F478633
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 742 | 390 | 740 | 131 |
Family's Representative Sequence
| Representative Sequence | 3300021388|Ga0213875_10183163|Ga0213875_101831632 |
| Length | 156 |
| Sequence | MLSDMHRLATKGAPIREGKQMAAEINIYNPKELGTPMGQYTHVTRVKATEFVFIAGMLAGDANDNIVGEGDFDAQVEQVFKNIEIALASAQVGWLNVVQFTTYLVHSQDIPKFMEFRKRAFPRMFSNGKYPPNTLLMVDRLVKESFLVEVQTIAAI |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2958122699 | Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 | Isolate | Nodule |
| 2 | 2977872689 | Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 | Isolate | Nodule |
| 3 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 4 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 9 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 70 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 71 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 72 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 73 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 74 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 77 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 78 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 79 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 80 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 82 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 85 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 86 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 87 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 88 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 89 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 96 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 126 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 127 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 128 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 129 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 200 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 207 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 208 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 211 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 213 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 214 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 215 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 216 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 217 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 218 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 219 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 220 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 221 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 222 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 223 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 224 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 225 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 226 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 227 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 228 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 229 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 230 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 234 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 237 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 238 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 239 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 240 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 241 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 242 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 243 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 245 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 253 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 256 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 257 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 260 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 263 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 264 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 267 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 268 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 269 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 270 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 271 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 272 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 273 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 274 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 275 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 276 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 277 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 278 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 279 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 280 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 281 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 282 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 283 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 284 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 334 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 335 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 336 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 337 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 338 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 339 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 342 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 343 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 344 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 345 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 346 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 347 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 368 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 375 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 379 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 380 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 381 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 382 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 383 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 386 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 387 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 389 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.73 |
| Metatranscriptomes | 0 |
| Isolates | 0.27 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.27 |
| Nodule | 0.27 |
| Rhizoplane | 3.37 |
| Rhizosphere | 93.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 2.29 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24742J22300_10024783 | 3300002244 | Bacteria | 1035 |
| 2 | JGI25405J52794_10100041 | 3300003911 | Bacteria | 646 |
| 3 | Ga0065704_10325148 | 3300005289 | Unclassified | 846 |
| 4 | Ga0065707_10005701 | 3300005295 | Bacteria | 2770 |
| 5 | Ga0065707_10106587 | 3300005295 | Bacteria | 2590 |
| 6 | Ga0065707_10731008 | 3300005295 | Bacteria | 626 |
| 7 | Ga0070658_10364204 | 3300005327 | Bacteria | 1239 |
| 8 | Ga0070683_100311306 | 3300005329 | Bacteria | 1498 |
| 9 | Ga0070683_100336504 | 3300005329 | Bacteria | 1437 |
| 10 | Ga0070690_100000172 | 3300005330 | Bacteria | 33180 |
| 11 | Ga0070690_100029637 | 3300005330 | Bacteria | 3396 |
| 12 | Ga0070690_100133703 | 3300005330 | Bacteria | 1678 |
| 13 | Ga0070690_100578248 | 3300005330 | Bacteria | 850 |
| 14 | Ga0068869_100004583 | 3300005334 | Bacteria | 8612 |
| 15 | Ga0070666_10247213 | 3300005335 | Bacteria | 1262 |
| 16 | Ga0070680_100000230 | 3300005336 | Bacteria | 36894 |
| 17 | Ga0070680_100017864 | 3300005336 | Bacteria | 5596 |
| 18 | Ga0070680_100234358 | 3300005336 | Bacteria | 1550 |
| 19 | Ga0070682_100023353 | 3300005337 | Bacteria | 3670 |
| 20 | Ga0068868_100001075 | 3300005338 | Bacteria | 18741 |
| 21 | Ga0068868_100569867 | 3300005338 | Bacteria | 1000 |
| 22 | Ga0068868_101669420 | 3300005338 | Unclassified | 600 |
| 23 | Ga0070660_100437560 | 3300005339 | Bacteria | 1084 |
| 24 | Ga0070689_100001034 | 3300005340 | Bacteria | 17460 |
| 25 | Ga0070689_100158951 | 3300005340 | Bacteria | 1826 |
| 26 | Ga0070691_10000935 | 3300005341 | Bacteria | 11861 |
| 27 | Ga0070691_10186338 | 3300005341 | Bacteria | 1083 |
| 28 | Ga0070691_10570298 | 3300005341 | Unclassified | 664 |
| 29 | Ga0070687_100000141 | 3300005343 | Bacteria | 25042 |
| 30 | Ga0070661_100735077 | 3300005344 | Bacteria | 806 |
| 31 | Ga0070692_10002703 | 3300005345 | Bacteria | 6951 |
| 32 | Ga0070692_10022726 | 3300005345 | Bacteria | 3066 |
| 33 | Ga0070668_100135997 | 3300005347 | Bacteria | 1977 |
| 34 | Ga0070669_100004039 | 3300005353 | Bacteria | 10618 |
| 35 | Ga0070669_100229804 | 3300005353 | Bacteria | 1470 |
| 36 | Ga0070675_100942597 | 3300005354 | Bacteria | 792 |
| 37 | Ga0070671_101289879 | 3300005355 | Bacteria | 644 |
| 38 | Ga0070674_100086449 | 3300005356 | Bacteria | 2252 |
| 39 | Ga0070674_101046603 | 3300005356 | Bacteria | 718 |
| 40 | Ga0070674_101855267 | 3300005356 | Bacteria | 547 |
| 41 | Ga0070673_100027946 | 3300005364 | Bacteria | 4189 |
| 42 | Ga0070673_100941539 | 3300005364 | Bacteria | 802 |
| 43 | Ga0070673_101527146 | 3300005364 | Bacteria | 630 |
| 44 | Ga0070688_101218612 | 3300005365 | Bacteria | 605 |
| 45 | Ga0070659_100564095 | 3300005366 | Bacteria | 976 |
| 46 | Ga0070667_101389817 | 3300005367 | Bacteria | 658 |
| 47 | Ga0070703_10014775 | 3300005406 | Bacteria | 2227 |
| 48 | Ga0070709_10097186 | 3300005434 | Unclassified | 1954 |
| 49 | Ga0070709_10118326 | 3300005434 | Bacteria | 1792 |
| 50 | Ga0070709_10142882 | 3300005434 | Bacteria | 1646 |
| 51 | Ga0070714_100003691 | 3300005435 | Bacteria | 11465 |
| 52 | Ga0070714_100042501 | 3300005435 | Bacteria | 3840 |
| 53 | Ga0070713_100039796 | 3300005436 | Bacteria | 3818 |
| 54 | Ga0070713_101287690 | 3300005436 | Bacteria | 708 |
| 55 | Ga0070713_101767560 | 3300005436 | Bacteria | 600 |
| 56 | Ga0070710_10022316 | 3300005437 | Unclassified | 3308 |
| 57 | Ga0070701_10000216 | 3300005438 | Bacteria | 18130 |
| 58 | Ga0070711_100235468 | 3300005439 | Bacteria | 1429 |
| 59 | Ga0070705_100001001 | 3300005440 | Bacteria | 15736 |
| 60 | Ga0070705_100013041 | 3300005440 | Bacteria | 4241 |
| 61 | Ga0070700_100000591 | 3300005441 | Bacteria | 18135 |
| 62 | Ga0070700_100304030 | 3300005441 | Bacteria | 1165 |
| 63 | Ga0070694_100001923 | 3300005444 | Bacteria | 12299 |
| 64 | Ga0070694_100003005 | 3300005444 | Bacteria | 10033 |
| 65 | Ga0070694_100114267 | 3300005444 | Bacteria | 1927 |
| 66 | Ga0070694_100115942 | 3300005444 | Bacteria | 1915 |
| 67 | Ga0070708_100313445 | 3300005445 | Bacteria | 1478 |
| 68 | Ga0070708_101075038 | 3300005445 | Bacteria | 754 |
| 69 | Ga0070663_100322859 | 3300005455 | Bacteria | 1242 |
| 70 | Ga0070678_101903225 | 3300005456 | Bacteria | 562 |
| 71 | Ga0070662_101373442 | 3300005457 | Unclassified | 608 |
| 72 | Ga0070681_10042871 | 3300005458 | Bacteria | 4534 |
| 73 | Ga0070681_10110098 | 3300005458 | Bacteria | 2694 |
| 74 | Ga0070681_10224793 | 3300005458 | Bacteria | 1792 |
| 75 | Ga0070681_10485955 | 3300005458 | Bacteria | 1148 |
| 76 | Ga0068867_100000275 | 3300005459 | Bacteria | 33877 |
| 77 | Ga0068867_100000487 | 3300005459 | Bacteria | 26508 |
| 78 | Ga0070706_100804209 | 3300005467 | Bacteria | 870 |
| 79 | Ga0070706_101687902 | 3300005467 | Bacteria | 577 |
| 80 | Ga0070698_100336715 | 3300005471 | Bacteria | 1440 |
| 81 | Ga0070699_100034399 | 3300005518 | Bacteria | 4379 |
| 82 | Ga0070679_100600987 | 3300005530 | Bacteria | 1043 |
| 83 | Ga0070679_100781892 | 3300005530 | Bacteria | 898 |
| 84 | Ga0070679_100839957 | 3300005530 | Bacteria | 862 |
| 85 | Ga0070679_101889527 | 3300005530 | Unclassified | 546 |
| 86 | Ga0070684_100016626 | 3300005535 | Bacteria | 6017 |
| 87 | Ga0070684_100025358 | 3300005535 | Bacteria | 4983 |
| 88 | Ga0070684_101167151 | 3300005535 | Bacteria | 724 |
| 89 | Ga0070684_101222058 | 3300005535 | Bacteria | 707 |
| 90 | Ga0068853_100136985 | 3300005539 | Bacteria | 2195 |
| 91 | Ga0068853_100363900 | 3300005539 | Bacteria | 1348 |
| 92 | Ga0068853_100615794 | 3300005539 | Bacteria | 1032 |
| 93 | Ga0068853_100671872 | 3300005539 | Bacteria | 987 |
| 94 | Ga0070672_100268151 | 3300005543 | Bacteria | 1441 |
| 95 | Ga0070686_100000527 | 3300005544 | Bacteria | 22925 |
| 96 | Ga0070686_100065931 | 3300005544 | Bacteria | 2353 |
| 97 | Ga0070695_100000498 | 3300005545 | Bacteria | 20517 |
| 98 | Ga0070695_100008411 | 3300005545 | Bacteria | 6126 |
| 99 | Ga0070695_100249577 | 3300005545 | Bacteria | 1291 |
| 100 | Ga0070696_100000061 | 3300005546 | Bacteria | 52371 |
| 101 | Ga0070696_100074309 | 3300005546 | Bacteria | 2397 |
| 102 | Ga0070696_100159185 | 3300005546 | Bacteria | 1663 |
| 103 | Ga0070696_100466611 | 3300005546 | Bacteria | 999 |
| 104 | Ga0070696_100533632 | 3300005546 | Bacteria | 938 |
| 105 | Ga0070693_100000016 | 3300005547 | Bacteria | 63019 |
| 106 | Ga0070693_100511286 | 3300005547 | Bacteria | 854 |
| 107 | Ga0070665_100344579 | 3300005548 | Bacteria | 1495 |
| 108 | Ga0070704_100000487 | 3300005549 | Bacteria | 18855 |
| 109 | Ga0070704_100119723 | 3300005549 | Bacteria | 2020 |
| 110 | Ga0070704_101026318 | 3300005549 | Bacteria | 747 |
| 111 | Ga0068855_100000975 | 3300005563 | Bacteria | 35626 |
| 112 | Ga0068855_100018315 | 3300005563 | Bacteria | 8412 |
| 113 | Ga0068855_100353997 | 3300005563 | Bacteria | 1617 |
| 114 | Ga0068855_100847732 | 3300005563 | Bacteria | 969 |
| 115 | Ga0068855_100936053 | 3300005563 | Bacteria | 914 |
| 116 | Ga0068857_100060760 | 3300005577 | Bacteria | 3356 |
| 117 | Ga0068857_101524409 | 3300005577 | Bacteria | 652 |
| 118 | Ga0068854_100000366 | 3300005578 | Bacteria | 28906 |
| 119 | Ga0068856_100010596 | 3300005614 | Bacteria | 8957 |
| 120 | Ga0068856_100020844 | 3300005614 | Bacteria | 6370 |
| 121 | Ga0068856_101714046 | 3300005614 | Unclassified | 641 |
| 122 | Ga0070702_100000485 | 3300005615 | Bacteria | 14291 |
| 123 | Ga0068852_100240908 | 3300005616 | Bacteria | 1728 |
| 124 | Ga0068852_102139086 | 3300005616 | Bacteria | 581 |
| 125 | Ga0068859_100005636 | 3300005617 | Bacteria | 12764 |
| 126 | Ga0068859_100513283 | 3300005617 | Unclassified | 1294 |
| 127 | Ga0068864_100015369 | 3300005618 | Bacteria | 6364 |
| 128 | Ga0068866_10000176 | 3300005718 | Bacteria | 29873 |
| 129 | Ga0068866_10627521 | 3300005718 | Unclassified | 729 |
| 130 | Ga0068861_100001699 | 3300005719 | Bacteria | 14134 |
| 131 | Ga0068861_100004033 | 3300005719 | Bacteria | 9835 |
| 132 | Ga0068851_10079942 | 3300005834 | Bacteria | 1706 |
| 133 | Ga0068870_10013749 | 3300005840 | Bacteria | 3811 |
| 134 | Ga0068870_10114773 | 3300005840 | Bacteria | 1543 |
| 135 | Ga0068863_100568029 | 3300005841 | Bacteria | 1121 |
| 136 | Ga0068858_100000619 | 3300005842 | Bacteria | 37094 |
| 137 | Ga0068858_100091525 | 3300005842 | Bacteria | 2831 |
| 138 | Ga0068858_102125838 | 3300005842 | Bacteria | 555 |
| 139 | Ga0068860_100002570 | 3300005843 | Bacteria | 18998 |
| 140 | Ga0068860_100847004 | 3300005843 | Bacteria | 929 |
| 141 | Ga0068862_100003412 | 3300005844 | Bacteria | 13698 |
| 142 | Ga0068862_100012212 | 3300005844 | Bacteria | 7099 |
| 143 | Ga0068862_100459243 | 3300005844 | Bacteria | 1202 |
| 144 | Ga0081455_10050130 | 3300005937 | Bacteria | 3593 |
| 145 | Ga0081540_1000370 | 3300005983 | Bacteria | 45002 |
| 146 | Ga0081539_10000008 | 3300005985 | Bacteria | 525071 |
| 147 | Ga0070717_10089862 | 3300006028 | Unclassified | 2591 |
| 148 | Ga0070717_10450680 | 3300006028 | Bacteria | 1160 |
| 149 | Ga0070717_11051079 | 3300006028 | Bacteria | 742 |
| 150 | Ga0070717_11256425 | 3300006028 | Bacteria | 673 |
| 151 | Ga0075365_10206258 | 3300006038 | Bacteria | 1378 |
| 152 | Ga0070715_10037076 | 3300006163 | Bacteria | 2015 |
| 153 | Ga0070715_10694607 | 3300006163 | Bacteria | 607 |
| 154 | Ga0070716_100003046 | 3300006173 | Bacteria | 7819 |
| 155 | Ga0070716_100945551 | 3300006173 | Bacteria | 678 |
| 156 | Ga0070712_100017433 | 3300006175 | Bacteria | 4649 |
| 157 | Ga0070712_100908306 | 3300006175 | Bacteria | 759 |
| 158 | Ga0097621_100001255 | 3300006237 | Bacteria | 17539 |
| 159 | Ga0097621_100001554 | 3300006237 | Bacteria | 15677 |
| 160 | Ga0097621_101034452 | 3300006237 | Bacteria | 769 |
| 161 | Ga0068871_100002479 | 3300006358 | Bacteria | 12590 |
| 162 | Ga0068871_100003865 | 3300006358 | Bacteria | 10325 |
| 163 | Ga0075428_100000532 | 3300006844 | Bacteria | 38828 |
| 164 | Ga0075428_100202643 | 3300006844 | Bacteria | 2145 |
| 165 | Ga0075428_100520332 | 3300006844 | Bacteria | 1272 |
| 166 | Ga0075428_100752533 | 3300006844 | Bacteria | 1037 |
| 167 | Ga0075428_101355406 | 3300006844 | Bacteria | 747 |
| 168 | Ga0075428_101971507 | 3300006844 | Bacteria | 606 |
| 169 | Ga0075430_100001203 | 3300006846 | Bacteria | 20788 |
| 170 | Ga0075430_100018890 | 3300006846 | Bacteria | 5865 |
| 171 | Ga0075430_100267639 | 3300006846 | Bacteria | 1415 |
| 172 | Ga0075430_100567535 | 3300006846 | Bacteria | 936 |
| 173 | Ga0075430_101023258 | 3300006846 | Bacteria | 680 |
| 174 | Ga0075430_101186501 | 3300006846 | Bacteria | 628 |
| 175 | Ga0075431_100119157 | 3300006847 | Bacteria | 2723 |
| 176 | Ga0075431_100816037 | 3300006847 | Bacteria | 905 |
| 177 | Ga0075431_101715467 | 3300006847 | Unclassified | 585 |
| 178 | Ga0075433_10463541 | 3300006852 | Bacteria | 1117 |
| 179 | Ga0075434_100027094 | 3300006871 | Bacteria | 5625 |
| 180 | Ga0075434_101060870 | 3300006871 | Unclassified | 824 |
| 181 | Ga0075429_100321678 | 3300006880 | Bacteria | 1354 |
| 182 | Ga0068865_100000262 | 3300006881 | Bacteria | 28966 |
| 183 | Ga0068865_100162540 | 3300006881 | Bacteria | 1705 |
| 184 | Ga0075436_100000639 | 3300006914 | Bacteria | 23035 |
| 185 | Ga0075436_100032287 | 3300006914 | Bacteria | 3608 |
| 186 | Ga0075436_100058044 | 3300006914 | Bacteria | 2673 |
| 187 | Ga0097620_100005635 | 3300006931 | Bacteria | 12764 |
| 188 | Ga0097620_100513330 | 3300006931 | Unclassified | 1294 |
| 189 | Ga0075435_100009644 | 3300007076 | Bacteria | 7008 |
| 190 | Ga0075435_100051941 | 3300007076 | Bacteria | 3303 |
| 191 | Ga0075435_100364022 | 3300007076 | Bacteria | 1241 |
| 192 | Ga0099794_10046095 | 3300007265 | Bacteria | 2087 |
| 193 | Ga0099794_10266657 | 3300007265 | Bacteria | 884 |
| 194 | Ga0099794_10273705 | 3300007265 | Bacteria | 872 |
| 195 | Ga0099794_10291435 | 3300007265 | Bacteria | 845 |
| 196 | Ga0099795_10104149 | 3300007788 | Bacteria | 1117 |
| 197 | Ga0099795_10131555 | 3300007788 | Bacteria | 1010 |
| 198 | Ga0099795_10346653 | 3300007788 | Bacteria | 663 |
| 199 | Ga0105240_10054802 | 3300009093 | Bacteria | 4995 |
| 200 | Ga0111539_10022190 | 3300009094 | Bacteria | 7804 |
| 201 | Ga0111539_10046759 | 3300009094 | Bacteria | 5175 |
| 202 | Ga0111539_10065376 | 3300009094 | Bacteria | 4298 |
| 203 | Ga0111539_10147190 | 3300009094 | Bacteria | 2758 |
| 204 | Ga0111539_12941698 | 3300009094 | Bacteria | 551 |
| 205 | Ga0105245_10000178 | 3300009098 | Bacteria | 60846 |
| 206 | Ga0105245_11615807 | 3300009098 | Bacteria | 700 |
| 207 | Ga0105247_10182982 | 3300009101 | Bacteria | 1399 |
| 208 | Ga0114129_10017720 | 3300009147 | Bacteria | 10142 |
| 209 | Ga0114129_10102952 | 3300009147 | Bacteria | 3948 |
| 210 | Ga0114129_10412330 | 3300009147 | Bacteria | 1778 |
| 211 | Ga0114129_10511631 | 3300009147 | Bacteria | 1566 |
| 212 | Ga0114129_10688549 | 3300009147 | Bacteria | 1315 |
| 213 | Ga0105243_10000270 | 3300009148 | Bacteria | 58296 |
| 214 | Ga0105241_10056256 | 3300009174 | Bacteria | 3016 |
| 215 | Ga0105242_10000409 | 3300009176 | Bacteria | 34163 |
| 216 | Ga0105242_10574225 | 3300009176 | Bacteria | 1085 |
| 217 | Ga0105248_10306890 | 3300009177 | Bacteria | 1787 |
| 218 | Ga0105237_10017737 | 3300009545 | Bacteria | 7380 |
| 219 | Ga0105237_10084602 | 3300009545 | Bacteria | 3162 |
| 220 | Ga0105238_10003279 | 3300009551 | Bacteria | 16156 |
| 221 | Ga0105238_10296437 | 3300009551 | Bacteria | 1600 |
| 222 | Ga0105238_10371092 | 3300009551 | Bacteria | 1421 |
| 223 | Ga0105238_12601910 | 3300009551 | Bacteria | 542 |
| 224 | Ga0105249_10012264 | 3300009553 | Bacteria | 7552 |
| 225 | Ga0105249_10211874 | 3300009553 | Bacteria | 1902 |
| 226 | Ga0105249_10793596 | 3300009553 | Bacteria | 1011 |
| 227 | Ga0105249_12190751 | 3300009553 | Bacteria | 625 |
| 228 | Ga0099796_10177522 | 3300010159 | Bacteria | 853 |
| 229 | Ga0105239_10075790 | 3300010375 | Bacteria | 3699 |
| 230 | Ga0105239_10130266 | 3300010375 | Bacteria | 2797 |
| 231 | Ga0105239_10285791 | 3300010375 | Bacteria | 1857 |
| 232 | Ga0105239_10505723 | 3300010375 | Bacteria | 1374 |
| 233 | Ga0105246_10238273 | 3300011119 | Bacteria | 1437 |
| 234 | Ga0105246_10902847 | 3300011119 | Bacteria | 792 |
| 235 | Ga0105246_12408309 | 3300011119 | Bacteria | 516 |
| 236 | Ga0157371_10343524 | 3300013102 | Bacteria | 1086 |
| 237 | Ga0157370_10203136 | 3300013104 | Bacteria | 1838 |
| 238 | Ga0157369_10056614 | 3300013105 | Bacteria | 4231 |
| 239 | Ga0157369_10452283 | 3300013105 | Bacteria | 1330 |
| 240 | Ga0157374_10405507 | 3300013296 | Bacteria | 1360 |
| 241 | Ga0157378_11110754 | 3300013297 | Bacteria | 828 |
| 242 | Ga0163162_10097503 | 3300013306 | Bacteria | 3028 |
| 243 | Ga0163162_10396291 | 3300013306 | Bacteria | 1513 |
| 244 | Ga0157372_10174365 | 3300013307 | Bacteria | 2489 |
| 245 | Ga0157372_10735448 | 3300013307 | Bacteria | 1147 |
| 246 | Ga0157372_11128184 | 3300013307 | Bacteria | 907 |
| 247 | Ga0157375_10420185 | 3300013308 | Bacteria | 1503 |
| 248 | Ga0157375_10736362 | 3300013308 | Bacteria | 1138 |
| 249 | Ga0163163_10919906 | 3300014325 | Bacteria | 938 |
| 250 | Ga0163163_12685922 | 3300014325 | Bacteria | 555 |
| 251 | Ga0157380_10009920 | 3300014326 | Bacteria | 6836 |
| 252 | Ga0157380_10029204 | 3300014326 | Bacteria | 4214 |
| 253 | Ga0157380_10679445 | 3300014326 | Bacteria | 1031 |
| 254 | Ga0157380_11430636 | 3300014326 | Bacteria | 743 |
| 255 | Ga0157377_10147018 | 3300014745 | Bacteria | 1454 |
| 256 | Ga0157379_10241373 | 3300014968 | Bacteria | 1639 |
| 257 | Ga0157376_10008044 | 3300014969 | Bacteria | 7574 |
| 258 | Ga0157376_10085285 | 3300014969 | Bacteria | 2721 |
| 259 | Ga0213873_10108626 | 3300021358 | Bacteria | 804 |
| 260 | Ga0213876_10012190 | 3300021384 | Bacteria | 4578 |
| 261 | Ga0213875_10183163 | 3300021388 | Unclassified | 984 |
| 262 | Ga0213871_10005256 | 3300021441 | Bacteria | 2655 |
| 263 | Ga0207653_10007295 | 3300025885 | Bacteria | 3448 |
| 264 | Ga0207692_10019156 | 3300025898 | Unclassified | 3087 |
| 265 | Ga0207642_10010162 | 3300025899 | Bacteria | 3303 |
| 266 | Ga0207642_10515909 | 3300025899 | Unclassified | 734 |
| 267 | Ga0207688_10012274 | 3300025901 | Bacteria | 4661 |
| 268 | Ga0207688_10113559 | 3300025901 | Bacteria | 1574 |
| 269 | Ga0207647_10119993 | 3300025904 | Bacteria | 1551 |
| 270 | Ga0207685_10027646 | 3300025905 | Bacteria | 1988 |
| 271 | Ga0207685_10376210 | 3300025905 | Bacteria | 722 |
| 272 | Ga0207699_10007692 | 3300025906 | Bacteria | 5276 |
| 273 | Ga0207699_10201974 | 3300025906 | Bacteria | 1347 |
| 274 | Ga0207699_10210401 | 3300025906 | Bacteria | 1322 |
| 275 | Ga0207643_10017173 | 3300025908 | Bacteria | 3953 |
| 276 | Ga0207643_10062857 | 3300025908 | Bacteria | 2122 |
| 277 | Ga0207705_10206827 | 3300025909 | Bacteria | 1488 |
| 278 | Ga0207684_10339434 | 3300025910 | Bacteria | 1294 |
| 279 | Ga0207684_10828379 | 3300025910 | Bacteria | 781 |
| 280 | Ga0207654_10168639 | 3300025911 | Bacteria | 1420 |
| 281 | Ga0207707_10007441 | 3300025912 | Bacteria | 9540 |
| 282 | Ga0207707_10143832 | 3300025912 | Bacteria | 2084 |
| 283 | Ga0207707_10166471 | 3300025912 | Bacteria | 1926 |
| 284 | Ga0207707_10405611 | 3300025912 | Bacteria | 1170 |
| 285 | Ga0207695_10359879 | 3300025913 | Bacteria | 1342 |
| 286 | Ga0207671_10342447 | 3300025914 | Bacteria | 1185 |
| 287 | Ga0207671_11255388 | 3300025914 | Bacteria | 578 |
| 288 | Ga0207693_10012174 | 3300025915 | Bacteria | 6949 |
| 289 | Ga0207663_10000291 | 3300025916 | Bacteria | 21797 |
| 290 | Ga0207663_10331253 | 3300025916 | Bacteria | 1147 |
| 291 | Ga0207663_10773154 | 3300025916 | Bacteria | 764 |
| 292 | Ga0207660_10002634 | 3300025917 | Bacteria | 11770 |
| 293 | Ga0207660_10084516 | 3300025917 | Bacteria | 2339 |
| 294 | Ga0207662_10000047 | 3300025918 | Bacteria | 52763 |
| 295 | Ga0207662_10292893 | 3300025918 | Bacteria | 1080 |
| 296 | Ga0207657_10101929 | 3300025919 | Bacteria | 2381 |
| 297 | Ga0207649_10570320 | 3300025920 | Bacteria | 868 |
| 298 | Ga0207652_10006338 | 3300025921 | Bacteria | 9558 |
| 299 | Ga0207681_10005133 | 3300025923 | Bacteria | 8042 |
| 300 | Ga0207681_10202933 | 3300025923 | Bacteria | 1523 |
| 301 | Ga0207694_10146832 | 3300025924 | Bacteria | 1898 |
| 302 | Ga0207659_10940782 | 3300025926 | Bacteria | 743 |
| 303 | Ga0207687_10001597 | 3300025927 | Bacteria | 15607 |
| 304 | Ga0207700_10121330 | 3300025928 | Unclassified | 2120 |
| 305 | Ga0207700_10274711 | 3300025928 | Bacteria | 1447 |
| 306 | Ga0207700_11189130 | 3300025928 | Bacteria | 681 |
| 307 | Ga0207664_10021624 | 3300025929 | Bacteria | 4787 |
| 308 | Ga0207664_10125999 | 3300025929 | Bacteria | 2150 |
| 309 | Ga0207690_10278439 | 3300025932 | Bacteria | 1302 |
| 310 | Ga0207690_10382846 | 3300025932 | Bacteria | 1118 |
| 311 | Ga0207686_10000446 | 3300025934 | Bacteria | 27472 |
| 312 | Ga0207709_10000910 | 3300025935 | Bacteria | 22284 |
| 313 | Ga0207709_10043589 | 3300025935 | Bacteria | 2706 |
| 314 | Ga0207670_10000462 | 3300025936 | Bacteria | 22646 |
| 315 | Ga0207670_10296248 | 3300025936 | Bacteria | 1265 |
| 316 | Ga0207669_10069537 | 3300025937 | Bacteria | 2203 |
| 317 | Ga0207669_10523932 | 3300025937 | Bacteria | 952 |
| 318 | Ga0207704_10000290 | 3300025938 | Bacteria | 23770 |
| 319 | Ga0207704_10072596 | 3300025938 | Bacteria | 2188 |
| 320 | Ga0207665_10000624 | 3300025939 | Bacteria | 23683 |
| 321 | Ga0207665_10206725 | 3300025939 | Bacteria | 1432 |
| 322 | Ga0207665_11278130 | 3300025939 | Bacteria | 585 |
| 323 | Ga0207691_10322186 | 3300025940 | Bacteria | 1325 |
| 324 | Ga0207711_10220954 | 3300025941 | Bacteria | 1733 |
| 325 | Ga0207711_10666649 | 3300025941 | Bacteria | 970 |
| 326 | Ga0207689_10000148 | 3300025942 | Bacteria | 60276 |
| 327 | Ga0207689_10393572 | 3300025942 | Bacteria | 1155 |
| 328 | Ga0207661_10013381 | 3300025944 | Bacteria | 5993 |
| 329 | Ga0207667_10004155 | 3300025949 | Bacteria | 17792 |
| 330 | Ga0207667_10046316 | 3300025949 | Bacteria | 4604 |
| 331 | Ga0207667_10170941 | 3300025949 | Bacteria | 2234 |
| 332 | Ga0207651_11285021 | 3300025960 | Unclassified | 658 |
| 333 | Ga0207712_10012530 | 3300025961 | Bacteria | 5418 |
| 334 | Ga0207712_11563492 | 3300025961 | Unclassified | 591 |
| 335 | Ga0207668_10079503 | 3300025972 | Bacteria | 2372 |
| 336 | Ga0207640_10000351 | 3300025981 | Bacteria | 30098 |
| 337 | Ga0207677_10012717 | 3300026023 | Bacteria | 4852 |
| 338 | Ga0207677_10501034 | 3300026023 | Bacteria | 1050 |
| 339 | Ga0207677_10654851 | 3300026023 | Bacteria | 927 |
| 340 | Ga0207703_10001208 | 3300026035 | Bacteria | 24188 |
| 341 | Ga0207703_10159611 | 3300026035 | Bacteria | 1974 |
| 342 | Ga0207703_11779942 | 3300026035 | Bacteria | 592 |
| 343 | Ga0207639_10318474 | 3300026041 | Bacteria | 1380 |
| 344 | Ga0207639_10416797 | 3300026041 | Bacteria | 1213 |
| 345 | Ga0207639_10635066 | 3300026041 | Bacteria | 987 |
| 346 | Ga0207678_10873331 | 3300026067 | Bacteria | 795 |
| 347 | Ga0207708_10000676 | 3300026075 | Bacteria | 26062 |
| 348 | Ga0207708_10025388 | 3300026075 | Bacteria | 4482 |
| 349 | Ga0207702_10010733 | 3300026078 | Bacteria | 7649 |
| 350 | Ga0207702_11067173 | 3300026078 | Unclassified | 801 |
| 351 | Ga0207702_11618875 | 3300026078 | Unclassified | 641 |
| 352 | Ga0207648_10000018 | 3300026089 | Bacteria | 148157 |
| 353 | Ga0207648_10000431 | 3300026089 | Bacteria | 46287 |
| 354 | Ga0207676_10019411 | 3300026095 | Bacteria | 4960 |
| 355 | Ga0207674_11420738 | 3300026116 | Bacteria | 663 |
| 356 | Ga0207675_100000170 | 3300026118 | Bacteria | 58303 |
| 357 | Ga0207675_100003942 | 3300026118 | Bacteria | 14408 |
| 358 | Ga0207675_101099197 | 3300026118 | Bacteria | 815 |
| 359 | Ga0207683_10921922 | 3300026121 | Bacteria | 811 |
| 360 | Ga0207698_10045738 | 3300026142 | Bacteria | 3299 |
| 361 | Ga0209969_1005956 | 3300027360 | Bacteria | 1714 |
| 362 | Ga0209969_1006243 | 3300027360 | Bacteria | 1677 |
| 363 | Ga0209969_1010549 | 3300027360 | Bacteria | 1323 |
| 364 | Ga0209967_1000349 | 3300027364 | Bacteria | 6170 |
| 365 | Ga0209967_1077168 | 3300027364 | Bacteria | 522 |
| 366 | Ga0209981_1000479 | 3300027378 | Bacteria | 5057 |
| 367 | Ga0209981_1008438 | 3300027378 | Bacteria | 1399 |
| 368 | Ga0209996_1003227 | 3300027395 | Bacteria | 2044 |
| 369 | Ga0210000_1000972 | 3300027462 | Bacteria | 4011 |
| 370 | Ga0210000_1017556 | 3300027462 | Bacteria | 1085 |
| 371 | Ga0209995_1021285 | 3300027471 | Bacteria | 1075 |
| 372 | Ga0209995_1083263 | 3300027471 | Bacteria | 549 |
| 373 | Ga0209179_1020739 | 3300027512 | Bacteria | 1277 |
| 374 | Ga0209999_1004910 | 3300027543 | Bacteria | 2405 |
| 375 | Ga0209999_1006553 | 3300027543 | Bacteria | 2092 |
| 376 | Ga0209999_1064526 | 3300027543 | Bacteria | 699 |
| 377 | Ga0209982_1010156 | 3300027552 | Bacteria | 1394 |
| 378 | Ga0209970_1006382 | 3300027614 | Bacteria | 1933 |
| 379 | Ga0210002_1010884 | 3300027617 | Bacteria | 1401 |
| 380 | Ga0209983_1017420 | 3300027665 | Bacteria | 1487 |
| 381 | Ga0209588_1049730 | 3300027671 | Bacteria | 1356 |
| 382 | Ga0209588_1089200 | 3300027671 | Bacteria | 994 |
| 383 | Ga0209966_1003030 | 3300027695 | Bacteria | 2819 |
| 384 | Ga0209998_10015880 | 3300027717 | Bacteria | 1581 |
| 385 | Ga0207428_10000835 | 3300027907 | Bacteria | 34652 |
| 386 | Ga0207428_10079253 | 3300027907 | Bacteria | 2568 |
| 387 | Ga0207428_10132490 | 3300027907 | Bacteria | 1906 |
| 388 | Ga0268266_10227172 | 3300028379 | Bacteria | 1718 |
| 389 | Ga0268265_10001514 | 3300028380 | Bacteria | 19411 |
| 390 | Ga0268265_10002339 | 3300028380 | Bacteria | 14386 |
| 391 | Ga0268265_10435050 | 3300028380 | Bacteria | 1221 |
| 392 | Ga0268264_10001414 | 3300028381 | Bacteria | 22435 |
| 393 | Ga0268264_10232689 | 3300028381 | Bacteria | 1703 |
| 394 | Ga0307515_10918991 | 3300028794 | Bacteria | 508 |
| 395 | Ga0265325_10067621 | 3300031241 | Bacteria | 1800 |
| 396 | Ga0265329_10051333 | 3300031242 | Bacteria | 1313 |
| 397 | Ga0265340_10013061 | 3300031247 | Bacteria | 4372 |
| 398 | Ga0265339_10003282 | 3300031249 | Bacteria | 11326 |
| 399 | Ga0265331_10017380 | 3300031250 | Bacteria | 3752 |
| 400 | Ga0265316_10055876 | 3300031344 | Bacteria | 3086 |
| 401 | Ga0307508_10304251 | 3300031616 | Bacteria | 1187 |
| 402 | Ga0265314_10086421 | 3300031711 | Bacteria | 2053 |
| 403 | Ga0265314_10550889 | 3300031711 | Bacteria | 600 |
| 404 | Ga0265342_10000026 | 3300031712 | Bacteria | 166610 |
| 405 | Ga0265342_10009061 | 3300031712 | Bacteria | 7059 |
| 406 | Ga0307413_11505153 | 3300031824 | Unclassified | 595 |
| 407 | Ga0307410_11180728 | 3300031852 | Bacteria | 666 |
| 408 | Ga0307412_10728011 | 3300031911 | Bacteria | 854 |
| 409 | Ga0307416_100084175 | 3300032002 | Bacteria | 2702 |
| 410 | Ga0307416_101465923 | 3300032002 | Bacteria | 788 |
| 411 | Ga0307416_101882541 | 3300032002 | Bacteria | 702 |
| 412 | Ga0373948_0027495 | 3300034817 | Bacteria | 1127 |
| 413 | Ga0373950_0062014 | 3300034818 | Bacteria | 752 |
| 414 | Ga0373958_0011120 | 3300034819 | Bacteria | 1515 |
| 415 | Ga0373959_0162331 | 3300034820 | Bacteria | 571 |
| 416 | Ga0373938_0052682 | 3300034957 | Bacteria | 933 |
| 417 | Ga0373938_0095235 | 3300034957 | Bacteria | 741 |
| 418 | Ga0373926_0009739 | 3300035083 | Bacteria | 3210 |
| 419 | Ga0373929_0147138 | 3300035085 | Unclassified | 629 |
| 420 | Ga0373934_0000157 | 3300035086 | Bacteria | 24724 |
| 421 | Ga0373934_0002551 | 3300035086 | Bacteria | 6702 |
| 422 | Ga0373940_0019387 | 3300035088 | Bacteria | 1718 |
| 423 | Ga0373944_0011847 | 3300035089 | Bacteria | 2395 |
| 424 | Ga0373944_0096979 | 3300035089 | Bacteria | 992 |
| 425 | Ga0373949_0101589 | 3300035090 | Unclassified | 788 |
| 426 | Ga0373951_0026110 | 3300035091 | Bacteria | 1360 |
| 427 | Ga0373951_0105189 | 3300035091 | Unclassified | 754 |
| 428 | Ga0373952_0074487 | 3300035092 | Bacteria | 855 |
| 429 | Ga0373923_0242420 | 3300035111 | Bacteria | 842 |
| 430 | Ga0373932_0003535 | 3300035112 | Bacteria | 3745 |
| 431 | Ga0373932_0005272 | 3300035112 | Bacteria | 3040 |
| 432 | Ga0373936_0012446 | 3300035113 | Bacteria | 3236 |
| 433 | Ga0373936_0031196 | 3300035113 | Bacteria | 2104 |
| 434 | Ga0373939_0013282 | 3300035114 | Bacteria | 2116 |
| 435 | Ga0373939_0150744 | 3300035114 | Bacteria | 846 |
| 436 | Ga0373939_0368031 | 3300035114 | Bacteria | 589 |
| 437 | Ga0373941_0025111 | 3300035115 | Bacteria | 1718 |
| 438 | Ga0373945_0016153 | 3300035116 | Bacteria | 2514 |
| 439 | Ga0373953_0157129 | 3300035117 | Bacteria | 976 |
| 440 | Ga0373953_0164379 | 3300035117 | Bacteria | 954 |
| 441 | Ga0373954_0000723 | 3300035118 | Bacteria | 12725 |
| 442 | Ga0373954_0007812 | 3300035118 | Bacteria | 4684 |
| 443 | Ga0373954_0019589 | 3300035118 | Bacteria | 3053 |
| 444 | Ga0373956_0000273 | 3300035119 | Bacteria | 20669 |
| 445 | Ga0373956_0021831 | 3300035119 | Bacteria | 2732 |
| 446 | Ga0373956_0386289 | 3300035119 | Bacteria | 668 |
| 447 | Ga0373957_0004451 | 3300035120 | Bacteria | 4264 |
| 448 | Ga0373957_0023316 | 3300035120 | Bacteria | 2212 |
| 449 | Ga0373960_0069525 | 3300035121 | Bacteria | 1086 |
| 450 | Ga0373960_0220844 | 3300035121 | Bacteria | 678 |
| 451 | Ga0373943_0065949 | 3300035170 | Bacteria | 1822 |
| 452 | Ga0373943_0102929 | 3300035170 | Bacteria | 1496 |
| 453 | Ga0373946_0011082 | 3300035171 | Bacteria | 3354 |
| 454 | Ga0373946_0085804 | 3300035171 | Bacteria | 1386 |
| 455 | Ga0373955_0008143 | 3300035172 | Bacteria | 4850 |
| 456 | Ga0373955_0015370 | 3300035172 | Bacteria | 3746 |
| 457 | Ga0373955_0082423 | 3300035172 | Bacteria | 1820 |
| 458 | Ga0373955_0481475 | 3300035172 | Bacteria | 757 |
| 459 | Ga0373942_0002745 | 3300035207 | Bacteria | 4203 |
| 460 | Ga0373942_0028241 | 3300035207 | Bacteria | 1465 |
| 461 | Ga0373942_0280435 | 3300035207 | Bacteria | 574 |
| 462 | Ga0373961_0016133 | 3300035241 | Bacteria | 1921 |
| 463 | Ga0373961_0048712 | 3300035241 | Unclassified | 1249 |
| 464 | Ga0373961_0055087 | 3300035241 | Bacteria | 1190 |
| 465 | Ga0373962_0100110 | 3300035242 | Bacteria | 903 |
| 466 | Ga0373962_0106460 | 3300035242 | Bacteria | 880 |
| 467 | Ga0373924_0041056 | 3300035410 | Bacteria | 1895 |
| 468 | Ga0373931_0003435 | 3300035691 | Bacteria | 7113 |
| 469 | Ga0373931_0037614 | 3300035691 | Bacteria | 2527 |
| 470 | Ga0373931_0177315 | 3300035691 | Bacteria | 1260 |
| 471 | Ga0373931_0487396 | 3300035691 | Bacteria | 793 |
| 472 | Ga0373935_0015295 | 3300035692 | Bacteria | 4635 |
| 473 | Ga0373935_0329750 | 3300035692 | Bacteria | 1084 |
| 474 | Ga0373935_0370001 | 3300035692 | Bacteria | 1025 |
| 475 | Ga0373927_0025425 | 3300035695 | Bacteria | 3871 |
| 476 | Ga0373927_0109836 | 3300035695 | Bacteria | 1796 |
| 477 | Ga0373933_0000480 | 3300035724 | Bacteria | 24930 |
| 478 | Ga0373933_0122493 | 3300035724 | Bacteria | 1629 |
| 479 | Ga0373947_0067283 | 3300035725 | Bacteria | 2188 |
| 480 | Ga0373937_0001784 | 3300036401 | Bacteria | 18069 |
| 481 | Ga0373937_0049292 | 3300036401 | Bacteria | 3856 |
| 482 | Ga0373937_0116819 | 3300036401 | Bacteria | 2484 |
| 483 | Ga0373937_0173406 | 3300036401 | Bacteria | 2024 |
| 484 | Ga0373937_0195082 | 3300036401 | Bacteria | 1903 |
| 485 | Ga0373925_0011560 | 3300037068 | Bacteria | 6385 |
| 486 | Ga0395900_0117051 | 3300037418 | Bacteria | 2735 |
| 487 | Ga0436364_1113710 | 3300037853 | Bacteria | 3647 |
| 488 | Ga0395901_0056419 | 3300038443 | Bacteria | 4086 |
| 489 | Ga0436365_0079817 | 3300039437 | Bacteria | 3681 |
| 490 | Ga0436365_0287902 | 3300039437 | Bacteria | 866 |
| 491 | Ga0436365_1366479 | 3300039437 | Bacteria | 2061 |
| 492 | Ga0436365_1679214 | 3300039437 | Bacteria | 929 |
| 493 | Ga0436360_0280684 | 3300039438 | Bacteria | 4981 |
| 494 | Ga0436360_0478030 | 3300039438 | Bacteria | 3048 |
| 495 | Ga0436360_0811880 | 3300039438 | Bacteria | 599 |
| 496 | Ga0436361_1208236 | 3300039447 | Bacteria | 1820 |
| 497 | Ga0436363_1102627 | 3300039450 | Bacteria | 556 |
| 498 | Ga0436363_1654719 | 3300039450 | Bacteria | 1240 |
| 499 | Ga0436362_0127817 | 3300039453 | Bacteria | 1899 |
| 500 | Ga0436362_0345626 | 3300039453 | Unclassified | 567 |
| 501 | Ga0439453_0003672 | 3300041408 | Bacteria | 2226 |
| 502 | Ga0451789_0234132 | 3300041443 | Bacteria | 620 |
| 503 | Ga0451807_2199014 | 3300041486 | Bacteria | 2201 |
| 504 | Ga0451807_2462780 | 3300041486 | Bacteria | 1645 |
| 505 | Ga0451853_0460087 | 3300041512 | Bacteria | 1103 |
| 506 | Ga0439441_005775 | 3300042001 | Bacteria | 1936 |
| 507 | Ga0439443_001965 | 3300042003 | Bacteria | 2385 |
| 508 | Ga0439451_010051 | 3300042009 | Bacteria | 1909 |
| 509 | Ga0439451_087259 | 3300042009 | Bacteria | 628 |
| 510 | Ga0439446_0175315 | 3300042156 | Bacteria | 715 |
| 511 | Ga0439446_0223913 | 3300042156 | Bacteria | 642 |
| 512 | Ga0439434_0000074 | 3300042435 | Bacteria | 24821 |
| 513 | Ga0439434_0070864 | 3300042435 | Bacteria | 1097 |
| 514 | Ga0439435_0000001 | 3300042436 | Bacteria | 43463 |
| 515 | Ga0439435_0000154 | 3300042436 | Bacteria | 9383 |
| 516 | Ga0439435_0000817 | 3300042436 | Bacteria | 5300 |
| 517 | Ga0439444_0002711 | 3300042437 | Bacteria | 2446 |
| 518 | Ga0439444_0032773 | 3300042437 | Bacteria | 984 |
| 519 | Ga0439464_0038631 | 3300042439 | Bacteria | 1356 |
| 520 | Ga0439460_0000495 | 3300042461 | Bacteria | 8550 |
| 521 | Ga0439460_0151211 | 3300042461 | Bacteria | 774 |
| 522 | Ga0451577_0109406 | 3300042876 | Bacteria | 2471 |
| 523 | Ga0451577_1021107 | 3300042876 | Unclassified | 742 |
| 524 | Ga0439440_0102072 | 3300042993 | Bacteria | 781 |
| 525 | Ga0453683_0577435 | 3300044673 | Unclassified | 732 |
| 526 | Ga0466963_0373859 | 3300044694 | Unclassified | 1004 |
| 527 | Ga0466963_0720945 | 3300044694 | Bacteria | 704 |
| 528 | Ga0466964_0317783 | 3300044706 | Unclassified | 790 |
| 529 | Ga0466957_0801542 | 3300044842 | Bacteria | 669 |
| 530 | Ga0451576_0003549 | 3300045051 | Bacteria | 21244 |
| 531 | Ga0451576_0068493 | 3300045051 | Bacteria | 3693 |
| 532 | Ga0451576_0224289 | 3300045051 | Bacteria | 1962 |
| 533 | Ga0451576_0226654 | 3300045051 | Bacteria | 1951 |
| 534 | Ga0466967_0192036 | 3300045976 | Unclassified | 1930 |
| 535 | Ga0466967_0518298 | 3300045976 | Bacteria | 1171 |
| 536 | Ga0495592_0003654 | 3300046454 | Bacteria | 11080 |
| 537 | Ga0495592_0046909 | 3300046454 | Bacteria | 3219 |
| 538 | Ga0495603_0076782 | 3300046455 | Bacteria | 1960 |
| 539 | Ga0495603_0243415 | 3300046455 | Bacteria | 1036 |
| 540 | Ga0495629_0144629 | 3300046459 | Bacteria | 1654 |
| 541 | Ga0495638_0464316 | 3300046460 | Bacteria | 644 |
| 542 | Ga0495641_0005394 | 3300046461 | Bacteria | 8652 |
| 543 | Ga0495651_0001404 | 3300046462 | Bacteria | 18677 |
| 544 | Ga0495651_0010052 | 3300046462 | Bacteria | 7271 |
| 545 | Ga0495580_0001708 | 3300046472 | Bacteria | 19287 |
| 546 | Ga0495580_0032036 | 3300046472 | Bacteria | 3795 |
| 547 | Ga0495582_0096153 | 3300046473 | Bacteria | 1655 |
| 548 | Ga0495582_0100238 | 3300046473 | Bacteria | 1621 |
| 549 | Ga0495639_0005581 | 3300046475 | Bacteria | 5418 |
| 550 | Ga0495639_0009811 | 3300046475 | Bacteria | 4110 |
| 551 | Ga0495662_0023307 | 3300046476 | Bacteria | 2988 |
| 552 | Ga0495664_0035621 | 3300046477 | Bacteria | 2931 |
| 553 | Ga0495664_0339728 | 3300046477 | Bacteria | 905 |
| 554 | Ga0495594_0052450 | 3300046499 | Bacteria | 2245 |
| 555 | Ga0495628_0003204 | 3300046516 | Bacteria | 14671 |
| 556 | Ga0495628_0026741 | 3300046516 | Bacteria | 4699 |
| 557 | Ga0495628_0031003 | 3300046516 | Bacteria | 4325 |
| 558 | Ga0495628_0335799 | 3300046516 | Bacteria | 1113 |
| 559 | Ga0495630_0009427 | 3300046517 | Bacteria | 7018 |
| 560 | Ga0495630_0180845 | 3300046517 | Bacteria | 1608 |
| 561 | Ga0495630_0331289 | 3300046517 | Bacteria | 1164 |
| 562 | Ga0495630_0395570 | 3300046517 | Bacteria | 1059 |
| 563 | Ga0495666_0023406 | 3300046526 | Bacteria | 3054 |
| 564 | Ga0495666_0056142 | 3300046526 | Bacteria | 1886 |
| 565 | Ga0495642_0034646 | 3300046528 | Bacteria | 2034 |
| 566 | Ga0495642_0076995 | 3300046528 | Bacteria | 1401 |
| 567 | Ga0495652_0031108 | 3300046529 | Bacteria | 4676 |
| 568 | Ga0495665_0015081 | 3300046531 | Bacteria | 4165 |
| 569 | Ga0495640_0055508 | 3300046533 | Bacteria | 2709 |
| 570 | Ga0495586_0012380 | 3300046535 | Bacteria | 4524 |
| 571 | Ga0495586_0123421 | 3300046535 | Bacteria | 1447 |
| 572 | Ga0495587_0028384 | 3300046536 | Bacteria | 3402 |
| 573 | Ga0495587_0104533 | 3300046536 | Bacteria | 1630 |
| 574 | Ga0495621_0029405 | 3300046539 | Bacteria | 1873 |
| 575 | Ga0495645_0170458 | 3300046543 | Bacteria | 1498 |
| 576 | Ga0495622_0019107 | 3300046557 | Bacteria | 3191 |
| 577 | Ga0495667_0006877 | 3300046559 | Bacteria | 7726 |
| 578 | Ga0495667_0038003 | 3300046559 | Bacteria | 3206 |
| 579 | Ga0495656_0251639 | 3300046615 | Bacteria | 893 |
| 580 | Ga0495634_0106415 | 3300046642 | Bacteria | 1807 |
| 581 | Ga0495634_0339215 | 3300046642 | Bacteria | 902 |
| 582 | Ga0495635_0023515 | 3300046663 | Bacteria | 4293 |
| 583 | Ga0495588_0116767 | 3300046674 | Bacteria | 1406 |
| 584 | Ga0495588_0184870 | 3300046674 | Bacteria | 1101 |
| 585 | Ga0495588_0305277 | 3300046674 | Bacteria | 838 |
| 586 | Ga0495657_0006684 | 3300046675 | Bacteria | 9003 |
| 587 | Ga0495657_0193579 | 3300046675 | Bacteria | 1242 |
| 588 | Ga0495599_0013413 | 3300046678 | Bacteria | 5063 |
| 589 | Ga0495599_0040993 | 3300046678 | Bacteria | 2907 |
| 590 | Ga0495646_0580384 | 3300046680 | Bacteria | 571 |
| 591 | Ga0495647_0012311 | 3300046681 | Bacteria | 2944 |
| 592 | Ga0495647_0014994 | 3300046681 | Bacteria | 2708 |
| 593 | Ga0495658_0018001 | 3300046683 | Bacteria | 3663 |
| 594 | Ga0495669_0010717 | 3300046684 | Bacteria | 3879 |
| 595 | Ga0495613_0103416 | 3300046689 | Bacteria | 2056 |
| 596 | Ga0495624_0131103 | 3300046690 | Bacteria | 1537 |
| 597 | Ga0495600_0124088 | 3300046809 | Bacteria | 1679 |
| 598 | Ga0495581_0120665 | 3300047315 | Bacteria | 1526 |
| 599 | Ga0495581_0131825 | 3300047315 | Bacteria | 1456 |
| 600 | Ga0495581_0296625 | 3300047315 | Bacteria | 945 |
| 601 | Ga0495604_0036544 | 3300047317 | Bacteria | 3872 |
| 602 | Ga0495674_0008256 | 3300047319 | Bacteria | 9933 |
| 603 | Ga0495674_0388126 | 3300047319 | Bacteria | 1129 |
| 604 | Ga0495674_0973660 | 3300047319 | Bacteria | 651 |
| 605 | Ga0495672_0100841 | 3300047320 | Bacteria | 1566 |
| 606 | Ga0495676_0045436 | 3300047321 | Bacteria | 3575 |
| 607 | Ga0495680_0548164 | 3300047322 | Bacteria | 779 |
| 608 | Ga0495675_0032218 | 3300047444 | Bacteria | 3344 |
| 609 | Ga0495684_0014546 | 3300047471 | Bacteria | 6056 |
| 610 | Ga0495684_0197833 | 3300047471 | Bacteria | 1483 |
| 611 | Ga0495684_0573479 | 3300047471 | Bacteria | 765 |
| 612 | Ga0495593_0444025 | 3300047673 | Bacteria | 649 |
| 613 | Ga0495602_0274070 | 3300048088 | Bacteria | 1246 |
| 614 | Ga0496101_0176014 | 3300048904 | Bacteria | 1646 |
| 615 | Ga0496101_0556566 | 3300048904 | Bacteria | 907 |
| 616 | Ga0496102_0094190 | 3300048905 | Bacteria | 2775 |
| 617 | Ga0496103_0343859 | 3300048906 | Bacteria | 959 |
| 618 | Ga0496104_0074260 | 3300048907 | Bacteria | 3237 |
| 619 | Ga0496104_0593112 | 3300048907 | Bacteria | 1018 |
| 620 | Ga0496105_0021478 | 3300048908 | Bacteria | 5223 |
| 621 | Ga0496106_0953898 | 3300048909 | Bacteria | 676 |
| 622 | Ga0496107_0424915 | 3300048910 | Bacteria | 988 |
| 623 | Ga0496108_0597465 | 3300048911 | Bacteria | 962 |
| 624 | Ga0496109_1259233 | 3300048912 | Bacteria | 676 |
| 625 | Ga0496109_1529927 | 3300048912 | Bacteria | 602 |
| 626 | Ga0496110_0609274 | 3300048913 | Bacteria | 990 |
| 627 | Ga0496110_0865028 | 3300048913 | Bacteria | 809 |
| 628 | Ga0496111_0256008 | 3300048914 | Bacteria | 1299 |
| 629 | Ga0496111_1234901 | 3300048914 | Unclassified | 528 |
| 630 | Ga0496112_0000059 | 3300048915 | Bacteria | 74946 |
| 631 | Ga0496112_0177400 | 3300048915 | Bacteria | 2095 |
| 632 | Ga0496112_0249552 | 3300048915 | Bacteria | 1726 |
| 633 | Ga0496113_0319654 | 3300048916 | Bacteria | 1244 |
| 634 | Ga0496113_0726455 | 3300048916 | Bacteria | 792 |
| 635 | Ga0496115_0050450 | 3300048918 | Bacteria | 3334 |
| 636 | Ga0496126_0033139 | 3300048929 | Bacteria | 4861 |
| 637 | Ga0496126_0092888 | 3300048929 | Bacteria | 2650 |
| 638 | Ga0496126_0147836 | 3300048929 | Bacteria | 2016 |
| 639 | Ga0496126_0366482 | 3300048929 | Bacteria | 1176 |
| 640 | Ga0496126_0788516 | 3300048929 | Bacteria | 730 |
| 641 | Ga0501031_0362604 | 3300049568 | Bacteria | 938 |
| 642 | Ga0501031_1106214 | 3300049568 | Unclassified | 506 |
| 643 | Ga0501033_0048828 | 3300049570 | Bacteria | 3143 |
| 644 | Ga0501033_0594598 | 3300049570 | Bacteria | 759 |
| 645 | Ga0501036_0141468 | 3300049572 | Bacteria | 2030 |
| 646 | Ga0501036_0173317 | 3300049572 | Bacteria | 1817 |
| 647 | Ga0501036_0298728 | 3300049572 | Bacteria | 1347 |
| 648 | Ga0501036_0315602 | 3300049572 | Bacteria | 1306 |
| 649 | Ga0501037_0134788 | 3300049573 | Bacteria | 1769 |
| 650 | Ga0501037_0581795 | 3300049573 | Bacteria | 753 |
| 651 | Ga0501038_0065554 | 3300049574 | Bacteria | 3094 |
| 652 | Ga0501038_0103525 | 3300049574 | Bacteria | 2367 |
| 653 | Ga0501038_0364342 | 3300049574 | Bacteria | 1124 |
| 654 | Ga0501039_0026150 | 3300049575 | Bacteria | 4485 |
| 655 | Ga0501039_0498230 | 3300049575 | Bacteria | 956 |
| 656 | Ga0501040_0007762 | 3300049576 | Bacteria | 6945 |
| 657 | Ga0501040_0009124 | 3300049576 | Bacteria | 6458 |
| 658 | Ga0501040_0172474 | 3300049576 | Bacteria | 1532 |
| 659 | Ga0501041_0014220 | 3300049577 | Bacteria | 4725 |
| 660 | Ga0501041_0073113 | 3300049577 | Bacteria | 2107 |
| 661 | Ga0501041_0170348 | 3300049577 | Bacteria | 1362 |
| 662 | Ga0501042_0068706 | 3300049578 | Bacteria | 2534 |
| 663 | Ga0501042_0183408 | 3300049578 | Bacteria | 1510 |
| 664 | Ga0501042_0463972 | 3300049578 | Bacteria | 919 |
| 665 | Ga0501043_0341980 | 3300049579 | Bacteria | 1138 |
| 666 | Ga0501043_0990806 | 3300049579 | Bacteria | 599 |
| 667 | Ga0501043_1334976 | 3300049579 | Bacteria | 500 |
| 668 | Ga0501046_0207872 | 3300049580 | Bacteria | 1454 |
| 669 | Ga0501046_0344766 | 3300049580 | Bacteria | 1082 |
| 670 | Ga0501047_0932578 | 3300049581 | Unclassified | 681 |
| 671 | Ga0501048_0082066 | 3300049582 | Bacteria | 2274 |
| 672 | Ga0501048_0275771 | 3300049582 | Bacteria | 1195 |
| 673 | Ga0501068_0103538 | 3300049584 | Bacteria | 1766 |
| 674 | Ga0501071_0413707 | 3300049587 | Bacteria | 1030 |
| 675 | Ga0501071_0854603 | 3300049587 | Bacteria | 702 |
| 676 | Ga0501072_0000757 | 3300049588 | Bacteria | 23565 |
| 677 | Ga0501072_0256408 | 3300049588 | Bacteria | 1393 |
| 678 | Ga0501072_0433320 | 3300049588 | Bacteria | 1042 |
| 679 | Ga0501074_0702335 | 3300049590 | Bacteria | 714 |
| 680 | Ga0501075_0003128 | 3300049591 | Bacteria | 11065 |
| 681 | Ga0501075_0264106 | 3300049591 | Bacteria | 1312 |
| 682 | Ga0501076_0000285 | 3300049592 | Bacteria | 31507 |
| 683 | Ga0501076_0615668 | 3300049592 | Bacteria | 896 |
| 684 | Ga0501077_0229060 | 3300049593 | Bacteria | 1181 |
| 685 | Ga0501077_0236169 | 3300049593 | Bacteria | 1162 |
| 686 | Ga0501230_098378 | 3300049667 | Bacteria | 629 |
| 687 | Ga0501079_0003127 | 3300049741 | Bacteria | 12127 |
| 688 | Ga0501079_0171879 | 3300049741 | Bacteria | 1690 |
| 689 | Ga0501079_0297082 | 3300049741 | Bacteria | 1263 |
| 690 | Ga0501079_0866955 | 3300049741 | Bacteria | 711 |
| 691 | Ga0501080_0015457 | 3300049742 | Bacteria | 7037 |
| 692 | Ga0501080_0393830 | 3300049742 | Bacteria | 1247 |
| 693 | Ga0501081_0000759 | 3300049743 | Bacteria | 18898 |
| 694 | Ga0501081_0006364 | 3300049743 | Bacteria | 7660 |
| 695 | Ga0501083_0055180 | 3300049744 | Bacteria | 2665 |
| 696 | Ga0501035_0368522 | 3300049822 | Bacteria | 1199 |
| 697 | Ga0501045_0051787 | 3300049824 | Bacteria | 2996 |
| 698 | Ga0501045_0835738 | 3300049824 | Bacteria | 678 |
| 699 | nmdc:mga0yw44_693589_c1 | 3300050492 | Bacteria | 692 |
| 700 | nmdc:mga05p37_1864800_c1 | 3300050507 | Unclassified | 576 |
| 701 | nmdc:mga05p37_2045_c1 | 3300050507 | Bacteria | 23532 |
| 702 | nmdc:mga05p37_378695_c1 | 3300050507 | Bacteria | 1659 |
| 703 | nmdc:mga05p37_379757_c1 | 3300050507 | Bacteria | 1656 |
| 704 | nmdc:mga09592_1655_c1 | 3300050508 | Bacteria | 17927 |
| 705 | nmdc:mga09592_200507_c1 | 3300050508 | Bacteria | 1728 |
| 706 | nmdc:mga09592_284247_c1 | 3300050508 | Bacteria | 1435 |
| 707 | nmdc:mga0qj67_137773_c1 | 3300050509 | Bacteria | 1978 |
| 708 | nmdc:mga0qj67_14040_c1 | 3300050509 | Bacteria | 6049 |
| 709 | nmdc:mga0qj67_202389_c1 | 3300050509 | Bacteria | 1613 |
| 710 | nmdc:mga0qj67_452188_c1 | 3300050509 | Bacteria | 1035 |
| 711 | nmdc:mga0qj67_526303_c1 | 3300050509 | Bacteria | 949 |
| 712 | nmdc:mga06r32_157084_c1 | 3300050510 | Bacteria | 2256 |
| 713 | nmdc:mga06r32_1622773_c1 | 3300050510 | Unclassified | 585 |
| 714 | nmdc:mga08y16_133287_c1 | 3300050511 | Bacteria | 2583 |
| 715 | nmdc:mga08y16_4849_c1 | 3300050511 | Bacteria | 14041 |
| 716 | nmdc:mga08y16_70976_c1 | 3300050511 | Bacteria | 3630 |
| 717 | nmdc:mga08y16_77092_c1 | 3300050511 | Bacteria | 3475 |
| 718 | nmdc:mga0n895_39500_c1 | 3300050512 | Bacteria | 4579 |
| 719 | nmdc:mga0rr50_1178798_c1 | 3300050513 | Bacteria | 651 |
| 720 | nmdc:mga0rr50_126820_c1 | 3300050513 | Bacteria | 2039 |
| 721 | nmdc:mga0rr50_1406880_c1 | 3300050513 | Bacteria | 590 |
| 722 | nmdc:mga0rr50_545908_c1 | 3300050513 | Bacteria | 987 |
| 723 | nmdc:mga0rr50_8370_c1 | 3300050513 | Bacteria | 6437 |
| 724 | nmdc:mga08x19_122448_c1 | 3300050514 | Bacteria | 1745 |
| 725 | nmdc:mga08x19_284852_c1 | 3300050514 | Bacteria | 1145 |
| 726 | nmdc:mga08x19_3563_c1 | 3300050514 | Bacteria | 9267 |
| 727 | nmdc:mga08x19_3851_c1 | 3300050514 | Bacteria | 8929 |
| 728 | nmdc:mga0a205_3207_c1 | 3300050515 | Bacteria | 14532 |
| 729 | nmdc:mga0a205_627150_c1 | 3300050515 | Bacteria | 927 |
| 730 | Ga0495601_0002510 | 3300053077 | Bacteria | 10448 |
| 731 | Ga0495612_0042322 | 3300053078 | Bacteria | 1859 |
| 732 | Ga0495619_0005618 | 3300053085 | Bacteria | 7956 |
| 733 | Ga0495619_0277934 | 3300053085 | Bacteria | 1160 |
| 734 | Ga0501084_0096780 | 3300054114 | Bacteria | 2478 |
| 735 | Ga0501084_0171301 | 3300054114 | Bacteria | 1832 |
| 736 | Ga0501084_1177843 | 3300054114 | Bacteria | 643 |
| 737 | Ga0590077_029822 | 3300059426 | Bacteria | 1188 |
| 738 | Ga0501082_0005281 | 3300060353 | Bacteria | 11227 |
| 739 | Ga0501082_0827153 | 3300060353 | Bacteria | 810 |
| 740 | Ga0530510_0000091 | 3300061734 | Bacteria | 48589 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300042156 | Ga0439446_0223913 | Ga0439446_0223913_287_607 | 106 |
| 2 | 3300049568 | Ga0501031_1106214 | Ga0501031_1106214_110_487 | 117 |
| 3 | 3300035118 | Ga0373954_0000723 | Ga0373954_0000723_9448_9843 | 122 |
| 4 | 3300035172 | Ga0373955_0481475 | Ga0373955_0481475_214_609 | 122 |
| 5 | 3300035692 | Ga0373935_0370001 | Ga0373935_0370001_415_810 | 122 |
| 6 | 3300036401 | Ga0373937_0195082 | Ga0373937_0195082_154_549 | 122 |
| 7 | 3300046517 | Ga0495630_0331289 | Ga0495630_0331289_552_947 | 122 |
| 8 | 3300046559 | Ga0495667_0006877 | Ga0495667_0006877_1570_1965 | 122 |
| 9 | 3300047322 | Ga0495680_0548164 | Ga0495680_0548164_69_464 | 122 |
| 10 | 3300047471 | Ga0495684_0197833 | Ga0495684_0197833_468_863 | 122 |
| 11 | 3300050514 | nmdc:mga08x19_284852_c1 | nmdc:mga08x19_284852_c1_666_1061 | 122 |
| 12 | 3300049570 | Ga0501033_0594598 | Ga0501033_0594598_267_641 | 124 |
| 13 | 3300049572 | Ga0501036_0141468 | Ga0501036_0141468_318_692 | 124 |
| 14 | 3300049572 | Ga0501036_0315602 | Ga0501036_0315602_165_539 | 124 |
| 15 | 3300049573 | Ga0501037_0581795 | Ga0501037_0581795_233_607 | 124 |
| 16 | 3300049574 | Ga0501038_0103525 | Ga0501038_0103525_1069_1443 | 124 |
| 17 | 3300049574 | Ga0501038_0364342 | Ga0501038_0364342_168_542 | 124 |
| 18 | 3300049575 | Ga0501039_0026150 | Ga0501039_0026150_2142_2516 | 124 |
| 19 | 3300049576 | Ga0501040_0007762 | Ga0501040_0007762_5821_6195 | 124 |
| 20 | 3300049577 | Ga0501041_0073113 | Ga0501041_0073113_846_1220 | 124 |
| 21 | 3300049578 | Ga0501042_0068706 | Ga0501042_0068706_615_989 | 124 |
| 22 | 3300049579 | Ga0501043_0990806 | Ga0501043_0990806_120_494 | 124 |
| 23 | 3300049579 | Ga0501043_1334976 | Ga0501043_1334976_75_452 | 124 |
| 24 | 3300049580 | Ga0501046_0207872 | Ga0501046_0207872_289_663 | 124 |
| 25 | 3300049582 | Ga0501048_0275771 | Ga0501048_0275771_633_1007 | 124 |
| 26 | 3300049584 | Ga0501068_0103538 | Ga0501068_0103538_647_1021 | 124 |
| 27 | 3300049587 | Ga0501071_0413707 | Ga0501071_0413707_500_874 | 124 |
| 28 | 3300049588 | Ga0501072_0000757 | Ga0501072_0000757_19958_20332 | 124 |
| 29 | 3300049588 | Ga0501072_0256408 | Ga0501072_0256408_765_1139 | 124 |
| 30 | 3300049591 | Ga0501075_0003128 | Ga0501075_0003128_5160_5534 | 124 |
| 31 | 3300049591 | Ga0501075_0264106 | Ga0501075_0264106_804_1178 | 124 |
| 32 | 3300049592 | Ga0501076_0000285 | Ga0501076_0000285_7920_8294 | 124 |
| 33 | 3300049593 | Ga0501077_0236169 | Ga0501077_0236169_218_592 | 124 |
| 34 | 3300049741 | Ga0501079_0003127 | Ga0501079_0003127_4578_4952 | 124 |
| 35 | 3300049741 | Ga0501079_0171879 | Ga0501079_0171879_333_707 | 124 |
| 36 | 3300049742 | Ga0501080_0015457 | Ga0501080_0015457_966_1340 | 124 |
| 37 | 3300049743 | Ga0501081_0000759 | Ga0501081_0000759_16745_17119 | 124 |
| 38 | 3300049743 | Ga0501081_0006364 | Ga0501081_0006364_4815_5189 | 124 |
| 39 | 3300049824 | Ga0501045_0051787 | Ga0501045_0051787_54_428 | 124 |
| 40 | 3300054114 | Ga0501084_0096780 | Ga0501084_0096780_590_964 | 124 |
| 41 | 3300060353 | Ga0501082_0005281 | Ga0501082_0005281_7407_7781 | 124 |
| 42 | 3300061734 | Ga0530510_0000091 | Ga0530510_0000091_31251_31625 | 124 |
| 43 | iso_pu_bacteria | 2958122699 | 2958128573 | 124 |
| 44 | iso_pu_bacteria | 2977872689 | 2977873058 | 124 |
| 45 | 3300046528 | Ga0495642_0076995 | Ga0495642_0076995_424_801 | 125 |
| 46 | 3300046539 | Ga0495621_0029405 | Ga0495621_0029405_255_632 | 125 |
| 47 | 3300021441 | Ga0213871_10005256 | Ga0213871_100052563 | 126 |
| 48 | 3300039438 | Ga0436360_0280684 | Ga0436360_0280684_3592_3972 | 126 |
| 49 | 3300039447 | Ga0436361_1208236 | Ga0436361_1208236_1369_1749 | 126 |
| 50 | 3300049572 | Ga0501036_0298728 | Ga0501036_0298728_790_1170 | 126 |
| 51 | 3300049573 | Ga0501037_0134788 | Ga0501037_0134788_1038_1418 | 126 |
| 52 | 3300049577 | Ga0501041_0170348 | Ga0501041_0170348_916_1296 | 126 |
| 53 | 3300049578 | Ga0501042_0183408 | Ga0501042_0183408_364_744 | 126 |
| 54 | 3300049579 | Ga0501043_0341980 | Ga0501043_0341980_104_484 | 126 |
| 55 | 3300049580 | Ga0501046_0344766 | Ga0501046_0344766_182_562 | 126 |
| 56 | 3300049741 | Ga0501079_0297082 | Ga0501079_0297082_642_1022 | 126 |
| 57 | 3300049744 | Ga0501083_0055180 | Ga0501083_0055180_1094_1474 | 126 |
| 58 | 3300002244 | JGI24742J22300_10024783 | JGI24742J22300_100247832 | 127 |
| 59 | 3300003911 | JGI25405J52794_10100041 | JGI25405J52794_101000411 | 127 |
| 60 | 3300005289 | Ga0065704_10325148 | Ga0065704_103251481 | 127 |
| 61 | 3300005295 | Ga0065707_10005701 | Ga0065707_100057013 | 127 |
| 62 | 3300005295 | Ga0065707_10106587 | Ga0065707_101065873 | 127 |
| 63 | 3300005295 | Ga0065707_10731008 | Ga0065707_107310081 | 127 |
| 64 | 3300005327 | Ga0070658_10364204 | Ga0070658_103642041 | 127 |
| 65 | 3300005329 | Ga0070683_100311306 | Ga0070683_1003113063 | 127 |
| 66 | 3300005329 | Ga0070683_100336504 | Ga0070683_1003365043 | 127 |
| 67 | 3300005330 | Ga0070690_100000172 | Ga0070690_10000017220 | 127 |
| 68 | 3300005330 | Ga0070690_100029637 | Ga0070690_1000296372 | 127 |
| 69 | 3300005330 | Ga0070690_100133703 | Ga0070690_1001337033 | 127 |
| 70 | 3300005330 | Ga0070690_100578248 | Ga0070690_1005782482 | 127 |
| 71 | 3300005334 | Ga0068869_100004583 | Ga0068869_10000458310 | 127 |
| 72 | 3300005335 | Ga0070666_10247213 | Ga0070666_102472133 | 127 |
| 73 | 3300005336 | Ga0070680_100000230 | Ga0070680_1000002303 | 127 |
| 74 | 3300005336 | Ga0070680_100017864 | Ga0070680_1000178644 | 127 |
| 75 | 3300005336 | Ga0070680_100234358 | Ga0070680_1002343582 | 127 |
| 76 | 3300005337 | Ga0070682_100023353 | Ga0070682_1000233533 | 127 |
| 77 | 3300005338 | Ga0068868_100001075 | Ga0068868_1000010759 | 127 |
| 78 | 3300005338 | Ga0068868_100569867 | Ga0068868_1005698672 | 127 |
| 79 | 3300005338 | Ga0068868_101669420 | Ga0068868_1016694202 | 127 |
| 80 | 3300005339 | Ga0070660_100437560 | Ga0070660_1004375602 | 127 |
| 81 | 3300005340 | Ga0070689_100001034 | Ga0070689_10000103410 | 127 |
| 82 | 3300005340 | Ga0070689_100158951 | Ga0070689_1001589512 | 127 |
| 83 | 3300005341 | Ga0070691_10000935 | Ga0070691_100009357 | 127 |
| 84 | 3300005341 | Ga0070691_10186338 | Ga0070691_101863381 | 127 |
| 85 | 3300005341 | Ga0070691_10570298 | Ga0070691_105702981 | 127 |
| 86 | 3300005343 | Ga0070687_100000141 | Ga0070687_1000001413 | 127 |
| 87 | 3300005344 | Ga0070661_100735077 | Ga0070661_1007350771 | 127 |
| 88 | 3300005345 | Ga0070692_10002703 | Ga0070692_100027032 | 127 |
| 89 | 3300005345 | Ga0070692_10022726 | Ga0070692_100227262 | 127 |
| 90 | 3300005347 | Ga0070668_100135997 | Ga0070668_1001359974 | 127 |
| 91 | 3300005353 | Ga0070669_100004039 | Ga0070669_1000040395 | 127 |
| 92 | 3300005353 | Ga0070669_100229804 | Ga0070669_1002298043 | 127 |
| 93 | 3300005354 | Ga0070675_100942597 | Ga0070675_1009425972 | 127 |
| 94 | 3300005355 | Ga0070671_101289879 | Ga0070671_1012898792 | 127 |
| 95 | 3300005356 | Ga0070674_100086449 | Ga0070674_1000864492 | 127 |
| 96 | 3300005356 | Ga0070674_101046603 | Ga0070674_1010466031 | 127 |
| 97 | 3300005356 | Ga0070674_101855267 | Ga0070674_1018552671 | 127 |
| 98 | 3300005364 | Ga0070673_100027946 | Ga0070673_1000279464 | 127 |
| 99 | 3300005364 | Ga0070673_100941539 | Ga0070673_1009415392 | 127 |
| 100 | 3300005364 | Ga0070673_101527146 | Ga0070673_1015271461 | 127 |
| 101 | 3300005365 | Ga0070688_101218612 | Ga0070688_1012186122 | 127 |
| 102 | 3300005366 | Ga0070659_100564095 | Ga0070659_1005640952 | 127 |
| 103 | 3300005367 | Ga0070667_101389817 | Ga0070667_1013898172 | 127 |
| 104 | 3300005406 | Ga0070703_10014775 | Ga0070703_100147752 | 127 |
| 105 | 3300005434 | Ga0070709_10097186 | Ga0070709_100971863 | 127 |
| 106 | 3300005434 | Ga0070709_10118326 | Ga0070709_101183262 | 127 |
| 107 | 3300005434 | Ga0070709_10142882 | Ga0070709_101428822 | 127 |
| 108 | 3300005435 | Ga0070714_100003691 | Ga0070714_1000036917 | 127 |
| 109 | 3300005435 | Ga0070714_100042501 | Ga0070714_1000425014 | 127 |
| 110 | 3300005436 | Ga0070713_100039796 | Ga0070713_1000397963 | 127 |
| 111 | 3300005436 | Ga0070713_101287690 | Ga0070713_1012876902 | 127 |
| 112 | 3300005436 | Ga0070713_101767560 | Ga0070713_1017675601 | 127 |
| 113 | 3300005437 | Ga0070710_10022316 | Ga0070710_100223163 | 127 |
| 114 | 3300005438 | Ga0070701_10000216 | Ga0070701_100002164 | 127 |
| 115 | 3300005439 | Ga0070711_100235468 | Ga0070711_1002354682 | 127 |
| 116 | 3300005440 | Ga0070705_100001001 | Ga0070705_1000010019 | 127 |
| 117 | 3300005440 | Ga0070705_100013041 | Ga0070705_1000130416 | 127 |
| 118 | 3300005441 | Ga0070700_100000591 | Ga0070700_1000005919 | 127 |
| 119 | 3300005441 | Ga0070700_100304030 | Ga0070700_1003040302 | 127 |
| 120 | 3300005444 | Ga0070694_100001923 | Ga0070694_1000019239 | 127 |
| 121 | 3300005444 | Ga0070694_100003005 | Ga0070694_1000030053 | 127 |
| 122 | 3300005444 | Ga0070694_100114267 | Ga0070694_1001142671 | 127 |
| 123 | 3300005444 | Ga0070694_100115942 | Ga0070694_1001159422 | 127 |
| 124 | 3300005445 | Ga0070708_100313445 | Ga0070708_1003134451 | 127 |
| 125 | 3300005445 | Ga0070708_101075038 | Ga0070708_1010750382 | 127 |
| 126 | 3300005455 | Ga0070663_100322859 | Ga0070663_1003228591 | 127 |
| 127 | 3300005456 | Ga0070678_101903225 | Ga0070678_1019032251 | 127 |
| 128 | 3300005457 | Ga0070662_101373442 | Ga0070662_1013734421 | 127 |
| 129 | 3300005458 | Ga0070681_10042871 | Ga0070681_100428714 | 127 |
| 130 | 3300005458 | Ga0070681_10110098 | Ga0070681_101100981 | 127 |
| 131 | 3300005458 | Ga0070681_10224793 | Ga0070681_102247933 | 127 |
| 132 | 3300005458 | Ga0070681_10485955 | Ga0070681_104859553 | 127 |
| 133 | 3300005459 | Ga0068867_100000275 | Ga0068867_10000027527 | 127 |
| 134 | 3300005459 | Ga0068867_100000487 | Ga0068867_10000048715 | 127 |
| 135 | 3300005467 | Ga0070706_100804209 | Ga0070706_1008042092 | 127 |
| 136 | 3300005467 | Ga0070706_101687902 | Ga0070706_1016879021 | 127 |
| 137 | 3300005471 | Ga0070698_100336715 | Ga0070698_1003367151 | 127 |
| 138 | 3300005518 | Ga0070699_100034399 | Ga0070699_1000343992 | 127 |
| 139 | 3300005530 | Ga0070679_100600987 | Ga0070679_1006009872 | 127 |
| 140 | 3300005530 | Ga0070679_100781892 | Ga0070679_1007818922 | 127 |
| 141 | 3300005530 | Ga0070679_100839957 | Ga0070679_1008399572 | 127 |
| 142 | 3300005530 | Ga0070679_101889527 | Ga0070679_1018895271 | 127 |
| 143 | 3300005535 | Ga0070684_100016626 | Ga0070684_1000166266 | 127 |
| 144 | 3300005535 | Ga0070684_100025358 | Ga0070684_1000253582 | 127 |
| 145 | 3300005535 | Ga0070684_101167151 | Ga0070684_1011671511 | 127 |
| 146 | 3300005535 | Ga0070684_101222058 | Ga0070684_1012220582 | 127 |
| 147 | 3300005539 | Ga0068853_100136985 | Ga0068853_1001369853 | 127 |
| 148 | 3300005539 | Ga0068853_100363900 | Ga0068853_1003639002 | 127 |
| 149 | 3300005539 | Ga0068853_100615794 | Ga0068853_1006157942 | 127 |
| 150 | 3300005539 | Ga0068853_100671872 | Ga0068853_1006718722 | 127 |
| 151 | 3300005543 | Ga0070672_100268151 | Ga0070672_1002681513 | 127 |
| 152 | 3300005544 | Ga0070686_100000527 | Ga0070686_10000052720 | 127 |
| 153 | 3300005544 | Ga0070686_100065931 | Ga0070686_1000659312 | 127 |
| 154 | 3300005545 | Ga0070695_100000498 | Ga0070695_10000049812 | 127 |
| 155 | 3300005545 | Ga0070695_100008411 | Ga0070695_1000084112 | 127 |
| 156 | 3300005545 | Ga0070695_100249577 | Ga0070695_1002495772 | 127 |
| 157 | 3300005546 | Ga0070696_100000061 | Ga0070696_10000006150 | 127 |
| 158 | 3300005546 | Ga0070696_100074309 | Ga0070696_1000743094 | 127 |
| 159 | 3300005546 | Ga0070696_100159185 | Ga0070696_1001591852 | 127 |
| 160 | 3300005546 | Ga0070696_100466611 | Ga0070696_1004666111 | 127 |
| 161 | 3300005546 | Ga0070696_100533632 | Ga0070696_1005336322 | 127 |
| 162 | 3300005547 | Ga0070693_100000016 | Ga0070693_10000001620 | 127 |
| 163 | 3300005547 | Ga0070693_100511286 | Ga0070693_1005112862 | 127 |
| 164 | 3300005548 | Ga0070665_100344579 | Ga0070665_1003445792 | 127 |
| 165 | 3300005549 | Ga0070704_100000487 | Ga0070704_10000048716 | 127 |
| 166 | 3300005549 | Ga0070704_100119723 | Ga0070704_1001197233 | 127 |
| 167 | 3300005549 | Ga0070704_101026318 | Ga0070704_1010263182 | 127 |
| 168 | 3300005563 | Ga0068855_100000975 | Ga0068855_10000097530 | 127 |
| 169 | 3300005563 | Ga0068855_100018315 | Ga0068855_1000183152 | 127 |
| 170 | 3300005563 | Ga0068855_100353997 | Ga0068855_1003539972 | 127 |
| 171 | 3300005563 | Ga0068855_100847732 | Ga0068855_1008477322 | 127 |
| 172 | 3300005563 | Ga0068855_100936053 | Ga0068855_1009360532 | 127 |
| 173 | 3300005577 | Ga0068857_100060760 | Ga0068857_1000607601 | 127 |
| 174 | 3300005577 | Ga0068857_101524409 | Ga0068857_1015244091 | 127 |
| 175 | 3300005578 | Ga0068854_100000366 | Ga0068854_1000003663 | 127 |
| 176 | 3300005614 | Ga0068856_100010596 | Ga0068856_1000105963 | 127 |
| 177 | 3300005614 | Ga0068856_100020844 | Ga0068856_1000208444 | 127 |
| 178 | 3300005614 | Ga0068856_101714046 | Ga0068856_1017140461 | 127 |
| 179 | 3300005615 | Ga0070702_100000485 | Ga0070702_10000048513 | 127 |
| 180 | 3300005616 | Ga0068852_100240908 | Ga0068852_1002409082 | 127 |
| 181 | 3300005616 | Ga0068852_102139086 | Ga0068852_1021390862 | 127 |
| 182 | 3300005617 | Ga0068859_100005636 | Ga0068859_1000056365 | 127 |
| 183 | 3300005617 | Ga0068859_100513283 | Ga0068859_1005132832 | 127 |
| 184 | 3300005618 | Ga0068864_100015369 | Ga0068864_1000153693 | 127 |
| 185 | 3300005718 | Ga0068866_10000176 | Ga0068866_1000017621 | 127 |
| 186 | 3300005718 | Ga0068866_10627521 | Ga0068866_106275211 | 127 |
| 187 | 3300005719 | Ga0068861_100001699 | Ga0068861_10000169912 | 127 |
| 188 | 3300005719 | Ga0068861_100004033 | Ga0068861_10000403313 | 127 |
| 189 | 3300005834 | Ga0068851_10079942 | Ga0068851_100799422 | 127 |
| 190 | 3300005840 | Ga0068870_10013749 | Ga0068870_100137492 | 127 |
| 191 | 3300005840 | Ga0068870_10114773 | Ga0068870_101147733 | 127 |
| 192 | 3300005841 | Ga0068863_100568029 | Ga0068863_1005680292 | 127 |
| 193 | 3300005842 | Ga0068858_100000619 | Ga0068858_10000061927 | 127 |
| 194 | 3300005842 | Ga0068858_100091525 | Ga0068858_1000915252 | 127 |
| 195 | 3300005842 | Ga0068858_102125838 | Ga0068858_1021258382 | 127 |
| 196 | 3300005843 | Ga0068860_100002570 | Ga0068860_10000257014 | 127 |
| 197 | 3300005843 | Ga0068860_100847004 | Ga0068860_1008470042 | 127 |
| 198 | 3300005844 | Ga0068862_100003412 | Ga0068862_10000341212 | 127 |
| 199 | 3300005844 | Ga0068862_100012212 | Ga0068862_1000122125 | 127 |
| 200 | 3300005844 | Ga0068862_100459243 | Ga0068862_1004592432 | 127 |
| 201 | 3300005937 | Ga0081455_10050130 | Ga0081455_100501303 | 127 |
| 202 | 3300005983 | Ga0081540_1000370 | Ga0081540_100037039 | 127 |
| 203 | 3300005985 | Ga0081539_10000008 | Ga0081539_10000008245 | 127 |
| 204 | 3300006028 | Ga0070717_10089862 | Ga0070717_100898623 | 127 |
| 205 | 3300006028 | Ga0070717_10450680 | Ga0070717_104506802 | 127 |
| 206 | 3300006028 | Ga0070717_11051079 | Ga0070717_110510792 | 127 |
| 207 | 3300006028 | Ga0070717_11256425 | Ga0070717_112564252 | 127 |
| 208 | 3300006038 | Ga0075365_10206258 | Ga0075365_102062582 | 127 |
| 209 | 3300006163 | Ga0070715_10037076 | Ga0070715_100370763 | 127 |
| 210 | 3300006163 | Ga0070715_10694607 | Ga0070715_106946072 | 127 |
| 211 | 3300006173 | Ga0070716_100003046 | Ga0070716_1000030466 | 127 |
| 212 | 3300006173 | Ga0070716_100945551 | Ga0070716_1009455512 | 127 |
| 213 | 3300006175 | Ga0070712_100017433 | Ga0070712_1000174334 | 127 |
| 214 | 3300006175 | Ga0070712_100908306 | Ga0070712_1009083062 | 127 |
| 215 | 3300006237 | Ga0097621_100001255 | Ga0097621_1000012558 | 127 |
| 216 | 3300006237 | Ga0097621_100001554 | Ga0097621_1000015548 | 127 |
| 217 | 3300006237 | Ga0097621_101034452 | Ga0097621_1010344522 | 127 |
| 218 | 3300006358 | Ga0068871_100002479 | Ga0068871_1000024793 | 127 |
| 219 | 3300006358 | Ga0068871_100003865 | Ga0068871_10000386513 | 127 |
| 220 | 3300006844 | Ga0075428_100000532 | Ga0075428_10000053224 | 127 |
| 221 | 3300006844 | Ga0075428_100202643 | Ga0075428_1002026433 | 127 |
| 222 | 3300006844 | Ga0075428_100520332 | Ga0075428_1005203323 | 127 |
| 223 | 3300006844 | Ga0075428_100752533 | Ga0075428_1007525332 | 127 |
| 224 | 3300006844 | Ga0075428_101355406 | Ga0075428_1013554061 | 127 |
| 225 | 3300006844 | Ga0075428_101971507 | Ga0075428_1019715072 | 127 |
| 226 | 3300006846 | Ga0075430_100001203 | Ga0075430_1000012033 | 127 |
| 227 | 3300006846 | Ga0075430_100018890 | Ga0075430_1000188908 | 127 |
| 228 | 3300006846 | Ga0075430_100267639 | Ga0075430_1002676393 | 127 |
| 229 | 3300006846 | Ga0075430_100567535 | Ga0075430_1005675352 | 127 |
| 230 | 3300006846 | Ga0075430_101023258 | Ga0075430_1010232581 | 127 |
| 231 | 3300006846 | Ga0075430_101186501 | Ga0075430_1011865011 | 127 |
| 232 | 3300006847 | Ga0075431_100119157 | Ga0075431_1001191573 | 127 |
| 233 | 3300006847 | Ga0075431_100816037 | Ga0075431_1008160372 | 127 |
| 234 | 3300006847 | Ga0075431_101715467 | Ga0075431_1017154672 | 127 |
| 235 | 3300006852 | Ga0075433_10463541 | Ga0075433_104635412 | 127 |
| 236 | 3300006871 | Ga0075434_100027094 | Ga0075434_1000270946 | 127 |
| 237 | 3300006871 | Ga0075434_101060870 | Ga0075434_1010608701 | 127 |
| 238 | 3300006880 | Ga0075429_100321678 | Ga0075429_1003216782 | 127 |
| 239 | 3300006881 | Ga0068865_100000262 | Ga0068865_10000026218 | 127 |
| 240 | 3300006881 | Ga0068865_100162540 | Ga0068865_1001625402 | 127 |
| 241 | 3300006914 | Ga0075436_100000639 | Ga0075436_10000063921 | 127 |
| 242 | 3300006914 | Ga0075436_100032287 | Ga0075436_1000322873 | 127 |
| 243 | 3300006914 | Ga0075436_100058044 | Ga0075436_1000580443 | 127 |
| 244 | 3300006931 | Ga0097620_100005635 | Ga0097620_10000563512 | 127 |
| 245 | 3300006931 | Ga0097620_100513330 | Ga0097620_1005133302 | 127 |
| 246 | 3300007076 | Ga0075435_100009644 | Ga0075435_1000096443 | 127 |
| 247 | 3300007076 | Ga0075435_100051941 | Ga0075435_1000519416 | 127 |
| 248 | 3300007076 | Ga0075435_100364022 | Ga0075435_1003640222 | 127 |
| 249 | 3300007265 | Ga0099794_10046095 | Ga0099794_100460952 | 127 |
| 250 | 3300007265 | Ga0099794_10266657 | Ga0099794_102666572 | 127 |
| 251 | 3300007265 | Ga0099794_10273705 | Ga0099794_102737051 | 127 |
| 252 | 3300007265 | Ga0099794_10291435 | Ga0099794_102914352 | 127 |
| 253 | 3300007788 | Ga0099795_10104149 | Ga0099795_101041491 | 127 |
| 254 | 3300007788 | Ga0099795_10131555 | Ga0099795_101315552 | 127 |
| 255 | 3300007788 | Ga0099795_10346653 | Ga0099795_103466532 | 127 |
| 256 | 3300009093 | Ga0105240_10054802 | Ga0105240_100548023 | 127 |
| 257 | 3300009094 | Ga0111539_10022190 | Ga0111539_100221909 | 127 |
| 258 | 3300009094 | Ga0111539_10046759 | Ga0111539_100467595 | 127 |
| 259 | 3300009094 | Ga0111539_10065376 | Ga0111539_100653763 | 127 |
| 260 | 3300009094 | Ga0111539_10147190 | Ga0111539_101471902 | 127 |
| 261 | 3300009094 | Ga0111539_12941698 | Ga0111539_129416981 | 127 |
| 262 | 3300009098 | Ga0105245_10000178 | Ga0105245_1000017838 | 127 |
| 263 | 3300009098 | Ga0105245_11615807 | Ga0105245_116158072 | 127 |
| 264 | 3300009101 | Ga0105247_10182982 | Ga0105247_101829822 | 127 |
| 265 | 3300009147 | Ga0114129_10017720 | Ga0114129_1001772010 | 127 |
| 266 | 3300009147 | Ga0114129_10102952 | Ga0114129_101029522 | 127 |
| 267 | 3300009147 | Ga0114129_10412330 | Ga0114129_104123302 | 127 |
| 268 | 3300009147 | Ga0114129_10511631 | Ga0114129_105116312 | 127 |
| 269 | 3300009147 | Ga0114129_10688549 | Ga0114129_106885493 | 127 |
| 270 | 3300009148 | Ga0105243_10000270 | Ga0105243_1000027046 | 127 |
| 271 | 3300009174 | Ga0105241_10056256 | Ga0105241_100562563 | 127 |
| 272 | 3300009176 | Ga0105242_10000409 | Ga0105242_1000040931 | 127 |
| 273 | 3300009176 | Ga0105242_10574225 | Ga0105242_105742252 | 127 |
| 274 | 3300009177 | Ga0105248_10306890 | Ga0105248_103068903 | 127 |
| 275 | 3300009545 | Ga0105237_10017737 | Ga0105237_100177378 | 127 |
| 276 | 3300009545 | Ga0105237_10084602 | Ga0105237_100846022 | 127 |
| 277 | 3300009551 | Ga0105238_10003279 | Ga0105238_100032794 | 127 |
| 278 | 3300009551 | Ga0105238_10296437 | Ga0105238_102964373 | 127 |
| 279 | 3300009551 | Ga0105238_10371092 | Ga0105238_103710922 | 127 |
| 280 | 3300009551 | Ga0105238_12601910 | Ga0105238_126019101 | 127 |
| 281 | 3300009553 | Ga0105249_10012264 | Ga0105249_100122643 | 127 |
| 282 | 3300009553 | Ga0105249_10211874 | Ga0105249_102118742 | 127 |
| 283 | 3300009553 | Ga0105249_10793596 | Ga0105249_107935962 | 127 |
| 284 | 3300009553 | Ga0105249_12190751 | Ga0105249_121907512 | 127 |
| 285 | 3300010159 | Ga0099796_10177522 | Ga0099796_101775221 | 127 |
| 286 | 3300010375 | Ga0105239_10075790 | Ga0105239_100757904 | 127 |
| 287 | 3300010375 | Ga0105239_10130266 | Ga0105239_101302664 | 127 |
| 288 | 3300010375 | Ga0105239_10285791 | Ga0105239_102857913 | 127 |
| 289 | 3300010375 | Ga0105239_10505723 | Ga0105239_105057233 | 127 |
| 290 | 3300011119 | Ga0105246_10238273 | Ga0105246_102382732 | 127 |
| 291 | 3300011119 | Ga0105246_10902847 | Ga0105246_109028471 | 127 |
| 292 | 3300011119 | Ga0105246_12408309 | Ga0105246_124083091 | 127 |
| 293 | 3300013102 | Ga0157371_10343524 | Ga0157371_103435242 | 127 |
| 294 | 3300013104 | Ga0157370_10203136 | Ga0157370_102031363 | 127 |
| 295 | 3300013105 | Ga0157369_10056614 | Ga0157369_100566145 | 127 |
| 296 | 3300013105 | Ga0157369_10452283 | Ga0157369_104522833 | 127 |
| 297 | 3300013296 | Ga0157374_10405507 | Ga0157374_104055071 | 127 |
| 298 | 3300013297 | Ga0157378_11110754 | Ga0157378_111107542 | 127 |
| 299 | 3300013306 | Ga0163162_10097503 | Ga0163162_100975033 | 127 |
| 300 | 3300013306 | Ga0163162_10396291 | Ga0163162_103962912 | 127 |
| 301 | 3300013307 | Ga0157372_10174365 | Ga0157372_101743653 | 127 |
| 302 | 3300013307 | Ga0157372_10735448 | Ga0157372_107354483 | 127 |
| 303 | 3300013307 | Ga0157372_11128184 | Ga0157372_111281842 | 127 |
| 304 | 3300013308 | Ga0157375_10420185 | Ga0157375_104201851 | 127 |
| 305 | 3300013308 | Ga0157375_10736362 | Ga0157375_107363622 | 127 |
| 306 | 3300014325 | Ga0163163_10919906 | Ga0163163_109199061 | 127 |
| 307 | 3300014325 | Ga0163163_12685922 | Ga0163163_126859221 | 127 |
| 308 | 3300014326 | Ga0157380_10009920 | Ga0157380_100099209 | 127 |
| 309 | 3300014326 | Ga0157380_10029204 | Ga0157380_100292043 | 127 |
| 310 | 3300014326 | Ga0157380_10679445 | Ga0157380_106794452 | 127 |
| 311 | 3300014326 | Ga0157380_11430636 | Ga0157380_114306362 | 127 |
| 312 | 3300014745 | Ga0157377_10147018 | Ga0157377_101470182 | 127 |
| 313 | 3300014968 | Ga0157379_10241373 | Ga0157379_102413733 | 127 |
| 314 | 3300014969 | Ga0157376_10008044 | Ga0157376_1000804410 | 127 |
| 315 | 3300014969 | Ga0157376_10085285 | Ga0157376_100852853 | 127 |
| 316 | 3300021358 | Ga0213873_10108626 | Ga0213873_101086262 | 127 |
| 317 | 3300021384 | Ga0213876_10012190 | Ga0213876_100121903 | 127 |
| 318 | 3300021388 | Ga0213875_10183163 | Ga0213875_101831632 | 127 |
| 319 | 3300025885 | Ga0207653_10007295 | Ga0207653_100072954 | 127 |
| 320 | 3300025898 | Ga0207692_10019156 | Ga0207692_100191562 | 127 |
| 321 | 3300025899 | Ga0207642_10010162 | Ga0207642_100101624 | 127 |
| 322 | 3300025899 | Ga0207642_10515909 | Ga0207642_105159091 | 127 |
| 323 | 3300025901 | Ga0207688_10012274 | Ga0207688_100122743 | 127 |
| 324 | 3300025901 | Ga0207688_10113559 | Ga0207688_101135592 | 127 |
| 325 | 3300025904 | Ga0207647_10119993 | Ga0207647_101199932 | 127 |
| 326 | 3300025905 | Ga0207685_10027646 | Ga0207685_100276463 | 127 |
| 327 | 3300025905 | Ga0207685_10376210 | Ga0207685_103762102 | 127 |
| 328 | 3300025906 | Ga0207699_10007692 | Ga0207699_100076924 | 127 |
| 329 | 3300025906 | Ga0207699_10201974 | Ga0207699_102019741 | 127 |
| 330 | 3300025906 | Ga0207699_10210401 | Ga0207699_102104012 | 127 |
| 331 | 3300025908 | Ga0207643_10017173 | Ga0207643_100171732 | 127 |
| 332 | 3300025908 | Ga0207643_10062857 | Ga0207643_100628573 | 127 |
| 333 | 3300025909 | Ga0207705_10206827 | Ga0207705_102068271 | 127 |
| 334 | 3300025910 | Ga0207684_10339434 | Ga0207684_103394343 | 127 |
| 335 | 3300025910 | Ga0207684_10828379 | Ga0207684_108283791 | 127 |
| 336 | 3300025911 | Ga0207654_10168639 | Ga0207654_101686392 | 127 |
| 337 | 3300025912 | Ga0207707_10007441 | Ga0207707_100074416 | 127 |
| 338 | 3300025912 | Ga0207707_10143832 | Ga0207707_101438323 | 127 |
| 339 | 3300025912 | Ga0207707_10166471 | Ga0207707_101664713 | 127 |
| 340 | 3300025912 | Ga0207707_10405611 | Ga0207707_104056112 | 127 |
| 341 | 3300025913 | Ga0207695_10359879 | Ga0207695_103598792 | 127 |
| 342 | 3300025914 | Ga0207671_10342447 | Ga0207671_103424472 | 127 |
| 343 | 3300025914 | Ga0207671_11255388 | Ga0207671_112553881 | 127 |
| 344 | 3300025915 | Ga0207693_10012174 | Ga0207693_100121745 | 127 |
| 345 | 3300025916 | Ga0207663_10000291 | Ga0207663_1000029121 | 127 |
| 346 | 3300025916 | Ga0207663_10331253 | Ga0207663_103312532 | 127 |
| 347 | 3300025916 | Ga0207663_10773154 | Ga0207663_107731543 | 127 |
| 348 | 3300025917 | Ga0207660_10002634 | Ga0207660_100026342 | 127 |
| 349 | 3300025917 | Ga0207660_10084516 | Ga0207660_100845162 | 127 |
| 350 | 3300025918 | Ga0207662_10000047 | Ga0207662_1000004721 | 127 |
| 351 | 3300025918 | Ga0207662_10292893 | Ga0207662_102928932 | 127 |
| 352 | 3300025919 | Ga0207657_10101929 | Ga0207657_101019291 | 127 |
| 353 | 3300025920 | Ga0207649_10570320 | Ga0207649_105703202 | 127 |
| 354 | 3300025921 | Ga0207652_10006338 | Ga0207652_100063384 | 127 |
| 355 | 3300025923 | Ga0207681_10005133 | Ga0207681_100051336 | 127 |
| 356 | 3300025923 | Ga0207681_10202933 | Ga0207681_102029331 | 127 |
| 357 | 3300025924 | Ga0207694_10146832 | Ga0207694_101468322 | 127 |
| 358 | 3300025926 | Ga0207659_10940782 | Ga0207659_109407822 | 127 |
| 359 | 3300025927 | Ga0207687_10001597 | Ga0207687_1000159712 | 127 |
| 360 | 3300025928 | Ga0207700_10121330 | Ga0207700_101213302 | 127 |
| 361 | 3300025928 | Ga0207700_10274711 | Ga0207700_102747111 | 127 |
| 362 | 3300025928 | Ga0207700_11189130 | Ga0207700_111891301 | 127 |
| 363 | 3300025929 | Ga0207664_10021624 | Ga0207664_100216242 | 127 |
| 364 | 3300025929 | Ga0207664_10125999 | Ga0207664_101259992 | 127 |
| 365 | 3300025932 | Ga0207690_10278439 | Ga0207690_102784391 | 127 |
| 366 | 3300025932 | Ga0207690_10382846 | Ga0207690_103828462 | 127 |
| 367 | 3300025934 | Ga0207686_10000446 | Ga0207686_1000044621 | 127 |
| 368 | 3300025935 | Ga0207709_10000910 | Ga0207709_100009106 | 127 |
| 369 | 3300025935 | Ga0207709_10043589 | Ga0207709_100435893 | 127 |
| 370 | 3300025936 | Ga0207670_10000462 | Ga0207670_100004622 | 127 |
| 371 | 3300025936 | Ga0207670_10296248 | Ga0207670_102962482 | 127 |
| 372 | 3300025937 | Ga0207669_10069537 | Ga0207669_100695373 | 127 |
| 373 | 3300025937 | Ga0207669_10523932 | Ga0207669_105239321 | 127 |
| 374 | 3300025938 | Ga0207704_10000290 | Ga0207704_1000029012 | 127 |
| 375 | 3300025938 | Ga0207704_10072596 | Ga0207704_100725963 | 127 |
| 376 | 3300025939 | Ga0207665_10000624 | Ga0207665_1000062419 | 127 |
| 377 | 3300025939 | Ga0207665_10206725 | Ga0207665_102067252 | 127 |
| 378 | 3300025939 | Ga0207665_11278130 | Ga0207665_112781301 | 127 |
| 379 | 3300025940 | Ga0207691_10322186 | Ga0207691_103221863 | 127 |
| 380 | 3300025941 | Ga0207711_10220954 | Ga0207711_102209543 | 127 |
| 381 | 3300025941 | Ga0207711_10666649 | Ga0207711_106666492 | 127 |
| 382 | 3300025942 | Ga0207689_10000148 | Ga0207689_1000014847 | 127 |
| 383 | 3300025942 | Ga0207689_10393572 | Ga0207689_103935722 | 127 |
| 384 | 3300025944 | Ga0207661_10013381 | Ga0207661_100133812 | 127 |
| 385 | 3300025949 | Ga0207667_10004155 | Ga0207667_100041558 | 127 |
| 386 | 3300025949 | Ga0207667_10046316 | Ga0207667_100463165 | 127 |
| 387 | 3300025949 | Ga0207667_10170941 | Ga0207667_101709412 | 127 |
| 388 | 3300025960 | Ga0207651_11285021 | Ga0207651_112850212 | 127 |
| 389 | 3300025961 | Ga0207712_10012530 | Ga0207712_100125308 | 127 |
| 390 | 3300025961 | Ga0207712_11563492 | Ga0207712_115634921 | 127 |
| 391 | 3300025972 | Ga0207668_10079503 | Ga0207668_100795035 | 127 |
| 392 | 3300025981 | Ga0207640_10000351 | Ga0207640_1000035132 | 127 |
| 393 | 3300026023 | Ga0207677_10012717 | Ga0207677_100127176 | 127 |
| 394 | 3300026023 | Ga0207677_10501034 | Ga0207677_105010342 | 127 |
| 395 | 3300026023 | Ga0207677_10654851 | Ga0207677_106548512 | 127 |
| 396 | 3300026035 | Ga0207703_10001208 | Ga0207703_1000120814 | 127 |
| 397 | 3300026035 | Ga0207703_10159611 | Ga0207703_101596112 | 127 |
| 398 | 3300026035 | Ga0207703_11779942 | Ga0207703_117799421 | 127 |
| 399 | 3300026041 | Ga0207639_10318474 | Ga0207639_103184742 | 127 |
| 400 | 3300026041 | Ga0207639_10416797 | Ga0207639_104167972 | 127 |
| 401 | 3300026041 | Ga0207639_10635066 | Ga0207639_106350662 | 127 |
| 402 | 3300026067 | Ga0207678_10873331 | Ga0207678_108733311 | 127 |
| 403 | 3300026075 | Ga0207708_10000676 | Ga0207708_1000067610 | 127 |
| 404 | 3300026075 | Ga0207708_10025388 | Ga0207708_100253885 | 127 |
| 405 | 3300026078 | Ga0207702_10010733 | Ga0207702_100107333 | 127 |
| 406 | 3300026078 | Ga0207702_11067173 | Ga0207702_110671732 | 127 |
| 407 | 3300026078 | Ga0207702_11618875 | Ga0207702_116188752 | 127 |
| 408 | 3300026089 | Ga0207648_10000018 | Ga0207648_10000018110 | 127 |
| 409 | 3300026089 | Ga0207648_10000431 | Ga0207648_100004314 | 127 |
| 410 | 3300026095 | Ga0207676_10019411 | Ga0207676_100194116 | 127 |
| 411 | 3300026116 | Ga0207674_11420738 | Ga0207674_114207381 | 127 |
| 412 | 3300026118 | Ga0207675_100000170 | Ga0207675_10000017047 | 127 |
| 413 | 3300026118 | Ga0207675_100003942 | Ga0207675_10000394212 | 127 |
| 414 | 3300026118 | Ga0207675_101099197 | Ga0207675_1010991972 | 127 |
| 415 | 3300026121 | Ga0207683_10921922 | Ga0207683_109219222 | 127 |
| 416 | 3300026142 | Ga0207698_10045738 | Ga0207698_100457381 | 127 |
| 417 | 3300027360 | Ga0209969_1005956 | Ga0209969_10059563 | 127 |
| 418 | 3300027360 | Ga0209969_1006243 | Ga0209969_10062434 | 127 |
| 419 | 3300027360 | Ga0209969_1010549 | Ga0209969_10105493 | 127 |
| 420 | 3300027364 | Ga0209967_1000349 | Ga0209967_10003499 | 127 |
| 421 | 3300027364 | Ga0209967_1077168 | Ga0209967_10771681 | 127 |
| 422 | 3300027378 | Ga0209981_1000479 | Ga0209981_10004798 | 127 |
| 423 | 3300027378 | Ga0209981_1008438 | Ga0209981_10084382 | 127 |
| 424 | 3300027395 | Ga0209996_1003227 | Ga0209996_10032272 | 127 |
| 425 | 3300027462 | Ga0210000_1000972 | Ga0210000_10009725 | 127 |
| 426 | 3300027462 | Ga0210000_1017556 | Ga0210000_10175562 | 127 |
| 427 | 3300027471 | Ga0209995_1021285 | Ga0209995_10212852 | 127 |
| 428 | 3300027471 | Ga0209995_1083263 | Ga0209995_10832632 | 127 |
| 429 | 3300027512 | Ga0209179_1020739 | Ga0209179_10207391 | 127 |
| 430 | 3300027543 | Ga0209999_1004910 | Ga0209999_10049102 | 127 |
| 431 | 3300027543 | Ga0209999_1006553 | Ga0209999_10065532 | 127 |
| 432 | 3300027543 | Ga0209999_1064526 | Ga0209999_10645262 | 127 |
| 433 | 3300027552 | Ga0209982_1010156 | Ga0209982_10101562 | 127 |
| 434 | 3300027614 | Ga0209970_1006382 | Ga0209970_10063822 | 127 |
| 435 | 3300027617 | Ga0210002_1010884 | Ga0210002_10108842 | 127 |
| 436 | 3300027665 | Ga0209983_1017420 | Ga0209983_10174202 | 127 |
| 437 | 3300027671 | Ga0209588_1049730 | Ga0209588_10497303 | 127 |
| 438 | 3300027671 | Ga0209588_1089200 | Ga0209588_10892002 | 127 |
| 439 | 3300027695 | Ga0209966_1003030 | Ga0209966_10030302 | 127 |
| 440 | 3300027717 | Ga0209998_10015880 | Ga0209998_100158803 | 127 |
| 441 | 3300027907 | Ga0207428_10000835 | Ga0207428_1000083519 | 127 |
| 442 | 3300027907 | Ga0207428_10079253 | Ga0207428_100792531 | 127 |
| 443 | 3300027907 | Ga0207428_10132490 | Ga0207428_101324902 | 127 |
| 444 | 3300028379 | Ga0268266_10227172 | Ga0268266_102271722 | 127 |
| 445 | 3300028380 | Ga0268265_10001514 | Ga0268265_1000151410 | 127 |
| 446 | 3300028380 | Ga0268265_10002339 | Ga0268265_100023398 | 127 |
| 447 | 3300028380 | Ga0268265_10435050 | Ga0268265_104350502 | 127 |
| 448 | 3300028381 | Ga0268264_10001414 | Ga0268264_1000141420 | 127 |
| 449 | 3300028381 | Ga0268264_10232689 | Ga0268264_102326893 | 127 |
| 450 | 3300028794 | Ga0307515_10918991 | Ga0307515_109189911 | 127 |
| 451 | 3300031241 | Ga0265325_10067621 | Ga0265325_100676212 | 127 |
| 452 | 3300031242 | Ga0265329_10051333 | Ga0265329_100513331 | 127 |
| 453 | 3300031247 | Ga0265340_10013061 | Ga0265340_100130614 | 127 |
| 454 | 3300031249 | Ga0265339_10003282 | Ga0265339_100032822 | 127 |
| 455 | 3300031250 | Ga0265331_10017380 | Ga0265331_100173803 | 127 |
| 456 | 3300031344 | Ga0265316_10055876 | Ga0265316_100558764 | 127 |
| 457 | 3300031616 | Ga0307508_10304251 | Ga0307508_103042511 | 127 |
| 458 | 3300031711 | Ga0265314_10086421 | Ga0265314_100864213 | 127 |
| 459 | 3300031711 | Ga0265314_10550889 | Ga0265314_105508891 | 127 |
| 460 | 3300031712 | Ga0265342_10000026 | Ga0265342_1000002695 | 127 |
| 461 | 3300031712 | Ga0265342_10009061 | Ga0265342_100090614 | 127 |
| 462 | 3300031824 | Ga0307413_11505153 | Ga0307413_115051532 | 127 |
| 463 | 3300031852 | Ga0307410_11180728 | Ga0307410_111807282 | 127 |
| 464 | 3300031911 | Ga0307412_10728011 | Ga0307412_107280112 | 127 |
| 465 | 3300032002 | Ga0307416_100084175 | Ga0307416_1000841754 | 127 |
| 466 | 3300032002 | Ga0307416_101465923 | Ga0307416_1014659232 | 127 |
| 467 | 3300032002 | Ga0307416_101882541 | Ga0307416_1018825412 | 127 |
| 468 | 3300034817 | Ga0373948_0027495 | Ga0373948_0027495_725_1108 | 127 |
| 469 | 3300034818 | Ga0373950_0062014 | Ga0373950_0062014_152_535 | 127 |
| 470 | 3300034819 | Ga0373958_0011120 | Ga0373958_0011120_69_452 | 127 |
| 471 | 3300034820 | Ga0373959_0162331 | Ga0373959_0162331_72_455 | 127 |
| 472 | 3300034957 | Ga0373938_0052682 | Ga0373938_0052682_200_583 | 127 |
| 473 | 3300034957 | Ga0373938_0095235 | Ga0373938_0095235_325_708 | 127 |
| 474 | 3300035083 | Ga0373926_0009739 | Ga0373926_0009739_431_844 | 127 |
| 475 | 3300035085 | Ga0373929_0147138 | Ga0373929_0147138_169_552 | 127 |
| 476 | 3300035086 | Ga0373934_0000157 | Ga0373934_0000157_21571_21984 | 127 |
| 477 | 3300035086 | Ga0373934_0002551 | Ga0373934_0002551_4470_4883 | 127 |
| 478 | 3300035088 | Ga0373940_0019387 | Ga0373940_0019387_349_732 | 127 |
| 479 | 3300035089 | Ga0373944_0011847 | Ga0373944_0011847_587_970 | 127 |
| 480 | 3300035089 | Ga0373944_0096979 | Ga0373944_0096979_549_962 | 127 |
| 481 | 3300035090 | Ga0373949_0101589 | Ga0373949_0101589_182_565 | 127 |
| 482 | 3300035091 | Ga0373951_0026110 | Ga0373951_0026110_629_1039 | 127 |
| 483 | 3300035091 | Ga0373951_0105189 | Ga0373951_0105189_348_731 | 127 |
| 484 | 3300035092 | Ga0373952_0074487 | Ga0373952_0074487_316_699 | 127 |
| 485 | 3300035111 | Ga0373923_0242420 | Ga0373923_0242420_108_491 | 127 |
| 486 | 3300035112 | Ga0373932_0003535 | Ga0373932_0003535_2932_3315 | 127 |
| 487 | 3300035112 | Ga0373932_0005272 | Ga0373932_0005272_2584_2967 | 127 |
| 488 | 3300035113 | Ga0373936_0012446 | Ga0373936_0012446_142_525 | 127 |
| 489 | 3300035113 | Ga0373936_0031196 | Ga0373936_0031196_754_1167 | 127 |
| 490 | 3300035114 | Ga0373939_0013282 | Ga0373939_0013282_1308_1691 | 127 |
| 491 | 3300035114 | Ga0373939_0150744 | Ga0373939_0150744_192_575 | 127 |
| 492 | 3300035114 | Ga0373939_0368031 | Ga0373939_0368031_90_473 | 127 |
| 493 | 3300035115 | Ga0373941_0025111 | Ga0373941_0025111_492_875 | 127 |
| 494 | 3300035116 | Ga0373945_0016153 | Ga0373945_0016153_413_796 | 127 |
| 495 | 3300035117 | Ga0373953_0157129 | Ga0373953_0157129_406_819 | 127 |
| 496 | 3300035117 | Ga0373953_0164379 | Ga0373953_0164379_432_845 | 127 |
| 497 | 3300035118 | Ga0373954_0007812 | Ga0373954_0007812_3228_3641 | 127 |
| 498 | 3300035118 | Ga0373954_0019589 | Ga0373954_0019589_1927_2340 | 127 |
| 499 | 3300035119 | Ga0373956_0000273 | Ga0373956_0000273_11921_12334 | 127 |
| 500 | 3300035119 | Ga0373956_0021831 | Ga0373956_0021831_1526_1939 | 127 |
| 501 | 3300035119 | Ga0373956_0386289 | Ga0373956_0386289_42_425 | 127 |
| 502 | 3300035120 | Ga0373957_0004451 | Ga0373957_0004451_79_492 | 127 |
| 503 | 3300035120 | Ga0373957_0023316 | Ga0373957_0023316_228_641 | 127 |
| 504 | 3300035121 | Ga0373960_0069525 | Ga0373960_0069525_635_1018 | 127 |
| 505 | 3300035121 | Ga0373960_0220844 | Ga0373960_0220844_107_490 | 127 |
| 506 | 3300035170 | Ga0373943_0065949 | Ga0373943_0065949_678_1091 | 127 |
| 507 | 3300035170 | Ga0373943_0102929 | Ga0373943_0102929_39_449 | 127 |
| 508 | 3300035171 | Ga0373946_0011082 | Ga0373946_0011082_2303_2716 | 127 |
| 509 | 3300035171 | Ga0373946_0085804 | Ga0373946_0085804_144_527 | 127 |
| 510 | 3300035172 | Ga0373955_0008143 | Ga0373955_0008143_1107_1520 | 127 |
| 511 | 3300035172 | Ga0373955_0015370 | Ga0373955_0015370_2150_2563 | 127 |
| 512 | 3300035172 | Ga0373955_0082423 | Ga0373955_0082423_1391_1774 | 127 |
| 513 | 3300035207 | Ga0373942_0002745 | Ga0373942_0002745_292_678 | 127 |
| 514 | 3300035207 | Ga0373942_0028241 | Ga0373942_0028241_987_1370 | 127 |
| 515 | 3300035207 | Ga0373942_0280435 | Ga0373942_0280435_132_515 | 127 |
| 516 | 3300035241 | Ga0373961_0016133 | Ga0373961_0016133_768_1151 | 127 |
| 517 | 3300035241 | Ga0373961_0048712 | Ga0373961_0048712_230_613 | 127 |
| 518 | 3300035241 | Ga0373961_0055087 | Ga0373961_0055087_559_942 | 127 |
| 519 | 3300035242 | Ga0373962_0100110 | Ga0373962_0100110_435_818 | 127 |
| 520 | 3300035242 | Ga0373962_0106460 | Ga0373962_0106460_98_508 | 127 |
| 521 | 3300035410 | Ga0373924_0041056 | Ga0373924_0041056_1013_1396 | 127 |
| 522 | 3300035691 | Ga0373931_0003435 | Ga0373931_0003435_6189_6572 | 127 |
| 523 | 3300035691 | Ga0373931_0037614 | Ga0373931_0037614_1971_2354 | 127 |
| 524 | 3300035691 | Ga0373931_0177315 | Ga0373931_0177315_62_475 | 127 |
| 525 | 3300035691 | Ga0373931_0487396 | Ga0373931_0487396_65_448 | 127 |
| 526 | 3300035692 | Ga0373935_0015295 | Ga0373935_0015295_1278_1691 | 127 |
| 527 | 3300035692 | Ga0373935_0329750 | Ga0373935_0329750_559_942 | 127 |
| 528 | 3300035695 | Ga0373927_0025425 | Ga0373927_0025425_381_764 | 127 |
| 529 | 3300035695 | Ga0373927_0109836 | Ga0373927_0109836_376_789 | 127 |
| 530 | 3300035724 | Ga0373933_0000480 | Ga0373933_0000480_10577_10990 | 127 |
| 531 | 3300035724 | Ga0373933_0122493 | Ga0373933_0122493_989_1402 | 127 |
| 532 | 3300035725 | Ga0373947_0067283 | Ga0373947_0067283_1356_1769 | 127 |
| 533 | 3300036401 | Ga0373937_0001784 | Ga0373937_0001784_8336_8749 | 127 |
| 534 | 3300036401 | Ga0373937_0049292 | Ga0373937_0049292_395_808 | 127 |
| 535 | 3300036401 | Ga0373937_0116819 | Ga0373937_0116819_922_1335 | 127 |
| 536 | 3300036401 | Ga0373937_0173406 | Ga0373937_0173406_513_896 | 127 |
| 537 | 3300037068 | Ga0373925_0011560 | Ga0373925_0011560_5919_6332 | 127 |
| 538 | 3300037418 | Ga0395900_0117051 | Ga0395900_0117051_220_630 | 127 |
| 539 | 3300037853 | Ga0436364_1113710 | Ga0436364_1113710_1317_1787 | 127 |
| 540 | 3300038443 | Ga0395901_0056419 | Ga0395901_0056419_3432_3842 | 127 |
| 541 | 3300039437 | Ga0436365_0079817 | Ga0436365_0079817_1874_2293 | 127 |
| 542 | 3300039437 | Ga0436365_0287902 | Ga0436365_0287902_368_778 | 127 |
| 543 | 3300039437 | Ga0436365_1366479 | Ga0436365_1366479_340_750 | 127 |
| 544 | 3300039437 | Ga0436365_1679214 | Ga0436365_1679214_252_662 | 127 |
| 545 | 3300039438 | Ga0436360_0478030 | Ga0436360_0478030_739_1122 | 127 |
| 546 | 3300039438 | Ga0436360_0811880 | Ga0436360_0811880_87_497 | 127 |
| 547 | 3300039450 | Ga0436363_1102627 | Ga0436363_1102627_42_452 | 127 |
| 548 | 3300039450 | Ga0436363_1654719 | Ga0436363_1654719_638_1048 | 127 |
| 549 | 3300039453 | Ga0436362_0127817 | Ga0436362_0127817_1171_1581 | 127 |
| 550 | 3300039453 | Ga0436362_0345626 | Ga0436362_0345626_37_420 | 127 |
| 551 | 3300041408 | Ga0439453_0003672 | Ga0439453_0003672_1247_1633 | 127 |
| 552 | 3300041443 | Ga0451789_0234132 | Ga0451789_0234132_75_518 | 127 |
| 553 | 3300041486 | Ga0451807_2199014 | Ga0451807_2199014_1745_2128 | 127 |
| 554 | 3300041486 | Ga0451807_2462780 | Ga0451807_2462780_688_1071 | 127 |
| 555 | 3300041512 | Ga0451853_0460087 | Ga0451853_0460087_162_545 | 127 |
| 556 | 3300042001 | Ga0439441_005775 | Ga0439441_005775_108_491 | 127 |
| 557 | 3300042003 | Ga0439443_001965 | Ga0439443_001965_1608_1991 | 127 |
| 558 | 3300042009 | Ga0439451_010051 | Ga0439451_010051_558_941 | 127 |
| 559 | 3300042009 | Ga0439451_087259 | Ga0439451_087259_150_536 | 127 |
| 560 | 3300042156 | Ga0439446_0175315 | Ga0439446_0175315_160_546 | 127 |
| 561 | 3300042435 | Ga0439434_0000074 | Ga0439434_0000074_16715_17098 | 127 |
| 562 | 3300042435 | Ga0439434_0070864 | Ga0439434_0070864_396_779 | 127 |
| 563 | 3300042436 | Ga0439435_0000001 | Ga0439435_0000001_1523_1906 | 127 |
| 564 | 3300042436 | Ga0439435_0000154 | Ga0439435_0000154_7267_7650 | 127 |
| 565 | 3300042436 | Ga0439435_0000817 | Ga0439435_0000817_4344_4730 | 127 |
| 566 | 3300042437 | Ga0439444_0002711 | Ga0439444_0002711_633_1016 | 127 |
| 567 | 3300042437 | Ga0439444_0032773 | Ga0439444_0032773_174_560 | 127 |
| 568 | 3300042439 | Ga0439464_0038631 | Ga0439464_0038631_85_471 | 127 |
| 569 | 3300042461 | Ga0439460_0000495 | Ga0439460_0000495_1117_1500 | 127 |
| 570 | 3300042461 | Ga0439460_0151211 | Ga0439460_0151211_205_591 | 127 |
| 571 | 3300042876 | Ga0451577_0109406 | Ga0451577_0109406_101_514 | 127 |
| 572 | 3300042876 | Ga0451577_1021107 | Ga0451577_1021107_74_457 | 127 |
| 573 | 3300042993 | Ga0439440_0102072 | Ga0439440_0102072_322_705 | 127 |
| 574 | 3300044673 | Ga0453683_0577435 | Ga0453683_0577435_209_595 | 127 |
| 575 | 3300044694 | Ga0466963_0373859 | Ga0466963_0373859_241_651 | 127 |
| 576 | 3300044694 | Ga0466963_0720945 | Ga0466963_0720945_133_543 | 127 |
| 577 | 3300044706 | Ga0466964_0317783 | Ga0466964_0317783_311_721 | 127 |
| 578 | 3300044842 | Ga0466957_0801542 | Ga0466957_0801542_32_439 | 127 |
| 579 | 3300045051 | Ga0451576_0003549 | Ga0451576_0003549_13738_14121 | 127 |
| 580 | 3300045051 | Ga0451576_0068493 | Ga0451576_0068493_2995_3381 | 127 |
| 581 | 3300045051 | Ga0451576_0224289 | Ga0451576_0224289_749_1132 | 127 |
| 582 | 3300045051 | Ga0451576_0226654 | Ga0451576_0226654_741_1124 | 127 |
| 583 | 3300045976 | Ga0466967_0192036 | Ga0466967_0192036_747_1157 | 127 |
| 584 | 3300045976 | Ga0466967_0518298 | Ga0466967_0518298_733_1140 | 127 |
| 585 | 3300046454 | Ga0495592_0003654 | Ga0495592_0003654_4401_4814 | 127 |
| 586 | 3300046454 | Ga0495592_0046909 | Ga0495592_0046909_2620_3033 | 127 |
| 587 | 3300046455 | Ga0495603_0076782 | Ga0495603_0076782_1109_1492 | 127 |
| 588 | 3300046455 | Ga0495603_0243415 | Ga0495603_0243415_327_740 | 127 |
| 589 | 3300046459 | Ga0495629_0144629 | Ga0495629_0144629_749_1162 | 127 |
| 590 | 3300046460 | Ga0495638_0464316 | Ga0495638_0464316_176_559 | 127 |
| 591 | 3300046461 | Ga0495641_0005394 | Ga0495641_0005394_2435_2848 | 127 |
| 592 | 3300046462 | Ga0495651_0001404 | Ga0495651_0001404_12390_12803 | 127 |
| 593 | 3300046462 | Ga0495651_0010052 | Ga0495651_0010052_2367_2780 | 127 |
| 594 | 3300046472 | Ga0495580_0001708 | Ga0495580_0001708_17318_17701 | 127 |
| 595 | 3300046472 | Ga0495580_0032036 | Ga0495580_0032036_939_1352 | 127 |
| 596 | 3300046473 | Ga0495582_0096153 | Ga0495582_0096153_732_1145 | 127 |
| 597 | 3300046473 | Ga0495582_0100238 | Ga0495582_0100238_984_1367 | 127 |
| 598 | 3300046475 | Ga0495639_0005581 | Ga0495639_0005581_745_1158 | 127 |
| 599 | 3300046475 | Ga0495639_0009811 | Ga0495639_0009811_3533_3916 | 127 |
| 600 | 3300046476 | Ga0495662_0023307 | Ga0495662_0023307_376_789 | 127 |
| 601 | 3300046477 | Ga0495664_0035621 | Ga0495664_0035621_1950_2363 | 127 |
| 602 | 3300046477 | Ga0495664_0339728 | Ga0495664_0339728_70_480 | 127 |
| 603 | 3300046499 | Ga0495594_0052450 | Ga0495594_0052450_547_960 | 127 |
| 604 | 3300046516 | Ga0495628_0003204 | Ga0495628_0003204_1660_2070 | 127 |
| 605 | 3300046516 | Ga0495628_0026741 | Ga0495628_0026741_2522_2935 | 127 |
| 606 | 3300046516 | Ga0495628_0031003 | Ga0495628_0031003_3421_3834 | 127 |
| 607 | 3300046516 | Ga0495628_0335799 | Ga0495628_0335799_499_882 | 127 |
| 608 | 3300046517 | Ga0495630_0009427 | Ga0495630_0009427_4293_4706 | 127 |
| 609 | 3300046517 | Ga0495630_0180845 | Ga0495630_0180845_166_549 | 127 |
| 610 | 3300046517 | Ga0495630_0395570 | Ga0495630_0395570_289_699 | 127 |
| 611 | 3300046526 | Ga0495666_0023406 | Ga0495666_0023406_1247_1660 | 127 |
| 612 | 3300046526 | Ga0495666_0056142 | Ga0495666_0056142_310_693 | 127 |
| 613 | 3300046528 | Ga0495642_0034646 | Ga0495642_0034646_1539_1922 | 127 |
| 614 | 3300046529 | Ga0495652_0031108 | Ga0495652_0031108_2776_3189 | 127 |
| 615 | 3300046531 | Ga0495665_0015081 | Ga0495665_0015081_1365_1778 | 127 |
| 616 | 3300046533 | Ga0495640_0055508 | Ga0495640_0055508_1375_1788 | 127 |
| 617 | 3300046535 | Ga0495586_0012380 | Ga0495586_0012380_989_1372 | 127 |
| 618 | 3300046535 | Ga0495586_0123421 | Ga0495586_0123421_580_990 | 127 |
| 619 | 3300046536 | Ga0495587_0028384 | Ga0495587_0028384_2069_2482 | 127 |
| 620 | 3300046536 | Ga0495587_0104533 | Ga0495587_0104533_1056_1469 | 127 |
| 621 | 3300046543 | Ga0495645_0170458 | Ga0495645_0170458_581_994 | 127 |
| 622 | 3300046557 | Ga0495622_0019107 | Ga0495622_0019107_2551_2964 | 127 |
| 623 | 3300046559 | Ga0495667_0038003 | Ga0495667_0038003_1769_2182 | 127 |
| 624 | 3300046615 | Ga0495656_0251639 | Ga0495656_0251639_335_745 | 127 |
| 625 | 3300046642 | Ga0495634_0106415 | Ga0495634_0106415_922_1335 | 127 |
| 626 | 3300046642 | Ga0495634_0339215 | Ga0495634_0339215_422_832 | 127 |
| 627 | 3300046663 | Ga0495635_0023515 | Ga0495635_0023515_1543_1956 | 127 |
| 628 | 3300046674 | Ga0495588_0116767 | Ga0495588_0116767_24_407 | 127 |
| 629 | 3300046674 | Ga0495588_0184870 | Ga0495588_0184870_585_1040 | 127 |
| 630 | 3300046674 | Ga0495588_0305277 | Ga0495588_0305277_391_777 | 127 |
| 631 | 3300046675 | Ga0495657_0006684 | Ga0495657_0006684_2460_2873 | 127 |
| 632 | 3300046675 | Ga0495657_0193579 | Ga0495657_0193579_148_558 | 127 |
| 633 | 3300046678 | Ga0495599_0013413 | Ga0495599_0013413_2168_2581 | 127 |
| 634 | 3300046678 | Ga0495599_0040993 | Ga0495599_0040993_1770_2183 | 127 |
| 635 | 3300046680 | Ga0495646_0580384 | Ga0495646_0580384_92_502 | 127 |
| 636 | 3300046681 | Ga0495647_0012311 | Ga0495647_0012311_1132_1545 | 127 |
| 637 | 3300046681 | Ga0495647_0014994 | Ga0495647_0014994_1230_1613 | 127 |
| 638 | 3300046683 | Ga0495658_0018001 | Ga0495658_0018001_2504_2887 | 127 |
| 639 | 3300046684 | Ga0495669_0010717 | Ga0495669_0010717_2546_2929 | 127 |
| 640 | 3300046689 | Ga0495613_0103416 | Ga0495613_0103416_382_795 | 127 |
| 641 | 3300046690 | Ga0495624_0131103 | Ga0495624_0131103_280_735 | 127 |
| 642 | 3300046809 | Ga0495600_0124088 | Ga0495600_0124088_794_1207 | 127 |
| 643 | 3300047315 | Ga0495581_0120665 | Ga0495581_0120665_235_690 | 127 |
| 644 | 3300047315 | Ga0495581_0131825 | Ga0495581_0131825_183_566 | 127 |
| 645 | 3300047315 | Ga0495581_0296625 | Ga0495581_0296625_165_575 | 127 |
| 646 | 3300047317 | Ga0495604_0036544 | Ga0495604_0036544_820_1233 | 127 |
| 647 | 3300047319 | Ga0495674_0008256 | Ga0495674_0008256_2201_2614 | 127 |
| 648 | 3300047319 | Ga0495674_0388126 | Ga0495674_0388126_81_491 | 127 |
| 649 | 3300047319 | Ga0495674_0973660 | Ga0495674_0973660_49_459 | 127 |
| 650 | 3300047320 | Ga0495672_0100841 | Ga0495672_0100841_628_1035 | 127 |
| 651 | 3300047321 | Ga0495676_0045436 | Ga0495676_0045436_228_611 | 127 |
| 652 | 3300047444 | Ga0495675_0032218 | Ga0495675_0032218_453_866 | 127 |
| 653 | 3300047471 | Ga0495684_0014546 | Ga0495684_0014546_5171_5584 | 127 |
| 654 | 3300047471 | Ga0495684_0573479 | Ga0495684_0573479_54_437 | 127 |
| 655 | 3300047673 | Ga0495593_0444025 | Ga0495593_0444025_88_498 | 127 |
| 656 | 3300048088 | Ga0495602_0274070 | Ga0495602_0274070_513_923 | 127 |
| 657 | 3300048904 | Ga0496101_0176014 | Ga0496101_0176014_126_533 | 127 |
| 658 | 3300048904 | Ga0496101_0556566 | Ga0496101_0556566_215_625 | 127 |
| 659 | 3300048905 | Ga0496102_0094190 | Ga0496102_0094190_1260_1667 | 127 |
| 660 | 3300048906 | Ga0496103_0343859 | Ga0496103_0343859_318_728 | 127 |
| 661 | 3300048907 | Ga0496104_0074260 | Ga0496104_0074260_2310_2717 | 127 |
| 662 | 3300048907 | Ga0496104_0593112 | Ga0496104_0593112_26_436 | 127 |
| 663 | 3300048908 | Ga0496105_0021478 | Ga0496105_0021478_3089_3496 | 127 |
| 664 | 3300048909 | Ga0496106_0953898 | Ga0496106_0953898_165_575 | 127 |
| 665 | 3300048910 | Ga0496107_0424915 | Ga0496107_0424915_241_651 | 127 |
| 666 | 3300048911 | Ga0496108_0597465 | Ga0496108_0597465_175_582 | 127 |
| 667 | 3300048912 | Ga0496109_1259233 | Ga0496109_1259233_230_640 | 127 |
| 668 | 3300048912 | Ga0496109_1529927 | Ga0496109_1529927_117_524 | 127 |
| 669 | 3300048913 | Ga0496110_0609274 | Ga0496110_0609274_218_628 | 127 |
| 670 | 3300048913 | Ga0496110_0865028 | Ga0496110_0865028_66_473 | 127 |
| 671 | 3300048914 | Ga0496111_0256008 | Ga0496111_0256008_117_527 | 127 |
| 672 | 3300048914 | Ga0496111_1234901 | Ga0496111_1234901_61_468 | 127 |
| 673 | 3300048915 | Ga0496112_0000059 | Ga0496112_0000059_2602_3012 | 127 |
| 674 | 3300048915 | Ga0496112_0177400 | Ga0496112_0177400_1536_1946 | 127 |
| 675 | 3300048915 | Ga0496112_0249552 | Ga0496112_0249552_256_666 | 127 |
| 676 | 3300048916 | Ga0496113_0319654 | Ga0496113_0319654_140_550 | 127 |
| 677 | 3300048916 | Ga0496113_0726455 | Ga0496113_0726455_55_462 | 127 |
| 678 | 3300048918 | Ga0496115_0050450 | Ga0496115_0050450_1631_2086 | 127 |
| 679 | 3300048929 | Ga0496126_0033139 | Ga0496126_0033139_1629_2039 | 127 |
| 680 | 3300048929 | Ga0496126_0092888 | Ga0496126_0092888_86_496 | 127 |
| 681 | 3300048929 | Ga0496126_0147836 | Ga0496126_0147836_145_555 | 127 |
| 682 | 3300048929 | Ga0496126_0366482 | Ga0496126_0366482_107_517 | 127 |
| 683 | 3300048929 | Ga0496126_0788516 | Ga0496126_0788516_266_676 | 127 |
| 684 | 3300049568 | Ga0501031_0362604 | Ga0501031_0362604_139_522 | 127 |
| 685 | 3300049570 | Ga0501033_0048828 | Ga0501033_0048828_360_743 | 127 |
| 686 | 3300049572 | Ga0501036_0173317 | Ga0501036_0173317_404_787 | 127 |
| 687 | 3300049574 | Ga0501038_0065554 | Ga0501038_0065554_45_428 | 127 |
| 688 | 3300049575 | Ga0501039_0498230 | Ga0501039_0498230_536_919 | 127 |
| 689 | 3300049576 | Ga0501040_0009124 | Ga0501040_0009124_1239_1622 | 127 |
| 690 | 3300049576 | Ga0501040_0172474 | Ga0501040_0172474_956_1339 | 127 |
| 691 | 3300049577 | Ga0501041_0014220 | Ga0501041_0014220_2988_3371 | 127 |
| 692 | 3300049578 | Ga0501042_0463972 | Ga0501042_0463972_194_580 | 127 |
| 693 | 3300049581 | Ga0501047_0932578 | Ga0501047_0932578_174_602 | 127 |
| 694 | 3300049582 | Ga0501048_0082066 | Ga0501048_0082066_71_454 | 127 |
| 695 | 3300049587 | Ga0501071_0854603 | Ga0501071_0854603_231_614 | 127 |
| 696 | 3300049588 | Ga0501072_0433320 | Ga0501072_0433320_507_890 | 127 |
| 697 | 3300049590 | Ga0501074_0702335 | Ga0501074_0702335_297_680 | 127 |
| 698 | 3300049592 | Ga0501076_0615668 | Ga0501076_0615668_464_847 | 127 |
| 699 | 3300049593 | Ga0501077_0229060 | Ga0501077_0229060_422_805 | 127 |
| 700 | 3300049667 | Ga0501230_098378 | Ga0501230_098378_41_424 | 127 |
| 701 | 3300049741 | Ga0501079_0866955 | Ga0501079_0866955_192_575 | 127 |
| 702 | 3300049742 | Ga0501080_0393830 | Ga0501080_0393830_434_817 | 127 |
| 703 | 3300049822 | Ga0501035_0368522 | Ga0501035_0368522_108_491 | 127 |
| 704 | 3300049824 | Ga0501045_0835738 | Ga0501045_0835738_129_512 | 127 |
| 705 | 3300050492 | nmdc:mga0yw44_693589_c1 | nmdc:mga0yw44_693589_c1_163_573 | 127 |
| 706 | 3300050507 | nmdc:mga05p37_1864800_c1 | nmdc:mga05p37_1864800_c1_76_462 | 127 |
| 707 | 3300050507 | nmdc:mga05p37_2045_c1 | nmdc:mga05p37_2045_c1_19838_20221 | 127 |
| 708 | 3300050507 | nmdc:mga05p37_378695_c1 | nmdc:mga05p37_378695_c1_280_687 | 127 |
| 709 | 3300050507 | nmdc:mga05p37_379757_c1 | nmdc:mga05p37_379757_c1_657_1040 | 127 |
| 710 | 3300050508 | nmdc:mga09592_1655_c1 | nmdc:mga09592_1655_c1_6804_7187 | 127 |
| 711 | 3300050508 | nmdc:mga09592_200507_c1 | nmdc:mga09592_200507_c1_876_1283 | 127 |
| 712 | 3300050508 | nmdc:mga09592_284247_c1 | nmdc:mga09592_284247_c1_791_1177 | 127 |
| 713 | 3300050509 | nmdc:mga0qj67_137773_c1 | nmdc:mga0qj67_137773_c1_815_1201 | 127 |
| 714 | 3300050509 | nmdc:mga0qj67_14040_c1 | nmdc:mga0qj67_14040_c1_2266_2649 | 127 |
| 715 | 3300050509 | nmdc:mga0qj67_202389_c1 | nmdc:mga0qj67_202389_c1_1205_1588 | 127 |
| 716 | 3300050509 | nmdc:mga0qj67_452188_c1 | nmdc:mga0qj67_452188_c1_299_685 | 127 |
| 717 | 3300050509 | nmdc:mga0qj67_526303_c1 | nmdc:mga0qj67_526303_c1_184_567 | 127 |
| 718 | 3300050510 | nmdc:mga06r32_157084_c1 | nmdc:mga06r32_157084_c1_572_958 | 127 |
| 719 | 3300050510 | nmdc:mga06r32_1622773_c1 | nmdc:mga06r32_1622773_c1_101_484 | 127 |
| 720 | 3300050511 | nmdc:mga08y16_133287_c1 | nmdc:mga08y16_133287_c1_38_421 | 127 |
| 721 | 3300050511 | nmdc:mga08y16_4849_c1 | nmdc:mga08y16_4849_c1_8724_9107 | 127 |
| 722 | 3300050511 | nmdc:mga08y16_70976_c1 | nmdc:mga08y16_70976_c1_1384_1767 | 127 |
| 723 | 3300050511 | nmdc:mga08y16_77092_c1 | nmdc:mga08y16_77092_c1_2922_3308 | 127 |
| 724 | 3300050512 | nmdc:mga0n895_39500_c1 | nmdc:mga0n895_39500_c1_284_667 | 127 |
| 725 | 3300050513 | nmdc:mga0rr50_1178798_c1 | nmdc:mga0rr50_1178798_c1_199_582 | 127 |
| 726 | 3300050513 | nmdc:mga0rr50_126820_c1 | nmdc:mga0rr50_126820_c1_99_482 | 127 |
| 727 | 3300050513 | nmdc:mga0rr50_1406880_c1 | nmdc:mga0rr50_1406880_c1_91_501 | 127 |
| 728 | 3300050513 | nmdc:mga0rr50_545908_c1 | nmdc:mga0rr50_545908_c1_502_888 | 127 |
| 729 | 3300050513 | nmdc:mga0rr50_8370_c1 | nmdc:mga0rr50_8370_c1_3334_3717 | 127 |
| 730 | 3300050514 | nmdc:mga08x19_122448_c1 | nmdc:mga08x19_122448_c1_547_957 | 127 |
| 731 | 3300050514 | nmdc:mga08x19_3563_c1 | nmdc:mga08x19_3563_c1_855_1238 | 127 |
| 732 | 3300050514 | nmdc:mga08x19_3851_c1 | nmdc:mga08x19_3851_c1_5096_5479 | 127 |
| 733 | 3300050515 | nmdc:mga0a205_3207_c1 | nmdc:mga0a205_3207_c1_7938_8321 | 127 |
| 734 | 3300050515 | nmdc:mga0a205_627150_c1 | nmdc:mga0a205_627150_c1_138_521 | 127 |
| 735 | 3300053077 | Ga0495601_0002510 | Ga0495601_0002510_2265_2675 | 127 |
| 736 | 3300053078 | Ga0495612_0042322 | Ga0495612_0042322_549_962 | 127 |
| 737 | 3300053085 | Ga0495619_0005618 | Ga0495619_0005618_1438_1851 | 127 |
| 738 | 3300053085 | Ga0495619_0277934 | Ga0495619_0277934_112_525 | 127 |
| 739 | 3300054114 | Ga0501084_0171301 | Ga0501084_0171301_1346_1729 | 127 |
| 740 | 3300054114 | Ga0501084_1177843 | Ga0501084_1177843_221_604 | 127 |
| 741 | 3300059426 | Ga0590077_029822 | Ga0590077_029822_123_506 | 127 |
| 742 | 3300060353 | Ga0501082_0827153 | Ga0501082_0827153_263_670 | 127 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5v4f-assembly1.cif.gz_A | crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis | 0.8702 | 4 | 126 |
| 5v4f-assembly1.cif.gz_A | crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis | 0.8445 | 4 | 126 |
| 3lyb-assembly1.cif.gz_D | structure of putative endoribonuclease(kp1_3112) from klebsiella pneumoniae | 0.8212 | 26 | 126 |
| 5hp7-assembly1.cif.gz_A | crystal structures of rida in the apo form | 0.8208 | 26 | 126 |
| 3lyb-assembly1.cif.gz_C | structure of putative endoribonuclease(kp1_3112) from klebsiella pneumoniae | 0.8178 | 26 | 126 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q8MRI4_457_563_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.8433 | 26 | 126 | 3.30.1330.40 |
| af_Q9USQ7_300_402_3.30.1330.40 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.8314 | 26 | 125 | 3.30.1330.40 |
| 3k12B01 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.8219 | 26 | 126 | 3.30.1330.40 |
| 5hp8A00 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.8187 | 26 | 126 | 3.30.1330.40 |
| 3k12B01 | Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like | 0.807 | 26 | 126 | 3.30.1330.40 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537L500-F1-model_v4 | RidA family protein | 0.9908 | 1 | 126 |
GO:0005829
GO:0019239 |
| AF-F8J6N8-F1-model_v4 | Endoribonuclease L-PSP | 0.9869 | 1 | 126 |
GO:0005829
GO:0019239 |
| AF-A0A537L500-F1-model_v4 | RidA family protein | 0.983 | 1 | 126 |
GO:0005829
GO:0019239 |
| AF-F8J6N8-F1-model_v4 | Endoribonuclease L-PSP | 0.9791 | 1 | 126 |
GO:0005829
GO:0019239 |
| AF-A0A435IH74-F1-model_v4 | deleted | 0.9754 | 16 | 126 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar