F478633

General Info

Members Datasets Scaffolds Average Seq Length
742 390 740 131

Family's Representative Sequence

Representative Sequence 3300021388|Ga0213875_10183163|Ga0213875_101831632
Length 156
Sequence MLSDMHRLATKGAPIREGKQMAAEINIYNPKELGTPMGQYTHVTRVKATEFVFIAGMLAGDANDNIVGEGDFDAQVEQVFKNIEIALASAQVGWLNVVQFTTYLVHSQDIPKFMEFRKRAFPRMFSNGKYPPNTLLMVDRLVKESFLVEVQTIAAI

Samples

Sample ID Description Type Environment
1 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
2 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
24 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
25 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
26 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
57 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
82 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
115 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
116 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
117 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
118 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
119 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
120 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
121 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
126 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
127 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
200 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
206 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
207 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
211 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
212 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
213 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
214 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
215 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
216 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
217 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
218 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
219 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
220 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
221 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
222 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
223 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
224 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
225 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
226 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
227 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
228 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
229 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
234 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
235 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
236 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
240 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
241 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
242 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
245 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
246 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
247 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
256 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
257 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
260 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
263 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
264 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
265 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
266 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
267 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
268 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
269 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
270 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
271 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
272 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
273 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
274 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
275 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
276 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
277 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
278 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
279 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
280 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
281 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
288 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
294 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
295 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
296 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
297 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
298 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
299 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
300 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
301 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
302 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
303 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
304 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
305 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
306 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
307 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
308 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
309 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
310 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
311 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
312 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
313 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
314 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
315 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
316 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
317 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
318 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
319 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
320 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
321 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
322 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
323 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
324 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
325 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
326 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
327 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
328 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
329 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
336 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
337 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
338 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
339 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
340 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
341 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
342 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
343 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
344 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
345 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
346 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
347 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
355 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
356 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
358 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
360 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
361 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
362 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
367 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
368 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
369 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
370 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
371 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
372 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
374 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
375 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
376 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
377 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
378 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
379 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
380 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
381 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
382 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
383 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
384 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
385 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
386 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
387 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
388 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
389 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
390 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.73
Metatranscriptomes 0
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.27
Nodule 0.27
Rhizoplane 3.37
Rhizosphere 93.8
Stem 0
Stem Tuber 0
Unclassified 2.29

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24742J22300_10024783 3300002244 Bacteria 1035
2 JGI25405J52794_10100041 3300003911 Bacteria 646
3 Ga0065704_10325148 3300005289 Unclassified 846
4 Ga0065707_10005701 3300005295 Bacteria 2770
5 Ga0065707_10106587 3300005295 Bacteria 2590
6 Ga0065707_10731008 3300005295 Bacteria 626
7 Ga0070658_10364204 3300005327 Bacteria 1239
8 Ga0070683_100311306 3300005329 Bacteria 1498
9 Ga0070683_100336504 3300005329 Bacteria 1437
10 Ga0070690_100000172 3300005330 Bacteria 33180
11 Ga0070690_100029637 3300005330 Bacteria 3396
12 Ga0070690_100133703 3300005330 Bacteria 1678
13 Ga0070690_100578248 3300005330 Bacteria 850
14 Ga0068869_100004583 3300005334 Bacteria 8612
15 Ga0070666_10247213 3300005335 Bacteria 1262
16 Ga0070680_100000230 3300005336 Bacteria 36894
17 Ga0070680_100017864 3300005336 Bacteria 5596
18 Ga0070680_100234358 3300005336 Bacteria 1550
19 Ga0070682_100023353 3300005337 Bacteria 3670
20 Ga0068868_100001075 3300005338 Bacteria 18741
21 Ga0068868_100569867 3300005338 Bacteria 1000
22 Ga0068868_101669420 3300005338 Unclassified 600
23 Ga0070660_100437560 3300005339 Bacteria 1084
24 Ga0070689_100001034 3300005340 Bacteria 17460
25 Ga0070689_100158951 3300005340 Bacteria 1826
26 Ga0070691_10000935 3300005341 Bacteria 11861
27 Ga0070691_10186338 3300005341 Bacteria 1083
28 Ga0070691_10570298 3300005341 Unclassified 664
29 Ga0070687_100000141 3300005343 Bacteria 25042
30 Ga0070661_100735077 3300005344 Bacteria 806
31 Ga0070692_10002703 3300005345 Bacteria 6951
32 Ga0070692_10022726 3300005345 Bacteria 3066
33 Ga0070668_100135997 3300005347 Bacteria 1977
34 Ga0070669_100004039 3300005353 Bacteria 10618
35 Ga0070669_100229804 3300005353 Bacteria 1470
36 Ga0070675_100942597 3300005354 Bacteria 792
37 Ga0070671_101289879 3300005355 Bacteria 644
38 Ga0070674_100086449 3300005356 Bacteria 2252
39 Ga0070674_101046603 3300005356 Bacteria 718
40 Ga0070674_101855267 3300005356 Bacteria 547
41 Ga0070673_100027946 3300005364 Bacteria 4189
42 Ga0070673_100941539 3300005364 Bacteria 802
43 Ga0070673_101527146 3300005364 Bacteria 630
44 Ga0070688_101218612 3300005365 Bacteria 605
45 Ga0070659_100564095 3300005366 Bacteria 976
46 Ga0070667_101389817 3300005367 Bacteria 658
47 Ga0070703_10014775 3300005406 Bacteria 2227
48 Ga0070709_10097186 3300005434 Unclassified 1954
49 Ga0070709_10118326 3300005434 Bacteria 1792
50 Ga0070709_10142882 3300005434 Bacteria 1646
51 Ga0070714_100003691 3300005435 Bacteria 11465
52 Ga0070714_100042501 3300005435 Bacteria 3840
53 Ga0070713_100039796 3300005436 Bacteria 3818
54 Ga0070713_101287690 3300005436 Bacteria 708
55 Ga0070713_101767560 3300005436 Bacteria 600
56 Ga0070710_10022316 3300005437 Unclassified 3308
57 Ga0070701_10000216 3300005438 Bacteria 18130
58 Ga0070711_100235468 3300005439 Bacteria 1429
59 Ga0070705_100001001 3300005440 Bacteria 15736
60 Ga0070705_100013041 3300005440 Bacteria 4241
61 Ga0070700_100000591 3300005441 Bacteria 18135
62 Ga0070700_100304030 3300005441 Bacteria 1165
63 Ga0070694_100001923 3300005444 Bacteria 12299
64 Ga0070694_100003005 3300005444 Bacteria 10033
65 Ga0070694_100114267 3300005444 Bacteria 1927
66 Ga0070694_100115942 3300005444 Bacteria 1915
67 Ga0070708_100313445 3300005445 Bacteria 1478
68 Ga0070708_101075038 3300005445 Bacteria 754
69 Ga0070663_100322859 3300005455 Bacteria 1242
70 Ga0070678_101903225 3300005456 Bacteria 562
71 Ga0070662_101373442 3300005457 Unclassified 608
72 Ga0070681_10042871 3300005458 Bacteria 4534
73 Ga0070681_10110098 3300005458 Bacteria 2694
74 Ga0070681_10224793 3300005458 Bacteria 1792
75 Ga0070681_10485955 3300005458 Bacteria 1148
76 Ga0068867_100000275 3300005459 Bacteria 33877
77 Ga0068867_100000487 3300005459 Bacteria 26508
78 Ga0070706_100804209 3300005467 Bacteria 870
79 Ga0070706_101687902 3300005467 Bacteria 577
80 Ga0070698_100336715 3300005471 Bacteria 1440
81 Ga0070699_100034399 3300005518 Bacteria 4379
82 Ga0070679_100600987 3300005530 Bacteria 1043
83 Ga0070679_100781892 3300005530 Bacteria 898
84 Ga0070679_100839957 3300005530 Bacteria 862
85 Ga0070679_101889527 3300005530 Unclassified 546
86 Ga0070684_100016626 3300005535 Bacteria 6017
87 Ga0070684_100025358 3300005535 Bacteria 4983
88 Ga0070684_101167151 3300005535 Bacteria 724
89 Ga0070684_101222058 3300005535 Bacteria 707
90 Ga0068853_100136985 3300005539 Bacteria 2195
91 Ga0068853_100363900 3300005539 Bacteria 1348
92 Ga0068853_100615794 3300005539 Bacteria 1032
93 Ga0068853_100671872 3300005539 Bacteria 987
94 Ga0070672_100268151 3300005543 Bacteria 1441
95 Ga0070686_100000527 3300005544 Bacteria 22925
96 Ga0070686_100065931 3300005544 Bacteria 2353
97 Ga0070695_100000498 3300005545 Bacteria 20517
98 Ga0070695_100008411 3300005545 Bacteria 6126
99 Ga0070695_100249577 3300005545 Bacteria 1291
100 Ga0070696_100000061 3300005546 Bacteria 52371
101 Ga0070696_100074309 3300005546 Bacteria 2397
102 Ga0070696_100159185 3300005546 Bacteria 1663
103 Ga0070696_100466611 3300005546 Bacteria 999
104 Ga0070696_100533632 3300005546 Bacteria 938
105 Ga0070693_100000016 3300005547 Bacteria 63019
106 Ga0070693_100511286 3300005547 Bacteria 854
107 Ga0070665_100344579 3300005548 Bacteria 1495
108 Ga0070704_100000487 3300005549 Bacteria 18855
109 Ga0070704_100119723 3300005549 Bacteria 2020
110 Ga0070704_101026318 3300005549 Bacteria 747
111 Ga0068855_100000975 3300005563 Bacteria 35626
112 Ga0068855_100018315 3300005563 Bacteria 8412
113 Ga0068855_100353997 3300005563 Bacteria 1617
114 Ga0068855_100847732 3300005563 Bacteria 969
115 Ga0068855_100936053 3300005563 Bacteria 914
116 Ga0068857_100060760 3300005577 Bacteria 3356
117 Ga0068857_101524409 3300005577 Bacteria 652
118 Ga0068854_100000366 3300005578 Bacteria 28906
119 Ga0068856_100010596 3300005614 Bacteria 8957
120 Ga0068856_100020844 3300005614 Bacteria 6370
121 Ga0068856_101714046 3300005614 Unclassified 641
122 Ga0070702_100000485 3300005615 Bacteria 14291
123 Ga0068852_100240908 3300005616 Bacteria 1728
124 Ga0068852_102139086 3300005616 Bacteria 581
125 Ga0068859_100005636 3300005617 Bacteria 12764
126 Ga0068859_100513283 3300005617 Unclassified 1294
127 Ga0068864_100015369 3300005618 Bacteria 6364
128 Ga0068866_10000176 3300005718 Bacteria 29873
129 Ga0068866_10627521 3300005718 Unclassified 729
130 Ga0068861_100001699 3300005719 Bacteria 14134
131 Ga0068861_100004033 3300005719 Bacteria 9835
132 Ga0068851_10079942 3300005834 Bacteria 1706
133 Ga0068870_10013749 3300005840 Bacteria 3811
134 Ga0068870_10114773 3300005840 Bacteria 1543
135 Ga0068863_100568029 3300005841 Bacteria 1121
136 Ga0068858_100000619 3300005842 Bacteria 37094
137 Ga0068858_100091525 3300005842 Bacteria 2831
138 Ga0068858_102125838 3300005842 Bacteria 555
139 Ga0068860_100002570 3300005843 Bacteria 18998
140 Ga0068860_100847004 3300005843 Bacteria 929
141 Ga0068862_100003412 3300005844 Bacteria 13698
142 Ga0068862_100012212 3300005844 Bacteria 7099
143 Ga0068862_100459243 3300005844 Bacteria 1202
144 Ga0081455_10050130 3300005937 Bacteria 3593
145 Ga0081540_1000370 3300005983 Bacteria 45002
146 Ga0081539_10000008 3300005985 Bacteria 525071
147 Ga0070717_10089862 3300006028 Unclassified 2591
148 Ga0070717_10450680 3300006028 Bacteria 1160
149 Ga0070717_11051079 3300006028 Bacteria 742
150 Ga0070717_11256425 3300006028 Bacteria 673
151 Ga0075365_10206258 3300006038 Bacteria 1378
152 Ga0070715_10037076 3300006163 Bacteria 2015
153 Ga0070715_10694607 3300006163 Bacteria 607
154 Ga0070716_100003046 3300006173 Bacteria 7819
155 Ga0070716_100945551 3300006173 Bacteria 678
156 Ga0070712_100017433 3300006175 Bacteria 4649
157 Ga0070712_100908306 3300006175 Bacteria 759
158 Ga0097621_100001255 3300006237 Bacteria 17539
159 Ga0097621_100001554 3300006237 Bacteria 15677
160 Ga0097621_101034452 3300006237 Bacteria 769
161 Ga0068871_100002479 3300006358 Bacteria 12590
162 Ga0068871_100003865 3300006358 Bacteria 10325
163 Ga0075428_100000532 3300006844 Bacteria 38828
164 Ga0075428_100202643 3300006844 Bacteria 2145
165 Ga0075428_100520332 3300006844 Bacteria 1272
166 Ga0075428_100752533 3300006844 Bacteria 1037
167 Ga0075428_101355406 3300006844 Bacteria 747
168 Ga0075428_101971507 3300006844 Bacteria 606
169 Ga0075430_100001203 3300006846 Bacteria 20788
170 Ga0075430_100018890 3300006846 Bacteria 5865
171 Ga0075430_100267639 3300006846 Bacteria 1415
172 Ga0075430_100567535 3300006846 Bacteria 936
173 Ga0075430_101023258 3300006846 Bacteria 680
174 Ga0075430_101186501 3300006846 Bacteria 628
175 Ga0075431_100119157 3300006847 Bacteria 2723
176 Ga0075431_100816037 3300006847 Bacteria 905
177 Ga0075431_101715467 3300006847 Unclassified 585
178 Ga0075433_10463541 3300006852 Bacteria 1117
179 Ga0075434_100027094 3300006871 Bacteria 5625
180 Ga0075434_101060870 3300006871 Unclassified 824
181 Ga0075429_100321678 3300006880 Bacteria 1354
182 Ga0068865_100000262 3300006881 Bacteria 28966
183 Ga0068865_100162540 3300006881 Bacteria 1705
184 Ga0075436_100000639 3300006914 Bacteria 23035
185 Ga0075436_100032287 3300006914 Bacteria 3608
186 Ga0075436_100058044 3300006914 Bacteria 2673
187 Ga0097620_100005635 3300006931 Bacteria 12764
188 Ga0097620_100513330 3300006931 Unclassified 1294
189 Ga0075435_100009644 3300007076 Bacteria 7008
190 Ga0075435_100051941 3300007076 Bacteria 3303
191 Ga0075435_100364022 3300007076 Bacteria 1241
192 Ga0099794_10046095 3300007265 Bacteria 2087
193 Ga0099794_10266657 3300007265 Bacteria 884
194 Ga0099794_10273705 3300007265 Bacteria 872
195 Ga0099794_10291435 3300007265 Bacteria 845
196 Ga0099795_10104149 3300007788 Bacteria 1117
197 Ga0099795_10131555 3300007788 Bacteria 1010
198 Ga0099795_10346653 3300007788 Bacteria 663
199 Ga0105240_10054802 3300009093 Bacteria 4995
200 Ga0111539_10022190 3300009094 Bacteria 7804
201 Ga0111539_10046759 3300009094 Bacteria 5175
202 Ga0111539_10065376 3300009094 Bacteria 4298
203 Ga0111539_10147190 3300009094 Bacteria 2758
204 Ga0111539_12941698 3300009094 Bacteria 551
205 Ga0105245_10000178 3300009098 Bacteria 60846
206 Ga0105245_11615807 3300009098 Bacteria 700
207 Ga0105247_10182982 3300009101 Bacteria 1399
208 Ga0114129_10017720 3300009147 Bacteria 10142
209 Ga0114129_10102952 3300009147 Bacteria 3948
210 Ga0114129_10412330 3300009147 Bacteria 1778
211 Ga0114129_10511631 3300009147 Bacteria 1566
212 Ga0114129_10688549 3300009147 Bacteria 1315
213 Ga0105243_10000270 3300009148 Bacteria 58296
214 Ga0105241_10056256 3300009174 Bacteria 3016
215 Ga0105242_10000409 3300009176 Bacteria 34163
216 Ga0105242_10574225 3300009176 Bacteria 1085
217 Ga0105248_10306890 3300009177 Bacteria 1787
218 Ga0105237_10017737 3300009545 Bacteria 7380
219 Ga0105237_10084602 3300009545 Bacteria 3162
220 Ga0105238_10003279 3300009551 Bacteria 16156
221 Ga0105238_10296437 3300009551 Bacteria 1600
222 Ga0105238_10371092 3300009551 Bacteria 1421
223 Ga0105238_12601910 3300009551 Bacteria 542
224 Ga0105249_10012264 3300009553 Bacteria 7552
225 Ga0105249_10211874 3300009553 Bacteria 1902
226 Ga0105249_10793596 3300009553 Bacteria 1011
227 Ga0105249_12190751 3300009553 Bacteria 625
228 Ga0099796_10177522 3300010159 Bacteria 853
229 Ga0105239_10075790 3300010375 Bacteria 3699
230 Ga0105239_10130266 3300010375 Bacteria 2797
231 Ga0105239_10285791 3300010375 Bacteria 1857
232 Ga0105239_10505723 3300010375 Bacteria 1374
233 Ga0105246_10238273 3300011119 Bacteria 1437
234 Ga0105246_10902847 3300011119 Bacteria 792
235 Ga0105246_12408309 3300011119 Bacteria 516
236 Ga0157371_10343524 3300013102 Bacteria 1086
237 Ga0157370_10203136 3300013104 Bacteria 1838
238 Ga0157369_10056614 3300013105 Bacteria 4231
239 Ga0157369_10452283 3300013105 Bacteria 1330
240 Ga0157374_10405507 3300013296 Bacteria 1360
241 Ga0157378_11110754 3300013297 Bacteria 828
242 Ga0163162_10097503 3300013306 Bacteria 3028
243 Ga0163162_10396291 3300013306 Bacteria 1513
244 Ga0157372_10174365 3300013307 Bacteria 2489
245 Ga0157372_10735448 3300013307 Bacteria 1147
246 Ga0157372_11128184 3300013307 Bacteria 907
247 Ga0157375_10420185 3300013308 Bacteria 1503
248 Ga0157375_10736362 3300013308 Bacteria 1138
249 Ga0163163_10919906 3300014325 Bacteria 938
250 Ga0163163_12685922 3300014325 Bacteria 555
251 Ga0157380_10009920 3300014326 Bacteria 6836
252 Ga0157380_10029204 3300014326 Bacteria 4214
253 Ga0157380_10679445 3300014326 Bacteria 1031
254 Ga0157380_11430636 3300014326 Bacteria 743
255 Ga0157377_10147018 3300014745 Bacteria 1454
256 Ga0157379_10241373 3300014968 Bacteria 1639
257 Ga0157376_10008044 3300014969 Bacteria 7574
258 Ga0157376_10085285 3300014969 Bacteria 2721
259 Ga0213873_10108626 3300021358 Bacteria 804
260 Ga0213876_10012190 3300021384 Bacteria 4578
261 Ga0213875_10183163 3300021388 Unclassified 984
262 Ga0213871_10005256 3300021441 Bacteria 2655
263 Ga0207653_10007295 3300025885 Bacteria 3448
264 Ga0207692_10019156 3300025898 Unclassified 3087
265 Ga0207642_10010162 3300025899 Bacteria 3303
266 Ga0207642_10515909 3300025899 Unclassified 734
267 Ga0207688_10012274 3300025901 Bacteria 4661
268 Ga0207688_10113559 3300025901 Bacteria 1574
269 Ga0207647_10119993 3300025904 Bacteria 1551
270 Ga0207685_10027646 3300025905 Bacteria 1988
271 Ga0207685_10376210 3300025905 Bacteria 722
272 Ga0207699_10007692 3300025906 Bacteria 5276
273 Ga0207699_10201974 3300025906 Bacteria 1347
274 Ga0207699_10210401 3300025906 Bacteria 1322
275 Ga0207643_10017173 3300025908 Bacteria 3953
276 Ga0207643_10062857 3300025908 Bacteria 2122
277 Ga0207705_10206827 3300025909 Bacteria 1488
278 Ga0207684_10339434 3300025910 Bacteria 1294
279 Ga0207684_10828379 3300025910 Bacteria 781
280 Ga0207654_10168639 3300025911 Bacteria 1420
281 Ga0207707_10007441 3300025912 Bacteria 9540
282 Ga0207707_10143832 3300025912 Bacteria 2084
283 Ga0207707_10166471 3300025912 Bacteria 1926
284 Ga0207707_10405611 3300025912 Bacteria 1170
285 Ga0207695_10359879 3300025913 Bacteria 1342
286 Ga0207671_10342447 3300025914 Bacteria 1185
287 Ga0207671_11255388 3300025914 Bacteria 578
288 Ga0207693_10012174 3300025915 Bacteria 6949
289 Ga0207663_10000291 3300025916 Bacteria 21797
290 Ga0207663_10331253 3300025916 Bacteria 1147
291 Ga0207663_10773154 3300025916 Bacteria 764
292 Ga0207660_10002634 3300025917 Bacteria 11770
293 Ga0207660_10084516 3300025917 Bacteria 2339
294 Ga0207662_10000047 3300025918 Bacteria 52763
295 Ga0207662_10292893 3300025918 Bacteria 1080
296 Ga0207657_10101929 3300025919 Bacteria 2381
297 Ga0207649_10570320 3300025920 Bacteria 868
298 Ga0207652_10006338 3300025921 Bacteria 9558
299 Ga0207681_10005133 3300025923 Bacteria 8042
300 Ga0207681_10202933 3300025923 Bacteria 1523
301 Ga0207694_10146832 3300025924 Bacteria 1898
302 Ga0207659_10940782 3300025926 Bacteria 743
303 Ga0207687_10001597 3300025927 Bacteria 15607
304 Ga0207700_10121330 3300025928 Unclassified 2120
305 Ga0207700_10274711 3300025928 Bacteria 1447
306 Ga0207700_11189130 3300025928 Bacteria 681
307 Ga0207664_10021624 3300025929 Bacteria 4787
308 Ga0207664_10125999 3300025929 Bacteria 2150
309 Ga0207690_10278439 3300025932 Bacteria 1302
310 Ga0207690_10382846 3300025932 Bacteria 1118
311 Ga0207686_10000446 3300025934 Bacteria 27472
312 Ga0207709_10000910 3300025935 Bacteria 22284
313 Ga0207709_10043589 3300025935 Bacteria 2706
314 Ga0207670_10000462 3300025936 Bacteria 22646
315 Ga0207670_10296248 3300025936 Bacteria 1265
316 Ga0207669_10069537 3300025937 Bacteria 2203
317 Ga0207669_10523932 3300025937 Bacteria 952
318 Ga0207704_10000290 3300025938 Bacteria 23770
319 Ga0207704_10072596 3300025938 Bacteria 2188
320 Ga0207665_10000624 3300025939 Bacteria 23683
321 Ga0207665_10206725 3300025939 Bacteria 1432
322 Ga0207665_11278130 3300025939 Bacteria 585
323 Ga0207691_10322186 3300025940 Bacteria 1325
324 Ga0207711_10220954 3300025941 Bacteria 1733
325 Ga0207711_10666649 3300025941 Bacteria 970
326 Ga0207689_10000148 3300025942 Bacteria 60276
327 Ga0207689_10393572 3300025942 Bacteria 1155
328 Ga0207661_10013381 3300025944 Bacteria 5993
329 Ga0207667_10004155 3300025949 Bacteria 17792
330 Ga0207667_10046316 3300025949 Bacteria 4604
331 Ga0207667_10170941 3300025949 Bacteria 2234
332 Ga0207651_11285021 3300025960 Unclassified 658
333 Ga0207712_10012530 3300025961 Bacteria 5418
334 Ga0207712_11563492 3300025961 Unclassified 591
335 Ga0207668_10079503 3300025972 Bacteria 2372
336 Ga0207640_10000351 3300025981 Bacteria 30098
337 Ga0207677_10012717 3300026023 Bacteria 4852
338 Ga0207677_10501034 3300026023 Bacteria 1050
339 Ga0207677_10654851 3300026023 Bacteria 927
340 Ga0207703_10001208 3300026035 Bacteria 24188
341 Ga0207703_10159611 3300026035 Bacteria 1974
342 Ga0207703_11779942 3300026035 Bacteria 592
343 Ga0207639_10318474 3300026041 Bacteria 1380
344 Ga0207639_10416797 3300026041 Bacteria 1213
345 Ga0207639_10635066 3300026041 Bacteria 987
346 Ga0207678_10873331 3300026067 Bacteria 795
347 Ga0207708_10000676 3300026075 Bacteria 26062
348 Ga0207708_10025388 3300026075 Bacteria 4482
349 Ga0207702_10010733 3300026078 Bacteria 7649
350 Ga0207702_11067173 3300026078 Unclassified 801
351 Ga0207702_11618875 3300026078 Unclassified 641
352 Ga0207648_10000018 3300026089 Bacteria 148157
353 Ga0207648_10000431 3300026089 Bacteria 46287
354 Ga0207676_10019411 3300026095 Bacteria 4960
355 Ga0207674_11420738 3300026116 Bacteria 663
356 Ga0207675_100000170 3300026118 Bacteria 58303
357 Ga0207675_100003942 3300026118 Bacteria 14408
358 Ga0207675_101099197 3300026118 Bacteria 815
359 Ga0207683_10921922 3300026121 Bacteria 811
360 Ga0207698_10045738 3300026142 Bacteria 3299
361 Ga0209969_1005956 3300027360 Bacteria 1714
362 Ga0209969_1006243 3300027360 Bacteria 1677
363 Ga0209969_1010549 3300027360 Bacteria 1323
364 Ga0209967_1000349 3300027364 Bacteria 6170
365 Ga0209967_1077168 3300027364 Bacteria 522
366 Ga0209981_1000479 3300027378 Bacteria 5057
367 Ga0209981_1008438 3300027378 Bacteria 1399
368 Ga0209996_1003227 3300027395 Bacteria 2044
369 Ga0210000_1000972 3300027462 Bacteria 4011
370 Ga0210000_1017556 3300027462 Bacteria 1085
371 Ga0209995_1021285 3300027471 Bacteria 1075
372 Ga0209995_1083263 3300027471 Bacteria 549
373 Ga0209179_1020739 3300027512 Bacteria 1277
374 Ga0209999_1004910 3300027543 Bacteria 2405
375 Ga0209999_1006553 3300027543 Bacteria 2092
376 Ga0209999_1064526 3300027543 Bacteria 699
377 Ga0209982_1010156 3300027552 Bacteria 1394
378 Ga0209970_1006382 3300027614 Bacteria 1933
379 Ga0210002_1010884 3300027617 Bacteria 1401
380 Ga0209983_1017420 3300027665 Bacteria 1487
381 Ga0209588_1049730 3300027671 Bacteria 1356
382 Ga0209588_1089200 3300027671 Bacteria 994
383 Ga0209966_1003030 3300027695 Bacteria 2819
384 Ga0209998_10015880 3300027717 Bacteria 1581
385 Ga0207428_10000835 3300027907 Bacteria 34652
386 Ga0207428_10079253 3300027907 Bacteria 2568
387 Ga0207428_10132490 3300027907 Bacteria 1906
388 Ga0268266_10227172 3300028379 Bacteria 1718
389 Ga0268265_10001514 3300028380 Bacteria 19411
390 Ga0268265_10002339 3300028380 Bacteria 14386
391 Ga0268265_10435050 3300028380 Bacteria 1221
392 Ga0268264_10001414 3300028381 Bacteria 22435
393 Ga0268264_10232689 3300028381 Bacteria 1703
394 Ga0307515_10918991 3300028794 Bacteria 508
395 Ga0265325_10067621 3300031241 Bacteria 1800
396 Ga0265329_10051333 3300031242 Bacteria 1313
397 Ga0265340_10013061 3300031247 Bacteria 4372
398 Ga0265339_10003282 3300031249 Bacteria 11326
399 Ga0265331_10017380 3300031250 Bacteria 3752
400 Ga0265316_10055876 3300031344 Bacteria 3086
401 Ga0307508_10304251 3300031616 Bacteria 1187
402 Ga0265314_10086421 3300031711 Bacteria 2053
403 Ga0265314_10550889 3300031711 Bacteria 600
404 Ga0265342_10000026 3300031712 Bacteria 166610
405 Ga0265342_10009061 3300031712 Bacteria 7059
406 Ga0307413_11505153 3300031824 Unclassified 595
407 Ga0307410_11180728 3300031852 Bacteria 666
408 Ga0307412_10728011 3300031911 Bacteria 854
409 Ga0307416_100084175 3300032002 Bacteria 2702
410 Ga0307416_101465923 3300032002 Bacteria 788
411 Ga0307416_101882541 3300032002 Bacteria 702
412 Ga0373948_0027495 3300034817 Bacteria 1127
413 Ga0373950_0062014 3300034818 Bacteria 752
414 Ga0373958_0011120 3300034819 Bacteria 1515
415 Ga0373959_0162331 3300034820 Bacteria 571
416 Ga0373938_0052682 3300034957 Bacteria 933
417 Ga0373938_0095235 3300034957 Bacteria 741
418 Ga0373926_0009739 3300035083 Bacteria 3210
419 Ga0373929_0147138 3300035085 Unclassified 629
420 Ga0373934_0000157 3300035086 Bacteria 24724
421 Ga0373934_0002551 3300035086 Bacteria 6702
422 Ga0373940_0019387 3300035088 Bacteria 1718
423 Ga0373944_0011847 3300035089 Bacteria 2395
424 Ga0373944_0096979 3300035089 Bacteria 992
425 Ga0373949_0101589 3300035090 Unclassified 788
426 Ga0373951_0026110 3300035091 Bacteria 1360
427 Ga0373951_0105189 3300035091 Unclassified 754
428 Ga0373952_0074487 3300035092 Bacteria 855
429 Ga0373923_0242420 3300035111 Bacteria 842
430 Ga0373932_0003535 3300035112 Bacteria 3745
431 Ga0373932_0005272 3300035112 Bacteria 3040
432 Ga0373936_0012446 3300035113 Bacteria 3236
433 Ga0373936_0031196 3300035113 Bacteria 2104
434 Ga0373939_0013282 3300035114 Bacteria 2116
435 Ga0373939_0150744 3300035114 Bacteria 846
436 Ga0373939_0368031 3300035114 Bacteria 589
437 Ga0373941_0025111 3300035115 Bacteria 1718
438 Ga0373945_0016153 3300035116 Bacteria 2514
439 Ga0373953_0157129 3300035117 Bacteria 976
440 Ga0373953_0164379 3300035117 Bacteria 954
441 Ga0373954_0000723 3300035118 Bacteria 12725
442 Ga0373954_0007812 3300035118 Bacteria 4684
443 Ga0373954_0019589 3300035118 Bacteria 3053
444 Ga0373956_0000273 3300035119 Bacteria 20669
445 Ga0373956_0021831 3300035119 Bacteria 2732
446 Ga0373956_0386289 3300035119 Bacteria 668
447 Ga0373957_0004451 3300035120 Bacteria 4264
448 Ga0373957_0023316 3300035120 Bacteria 2212
449 Ga0373960_0069525 3300035121 Bacteria 1086
450 Ga0373960_0220844 3300035121 Bacteria 678
451 Ga0373943_0065949 3300035170 Bacteria 1822
452 Ga0373943_0102929 3300035170 Bacteria 1496
453 Ga0373946_0011082 3300035171 Bacteria 3354
454 Ga0373946_0085804 3300035171 Bacteria 1386
455 Ga0373955_0008143 3300035172 Bacteria 4850
456 Ga0373955_0015370 3300035172 Bacteria 3746
457 Ga0373955_0082423 3300035172 Bacteria 1820
458 Ga0373955_0481475 3300035172 Bacteria 757
459 Ga0373942_0002745 3300035207 Bacteria 4203
460 Ga0373942_0028241 3300035207 Bacteria 1465
461 Ga0373942_0280435 3300035207 Bacteria 574
462 Ga0373961_0016133 3300035241 Bacteria 1921
463 Ga0373961_0048712 3300035241 Unclassified 1249
464 Ga0373961_0055087 3300035241 Bacteria 1190
465 Ga0373962_0100110 3300035242 Bacteria 903
466 Ga0373962_0106460 3300035242 Bacteria 880
467 Ga0373924_0041056 3300035410 Bacteria 1895
468 Ga0373931_0003435 3300035691 Bacteria 7113
469 Ga0373931_0037614 3300035691 Bacteria 2527
470 Ga0373931_0177315 3300035691 Bacteria 1260
471 Ga0373931_0487396 3300035691 Bacteria 793
472 Ga0373935_0015295 3300035692 Bacteria 4635
473 Ga0373935_0329750 3300035692 Bacteria 1084
474 Ga0373935_0370001 3300035692 Bacteria 1025
475 Ga0373927_0025425 3300035695 Bacteria 3871
476 Ga0373927_0109836 3300035695 Bacteria 1796
477 Ga0373933_0000480 3300035724 Bacteria 24930
478 Ga0373933_0122493 3300035724 Bacteria 1629
479 Ga0373947_0067283 3300035725 Bacteria 2188
480 Ga0373937_0001784 3300036401 Bacteria 18069
481 Ga0373937_0049292 3300036401 Bacteria 3856
482 Ga0373937_0116819 3300036401 Bacteria 2484
483 Ga0373937_0173406 3300036401 Bacteria 2024
484 Ga0373937_0195082 3300036401 Bacteria 1903
485 Ga0373925_0011560 3300037068 Bacteria 6385
486 Ga0395900_0117051 3300037418 Bacteria 2735
487 Ga0436364_1113710 3300037853 Bacteria 3647
488 Ga0395901_0056419 3300038443 Bacteria 4086
489 Ga0436365_0079817 3300039437 Bacteria 3681
490 Ga0436365_0287902 3300039437 Bacteria 866
491 Ga0436365_1366479 3300039437 Bacteria 2061
492 Ga0436365_1679214 3300039437 Bacteria 929
493 Ga0436360_0280684 3300039438 Bacteria 4981
494 Ga0436360_0478030 3300039438 Bacteria 3048
495 Ga0436360_0811880 3300039438 Bacteria 599
496 Ga0436361_1208236 3300039447 Bacteria 1820
497 Ga0436363_1102627 3300039450 Bacteria 556
498 Ga0436363_1654719 3300039450 Bacteria 1240
499 Ga0436362_0127817 3300039453 Bacteria 1899
500 Ga0436362_0345626 3300039453 Unclassified 567
501 Ga0439453_0003672 3300041408 Bacteria 2226
502 Ga0451789_0234132 3300041443 Bacteria 620
503 Ga0451807_2199014 3300041486 Bacteria 2201
504 Ga0451807_2462780 3300041486 Bacteria 1645
505 Ga0451853_0460087 3300041512 Bacteria 1103
506 Ga0439441_005775 3300042001 Bacteria 1936
507 Ga0439443_001965 3300042003 Bacteria 2385
508 Ga0439451_010051 3300042009 Bacteria 1909
509 Ga0439451_087259 3300042009 Bacteria 628
510 Ga0439446_0175315 3300042156 Bacteria 715
511 Ga0439446_0223913 3300042156 Bacteria 642
512 Ga0439434_0000074 3300042435 Bacteria 24821
513 Ga0439434_0070864 3300042435 Bacteria 1097
514 Ga0439435_0000001 3300042436 Bacteria 43463
515 Ga0439435_0000154 3300042436 Bacteria 9383
516 Ga0439435_0000817 3300042436 Bacteria 5300
517 Ga0439444_0002711 3300042437 Bacteria 2446
518 Ga0439444_0032773 3300042437 Bacteria 984
519 Ga0439464_0038631 3300042439 Bacteria 1356
520 Ga0439460_0000495 3300042461 Bacteria 8550
521 Ga0439460_0151211 3300042461 Bacteria 774
522 Ga0451577_0109406 3300042876 Bacteria 2471
523 Ga0451577_1021107 3300042876 Unclassified 742
524 Ga0439440_0102072 3300042993 Bacteria 781
525 Ga0453683_0577435 3300044673 Unclassified 732
526 Ga0466963_0373859 3300044694 Unclassified 1004
527 Ga0466963_0720945 3300044694 Bacteria 704
528 Ga0466964_0317783 3300044706 Unclassified 790
529 Ga0466957_0801542 3300044842 Bacteria 669
530 Ga0451576_0003549 3300045051 Bacteria 21244
531 Ga0451576_0068493 3300045051 Bacteria 3693
532 Ga0451576_0224289 3300045051 Bacteria 1962
533 Ga0451576_0226654 3300045051 Bacteria 1951
534 Ga0466967_0192036 3300045976 Unclassified 1930
535 Ga0466967_0518298 3300045976 Bacteria 1171
536 Ga0495592_0003654 3300046454 Bacteria 11080
537 Ga0495592_0046909 3300046454 Bacteria 3219
538 Ga0495603_0076782 3300046455 Bacteria 1960
539 Ga0495603_0243415 3300046455 Bacteria 1036
540 Ga0495629_0144629 3300046459 Bacteria 1654
541 Ga0495638_0464316 3300046460 Bacteria 644
542 Ga0495641_0005394 3300046461 Bacteria 8652
543 Ga0495651_0001404 3300046462 Bacteria 18677
544 Ga0495651_0010052 3300046462 Bacteria 7271
545 Ga0495580_0001708 3300046472 Bacteria 19287
546 Ga0495580_0032036 3300046472 Bacteria 3795
547 Ga0495582_0096153 3300046473 Bacteria 1655
548 Ga0495582_0100238 3300046473 Bacteria 1621
549 Ga0495639_0005581 3300046475 Bacteria 5418
550 Ga0495639_0009811 3300046475 Bacteria 4110
551 Ga0495662_0023307 3300046476 Bacteria 2988
552 Ga0495664_0035621 3300046477 Bacteria 2931
553 Ga0495664_0339728 3300046477 Bacteria 905
554 Ga0495594_0052450 3300046499 Bacteria 2245
555 Ga0495628_0003204 3300046516 Bacteria 14671
556 Ga0495628_0026741 3300046516 Bacteria 4699
557 Ga0495628_0031003 3300046516 Bacteria 4325
558 Ga0495628_0335799 3300046516 Bacteria 1113
559 Ga0495630_0009427 3300046517 Bacteria 7018
560 Ga0495630_0180845 3300046517 Bacteria 1608
561 Ga0495630_0331289 3300046517 Bacteria 1164
562 Ga0495630_0395570 3300046517 Bacteria 1059
563 Ga0495666_0023406 3300046526 Bacteria 3054
564 Ga0495666_0056142 3300046526 Bacteria 1886
565 Ga0495642_0034646 3300046528 Bacteria 2034
566 Ga0495642_0076995 3300046528 Bacteria 1401
567 Ga0495652_0031108 3300046529 Bacteria 4676
568 Ga0495665_0015081 3300046531 Bacteria 4165
569 Ga0495640_0055508 3300046533 Bacteria 2709
570 Ga0495586_0012380 3300046535 Bacteria 4524
571 Ga0495586_0123421 3300046535 Bacteria 1447
572 Ga0495587_0028384 3300046536 Bacteria 3402
573 Ga0495587_0104533 3300046536 Bacteria 1630
574 Ga0495621_0029405 3300046539 Bacteria 1873
575 Ga0495645_0170458 3300046543 Bacteria 1498
576 Ga0495622_0019107 3300046557 Bacteria 3191
577 Ga0495667_0006877 3300046559 Bacteria 7726
578 Ga0495667_0038003 3300046559 Bacteria 3206
579 Ga0495656_0251639 3300046615 Bacteria 893
580 Ga0495634_0106415 3300046642 Bacteria 1807
581 Ga0495634_0339215 3300046642 Bacteria 902
582 Ga0495635_0023515 3300046663 Bacteria 4293
583 Ga0495588_0116767 3300046674 Bacteria 1406
584 Ga0495588_0184870 3300046674 Bacteria 1101
585 Ga0495588_0305277 3300046674 Bacteria 838
586 Ga0495657_0006684 3300046675 Bacteria 9003
587 Ga0495657_0193579 3300046675 Bacteria 1242
588 Ga0495599_0013413 3300046678 Bacteria 5063
589 Ga0495599_0040993 3300046678 Bacteria 2907
590 Ga0495646_0580384 3300046680 Bacteria 571
591 Ga0495647_0012311 3300046681 Bacteria 2944
592 Ga0495647_0014994 3300046681 Bacteria 2708
593 Ga0495658_0018001 3300046683 Bacteria 3663
594 Ga0495669_0010717 3300046684 Bacteria 3879
595 Ga0495613_0103416 3300046689 Bacteria 2056
596 Ga0495624_0131103 3300046690 Bacteria 1537
597 Ga0495600_0124088 3300046809 Bacteria 1679
598 Ga0495581_0120665 3300047315 Bacteria 1526
599 Ga0495581_0131825 3300047315 Bacteria 1456
600 Ga0495581_0296625 3300047315 Bacteria 945
601 Ga0495604_0036544 3300047317 Bacteria 3872
602 Ga0495674_0008256 3300047319 Bacteria 9933
603 Ga0495674_0388126 3300047319 Bacteria 1129
604 Ga0495674_0973660 3300047319 Bacteria 651
605 Ga0495672_0100841 3300047320 Bacteria 1566
606 Ga0495676_0045436 3300047321 Bacteria 3575
607 Ga0495680_0548164 3300047322 Bacteria 779
608 Ga0495675_0032218 3300047444 Bacteria 3344
609 Ga0495684_0014546 3300047471 Bacteria 6056
610 Ga0495684_0197833 3300047471 Bacteria 1483
611 Ga0495684_0573479 3300047471 Bacteria 765
612 Ga0495593_0444025 3300047673 Bacteria 649
613 Ga0495602_0274070 3300048088 Bacteria 1246
614 Ga0496101_0176014 3300048904 Bacteria 1646
615 Ga0496101_0556566 3300048904 Bacteria 907
616 Ga0496102_0094190 3300048905 Bacteria 2775
617 Ga0496103_0343859 3300048906 Bacteria 959
618 Ga0496104_0074260 3300048907 Bacteria 3237
619 Ga0496104_0593112 3300048907 Bacteria 1018
620 Ga0496105_0021478 3300048908 Bacteria 5223
621 Ga0496106_0953898 3300048909 Bacteria 676
622 Ga0496107_0424915 3300048910 Bacteria 988
623 Ga0496108_0597465 3300048911 Bacteria 962
624 Ga0496109_1259233 3300048912 Bacteria 676
625 Ga0496109_1529927 3300048912 Bacteria 602
626 Ga0496110_0609274 3300048913 Bacteria 990
627 Ga0496110_0865028 3300048913 Bacteria 809
628 Ga0496111_0256008 3300048914 Bacteria 1299
629 Ga0496111_1234901 3300048914 Unclassified 528
630 Ga0496112_0000059 3300048915 Bacteria 74946
631 Ga0496112_0177400 3300048915 Bacteria 2095
632 Ga0496112_0249552 3300048915 Bacteria 1726
633 Ga0496113_0319654 3300048916 Bacteria 1244
634 Ga0496113_0726455 3300048916 Bacteria 792
635 Ga0496115_0050450 3300048918 Bacteria 3334
636 Ga0496126_0033139 3300048929 Bacteria 4861
637 Ga0496126_0092888 3300048929 Bacteria 2650
638 Ga0496126_0147836 3300048929 Bacteria 2016
639 Ga0496126_0366482 3300048929 Bacteria 1176
640 Ga0496126_0788516 3300048929 Bacteria 730
641 Ga0501031_0362604 3300049568 Bacteria 938
642 Ga0501031_1106214 3300049568 Unclassified 506
643 Ga0501033_0048828 3300049570 Bacteria 3143
644 Ga0501033_0594598 3300049570 Bacteria 759
645 Ga0501036_0141468 3300049572 Bacteria 2030
646 Ga0501036_0173317 3300049572 Bacteria 1817
647 Ga0501036_0298728 3300049572 Bacteria 1347
648 Ga0501036_0315602 3300049572 Bacteria 1306
649 Ga0501037_0134788 3300049573 Bacteria 1769
650 Ga0501037_0581795 3300049573 Bacteria 753
651 Ga0501038_0065554 3300049574 Bacteria 3094
652 Ga0501038_0103525 3300049574 Bacteria 2367
653 Ga0501038_0364342 3300049574 Bacteria 1124
654 Ga0501039_0026150 3300049575 Bacteria 4485
655 Ga0501039_0498230 3300049575 Bacteria 956
656 Ga0501040_0007762 3300049576 Bacteria 6945
657 Ga0501040_0009124 3300049576 Bacteria 6458
658 Ga0501040_0172474 3300049576 Bacteria 1532
659 Ga0501041_0014220 3300049577 Bacteria 4725
660 Ga0501041_0073113 3300049577 Bacteria 2107
661 Ga0501041_0170348 3300049577 Bacteria 1362
662 Ga0501042_0068706 3300049578 Bacteria 2534
663 Ga0501042_0183408 3300049578 Bacteria 1510
664 Ga0501042_0463972 3300049578 Bacteria 919
665 Ga0501043_0341980 3300049579 Bacteria 1138
666 Ga0501043_0990806 3300049579 Bacteria 599
667 Ga0501043_1334976 3300049579 Bacteria 500
668 Ga0501046_0207872 3300049580 Bacteria 1454
669 Ga0501046_0344766 3300049580 Bacteria 1082
670 Ga0501047_0932578 3300049581 Unclassified 681
671 Ga0501048_0082066 3300049582 Bacteria 2274
672 Ga0501048_0275771 3300049582 Bacteria 1195
673 Ga0501068_0103538 3300049584 Bacteria 1766
674 Ga0501071_0413707 3300049587 Bacteria 1030
675 Ga0501071_0854603 3300049587 Bacteria 702
676 Ga0501072_0000757 3300049588 Bacteria 23565
677 Ga0501072_0256408 3300049588 Bacteria 1393
678 Ga0501072_0433320 3300049588 Bacteria 1042
679 Ga0501074_0702335 3300049590 Bacteria 714
680 Ga0501075_0003128 3300049591 Bacteria 11065
681 Ga0501075_0264106 3300049591 Bacteria 1312
682 Ga0501076_0000285 3300049592 Bacteria 31507
683 Ga0501076_0615668 3300049592 Bacteria 896
684 Ga0501077_0229060 3300049593 Bacteria 1181
685 Ga0501077_0236169 3300049593 Bacteria 1162
686 Ga0501230_098378 3300049667 Bacteria 629
687 Ga0501079_0003127 3300049741 Bacteria 12127
688 Ga0501079_0171879 3300049741 Bacteria 1690
689 Ga0501079_0297082 3300049741 Bacteria 1263
690 Ga0501079_0866955 3300049741 Bacteria 711
691 Ga0501080_0015457 3300049742 Bacteria 7037
692 Ga0501080_0393830 3300049742 Bacteria 1247
693 Ga0501081_0000759 3300049743 Bacteria 18898
694 Ga0501081_0006364 3300049743 Bacteria 7660
695 Ga0501083_0055180 3300049744 Bacteria 2665
696 Ga0501035_0368522 3300049822 Bacteria 1199
697 Ga0501045_0051787 3300049824 Bacteria 2996
698 Ga0501045_0835738 3300049824 Bacteria 678
699 nmdc:mga0yw44_693589_c1 3300050492 Bacteria 692
700 nmdc:mga05p37_1864800_c1 3300050507 Unclassified 576
701 nmdc:mga05p37_2045_c1 3300050507 Bacteria 23532
702 nmdc:mga05p37_378695_c1 3300050507 Bacteria 1659
703 nmdc:mga05p37_379757_c1 3300050507 Bacteria 1656
704 nmdc:mga09592_1655_c1 3300050508 Bacteria 17927
705 nmdc:mga09592_200507_c1 3300050508 Bacteria 1728
706 nmdc:mga09592_284247_c1 3300050508 Bacteria 1435
707 nmdc:mga0qj67_137773_c1 3300050509 Bacteria 1978
708 nmdc:mga0qj67_14040_c1 3300050509 Bacteria 6049
709 nmdc:mga0qj67_202389_c1 3300050509 Bacteria 1613
710 nmdc:mga0qj67_452188_c1 3300050509 Bacteria 1035
711 nmdc:mga0qj67_526303_c1 3300050509 Bacteria 949
712 nmdc:mga06r32_157084_c1 3300050510 Bacteria 2256
713 nmdc:mga06r32_1622773_c1 3300050510 Unclassified 585
714 nmdc:mga08y16_133287_c1 3300050511 Bacteria 2583
715 nmdc:mga08y16_4849_c1 3300050511 Bacteria 14041
716 nmdc:mga08y16_70976_c1 3300050511 Bacteria 3630
717 nmdc:mga08y16_77092_c1 3300050511 Bacteria 3475
718 nmdc:mga0n895_39500_c1 3300050512 Bacteria 4579
719 nmdc:mga0rr50_1178798_c1 3300050513 Bacteria 651
720 nmdc:mga0rr50_126820_c1 3300050513 Bacteria 2039
721 nmdc:mga0rr50_1406880_c1 3300050513 Bacteria 590
722 nmdc:mga0rr50_545908_c1 3300050513 Bacteria 987
723 nmdc:mga0rr50_8370_c1 3300050513 Bacteria 6437
724 nmdc:mga08x19_122448_c1 3300050514 Bacteria 1745
725 nmdc:mga08x19_284852_c1 3300050514 Bacteria 1145
726 nmdc:mga08x19_3563_c1 3300050514 Bacteria 9267
727 nmdc:mga08x19_3851_c1 3300050514 Bacteria 8929
728 nmdc:mga0a205_3207_c1 3300050515 Bacteria 14532
729 nmdc:mga0a205_627150_c1 3300050515 Bacteria 927
730 Ga0495601_0002510 3300053077 Bacteria 10448
731 Ga0495612_0042322 3300053078 Bacteria 1859
732 Ga0495619_0005618 3300053085 Bacteria 7956
733 Ga0495619_0277934 3300053085 Bacteria 1160
734 Ga0501084_0096780 3300054114 Bacteria 2478
735 Ga0501084_0171301 3300054114 Bacteria 1832
736 Ga0501084_1177843 3300054114 Bacteria 643
737 Ga0590077_029822 3300059426 Bacteria 1188
738 Ga0501082_0005281 3300060353 Bacteria 11227
739 Ga0501082_0827153 3300060353 Bacteria 810
740 Ga0530510_0000091 3300061734 Bacteria 48589

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300042156 Ga0439446_0223913 Ga0439446_0223913_287_607 106
2 3300049568 Ga0501031_1106214 Ga0501031_1106214_110_487 117
3 3300035118 Ga0373954_0000723 Ga0373954_0000723_9448_9843 122
4 3300035172 Ga0373955_0481475 Ga0373955_0481475_214_609 122
5 3300035692 Ga0373935_0370001 Ga0373935_0370001_415_810 122
6 3300036401 Ga0373937_0195082 Ga0373937_0195082_154_549 122
7 3300046517 Ga0495630_0331289 Ga0495630_0331289_552_947 122
8 3300046559 Ga0495667_0006877 Ga0495667_0006877_1570_1965 122
9 3300047322 Ga0495680_0548164 Ga0495680_0548164_69_464 122
10 3300047471 Ga0495684_0197833 Ga0495684_0197833_468_863 122
11 3300050514 nmdc:mga08x19_284852_c1 nmdc:mga08x19_284852_c1_666_1061 122
12 3300049570 Ga0501033_0594598 Ga0501033_0594598_267_641 124
13 3300049572 Ga0501036_0141468 Ga0501036_0141468_318_692 124
14 3300049572 Ga0501036_0315602 Ga0501036_0315602_165_539 124
15 3300049573 Ga0501037_0581795 Ga0501037_0581795_233_607 124
16 3300049574 Ga0501038_0103525 Ga0501038_0103525_1069_1443 124
17 3300049574 Ga0501038_0364342 Ga0501038_0364342_168_542 124
18 3300049575 Ga0501039_0026150 Ga0501039_0026150_2142_2516 124
19 3300049576 Ga0501040_0007762 Ga0501040_0007762_5821_6195 124
20 3300049577 Ga0501041_0073113 Ga0501041_0073113_846_1220 124
21 3300049578 Ga0501042_0068706 Ga0501042_0068706_615_989 124
22 3300049579 Ga0501043_0990806 Ga0501043_0990806_120_494 124
23 3300049579 Ga0501043_1334976 Ga0501043_1334976_75_452 124
24 3300049580 Ga0501046_0207872 Ga0501046_0207872_289_663 124
25 3300049582 Ga0501048_0275771 Ga0501048_0275771_633_1007 124
26 3300049584 Ga0501068_0103538 Ga0501068_0103538_647_1021 124
27 3300049587 Ga0501071_0413707 Ga0501071_0413707_500_874 124
28 3300049588 Ga0501072_0000757 Ga0501072_0000757_19958_20332 124
29 3300049588 Ga0501072_0256408 Ga0501072_0256408_765_1139 124
30 3300049591 Ga0501075_0003128 Ga0501075_0003128_5160_5534 124
31 3300049591 Ga0501075_0264106 Ga0501075_0264106_804_1178 124
32 3300049592 Ga0501076_0000285 Ga0501076_0000285_7920_8294 124
33 3300049593 Ga0501077_0236169 Ga0501077_0236169_218_592 124
34 3300049741 Ga0501079_0003127 Ga0501079_0003127_4578_4952 124
35 3300049741 Ga0501079_0171879 Ga0501079_0171879_333_707 124
36 3300049742 Ga0501080_0015457 Ga0501080_0015457_966_1340 124
37 3300049743 Ga0501081_0000759 Ga0501081_0000759_16745_17119 124
38 3300049743 Ga0501081_0006364 Ga0501081_0006364_4815_5189 124
39 3300049824 Ga0501045_0051787 Ga0501045_0051787_54_428 124
40 3300054114 Ga0501084_0096780 Ga0501084_0096780_590_964 124
41 3300060353 Ga0501082_0005281 Ga0501082_0005281_7407_7781 124
42 3300061734 Ga0530510_0000091 Ga0530510_0000091_31251_31625 124
43 iso_pu_bacteria 2958122699 2958128573 124
44 iso_pu_bacteria 2977872689 2977873058 124
45 3300046528 Ga0495642_0076995 Ga0495642_0076995_424_801 125
46 3300046539 Ga0495621_0029405 Ga0495621_0029405_255_632 125
47 3300021441 Ga0213871_10005256 Ga0213871_100052563 126
48 3300039438 Ga0436360_0280684 Ga0436360_0280684_3592_3972 126
49 3300039447 Ga0436361_1208236 Ga0436361_1208236_1369_1749 126
50 3300049572 Ga0501036_0298728 Ga0501036_0298728_790_1170 126
51 3300049573 Ga0501037_0134788 Ga0501037_0134788_1038_1418 126
52 3300049577 Ga0501041_0170348 Ga0501041_0170348_916_1296 126
53 3300049578 Ga0501042_0183408 Ga0501042_0183408_364_744 126
54 3300049579 Ga0501043_0341980 Ga0501043_0341980_104_484 126
55 3300049580 Ga0501046_0344766 Ga0501046_0344766_182_562 126
56 3300049741 Ga0501079_0297082 Ga0501079_0297082_642_1022 126
57 3300049744 Ga0501083_0055180 Ga0501083_0055180_1094_1474 126
58 3300002244 JGI24742J22300_10024783 JGI24742J22300_100247832 127
59 3300003911 JGI25405J52794_10100041 JGI25405J52794_101000411 127
60 3300005289 Ga0065704_10325148 Ga0065704_103251481 127
61 3300005295 Ga0065707_10005701 Ga0065707_100057013 127
62 3300005295 Ga0065707_10106587 Ga0065707_101065873 127
63 3300005295 Ga0065707_10731008 Ga0065707_107310081 127
64 3300005327 Ga0070658_10364204 Ga0070658_103642041 127
65 3300005329 Ga0070683_100311306 Ga0070683_1003113063 127
66 3300005329 Ga0070683_100336504 Ga0070683_1003365043 127
67 3300005330 Ga0070690_100000172 Ga0070690_10000017220 127
68 3300005330 Ga0070690_100029637 Ga0070690_1000296372 127
69 3300005330 Ga0070690_100133703 Ga0070690_1001337033 127
70 3300005330 Ga0070690_100578248 Ga0070690_1005782482 127
71 3300005334 Ga0068869_100004583 Ga0068869_10000458310 127
72 3300005335 Ga0070666_10247213 Ga0070666_102472133 127
73 3300005336 Ga0070680_100000230 Ga0070680_1000002303 127
74 3300005336 Ga0070680_100017864 Ga0070680_1000178644 127
75 3300005336 Ga0070680_100234358 Ga0070680_1002343582 127
76 3300005337 Ga0070682_100023353 Ga0070682_1000233533 127
77 3300005338 Ga0068868_100001075 Ga0068868_1000010759 127
78 3300005338 Ga0068868_100569867 Ga0068868_1005698672 127
79 3300005338 Ga0068868_101669420 Ga0068868_1016694202 127
80 3300005339 Ga0070660_100437560 Ga0070660_1004375602 127
81 3300005340 Ga0070689_100001034 Ga0070689_10000103410 127
82 3300005340 Ga0070689_100158951 Ga0070689_1001589512 127
83 3300005341 Ga0070691_10000935 Ga0070691_100009357 127
84 3300005341 Ga0070691_10186338 Ga0070691_101863381 127
85 3300005341 Ga0070691_10570298 Ga0070691_105702981 127
86 3300005343 Ga0070687_100000141 Ga0070687_1000001413 127
87 3300005344 Ga0070661_100735077 Ga0070661_1007350771 127
88 3300005345 Ga0070692_10002703 Ga0070692_100027032 127
89 3300005345 Ga0070692_10022726 Ga0070692_100227262 127
90 3300005347 Ga0070668_100135997 Ga0070668_1001359974 127
91 3300005353 Ga0070669_100004039 Ga0070669_1000040395 127
92 3300005353 Ga0070669_100229804 Ga0070669_1002298043 127
93 3300005354 Ga0070675_100942597 Ga0070675_1009425972 127
94 3300005355 Ga0070671_101289879 Ga0070671_1012898792 127
95 3300005356 Ga0070674_100086449 Ga0070674_1000864492 127
96 3300005356 Ga0070674_101046603 Ga0070674_1010466031 127
97 3300005356 Ga0070674_101855267 Ga0070674_1018552671 127
98 3300005364 Ga0070673_100027946 Ga0070673_1000279464 127
99 3300005364 Ga0070673_100941539 Ga0070673_1009415392 127
100 3300005364 Ga0070673_101527146 Ga0070673_1015271461 127
101 3300005365 Ga0070688_101218612 Ga0070688_1012186122 127
102 3300005366 Ga0070659_100564095 Ga0070659_1005640952 127
103 3300005367 Ga0070667_101389817 Ga0070667_1013898172 127
104 3300005406 Ga0070703_10014775 Ga0070703_100147752 127
105 3300005434 Ga0070709_10097186 Ga0070709_100971863 127
106 3300005434 Ga0070709_10118326 Ga0070709_101183262 127
107 3300005434 Ga0070709_10142882 Ga0070709_101428822 127
108 3300005435 Ga0070714_100003691 Ga0070714_1000036917 127
109 3300005435 Ga0070714_100042501 Ga0070714_1000425014 127
110 3300005436 Ga0070713_100039796 Ga0070713_1000397963 127
111 3300005436 Ga0070713_101287690 Ga0070713_1012876902 127
112 3300005436 Ga0070713_101767560 Ga0070713_1017675601 127
113 3300005437 Ga0070710_10022316 Ga0070710_100223163 127
114 3300005438 Ga0070701_10000216 Ga0070701_100002164 127
115 3300005439 Ga0070711_100235468 Ga0070711_1002354682 127
116 3300005440 Ga0070705_100001001 Ga0070705_1000010019 127
117 3300005440 Ga0070705_100013041 Ga0070705_1000130416 127
118 3300005441 Ga0070700_100000591 Ga0070700_1000005919 127
119 3300005441 Ga0070700_100304030 Ga0070700_1003040302 127
120 3300005444 Ga0070694_100001923 Ga0070694_1000019239 127
121 3300005444 Ga0070694_100003005 Ga0070694_1000030053 127
122 3300005444 Ga0070694_100114267 Ga0070694_1001142671 127
123 3300005444 Ga0070694_100115942 Ga0070694_1001159422 127
124 3300005445 Ga0070708_100313445 Ga0070708_1003134451 127
125 3300005445 Ga0070708_101075038 Ga0070708_1010750382 127
126 3300005455 Ga0070663_100322859 Ga0070663_1003228591 127
127 3300005456 Ga0070678_101903225 Ga0070678_1019032251 127
128 3300005457 Ga0070662_101373442 Ga0070662_1013734421 127
129 3300005458 Ga0070681_10042871 Ga0070681_100428714 127
130 3300005458 Ga0070681_10110098 Ga0070681_101100981 127
131 3300005458 Ga0070681_10224793 Ga0070681_102247933 127
132 3300005458 Ga0070681_10485955 Ga0070681_104859553 127
133 3300005459 Ga0068867_100000275 Ga0068867_10000027527 127
134 3300005459 Ga0068867_100000487 Ga0068867_10000048715 127
135 3300005467 Ga0070706_100804209 Ga0070706_1008042092 127
136 3300005467 Ga0070706_101687902 Ga0070706_1016879021 127
137 3300005471 Ga0070698_100336715 Ga0070698_1003367151 127
138 3300005518 Ga0070699_100034399 Ga0070699_1000343992 127
139 3300005530 Ga0070679_100600987 Ga0070679_1006009872 127
140 3300005530 Ga0070679_100781892 Ga0070679_1007818922 127
141 3300005530 Ga0070679_100839957 Ga0070679_1008399572 127
142 3300005530 Ga0070679_101889527 Ga0070679_1018895271 127
143 3300005535 Ga0070684_100016626 Ga0070684_1000166266 127
144 3300005535 Ga0070684_100025358 Ga0070684_1000253582 127
145 3300005535 Ga0070684_101167151 Ga0070684_1011671511 127
146 3300005535 Ga0070684_101222058 Ga0070684_1012220582 127
147 3300005539 Ga0068853_100136985 Ga0068853_1001369853 127
148 3300005539 Ga0068853_100363900 Ga0068853_1003639002 127
149 3300005539 Ga0068853_100615794 Ga0068853_1006157942 127
150 3300005539 Ga0068853_100671872 Ga0068853_1006718722 127
151 3300005543 Ga0070672_100268151 Ga0070672_1002681513 127
152 3300005544 Ga0070686_100000527 Ga0070686_10000052720 127
153 3300005544 Ga0070686_100065931 Ga0070686_1000659312 127
154 3300005545 Ga0070695_100000498 Ga0070695_10000049812 127
155 3300005545 Ga0070695_100008411 Ga0070695_1000084112 127
156 3300005545 Ga0070695_100249577 Ga0070695_1002495772 127
157 3300005546 Ga0070696_100000061 Ga0070696_10000006150 127
158 3300005546 Ga0070696_100074309 Ga0070696_1000743094 127
159 3300005546 Ga0070696_100159185 Ga0070696_1001591852 127
160 3300005546 Ga0070696_100466611 Ga0070696_1004666111 127
161 3300005546 Ga0070696_100533632 Ga0070696_1005336322 127
162 3300005547 Ga0070693_100000016 Ga0070693_10000001620 127
163 3300005547 Ga0070693_100511286 Ga0070693_1005112862 127
164 3300005548 Ga0070665_100344579 Ga0070665_1003445792 127
165 3300005549 Ga0070704_100000487 Ga0070704_10000048716 127
166 3300005549 Ga0070704_100119723 Ga0070704_1001197233 127
167 3300005549 Ga0070704_101026318 Ga0070704_1010263182 127
168 3300005563 Ga0068855_100000975 Ga0068855_10000097530 127
169 3300005563 Ga0068855_100018315 Ga0068855_1000183152 127
170 3300005563 Ga0068855_100353997 Ga0068855_1003539972 127
171 3300005563 Ga0068855_100847732 Ga0068855_1008477322 127
172 3300005563 Ga0068855_100936053 Ga0068855_1009360532 127
173 3300005577 Ga0068857_100060760 Ga0068857_1000607601 127
174 3300005577 Ga0068857_101524409 Ga0068857_1015244091 127
175 3300005578 Ga0068854_100000366 Ga0068854_1000003663 127
176 3300005614 Ga0068856_100010596 Ga0068856_1000105963 127
177 3300005614 Ga0068856_100020844 Ga0068856_1000208444 127
178 3300005614 Ga0068856_101714046 Ga0068856_1017140461 127
179 3300005615 Ga0070702_100000485 Ga0070702_10000048513 127
180 3300005616 Ga0068852_100240908 Ga0068852_1002409082 127
181 3300005616 Ga0068852_102139086 Ga0068852_1021390862 127
182 3300005617 Ga0068859_100005636 Ga0068859_1000056365 127
183 3300005617 Ga0068859_100513283 Ga0068859_1005132832 127
184 3300005618 Ga0068864_100015369 Ga0068864_1000153693 127
185 3300005718 Ga0068866_10000176 Ga0068866_1000017621 127
186 3300005718 Ga0068866_10627521 Ga0068866_106275211 127
187 3300005719 Ga0068861_100001699 Ga0068861_10000169912 127
188 3300005719 Ga0068861_100004033 Ga0068861_10000403313 127
189 3300005834 Ga0068851_10079942 Ga0068851_100799422 127
190 3300005840 Ga0068870_10013749 Ga0068870_100137492 127
191 3300005840 Ga0068870_10114773 Ga0068870_101147733 127
192 3300005841 Ga0068863_100568029 Ga0068863_1005680292 127
193 3300005842 Ga0068858_100000619 Ga0068858_10000061927 127
194 3300005842 Ga0068858_100091525 Ga0068858_1000915252 127
195 3300005842 Ga0068858_102125838 Ga0068858_1021258382 127
196 3300005843 Ga0068860_100002570 Ga0068860_10000257014 127
197 3300005843 Ga0068860_100847004 Ga0068860_1008470042 127
198 3300005844 Ga0068862_100003412 Ga0068862_10000341212 127
199 3300005844 Ga0068862_100012212 Ga0068862_1000122125 127
200 3300005844 Ga0068862_100459243 Ga0068862_1004592432 127
201 3300005937 Ga0081455_10050130 Ga0081455_100501303 127
202 3300005983 Ga0081540_1000370 Ga0081540_100037039 127
203 3300005985 Ga0081539_10000008 Ga0081539_10000008245 127
204 3300006028 Ga0070717_10089862 Ga0070717_100898623 127
205 3300006028 Ga0070717_10450680 Ga0070717_104506802 127
206 3300006028 Ga0070717_11051079 Ga0070717_110510792 127
207 3300006028 Ga0070717_11256425 Ga0070717_112564252 127
208 3300006038 Ga0075365_10206258 Ga0075365_102062582 127
209 3300006163 Ga0070715_10037076 Ga0070715_100370763 127
210 3300006163 Ga0070715_10694607 Ga0070715_106946072 127
211 3300006173 Ga0070716_100003046 Ga0070716_1000030466 127
212 3300006173 Ga0070716_100945551 Ga0070716_1009455512 127
213 3300006175 Ga0070712_100017433 Ga0070712_1000174334 127
214 3300006175 Ga0070712_100908306 Ga0070712_1009083062 127
215 3300006237 Ga0097621_100001255 Ga0097621_1000012558 127
216 3300006237 Ga0097621_100001554 Ga0097621_1000015548 127
217 3300006237 Ga0097621_101034452 Ga0097621_1010344522 127
218 3300006358 Ga0068871_100002479 Ga0068871_1000024793 127
219 3300006358 Ga0068871_100003865 Ga0068871_10000386513 127
220 3300006844 Ga0075428_100000532 Ga0075428_10000053224 127
221 3300006844 Ga0075428_100202643 Ga0075428_1002026433 127
222 3300006844 Ga0075428_100520332 Ga0075428_1005203323 127
223 3300006844 Ga0075428_100752533 Ga0075428_1007525332 127
224 3300006844 Ga0075428_101355406 Ga0075428_1013554061 127
225 3300006844 Ga0075428_101971507 Ga0075428_1019715072 127
226 3300006846 Ga0075430_100001203 Ga0075430_1000012033 127
227 3300006846 Ga0075430_100018890 Ga0075430_1000188908 127
228 3300006846 Ga0075430_100267639 Ga0075430_1002676393 127
229 3300006846 Ga0075430_100567535 Ga0075430_1005675352 127
230 3300006846 Ga0075430_101023258 Ga0075430_1010232581 127
231 3300006846 Ga0075430_101186501 Ga0075430_1011865011 127
232 3300006847 Ga0075431_100119157 Ga0075431_1001191573 127
233 3300006847 Ga0075431_100816037 Ga0075431_1008160372 127
234 3300006847 Ga0075431_101715467 Ga0075431_1017154672 127
235 3300006852 Ga0075433_10463541 Ga0075433_104635412 127
236 3300006871 Ga0075434_100027094 Ga0075434_1000270946 127
237 3300006871 Ga0075434_101060870 Ga0075434_1010608701 127
238 3300006880 Ga0075429_100321678 Ga0075429_1003216782 127
239 3300006881 Ga0068865_100000262 Ga0068865_10000026218 127
240 3300006881 Ga0068865_100162540 Ga0068865_1001625402 127
241 3300006914 Ga0075436_100000639 Ga0075436_10000063921 127
242 3300006914 Ga0075436_100032287 Ga0075436_1000322873 127
243 3300006914 Ga0075436_100058044 Ga0075436_1000580443 127
244 3300006931 Ga0097620_100005635 Ga0097620_10000563512 127
245 3300006931 Ga0097620_100513330 Ga0097620_1005133302 127
246 3300007076 Ga0075435_100009644 Ga0075435_1000096443 127
247 3300007076 Ga0075435_100051941 Ga0075435_1000519416 127
248 3300007076 Ga0075435_100364022 Ga0075435_1003640222 127
249 3300007265 Ga0099794_10046095 Ga0099794_100460952 127
250 3300007265 Ga0099794_10266657 Ga0099794_102666572 127
251 3300007265 Ga0099794_10273705 Ga0099794_102737051 127
252 3300007265 Ga0099794_10291435 Ga0099794_102914352 127
253 3300007788 Ga0099795_10104149 Ga0099795_101041491 127
254 3300007788 Ga0099795_10131555 Ga0099795_101315552 127
255 3300007788 Ga0099795_10346653 Ga0099795_103466532 127
256 3300009093 Ga0105240_10054802 Ga0105240_100548023 127
257 3300009094 Ga0111539_10022190 Ga0111539_100221909 127
258 3300009094 Ga0111539_10046759 Ga0111539_100467595 127
259 3300009094 Ga0111539_10065376 Ga0111539_100653763 127
260 3300009094 Ga0111539_10147190 Ga0111539_101471902 127
261 3300009094 Ga0111539_12941698 Ga0111539_129416981 127
262 3300009098 Ga0105245_10000178 Ga0105245_1000017838 127
263 3300009098 Ga0105245_11615807 Ga0105245_116158072 127
264 3300009101 Ga0105247_10182982 Ga0105247_101829822 127
265 3300009147 Ga0114129_10017720 Ga0114129_1001772010 127
266 3300009147 Ga0114129_10102952 Ga0114129_101029522 127
267 3300009147 Ga0114129_10412330 Ga0114129_104123302 127
268 3300009147 Ga0114129_10511631 Ga0114129_105116312 127
269 3300009147 Ga0114129_10688549 Ga0114129_106885493 127
270 3300009148 Ga0105243_10000270 Ga0105243_1000027046 127
271 3300009174 Ga0105241_10056256 Ga0105241_100562563 127
272 3300009176 Ga0105242_10000409 Ga0105242_1000040931 127
273 3300009176 Ga0105242_10574225 Ga0105242_105742252 127
274 3300009177 Ga0105248_10306890 Ga0105248_103068903 127
275 3300009545 Ga0105237_10017737 Ga0105237_100177378 127
276 3300009545 Ga0105237_10084602 Ga0105237_100846022 127
277 3300009551 Ga0105238_10003279 Ga0105238_100032794 127
278 3300009551 Ga0105238_10296437 Ga0105238_102964373 127
279 3300009551 Ga0105238_10371092 Ga0105238_103710922 127
280 3300009551 Ga0105238_12601910 Ga0105238_126019101 127
281 3300009553 Ga0105249_10012264 Ga0105249_100122643 127
282 3300009553 Ga0105249_10211874 Ga0105249_102118742 127
283 3300009553 Ga0105249_10793596 Ga0105249_107935962 127
284 3300009553 Ga0105249_12190751 Ga0105249_121907512 127
285 3300010159 Ga0099796_10177522 Ga0099796_101775221 127
286 3300010375 Ga0105239_10075790 Ga0105239_100757904 127
287 3300010375 Ga0105239_10130266 Ga0105239_101302664 127
288 3300010375 Ga0105239_10285791 Ga0105239_102857913 127
289 3300010375 Ga0105239_10505723 Ga0105239_105057233 127
290 3300011119 Ga0105246_10238273 Ga0105246_102382732 127
291 3300011119 Ga0105246_10902847 Ga0105246_109028471 127
292 3300011119 Ga0105246_12408309 Ga0105246_124083091 127
293 3300013102 Ga0157371_10343524 Ga0157371_103435242 127
294 3300013104 Ga0157370_10203136 Ga0157370_102031363 127
295 3300013105 Ga0157369_10056614 Ga0157369_100566145 127
296 3300013105 Ga0157369_10452283 Ga0157369_104522833 127
297 3300013296 Ga0157374_10405507 Ga0157374_104055071 127
298 3300013297 Ga0157378_11110754 Ga0157378_111107542 127
299 3300013306 Ga0163162_10097503 Ga0163162_100975033 127
300 3300013306 Ga0163162_10396291 Ga0163162_103962912 127
301 3300013307 Ga0157372_10174365 Ga0157372_101743653 127
302 3300013307 Ga0157372_10735448 Ga0157372_107354483 127
303 3300013307 Ga0157372_11128184 Ga0157372_111281842 127
304 3300013308 Ga0157375_10420185 Ga0157375_104201851 127
305 3300013308 Ga0157375_10736362 Ga0157375_107363622 127
306 3300014325 Ga0163163_10919906 Ga0163163_109199061 127
307 3300014325 Ga0163163_12685922 Ga0163163_126859221 127
308 3300014326 Ga0157380_10009920 Ga0157380_100099209 127
309 3300014326 Ga0157380_10029204 Ga0157380_100292043 127
310 3300014326 Ga0157380_10679445 Ga0157380_106794452 127
311 3300014326 Ga0157380_11430636 Ga0157380_114306362 127
312 3300014745 Ga0157377_10147018 Ga0157377_101470182 127
313 3300014968 Ga0157379_10241373 Ga0157379_102413733 127
314 3300014969 Ga0157376_10008044 Ga0157376_1000804410 127
315 3300014969 Ga0157376_10085285 Ga0157376_100852853 127
316 3300021358 Ga0213873_10108626 Ga0213873_101086262 127
317 3300021384 Ga0213876_10012190 Ga0213876_100121903 127
318 3300021388 Ga0213875_10183163 Ga0213875_101831632 127
319 3300025885 Ga0207653_10007295 Ga0207653_100072954 127
320 3300025898 Ga0207692_10019156 Ga0207692_100191562 127
321 3300025899 Ga0207642_10010162 Ga0207642_100101624 127
322 3300025899 Ga0207642_10515909 Ga0207642_105159091 127
323 3300025901 Ga0207688_10012274 Ga0207688_100122743 127
324 3300025901 Ga0207688_10113559 Ga0207688_101135592 127
325 3300025904 Ga0207647_10119993 Ga0207647_101199932 127
326 3300025905 Ga0207685_10027646 Ga0207685_100276463 127
327 3300025905 Ga0207685_10376210 Ga0207685_103762102 127
328 3300025906 Ga0207699_10007692 Ga0207699_100076924 127
329 3300025906 Ga0207699_10201974 Ga0207699_102019741 127
330 3300025906 Ga0207699_10210401 Ga0207699_102104012 127
331 3300025908 Ga0207643_10017173 Ga0207643_100171732 127
332 3300025908 Ga0207643_10062857 Ga0207643_100628573 127
333 3300025909 Ga0207705_10206827 Ga0207705_102068271 127
334 3300025910 Ga0207684_10339434 Ga0207684_103394343 127
335 3300025910 Ga0207684_10828379 Ga0207684_108283791 127
336 3300025911 Ga0207654_10168639 Ga0207654_101686392 127
337 3300025912 Ga0207707_10007441 Ga0207707_100074416 127
338 3300025912 Ga0207707_10143832 Ga0207707_101438323 127
339 3300025912 Ga0207707_10166471 Ga0207707_101664713 127
340 3300025912 Ga0207707_10405611 Ga0207707_104056112 127
341 3300025913 Ga0207695_10359879 Ga0207695_103598792 127
342 3300025914 Ga0207671_10342447 Ga0207671_103424472 127
343 3300025914 Ga0207671_11255388 Ga0207671_112553881 127
344 3300025915 Ga0207693_10012174 Ga0207693_100121745 127
345 3300025916 Ga0207663_10000291 Ga0207663_1000029121 127
346 3300025916 Ga0207663_10331253 Ga0207663_103312532 127
347 3300025916 Ga0207663_10773154 Ga0207663_107731543 127
348 3300025917 Ga0207660_10002634 Ga0207660_100026342 127
349 3300025917 Ga0207660_10084516 Ga0207660_100845162 127
350 3300025918 Ga0207662_10000047 Ga0207662_1000004721 127
351 3300025918 Ga0207662_10292893 Ga0207662_102928932 127
352 3300025919 Ga0207657_10101929 Ga0207657_101019291 127
353 3300025920 Ga0207649_10570320 Ga0207649_105703202 127
354 3300025921 Ga0207652_10006338 Ga0207652_100063384 127
355 3300025923 Ga0207681_10005133 Ga0207681_100051336 127
356 3300025923 Ga0207681_10202933 Ga0207681_102029331 127
357 3300025924 Ga0207694_10146832 Ga0207694_101468322 127
358 3300025926 Ga0207659_10940782 Ga0207659_109407822 127
359 3300025927 Ga0207687_10001597 Ga0207687_1000159712 127
360 3300025928 Ga0207700_10121330 Ga0207700_101213302 127
361 3300025928 Ga0207700_10274711 Ga0207700_102747111 127
362 3300025928 Ga0207700_11189130 Ga0207700_111891301 127
363 3300025929 Ga0207664_10021624 Ga0207664_100216242 127
364 3300025929 Ga0207664_10125999 Ga0207664_101259992 127
365 3300025932 Ga0207690_10278439 Ga0207690_102784391 127
366 3300025932 Ga0207690_10382846 Ga0207690_103828462 127
367 3300025934 Ga0207686_10000446 Ga0207686_1000044621 127
368 3300025935 Ga0207709_10000910 Ga0207709_100009106 127
369 3300025935 Ga0207709_10043589 Ga0207709_100435893 127
370 3300025936 Ga0207670_10000462 Ga0207670_100004622 127
371 3300025936 Ga0207670_10296248 Ga0207670_102962482 127
372 3300025937 Ga0207669_10069537 Ga0207669_100695373 127
373 3300025937 Ga0207669_10523932 Ga0207669_105239321 127
374 3300025938 Ga0207704_10000290 Ga0207704_1000029012 127
375 3300025938 Ga0207704_10072596 Ga0207704_100725963 127
376 3300025939 Ga0207665_10000624 Ga0207665_1000062419 127
377 3300025939 Ga0207665_10206725 Ga0207665_102067252 127
378 3300025939 Ga0207665_11278130 Ga0207665_112781301 127
379 3300025940 Ga0207691_10322186 Ga0207691_103221863 127
380 3300025941 Ga0207711_10220954 Ga0207711_102209543 127
381 3300025941 Ga0207711_10666649 Ga0207711_106666492 127
382 3300025942 Ga0207689_10000148 Ga0207689_1000014847 127
383 3300025942 Ga0207689_10393572 Ga0207689_103935722 127
384 3300025944 Ga0207661_10013381 Ga0207661_100133812 127
385 3300025949 Ga0207667_10004155 Ga0207667_100041558 127
386 3300025949 Ga0207667_10046316 Ga0207667_100463165 127
387 3300025949 Ga0207667_10170941 Ga0207667_101709412 127
388 3300025960 Ga0207651_11285021 Ga0207651_112850212 127
389 3300025961 Ga0207712_10012530 Ga0207712_100125308 127
390 3300025961 Ga0207712_11563492 Ga0207712_115634921 127
391 3300025972 Ga0207668_10079503 Ga0207668_100795035 127
392 3300025981 Ga0207640_10000351 Ga0207640_1000035132 127
393 3300026023 Ga0207677_10012717 Ga0207677_100127176 127
394 3300026023 Ga0207677_10501034 Ga0207677_105010342 127
395 3300026023 Ga0207677_10654851 Ga0207677_106548512 127
396 3300026035 Ga0207703_10001208 Ga0207703_1000120814 127
397 3300026035 Ga0207703_10159611 Ga0207703_101596112 127
398 3300026035 Ga0207703_11779942 Ga0207703_117799421 127
399 3300026041 Ga0207639_10318474 Ga0207639_103184742 127
400 3300026041 Ga0207639_10416797 Ga0207639_104167972 127
401 3300026041 Ga0207639_10635066 Ga0207639_106350662 127
402 3300026067 Ga0207678_10873331 Ga0207678_108733311 127
403 3300026075 Ga0207708_10000676 Ga0207708_1000067610 127
404 3300026075 Ga0207708_10025388 Ga0207708_100253885 127
405 3300026078 Ga0207702_10010733 Ga0207702_100107333 127
406 3300026078 Ga0207702_11067173 Ga0207702_110671732 127
407 3300026078 Ga0207702_11618875 Ga0207702_116188752 127
408 3300026089 Ga0207648_10000018 Ga0207648_10000018110 127
409 3300026089 Ga0207648_10000431 Ga0207648_100004314 127
410 3300026095 Ga0207676_10019411 Ga0207676_100194116 127
411 3300026116 Ga0207674_11420738 Ga0207674_114207381 127
412 3300026118 Ga0207675_100000170 Ga0207675_10000017047 127
413 3300026118 Ga0207675_100003942 Ga0207675_10000394212 127
414 3300026118 Ga0207675_101099197 Ga0207675_1010991972 127
415 3300026121 Ga0207683_10921922 Ga0207683_109219222 127
416 3300026142 Ga0207698_10045738 Ga0207698_100457381 127
417 3300027360 Ga0209969_1005956 Ga0209969_10059563 127
418 3300027360 Ga0209969_1006243 Ga0209969_10062434 127
419 3300027360 Ga0209969_1010549 Ga0209969_10105493 127
420 3300027364 Ga0209967_1000349 Ga0209967_10003499 127
421 3300027364 Ga0209967_1077168 Ga0209967_10771681 127
422 3300027378 Ga0209981_1000479 Ga0209981_10004798 127
423 3300027378 Ga0209981_1008438 Ga0209981_10084382 127
424 3300027395 Ga0209996_1003227 Ga0209996_10032272 127
425 3300027462 Ga0210000_1000972 Ga0210000_10009725 127
426 3300027462 Ga0210000_1017556 Ga0210000_10175562 127
427 3300027471 Ga0209995_1021285 Ga0209995_10212852 127
428 3300027471 Ga0209995_1083263 Ga0209995_10832632 127
429 3300027512 Ga0209179_1020739 Ga0209179_10207391 127
430 3300027543 Ga0209999_1004910 Ga0209999_10049102 127
431 3300027543 Ga0209999_1006553 Ga0209999_10065532 127
432 3300027543 Ga0209999_1064526 Ga0209999_10645262 127
433 3300027552 Ga0209982_1010156 Ga0209982_10101562 127
434 3300027614 Ga0209970_1006382 Ga0209970_10063822 127
435 3300027617 Ga0210002_1010884 Ga0210002_10108842 127
436 3300027665 Ga0209983_1017420 Ga0209983_10174202 127
437 3300027671 Ga0209588_1049730 Ga0209588_10497303 127
438 3300027671 Ga0209588_1089200 Ga0209588_10892002 127
439 3300027695 Ga0209966_1003030 Ga0209966_10030302 127
440 3300027717 Ga0209998_10015880 Ga0209998_100158803 127
441 3300027907 Ga0207428_10000835 Ga0207428_1000083519 127
442 3300027907 Ga0207428_10079253 Ga0207428_100792531 127
443 3300027907 Ga0207428_10132490 Ga0207428_101324902 127
444 3300028379 Ga0268266_10227172 Ga0268266_102271722 127
445 3300028380 Ga0268265_10001514 Ga0268265_1000151410 127
446 3300028380 Ga0268265_10002339 Ga0268265_100023398 127
447 3300028380 Ga0268265_10435050 Ga0268265_104350502 127
448 3300028381 Ga0268264_10001414 Ga0268264_1000141420 127
449 3300028381 Ga0268264_10232689 Ga0268264_102326893 127
450 3300028794 Ga0307515_10918991 Ga0307515_109189911 127
451 3300031241 Ga0265325_10067621 Ga0265325_100676212 127
452 3300031242 Ga0265329_10051333 Ga0265329_100513331 127
453 3300031247 Ga0265340_10013061 Ga0265340_100130614 127
454 3300031249 Ga0265339_10003282 Ga0265339_100032822 127
455 3300031250 Ga0265331_10017380 Ga0265331_100173803 127
456 3300031344 Ga0265316_10055876 Ga0265316_100558764 127
457 3300031616 Ga0307508_10304251 Ga0307508_103042511 127
458 3300031711 Ga0265314_10086421 Ga0265314_100864213 127
459 3300031711 Ga0265314_10550889 Ga0265314_105508891 127
460 3300031712 Ga0265342_10000026 Ga0265342_1000002695 127
461 3300031712 Ga0265342_10009061 Ga0265342_100090614 127
462 3300031824 Ga0307413_11505153 Ga0307413_115051532 127
463 3300031852 Ga0307410_11180728 Ga0307410_111807282 127
464 3300031911 Ga0307412_10728011 Ga0307412_107280112 127
465 3300032002 Ga0307416_100084175 Ga0307416_1000841754 127
466 3300032002 Ga0307416_101465923 Ga0307416_1014659232 127
467 3300032002 Ga0307416_101882541 Ga0307416_1018825412 127
468 3300034817 Ga0373948_0027495 Ga0373948_0027495_725_1108 127
469 3300034818 Ga0373950_0062014 Ga0373950_0062014_152_535 127
470 3300034819 Ga0373958_0011120 Ga0373958_0011120_69_452 127
471 3300034820 Ga0373959_0162331 Ga0373959_0162331_72_455 127
472 3300034957 Ga0373938_0052682 Ga0373938_0052682_200_583 127
473 3300034957 Ga0373938_0095235 Ga0373938_0095235_325_708 127
474 3300035083 Ga0373926_0009739 Ga0373926_0009739_431_844 127
475 3300035085 Ga0373929_0147138 Ga0373929_0147138_169_552 127
476 3300035086 Ga0373934_0000157 Ga0373934_0000157_21571_21984 127
477 3300035086 Ga0373934_0002551 Ga0373934_0002551_4470_4883 127
478 3300035088 Ga0373940_0019387 Ga0373940_0019387_349_732 127
479 3300035089 Ga0373944_0011847 Ga0373944_0011847_587_970 127
480 3300035089 Ga0373944_0096979 Ga0373944_0096979_549_962 127
481 3300035090 Ga0373949_0101589 Ga0373949_0101589_182_565 127
482 3300035091 Ga0373951_0026110 Ga0373951_0026110_629_1039 127
483 3300035091 Ga0373951_0105189 Ga0373951_0105189_348_731 127
484 3300035092 Ga0373952_0074487 Ga0373952_0074487_316_699 127
485 3300035111 Ga0373923_0242420 Ga0373923_0242420_108_491 127
486 3300035112 Ga0373932_0003535 Ga0373932_0003535_2932_3315 127
487 3300035112 Ga0373932_0005272 Ga0373932_0005272_2584_2967 127
488 3300035113 Ga0373936_0012446 Ga0373936_0012446_142_525 127
489 3300035113 Ga0373936_0031196 Ga0373936_0031196_754_1167 127
490 3300035114 Ga0373939_0013282 Ga0373939_0013282_1308_1691 127
491 3300035114 Ga0373939_0150744 Ga0373939_0150744_192_575 127
492 3300035114 Ga0373939_0368031 Ga0373939_0368031_90_473 127
493 3300035115 Ga0373941_0025111 Ga0373941_0025111_492_875 127
494 3300035116 Ga0373945_0016153 Ga0373945_0016153_413_796 127
495 3300035117 Ga0373953_0157129 Ga0373953_0157129_406_819 127
496 3300035117 Ga0373953_0164379 Ga0373953_0164379_432_845 127
497 3300035118 Ga0373954_0007812 Ga0373954_0007812_3228_3641 127
498 3300035118 Ga0373954_0019589 Ga0373954_0019589_1927_2340 127
499 3300035119 Ga0373956_0000273 Ga0373956_0000273_11921_12334 127
500 3300035119 Ga0373956_0021831 Ga0373956_0021831_1526_1939 127
501 3300035119 Ga0373956_0386289 Ga0373956_0386289_42_425 127
502 3300035120 Ga0373957_0004451 Ga0373957_0004451_79_492 127
503 3300035120 Ga0373957_0023316 Ga0373957_0023316_228_641 127
504 3300035121 Ga0373960_0069525 Ga0373960_0069525_635_1018 127
505 3300035121 Ga0373960_0220844 Ga0373960_0220844_107_490 127
506 3300035170 Ga0373943_0065949 Ga0373943_0065949_678_1091 127
507 3300035170 Ga0373943_0102929 Ga0373943_0102929_39_449 127
508 3300035171 Ga0373946_0011082 Ga0373946_0011082_2303_2716 127
509 3300035171 Ga0373946_0085804 Ga0373946_0085804_144_527 127
510 3300035172 Ga0373955_0008143 Ga0373955_0008143_1107_1520 127
511 3300035172 Ga0373955_0015370 Ga0373955_0015370_2150_2563 127
512 3300035172 Ga0373955_0082423 Ga0373955_0082423_1391_1774 127
513 3300035207 Ga0373942_0002745 Ga0373942_0002745_292_678 127
514 3300035207 Ga0373942_0028241 Ga0373942_0028241_987_1370 127
515 3300035207 Ga0373942_0280435 Ga0373942_0280435_132_515 127
516 3300035241 Ga0373961_0016133 Ga0373961_0016133_768_1151 127
517 3300035241 Ga0373961_0048712 Ga0373961_0048712_230_613 127
518 3300035241 Ga0373961_0055087 Ga0373961_0055087_559_942 127
519 3300035242 Ga0373962_0100110 Ga0373962_0100110_435_818 127
520 3300035242 Ga0373962_0106460 Ga0373962_0106460_98_508 127
521 3300035410 Ga0373924_0041056 Ga0373924_0041056_1013_1396 127
522 3300035691 Ga0373931_0003435 Ga0373931_0003435_6189_6572 127
523 3300035691 Ga0373931_0037614 Ga0373931_0037614_1971_2354 127
524 3300035691 Ga0373931_0177315 Ga0373931_0177315_62_475 127
525 3300035691 Ga0373931_0487396 Ga0373931_0487396_65_448 127
526 3300035692 Ga0373935_0015295 Ga0373935_0015295_1278_1691 127
527 3300035692 Ga0373935_0329750 Ga0373935_0329750_559_942 127
528 3300035695 Ga0373927_0025425 Ga0373927_0025425_381_764 127
529 3300035695 Ga0373927_0109836 Ga0373927_0109836_376_789 127
530 3300035724 Ga0373933_0000480 Ga0373933_0000480_10577_10990 127
531 3300035724 Ga0373933_0122493 Ga0373933_0122493_989_1402 127
532 3300035725 Ga0373947_0067283 Ga0373947_0067283_1356_1769 127
533 3300036401 Ga0373937_0001784 Ga0373937_0001784_8336_8749 127
534 3300036401 Ga0373937_0049292 Ga0373937_0049292_395_808 127
535 3300036401 Ga0373937_0116819 Ga0373937_0116819_922_1335 127
536 3300036401 Ga0373937_0173406 Ga0373937_0173406_513_896 127
537 3300037068 Ga0373925_0011560 Ga0373925_0011560_5919_6332 127
538 3300037418 Ga0395900_0117051 Ga0395900_0117051_220_630 127
539 3300037853 Ga0436364_1113710 Ga0436364_1113710_1317_1787 127
540 3300038443 Ga0395901_0056419 Ga0395901_0056419_3432_3842 127
541 3300039437 Ga0436365_0079817 Ga0436365_0079817_1874_2293 127
542 3300039437 Ga0436365_0287902 Ga0436365_0287902_368_778 127
543 3300039437 Ga0436365_1366479 Ga0436365_1366479_340_750 127
544 3300039437 Ga0436365_1679214 Ga0436365_1679214_252_662 127
545 3300039438 Ga0436360_0478030 Ga0436360_0478030_739_1122 127
546 3300039438 Ga0436360_0811880 Ga0436360_0811880_87_497 127
547 3300039450 Ga0436363_1102627 Ga0436363_1102627_42_452 127
548 3300039450 Ga0436363_1654719 Ga0436363_1654719_638_1048 127
549 3300039453 Ga0436362_0127817 Ga0436362_0127817_1171_1581 127
550 3300039453 Ga0436362_0345626 Ga0436362_0345626_37_420 127
551 3300041408 Ga0439453_0003672 Ga0439453_0003672_1247_1633 127
552 3300041443 Ga0451789_0234132 Ga0451789_0234132_75_518 127
553 3300041486 Ga0451807_2199014 Ga0451807_2199014_1745_2128 127
554 3300041486 Ga0451807_2462780 Ga0451807_2462780_688_1071 127
555 3300041512 Ga0451853_0460087 Ga0451853_0460087_162_545 127
556 3300042001 Ga0439441_005775 Ga0439441_005775_108_491 127
557 3300042003 Ga0439443_001965 Ga0439443_001965_1608_1991 127
558 3300042009 Ga0439451_010051 Ga0439451_010051_558_941 127
559 3300042009 Ga0439451_087259 Ga0439451_087259_150_536 127
560 3300042156 Ga0439446_0175315 Ga0439446_0175315_160_546 127
561 3300042435 Ga0439434_0000074 Ga0439434_0000074_16715_17098 127
562 3300042435 Ga0439434_0070864 Ga0439434_0070864_396_779 127
563 3300042436 Ga0439435_0000001 Ga0439435_0000001_1523_1906 127
564 3300042436 Ga0439435_0000154 Ga0439435_0000154_7267_7650 127
565 3300042436 Ga0439435_0000817 Ga0439435_0000817_4344_4730 127
566 3300042437 Ga0439444_0002711 Ga0439444_0002711_633_1016 127
567 3300042437 Ga0439444_0032773 Ga0439444_0032773_174_560 127
568 3300042439 Ga0439464_0038631 Ga0439464_0038631_85_471 127
569 3300042461 Ga0439460_0000495 Ga0439460_0000495_1117_1500 127
570 3300042461 Ga0439460_0151211 Ga0439460_0151211_205_591 127
571 3300042876 Ga0451577_0109406 Ga0451577_0109406_101_514 127
572 3300042876 Ga0451577_1021107 Ga0451577_1021107_74_457 127
573 3300042993 Ga0439440_0102072 Ga0439440_0102072_322_705 127
574 3300044673 Ga0453683_0577435 Ga0453683_0577435_209_595 127
575 3300044694 Ga0466963_0373859 Ga0466963_0373859_241_651 127
576 3300044694 Ga0466963_0720945 Ga0466963_0720945_133_543 127
577 3300044706 Ga0466964_0317783 Ga0466964_0317783_311_721 127
578 3300044842 Ga0466957_0801542 Ga0466957_0801542_32_439 127
579 3300045051 Ga0451576_0003549 Ga0451576_0003549_13738_14121 127
580 3300045051 Ga0451576_0068493 Ga0451576_0068493_2995_3381 127
581 3300045051 Ga0451576_0224289 Ga0451576_0224289_749_1132 127
582 3300045051 Ga0451576_0226654 Ga0451576_0226654_741_1124 127
583 3300045976 Ga0466967_0192036 Ga0466967_0192036_747_1157 127
584 3300045976 Ga0466967_0518298 Ga0466967_0518298_733_1140 127
585 3300046454 Ga0495592_0003654 Ga0495592_0003654_4401_4814 127
586 3300046454 Ga0495592_0046909 Ga0495592_0046909_2620_3033 127
587 3300046455 Ga0495603_0076782 Ga0495603_0076782_1109_1492 127
588 3300046455 Ga0495603_0243415 Ga0495603_0243415_327_740 127
589 3300046459 Ga0495629_0144629 Ga0495629_0144629_749_1162 127
590 3300046460 Ga0495638_0464316 Ga0495638_0464316_176_559 127
591 3300046461 Ga0495641_0005394 Ga0495641_0005394_2435_2848 127
592 3300046462 Ga0495651_0001404 Ga0495651_0001404_12390_12803 127
593 3300046462 Ga0495651_0010052 Ga0495651_0010052_2367_2780 127
594 3300046472 Ga0495580_0001708 Ga0495580_0001708_17318_17701 127
595 3300046472 Ga0495580_0032036 Ga0495580_0032036_939_1352 127
596 3300046473 Ga0495582_0096153 Ga0495582_0096153_732_1145 127
597 3300046473 Ga0495582_0100238 Ga0495582_0100238_984_1367 127
598 3300046475 Ga0495639_0005581 Ga0495639_0005581_745_1158 127
599 3300046475 Ga0495639_0009811 Ga0495639_0009811_3533_3916 127
600 3300046476 Ga0495662_0023307 Ga0495662_0023307_376_789 127
601 3300046477 Ga0495664_0035621 Ga0495664_0035621_1950_2363 127
602 3300046477 Ga0495664_0339728 Ga0495664_0339728_70_480 127
603 3300046499 Ga0495594_0052450 Ga0495594_0052450_547_960 127
604 3300046516 Ga0495628_0003204 Ga0495628_0003204_1660_2070 127
605 3300046516 Ga0495628_0026741 Ga0495628_0026741_2522_2935 127
606 3300046516 Ga0495628_0031003 Ga0495628_0031003_3421_3834 127
607 3300046516 Ga0495628_0335799 Ga0495628_0335799_499_882 127
608 3300046517 Ga0495630_0009427 Ga0495630_0009427_4293_4706 127
609 3300046517 Ga0495630_0180845 Ga0495630_0180845_166_549 127
610 3300046517 Ga0495630_0395570 Ga0495630_0395570_289_699 127
611 3300046526 Ga0495666_0023406 Ga0495666_0023406_1247_1660 127
612 3300046526 Ga0495666_0056142 Ga0495666_0056142_310_693 127
613 3300046528 Ga0495642_0034646 Ga0495642_0034646_1539_1922 127
614 3300046529 Ga0495652_0031108 Ga0495652_0031108_2776_3189 127
615 3300046531 Ga0495665_0015081 Ga0495665_0015081_1365_1778 127
616 3300046533 Ga0495640_0055508 Ga0495640_0055508_1375_1788 127
617 3300046535 Ga0495586_0012380 Ga0495586_0012380_989_1372 127
618 3300046535 Ga0495586_0123421 Ga0495586_0123421_580_990 127
619 3300046536 Ga0495587_0028384 Ga0495587_0028384_2069_2482 127
620 3300046536 Ga0495587_0104533 Ga0495587_0104533_1056_1469 127
621 3300046543 Ga0495645_0170458 Ga0495645_0170458_581_994 127
622 3300046557 Ga0495622_0019107 Ga0495622_0019107_2551_2964 127
623 3300046559 Ga0495667_0038003 Ga0495667_0038003_1769_2182 127
624 3300046615 Ga0495656_0251639 Ga0495656_0251639_335_745 127
625 3300046642 Ga0495634_0106415 Ga0495634_0106415_922_1335 127
626 3300046642 Ga0495634_0339215 Ga0495634_0339215_422_832 127
627 3300046663 Ga0495635_0023515 Ga0495635_0023515_1543_1956 127
628 3300046674 Ga0495588_0116767 Ga0495588_0116767_24_407 127
629 3300046674 Ga0495588_0184870 Ga0495588_0184870_585_1040 127
630 3300046674 Ga0495588_0305277 Ga0495588_0305277_391_777 127
631 3300046675 Ga0495657_0006684 Ga0495657_0006684_2460_2873 127
632 3300046675 Ga0495657_0193579 Ga0495657_0193579_148_558 127
633 3300046678 Ga0495599_0013413 Ga0495599_0013413_2168_2581 127
634 3300046678 Ga0495599_0040993 Ga0495599_0040993_1770_2183 127
635 3300046680 Ga0495646_0580384 Ga0495646_0580384_92_502 127
636 3300046681 Ga0495647_0012311 Ga0495647_0012311_1132_1545 127
637 3300046681 Ga0495647_0014994 Ga0495647_0014994_1230_1613 127
638 3300046683 Ga0495658_0018001 Ga0495658_0018001_2504_2887 127
639 3300046684 Ga0495669_0010717 Ga0495669_0010717_2546_2929 127
640 3300046689 Ga0495613_0103416 Ga0495613_0103416_382_795 127
641 3300046690 Ga0495624_0131103 Ga0495624_0131103_280_735 127
642 3300046809 Ga0495600_0124088 Ga0495600_0124088_794_1207 127
643 3300047315 Ga0495581_0120665 Ga0495581_0120665_235_690 127
644 3300047315 Ga0495581_0131825 Ga0495581_0131825_183_566 127
645 3300047315 Ga0495581_0296625 Ga0495581_0296625_165_575 127
646 3300047317 Ga0495604_0036544 Ga0495604_0036544_820_1233 127
647 3300047319 Ga0495674_0008256 Ga0495674_0008256_2201_2614 127
648 3300047319 Ga0495674_0388126 Ga0495674_0388126_81_491 127
649 3300047319 Ga0495674_0973660 Ga0495674_0973660_49_459 127
650 3300047320 Ga0495672_0100841 Ga0495672_0100841_628_1035 127
651 3300047321 Ga0495676_0045436 Ga0495676_0045436_228_611 127
652 3300047444 Ga0495675_0032218 Ga0495675_0032218_453_866 127
653 3300047471 Ga0495684_0014546 Ga0495684_0014546_5171_5584 127
654 3300047471 Ga0495684_0573479 Ga0495684_0573479_54_437 127
655 3300047673 Ga0495593_0444025 Ga0495593_0444025_88_498 127
656 3300048088 Ga0495602_0274070 Ga0495602_0274070_513_923 127
657 3300048904 Ga0496101_0176014 Ga0496101_0176014_126_533 127
658 3300048904 Ga0496101_0556566 Ga0496101_0556566_215_625 127
659 3300048905 Ga0496102_0094190 Ga0496102_0094190_1260_1667 127
660 3300048906 Ga0496103_0343859 Ga0496103_0343859_318_728 127
661 3300048907 Ga0496104_0074260 Ga0496104_0074260_2310_2717 127
662 3300048907 Ga0496104_0593112 Ga0496104_0593112_26_436 127
663 3300048908 Ga0496105_0021478 Ga0496105_0021478_3089_3496 127
664 3300048909 Ga0496106_0953898 Ga0496106_0953898_165_575 127
665 3300048910 Ga0496107_0424915 Ga0496107_0424915_241_651 127
666 3300048911 Ga0496108_0597465 Ga0496108_0597465_175_582 127
667 3300048912 Ga0496109_1259233 Ga0496109_1259233_230_640 127
668 3300048912 Ga0496109_1529927 Ga0496109_1529927_117_524 127
669 3300048913 Ga0496110_0609274 Ga0496110_0609274_218_628 127
670 3300048913 Ga0496110_0865028 Ga0496110_0865028_66_473 127
671 3300048914 Ga0496111_0256008 Ga0496111_0256008_117_527 127
672 3300048914 Ga0496111_1234901 Ga0496111_1234901_61_468 127
673 3300048915 Ga0496112_0000059 Ga0496112_0000059_2602_3012 127
674 3300048915 Ga0496112_0177400 Ga0496112_0177400_1536_1946 127
675 3300048915 Ga0496112_0249552 Ga0496112_0249552_256_666 127
676 3300048916 Ga0496113_0319654 Ga0496113_0319654_140_550 127
677 3300048916 Ga0496113_0726455 Ga0496113_0726455_55_462 127
678 3300048918 Ga0496115_0050450 Ga0496115_0050450_1631_2086 127
679 3300048929 Ga0496126_0033139 Ga0496126_0033139_1629_2039 127
680 3300048929 Ga0496126_0092888 Ga0496126_0092888_86_496 127
681 3300048929 Ga0496126_0147836 Ga0496126_0147836_145_555 127
682 3300048929 Ga0496126_0366482 Ga0496126_0366482_107_517 127
683 3300048929 Ga0496126_0788516 Ga0496126_0788516_266_676 127
684 3300049568 Ga0501031_0362604 Ga0501031_0362604_139_522 127
685 3300049570 Ga0501033_0048828 Ga0501033_0048828_360_743 127
686 3300049572 Ga0501036_0173317 Ga0501036_0173317_404_787 127
687 3300049574 Ga0501038_0065554 Ga0501038_0065554_45_428 127
688 3300049575 Ga0501039_0498230 Ga0501039_0498230_536_919 127
689 3300049576 Ga0501040_0009124 Ga0501040_0009124_1239_1622 127
690 3300049576 Ga0501040_0172474 Ga0501040_0172474_956_1339 127
691 3300049577 Ga0501041_0014220 Ga0501041_0014220_2988_3371 127
692 3300049578 Ga0501042_0463972 Ga0501042_0463972_194_580 127
693 3300049581 Ga0501047_0932578 Ga0501047_0932578_174_602 127
694 3300049582 Ga0501048_0082066 Ga0501048_0082066_71_454 127
695 3300049587 Ga0501071_0854603 Ga0501071_0854603_231_614 127
696 3300049588 Ga0501072_0433320 Ga0501072_0433320_507_890 127
697 3300049590 Ga0501074_0702335 Ga0501074_0702335_297_680 127
698 3300049592 Ga0501076_0615668 Ga0501076_0615668_464_847 127
699 3300049593 Ga0501077_0229060 Ga0501077_0229060_422_805 127
700 3300049667 Ga0501230_098378 Ga0501230_098378_41_424 127
701 3300049741 Ga0501079_0866955 Ga0501079_0866955_192_575 127
702 3300049742 Ga0501080_0393830 Ga0501080_0393830_434_817 127
703 3300049822 Ga0501035_0368522 Ga0501035_0368522_108_491 127
704 3300049824 Ga0501045_0835738 Ga0501045_0835738_129_512 127
705 3300050492 nmdc:mga0yw44_693589_c1 nmdc:mga0yw44_693589_c1_163_573 127
706 3300050507 nmdc:mga05p37_1864800_c1 nmdc:mga05p37_1864800_c1_76_462 127
707 3300050507 nmdc:mga05p37_2045_c1 nmdc:mga05p37_2045_c1_19838_20221 127
708 3300050507 nmdc:mga05p37_378695_c1 nmdc:mga05p37_378695_c1_280_687 127
709 3300050507 nmdc:mga05p37_379757_c1 nmdc:mga05p37_379757_c1_657_1040 127
710 3300050508 nmdc:mga09592_1655_c1 nmdc:mga09592_1655_c1_6804_7187 127
711 3300050508 nmdc:mga09592_200507_c1 nmdc:mga09592_200507_c1_876_1283 127
712 3300050508 nmdc:mga09592_284247_c1 nmdc:mga09592_284247_c1_791_1177 127
713 3300050509 nmdc:mga0qj67_137773_c1 nmdc:mga0qj67_137773_c1_815_1201 127
714 3300050509 nmdc:mga0qj67_14040_c1 nmdc:mga0qj67_14040_c1_2266_2649 127
715 3300050509 nmdc:mga0qj67_202389_c1 nmdc:mga0qj67_202389_c1_1205_1588 127
716 3300050509 nmdc:mga0qj67_452188_c1 nmdc:mga0qj67_452188_c1_299_685 127
717 3300050509 nmdc:mga0qj67_526303_c1 nmdc:mga0qj67_526303_c1_184_567 127
718 3300050510 nmdc:mga06r32_157084_c1 nmdc:mga06r32_157084_c1_572_958 127
719 3300050510 nmdc:mga06r32_1622773_c1 nmdc:mga06r32_1622773_c1_101_484 127
720 3300050511 nmdc:mga08y16_133287_c1 nmdc:mga08y16_133287_c1_38_421 127
721 3300050511 nmdc:mga08y16_4849_c1 nmdc:mga08y16_4849_c1_8724_9107 127
722 3300050511 nmdc:mga08y16_70976_c1 nmdc:mga08y16_70976_c1_1384_1767 127
723 3300050511 nmdc:mga08y16_77092_c1 nmdc:mga08y16_77092_c1_2922_3308 127
724 3300050512 nmdc:mga0n895_39500_c1 nmdc:mga0n895_39500_c1_284_667 127
725 3300050513 nmdc:mga0rr50_1178798_c1 nmdc:mga0rr50_1178798_c1_199_582 127
726 3300050513 nmdc:mga0rr50_126820_c1 nmdc:mga0rr50_126820_c1_99_482 127
727 3300050513 nmdc:mga0rr50_1406880_c1 nmdc:mga0rr50_1406880_c1_91_501 127
728 3300050513 nmdc:mga0rr50_545908_c1 nmdc:mga0rr50_545908_c1_502_888 127
729 3300050513 nmdc:mga0rr50_8370_c1 nmdc:mga0rr50_8370_c1_3334_3717 127
730 3300050514 nmdc:mga08x19_122448_c1 nmdc:mga08x19_122448_c1_547_957 127
731 3300050514 nmdc:mga08x19_3563_c1 nmdc:mga08x19_3563_c1_855_1238 127
732 3300050514 nmdc:mga08x19_3851_c1 nmdc:mga08x19_3851_c1_5096_5479 127
733 3300050515 nmdc:mga0a205_3207_c1 nmdc:mga0a205_3207_c1_7938_8321 127
734 3300050515 nmdc:mga0a205_627150_c1 nmdc:mga0a205_627150_c1_138_521 127
735 3300053077 Ga0495601_0002510 Ga0495601_0002510_2265_2675 127
736 3300053078 Ga0495612_0042322 Ga0495612_0042322_549_962 127
737 3300053085 Ga0495619_0005618 Ga0495619_0005618_1438_1851 127
738 3300053085 Ga0495619_0277934 Ga0495619_0277934_112_525 127
739 3300054114 Ga0501084_0171301 Ga0501084_0171301_1346_1729 127
740 3300054114 Ga0501084_1177843 Ga0501084_1177843_221_604 127
741 3300059426 Ga0590077_029822 Ga0590077_029822_123_506 127
742 3300060353 Ga0501082_0827153 Ga0501082_0827153_263_670 127

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

31

156

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v4f-assembly1.cif.gz_A crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis 0.8702 4 126
5v4f-assembly1.cif.gz_A crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis 0.8445 4 126
3lyb-assembly1.cif.gz_D structure of putative endoribonuclease(kp1_3112) from klebsiella pneumoniae 0.8212 26 126
5hp7-assembly1.cif.gz_A crystal structures of rida in the apo form 0.8208 26 126
3lyb-assembly1.cif.gz_C structure of putative endoribonuclease(kp1_3112) from klebsiella pneumoniae 0.8178 26 126
ID Description Score Start End Superfamily
af_Q8MRI4_457_563_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8433 26 126 3.30.1330.40
af_Q9USQ7_300_402_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8314 26 125 3.30.1330.40
3k12B01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8219 26 126 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8187 26 126 3.30.1330.40
3k12B01 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.807 26 126 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A537L500-F1-model_v4 RidA family protein 0.9908 1 126 GO:0005829
GO:0019239
AF-F8J6N8-F1-model_v4 Endoribonuclease L-PSP 0.9869 1 126 GO:0005829
GO:0019239
AF-A0A537L500-F1-model_v4 RidA family protein 0.983 1 126 GO:0005829
GO:0019239
AF-F8J6N8-F1-model_v4 Endoribonuclease L-PSP 0.9791 1 126 GO:0005829
GO:0019239
AF-A0A435IH74-F1-model_v4 deleted 0.9754 16 126

Feature Viewer

pLDDT pTM Quality
95.5 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map