nmdc:mga06r32_456209_c1_241_1044 | 258 |
| 735 | 3300050511 | nmdc:mga08y16_116701_c1 | nmdc:mga08y16_116701_c1_100_978 | 258 |
| 736 | 3300050511 | nmdc:mga08y16_25926_c1 | nmdc:mga08y16_25926_c1_326_1129 | 258 |
| 737 | 3300050512 | nmdc:mga0n895_23064_c1 | nmdc:mga0n895_23064_c1_1641_2444 | 258 |
| 738 | 3300050513 | nmdc:mga0rr50_453337_c1 | nmdc:mga0rr50_453337_c1_269_1054 | 258 |
| 739 | 3300050515 | nmdc:mga0a205_117672_c1 | nmdc:mga0a205_117672_c1_1586_2389 | 258 |
| 740 | 3300053077 | Ga0495601_0043276 | Ga0495601_0043276_1546_2334 | 258 |
| 741 | 3300053078 | Ga0495612_0052657 | Ga0495612_0052657_722_1510 | 258 |
| 742 | 3300061719 | Ga0466962_0003384 | Ga0466962_0003384_2845_3723 | 258 |
| 743 | 3300061734 | Ga0530510_0343419 | Ga0530510_0343419_132_908 | 258 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5hxo-assembly1.cif.gz_A | crystal structure of z,z-farnesyl diphosphate synthase with d71m, e75a and h103y mutants | 0.8823 | 29 | 252 |
| 5hxn-assembly1.cif.gz_A-2 | crystal structure of z,z-farnesyl diphosphate synthase (d71m and e75a mutants) from the wild tomato solanum habrochaites | 0.8806 | 29 | 253 |
| 5hxo-assembly1.cif.gz_A | crystal structure of z,z-farnesyl diphosphate synthase with d71m, e75a and h103y mutants | 0.8786 | 29 | 252 |
| 5hxp-assembly1.cif.gz_A | crystal structure of z,z-farnesyl diphosphate synthase (d71m, e75a and h103y mutants) complexed with ipp | 0.8782 | 24 | 257 |
| 5ygk-assembly1.cif.gz_A | crystal structure of a synthase from streptomyces sp. cl190 with dmaspp | 0.8765 | 33 | 249 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5hxoA00 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.8823 | 29 | 252 | 3.40.1180.10 |
| 5hxoA00 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.8786 | 29 | 252 | 3.40.1180.10 |
| af_Q58767_31_280_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.8609 | 14 | 258 | 3.40.1180.10 |
| 5hc7A00 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.858 | 27 | 252 | 3.40.1180.10 |
| af_K7KA63_68_310_3.40.1180.10 | Alpha Beta;3-Layer(aba) Sandwich;Undecaprenyl pyrophosphate synthetase;Decaprenyl diphosphate synthase-like | 0.8578 | 24 | 257 | 3.40.1180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6G3X3Y9-F1-model_v4 | Isoprenyl transferase | 0.9805 | 75 | 151 |
GO:0005886
GO:0016094 GO:0033850 GO:0045547 |
| AF-A0A202DGC7-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase | 0.9493 | 29 | 155 |
GO:0016094
GO:0045547 |
| AF-A0A524KN88-F1-model_v4 | Di-trans,poly-cis-decaprenylcistransferase (EC 2.5.1.31) | 0.9475 | 29 | 155 |
GO:0008834
GO:0016094 GO:0045547 |
| AF-A0A2S9REF4-F1-model_v4 | deleted | 0.9359 | 24 | 156 |
|
| AF-A0A6G3X3Y9-F1-model_v4 | Isoprenyl transferase | 0.9329 | 75 | 151 |
GO:0005886
GO:0016094 GO:0033850 GO:0045547 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar