F478551

General Info

Members Datasets Scaffolds Average Seq Length
740 470 1480 178

Family's Representative Sequence

Representative Sequence 3300048924|Ga0496121_0020930|Ga0496121_0020930_1023_1661
Length 212
Sequence LPDHSSAGADLPGQIFAKGPSLMGRSTKQHRPTAGRNAPVAAGPSATGLRRLAAACLALAAVSAPGAAYAQGAVRSVHGDWQIRCDTPPGAQAEQCALIQSVVAEDRSNAGLTVIVLKTADQKSKLMRVVAPLGVLLPSGLGLKLDNVDVGRAGFVRCLPNGCVAEVVMDDKLLAQLRTAKTATFIIFETPEEGIGFPLSLNGIGEGYDKLP

Samples

Sample ID Description Type Environment
1 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
9 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
32 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
48 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
59 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
60 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
61 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
62 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
63 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
64 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
65 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
66 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
67 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
68 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
69 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
74 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
75 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
77 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
78 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
79 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
80 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
82 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
83 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
85 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
86 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
89 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
92 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
93 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
94 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
95 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
96 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
97 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
98 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
99 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
100 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
101 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
104 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
105 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
155 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
156 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
157 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
162 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
163 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
164 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
165 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
166 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
167 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
168 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
169 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
170 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
171 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
172 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
173 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
174 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
175 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
178 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
179 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
180 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
181 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
182 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
183 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
184 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
185 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
186 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
187 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
188 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
189 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
190 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
191 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
192 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
193 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
194 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
197 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
201 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
202 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
205 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
206 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
207 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
208 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
209 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
210 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
211 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
212 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
213 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
214 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
215 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
216 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
217 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
218 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
221 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
222 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
223 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
224 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
225 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
226 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
227 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
228 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
229 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
230 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
231 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
232 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
233 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
234 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
235 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
236 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
237 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
238 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
239 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
240 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
241 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
242 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
245 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
246 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
247 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
248 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
249 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
250 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
251 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
252 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
253 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
254 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
257 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
264 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
265 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
266 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
267 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
268 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
269 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
270 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
271 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
272 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
273 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
274 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
275 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
276 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
277 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
281 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
282 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
283 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
284 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
285 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
286 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
287 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
288 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
289 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
290 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
291 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
292 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
293 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
294 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
295 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
296 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
297 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
298 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
299 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
300 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
301 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
302 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
303 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
306 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
307 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
308 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
312 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
313 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
314 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
315 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
316 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
317 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
319 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
320 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
321 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
322 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
323 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
324 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
325 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
326 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
327 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
328 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
329 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
330 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
331 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
332 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
333 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
334 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
335 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
336 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
337 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
338 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
339 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
340 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
341 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
342 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
343 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
344 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
345 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
346 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
347 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
348 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
349 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
350 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
351 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
352 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
353 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
354 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
355 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
356 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
357 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
358 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
359 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
360 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
361 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
362 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
363 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
364 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
365 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
366 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
367 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
368 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
369 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
370 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
371 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
372 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
373 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
374 2643221651 Afipia sp. Root123D2 Isolate Unclassified
375 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
376 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
377 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
378 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
379 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
380 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
381 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
382 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
383 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
384 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
385 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
386 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
387 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
388 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
389 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
390 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
391 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
392 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
393 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
394 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
395 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
396 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
397 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
398 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
399 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
400 2906610324
401 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
402 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
403 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
404 2922368715
405 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
406 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
407 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
408 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
409 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
410 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
411 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
412 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
413 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
414 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
415 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
416 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
417 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
418 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
419 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
420 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
421 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
422 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
423 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
424 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
425 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
426 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
427 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
428 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
429 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
430 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
431 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
432 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
433 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
434 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
435 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
436 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
437 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
438 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
439 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
440 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
441 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
442 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
443 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
444 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
445 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
446 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
447 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
448 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
449 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
450 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
451 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
452 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
453 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
454 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
455 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
456 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
457 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
458 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
459 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
460 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
461 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
462 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
463 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
464 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
465 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
466 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
467 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
468 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
469 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
470 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.69
Metatranscriptomes 0.14
Isolates 15.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.86
Nodule 12.43
Rhizoplane 6.49
Rhizosphere 60.54
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496121_0020930 3300048924 Bacteria 6438
2 JGI24739J22299_10038604 3300001989 Bacteria 1604
3 JGI24737J22298_10137658 3300001990 Bacteria 721
4 JGI24034J26672_10047389 3300002239 Bacteria 733
5 JGI25406J46586_10000063 3300003203 Bacteria 49219
6 JGI25160J50197_1003914 3300003354 Bacteria 6516
7 JGI25160J50197_1018061 3300003354 Bacteria 2211
8 JGI25404J52841_10003528 3300003659 Bacteria 3100
9 Ga0055526_1011339 3300003771 Bacteria 4025
10 Ga0065165_1002895 3300005262 Bacteria 13175
11 Ga0070658_10047721 3300005327 Bacteria 3465
12 Ga0070658_10208537 3300005327 Bacteria 1650
13 Ga0070658_10515322 3300005327 Bacteria 1034
14 Ga0070670_100023652 3300005331 Bacteria 5288
15 Ga0068869_100159530 3300005334 Bacteria 1754
16 Ga0068869_100483201 3300005334 Bacteria 1032
17 Ga0070680_100089742 3300005336 Bacteria 2543
18 Ga0070682_100183769 3300005337 Bacteria 1462
19 Ga0068868_100156062 3300005338 Bacteria 1882
20 Ga0068868_100233549 3300005338 Bacteria 1543
21 Ga0068868_100576229 3300005338 Bacteria 995
22 Ga0070660_100042497 3300005339 Bacteria 3469
23 Ga0070660_100215651 3300005339 Bacteria 1559
24 Ga0070689_100045724 3300005340 Bacteria 3371
25 Ga0070689_100047229 3300005340 Bacteria 3319
26 Ga0070689_100085659 3300005340 Bacteria 2478
27 Ga0070689_100243956 3300005340 Bacteria 1480
28 Ga0070689_100536341 3300005340 Bacteria 1007
29 Ga0070691_10149423 3300005341 Bacteria 1197
30 Ga0070661_100063389 3300005344 Bacteria 2715
31 Ga0070661_100099459 3300005344 Bacteria 2161
32 Ga0070668_100131982 3300005347 Bacteria 2005
33 Ga0070668_100352215 3300005347 Bacteria 1246
34 Ga0070675_101290533 3300005354 Bacteria 673
35 Ga0070671_100002663 3300005355 Bacteria 13839
36 Ga0070671_100022035 3300005355 Bacteria 5204
37 Ga0070674_100046286 3300005356 Bacteria 2975
38 Ga0070673_100001059 3300005364 Bacteria 15672
39 Ga0070673_100404250 3300005364 Bacteria 1222
40 Ga0070673_100908879 3300005364 Bacteria 817
41 Ga0070688_100096123 3300005365 Bacteria 1945
42 Ga0070688_100737572 3300005365 Bacteria 766
43 Ga0070659_100088617 3300005366 Bacteria 2478
44 Ga0070659_100226724 3300005366 Bacteria 1543
45 Ga0070659_100250263 3300005366 Bacteria 1468
46 Ga0070667_100563394 3300005367 Bacteria 1048
47 Ga0070709_10026613 3300005434 Bacteria 3430
48 Ga0070714_100017940 3300005435 Bacteria 5739
49 Ga0070714_100214333 3300005435 Bacteria 1767
50 Ga0070713_100756849 3300005436 Bacteria 930
51 Ga0070711_100130217 3300005439 Bacteria 1873
52 Ga0070705_100327388 3300005440 Bacteria 1109
53 Ga0070700_100164012 3300005441 Bacteria 1532
54 Ga0070663_100140786 3300005455 Bacteria 1841
55 Ga0070663_100183465 3300005455 Bacteria 1625
56 Ga0070663_100239545 3300005455 Bacteria 1431
57 Ga0070663_100377594 3300005455 Bacteria 1154
58 Ga0070678_100173902 3300005456 Bacteria 1756
59 Ga0070678_100836460 3300005456 Bacteria 838
60 Ga0070662_100082632 3300005457 Bacteria 2395
61 Ga0070662_100104488 3300005457 Bacteria 2149
62 Ga0070681_10006243 3300005458 Bacteria 11591
63 Ga0068867_100155475 3300005459 Bacteria 1800
64 Ga0070706_100201134 3300005467 Bacteria 1861
65 Ga0068853_100007760 3300005539 Bacteria 8605
66 Ga0068853_100086409 3300005539 Bacteria 2750
67 Ga0068853_100673287 3300005539 Bacteria 986
68 Ga0070693_100050708 3300005547 Bacteria 2373
69 Ga0070665_100124552 3300005548 Bacteria 2579
70 Ga0070665_100225647 3300005548 Bacteria 1873
71 Ga0070665_100417509 3300005548 Bacteria 1350
72 Ga0070665_100548965 3300005548 Bacteria 1168
73 Ga0070665_101191018 3300005548 Bacteria 773
74 Ga0070664_100292604 3300005564 Bacteria 1470
75 Ga0070664_100936413 3300005564 Bacteria 813
76 Ga0068857_100408926 3300005577 Bacteria 1263
77 Ga0068856_100185263 3300005614 Bacteria 2095
78 Ga0068856_100348457 3300005614 Bacteria 1499
79 Ga0070702_100187724 3300005615 Bacteria 1358
80 Ga0068852_100010820 3300005616 Bacteria 6834
81 Ga0068852_100486195 3300005616 Bacteria 1227
82 Ga0068852_100507518 3300005616 Bacteria 1202
83 Ga0068852_100945719 3300005616 Bacteria 880
84 Ga0068859_100023026 3300005617 Bacteria 6247
85 Ga0068866_10111415 3300005718 Bacteria 1527
86 Ga0068861_100088464 3300005719 Bacteria 2439
87 Ga0068863_100280055 3300005841 Bacteria 1615
88 Ga0068858_100110662 3300005842 Bacteria 2564
89 Ga0068860_100851199 3300005843 Bacteria 926
90 Ga0068862_100207623 3300005844 Bacteria 1768
91 Ga0068862_100460353 3300005844 Bacteria 1201
92 Ga0068862_100544571 3300005844 Bacteria 1107
93 Ga0081455_10051861 3300005937 Bacteria 3516
94 Ga0081538_10019361 3300005981 Bacteria 5062
95 Ga0081538_10038844 3300005981 Bacteria 3062
96 Ga0081538_10086706 3300005981 Bacteria 1638
97 Ga0081540_1002214 3300005983 Bacteria 16042
98 Ga0081540_1183185 3300005983 Bacteria 781
99 Ga0081539_10000229 3300005985 Bacteria 131455
100 Ga0081539_10023917 3300005985 Bacteria 3984
101 Ga0070717_10204695 3300006028 Bacteria 1730
102 Ga0070717_10211384 3300006028 Bacteria 1702
103 Ga0075365_10090648 3300006038 Bacteria 2082
104 Ga0075365_10284158 3300006038 Bacteria 1164
105 Ga0075368_10042305 3300006042 Bacteria 1792
106 Ga0075368_10287341 3300006042 Bacteria 708
107 Ga0075363_100338258 3300006048 Bacteria 877
108 Ga0075364_10041269 3300006051 Bacteria 2996
109 Ga0075364_10049976 3300006051 Bacteria 2728
110 Ga0070715_10227914 3300006163 Bacteria 962
111 Ga0070716_100416666 3300006173 Bacteria 970
112 Ga0070712_100057650 3300006175 Bacteria 2729
113 Ga0075362_10046435 3300006177 Bacteria 1932
114 Ga0075367_10028172 3300006178 Bacteria 3202
115 Ga0075367_10034085 3300006178 Bacteria 2938
116 Ga0075367_10069372 3300006178 Bacteria 2116
117 Ga0075367_10085881 3300006178 Bacteria 1909
118 Ga0075367_10184009 3300006178 Bacteria 1303
119 Ga0075369_10020499 3300006186 Bacteria 2707
120 Ga0075369_10081386 3300006186 Bacteria 1436
121 Ga0075369_10114669 3300006186 Bacteria 1216
122 Ga0075369_10202757 3300006186 Bacteria 915
123 Ga0075366_10058917 3300006195 Bacteria 2281
124 Ga0075366_10321837 3300006195 Bacteria 947
125 Ga0097621_100127950 3300006237 Bacteria 2159
126 Ga0068871_100759734 3300006358 Bacteria 892
127 Ga0068871_100997735 3300006358 Bacteria 780
128 Ga0068865_100242198 3300006881 Bacteria 1420
129 Ga0075436_100057699 3300006914 Bacteria 2681
130 Ga0097620_100023027 3300006931 Bacteria 6247
131 Ga0099824_1047935 3300006942 Bacteria 844
132 Ga0099823_1048989 3300006944 Bacteria 2662
133 Ga0099794_10024063 3300007265 Bacteria 2792
134 Ga0099794_10155557 3300007265 Bacteria 1162
135 Ga0099795_10000668 3300007788 Bacteria 6591
136 Ga0099795_10126062 3300007788 Bacteria 1029
137 Ga0111539_10587725 3300009094 Bacteria 1297
138 Ga0105245_10057387 3300009098 Bacteria 3502
139 Ga0105247_10233409 3300009101 Bacteria 1250
140 Ga0114129_10652479 3300009147 Bacteria 1358
141 Ga0105243_10165378 3300009148 Bacteria 1911
142 Ga0105241_10338164 3300009174 Bacteria 1303
143 Ga0105237_10209223 3300009545 Bacteria 1951
144 Ga0105237_10442343 3300009545 Bacteria 1306
145 Ga0105237_10608552 3300009545 Bacteria 1100
146 Ga0105237_10707988 3300009545 Bacteria 1013
147 Ga0105249_10152135 3300009553 Bacteria 2228
148 Ga0099796_10000771 3300010159 Bacteria 5762
149 Ga0105239_10087915 3300010375 Bacteria 3426
150 Ga0105239_10091201 3300010375 Bacteria 3362
151 Ga0105239_10096232 3300010375 Bacteria 3271
152 Ga0105239_10307248 3300010375 Bacteria 1787
153 Ga0105239_11739311 3300010375 Bacteria 722
154 Ga0157373_10031988 3300013100 Bacteria 3788
155 Ga0157374_10679781 3300013296 Bacteria 1042
156 Ga0157378_10342094 3300013297 Bacteria 1459
157 Ga0157378_10375375 3300013297 Bacteria 1395
158 Ga0163162_10386420 3300013306 Bacteria 1533
159 Ga0163162_12192197 3300013306 Bacteria 634
160 Ga0163163_10100908 3300014325 Bacteria 2908
161 Ga0163163_10231266 3300014325 Bacteria 1898
162 Ga0163163_10430329 3300014325 Bacteria 1379
163 Ga0157380_10241441 3300014326 Bacteria 1629
164 Ga0157377_10124011 3300014745 Bacteria 1569
165 Ga0157376_10095159 3300014969 Bacteria 2590
166 Ga0157376_10281519 3300014969 Bacteria 1566
167 Ga0163161_10079772 3300017792 Bacteria 2408
168 Ga0163161_10112019 3300017792 Bacteria 2041
169 Ga0163161_10188180 3300017792 Bacteria 1586
170 Ga0213876_10131975 3300021384 Bacteria 1328
171 Ga0209677_103776 3300025253 Bacteria 4710
172 Ga0209455_1016609 3300025272 Bacteria 1576
173 Ga0209564_1006792 3300025295 Bacteria 6052
174 Ga0209758_1017896 3300025297 Bacteria 3501
175 Ga0209758_1021687 3300025297 Bacteria 2984
176 Ga0209758_1048939 3300025297 Bacteria 1497
177 Ga0207426_1000905 3300025302 Bacteria 29814
178 Ga0207426_1001164 3300025302 Bacteria 23548
179 Ga0207426_1001422 3300025302 Bacteria 19986
180 Ga0207697_10015107 3300025315 Bacteria 3193
181 Ga0207697_10071931 3300025315 Bacteria 1449
182 Ga0207697_10222323 3300025315 Bacteria 833
183 Ga0207692_10579830 3300025898 Bacteria 719
184 Ga0207692_10582953 3300025898 Bacteria 717
185 Ga0207710_10075580 3300025900 Bacteria 1553
186 Ga0207688_10043696 3300025901 Bacteria 2495
187 Ga0207680_10075611 3300025903 Bacteria 2101
188 Ga0207647_10029503 3300025904 Bacteria 3550
189 Ga0207647_10162527 3300025904 Bacteria 1302
190 Ga0207647_10199757 3300025904 Bacteria 1157
191 Ga0207685_10119180 3300025905 Bacteria 1156
192 Ga0207699_10037773 3300025906 Bacteria 2763
193 Ga0207699_10602724 3300025906 Bacteria 800
194 Ga0207645_10027318 3300025907 Bacteria 3686
195 Ga0207643_10133585 3300025908 Bacteria 1478
196 Ga0207643_10186046 3300025908 Bacteria 1259
197 Ga0207705_10015453 3300025909 Bacteria 5478
198 Ga0207705_10050928 3300025909 Bacteria 2981
199 Ga0207705_10153584 3300025909 Bacteria 1726
200 Ga0207705_10257635 3300025909 Bacteria 1331
201 Ga0207654_10058822 3300025911 Bacteria 2239
202 Ga0207707_10107117 3300025912 Bacteria 2443
203 Ga0207695_10000059 3300025913 Bacteria 363920
204 Ga0207695_10152947 3300025913 Bacteria 2245
205 Ga0207671_10038728 3300025914 Bacteria 3533
206 Ga0207671_10133859 3300025914 Bacteria 1905
207 Ga0207693_10003714 3300025915 Bacteria 13016
208 Ga0207693_10054658 3300025915 Bacteria 3132
209 Ga0207663_10018774 3300025916 Bacteria 3883
210 Ga0207663_10081948 3300025916 Bacteria 2115
211 Ga0207663_10106481 3300025916 Bacteria 1895
212 Ga0207662_10289094 3300025918 Bacteria 1087
213 Ga0207657_10067150 3300025919 Bacteria 3050
214 Ga0207657_10278747 3300025919 Bacteria 1328
215 Ga0207657_10318100 3300025919 Bacteria 1231
216 Ga0207687_10027547 3300025927 Bacteria 3814
217 Ga0207687_10076713 3300025927 Bacteria 2401
218 Ga0207700_10118412 3300025928 Bacteria 2143
219 Ga0207700_10905127 3300025928 Bacteria 789
220 Ga0207664_10128544 3300025929 Bacteria 2130
221 Ga0207664_11020549 3300025929 Bacteria 741
222 Ga0207644_10005174 3300025931 Bacteria 8519
223 Ga0207644_10265659 3300025931 Bacteria 1373
224 Ga0207690_10716078 3300025932 Bacteria 823
225 Ga0207706_10045258 3300025933 Bacteria 3900
226 Ga0207706_10064007 3300025933 Bacteria 3238
227 Ga0207686_10401743 3300025934 Bacteria 1044
228 Ga0207709_10114312 3300025935 Bacteria 1811
229 Ga0207670_10026594 3300025936 Bacteria 3648
230 Ga0207670_10085153 3300025936 Bacteria 2221
231 Ga0207669_10061641 3300025937 Bacteria 2306
232 Ga0207704_10081230 3300025938 Bacteria 2096
233 Ga0207704_10441286 3300025938 Bacteria 1037
234 Ga0207665_10250785 3300025939 Bacteria 1308
235 Ga0207691_10311309 3300025940 Bacteria 1351
236 Ga0207711_10328191 3300025941 Bacteria 1415
237 Ga0207679_10052425 3300025945 Bacteria 2992
238 Ga0207679_10210079 3300025945 Bacteria 1631
239 Ga0207667_10154622 3300025949 Bacteria 2360
240 Ga0207667_10266349 3300025949 Bacteria 1752
241 Ga0207667_10414719 3300025949 Bacteria 1370
242 Ga0207651_10006538 3300025960 Bacteria 6116
243 Ga0207651_10248871 3300025960 Bacteria 1453
244 Ga0207668_10081110 3300025972 Bacteria 2352
245 Ga0207668_10090654 3300025972 Bacteria 2244
246 Ga0207668_10105126 3300025972 Bacteria 2106
247 Ga0207668_10178759 3300025972 Bacteria 1671
248 Ga0207668_10673037 3300025972 Bacteria 907
249 Ga0207658_10672559 3300025986 Bacteria 934
250 Ga0207658_11172387 3300025986 Bacteria 702
251 Ga0207677_10055825 3300026023 Bacteria 2703
252 Ga0207677_10184825 3300026023 Bacteria 1643
253 Ga0207677_10562980 3300026023 Bacteria 995
254 Ga0207703_10108810 3300026035 Bacteria 2361
255 Ga0207703_10200548 3300026035 Bacteria 1773
256 Ga0207678_10042075 3300026067 Bacteria 3960
257 Ga0207678_10051479 3300026067 Bacteria 3555
258 Ga0207678_10317259 3300026067 Bacteria 1341
259 Ga0207708_10123408 3300026075 Bacteria 2020
260 Ga0207708_10200184 3300026075 Bacteria 1593
261 Ga0207702_10235312 3300026078 Bacteria 1713
262 Ga0207648_10140618 3300026089 Bacteria 2127
263 Ga0207676_10493598 3300026095 Bacteria 1161
264 Ga0207674_10032546 3300026116 Bacteria 5469
265 Ga0207674_10075935 3300026116 Bacteria 3369
266 Ga0207675_100037344 3300026118 Bacteria 4531
267 Ga0207675_100313588 3300026118 Bacteria 1530
268 Ga0207683_10183250 3300026121 Bacteria 1899
269 Ga0207683_10446136 3300026121 Bacteria 1193
270 Ga0207698_10180090 3300026142 Bacteria 1871
271 Ga0207698_11113629 3300026142 Bacteria 802
272 Ga0209389_1000012 3300027296 Bacteria 213243
273 Ga0209489_100019 3300027361 Bacteria 213243
274 Ga0209700_100018 3300027363 Bacteria 238200
275 Ga0209179_1005473 3300027512 Bacteria 1990
276 Ga0209179_1056618 3300027512 Bacteria 847
277 Ga0209588_1023538 3300027671 Bacteria 1942
278 Ga0268266_10011827 3300028379 Bacteria 7564
279 Ga0268266_10054804 3300028379 Bacteria 3427
280 Ga0268266_10117604 3300028379 Bacteria 2362
281 Ga0268266_10162167 3300028379 Bacteria 2023
282 Ga0268266_10724189 3300028379 Bacteria 959
283 Ga0268266_11501032 3300028379 Bacteria 649
284 Ga0268265_10050254 3300028380 Bacteria 3140
285 Ga0268265_10241838 3300028380 Bacteria 1593
286 Ga0268265_10350639 3300028380 Bacteria 1347
287 Ga0307515_10164083 3300028794 Bacteria 2249
288 Ga0307515_10294806 3300028794 Bacteria 1313
289 Ga0265760_10077114 3300031090 Bacteria 1028
290 Ga0265330_10032518 3300031235 Bacteria 2337
291 Ga0265325_10174139 3300031241 Bacteria 1005
292 Ga0265325_10412017 3300031241 Bacteria 591
293 Ga0265340_10000546 3300031247 Bacteria 20836
294 Ga0265340_10018085 3300031247 Bacteria 3640
295 Ga0265339_10005522 3300031249 Bacteria 8416
296 Ga0265331_10054467 3300031250 Bacteria 1905
297 Ga0265316_10112005 3300031344 Bacteria 2066
298 Ga0265316_10372258 3300031344 Bacteria 1031
299 Ga0307509_10116773 3300031507 Bacteria 2657
300 Ga0307408_100568091 3300031548 Bacteria 1003
301 Ga0307408_101271146 3300031548 Bacteria 689
302 Ga0265313_10010184 3300031595 Bacteria 5996
303 Ga0307508_10230776 3300031616 Bacteria 1449
304 Ga0307508_10462365 3300031616 Bacteria 862
305 Ga0265314_10141437 3300031711 Bacteria 1487
306 Ga0265342_10255400 3300031712 Bacteria 934
307 Ga0316578_10079539 3300031728 Bacteria 1949
308 Ga0307405_10133628 3300031731 Bacteria 1719
309 Ga0307405_10420430 3300031731 Bacteria 1052
310 Ga0307518_10231873 3300031838 Bacteria 1194
311 Ga0307407_10666328 3300031903 Bacteria 781
312 Ga0307412_10515388 3300031911 Bacteria 998
313 Ga0307409_101500880 3300031995 Bacteria 701
314 Ga0307409_101888536 3300031995 Bacteria 627
315 Ga0307415_100962706 3300032126 Bacteria 791
316 Ga0307510_10013788 3300033180 Bacteria 9582
317 Ga0307510_10033275 3300033180 Bacteria 5793
318 Ga0307510_10101242 3300033180 Bacteria 2669
319 Ga0307510_10194874 3300033180 Bacteria 1569
320 Ga0373923_0022541 3300035111 Bacteria 2471
321 Ga0373936_0012782 3300035113 Bacteria 3199
322 Ga0373953_0199399 3300035117 Bacteria 865
323 Ga0373953_0215441 3300035117 Bacteria 831
324 Ga0373954_0009683 3300035118 Bacteria 4243
325 Ga0373957_0166731 3300035120 Bacteria 909
326 Ga0373943_0052647 3300035170 Bacteria 2007
327 Ga0373946_0007578 3300035171 Bacteria 3972
328 Ga0373955_0184265 3300035172 Bacteria 1239
329 Ga0373924_0014981 3300035410 Bacteria 2938
330 Ga0373935_0008926 3300035692 Bacteria 5999
331 Ga0373927_0134392 3300035695 Bacteria 1616
332 Ga0373927_0187881 3300035695 Bacteria 1355
333 Ga0373947_0053181 3300035725 Bacteria 2441
334 Ga0373947_0064904 3300035725 Bacteria 2226
335 Ga0373947_0096380 3300035725 Bacteria 1852
336 Ga0373937_0061071 3300036401 Bacteria 3464
337 Ga0373937_0475015 3300036401 Bacteria 1187
338 Ga0373937_0603787 3300036401 Bacteria 1042
339 Ga0373925_0138987 3300037068 Bacteria 1900
340 Ga0373925_0149464 3300037068 Bacteria 1833
341 Ga0373925_0367739 3300037068 Bacteria 1170
342 Ga0395899_0237400 3300037312 Bacteria 1256
343 Ga0395900_0001392 3300037418 Bacteria 28939
344 Ga0395898_0022124 3300037466 Bacteria 6441
345 Ga0395905_0381177 3300037471 Bacteria 1304
346 Ga0436364_0657395 3300037853 Bacteria 4336
347 Ga0395901_0080351 3300038443 Bacteria 3404
348 Ga0395901_0228161 3300038443 Bacteria 1945
349 Ga0436365_0978755 3300039437 Bacteria 1645
350 Ga0436365_1371253 3300039437 Bacteria 611
351 Ga0436365_1481893 3300039437 Bacteria 780
352 Ga0436365_1865997 3300039437 Bacteria 880
353 Ga0436360_0902241 3300039438 Bacteria 632
354 Ga0436360_1239649 3300039438 Bacteria 905
355 Ga0436361_1141498 3300039447 Bacteria 1467
356 Ga0451793_0049426 3300041452 Bacteria 712
357 Ga0451849_0560020 3300041505 Bacteria 756
358 Ga0451843_0743394 3300041509 Bacteria 706
359 Ga0439431_0057577 3300041997 Bacteria 1018
360 Ga0466970_0269642 3300044765 Bacteria 956
361 Ga0466957_0963261 3300044842 Bacteria 612
362 Ga0495592_0051565 3300046454 Bacteria 3056
363 Ga0495592_0068416 3300046454 Bacteria 2592
364 Ga0495592_0282133 3300046454 Bacteria 1086
365 Ga0495603_0040310 3300046455 Bacteria 2795
366 Ga0495590_0068990 3300046457 Bacteria 1239
367 Ga0495638_0022483 3300046460 Bacteria 4138
368 Ga0495638_0191031 3300046460 Bacteria 1162
369 Ga0495641_0050183 3300046461 Bacteria 1908
370 Ga0495641_0111150 3300046461 Bacteria 1223
371 Ga0495651_0029063 3300046462 Bacteria 4311
372 Ga0495651_0043877 3300046462 Bacteria 3468
373 Ga0495653_0060512 3300046463 Bacteria 2869
374 Ga0495580_0625248 3300046472 Bacteria 710
375 Ga0495582_0034199 3300046473 Bacteria 2794
376 Ga0495582_0047026 3300046473 Bacteria 2376
377 Ga0495582_0118538 3300046473 Bacteria 1490
378 Ga0495639_0109035 3300046475 Bacteria 1312
379 Ga0495662_0189508 3300046476 Unclassified 1014
380 Ga0495664_0019207 3300046477 Bacteria 3926
381 Ga0495664_0160634 3300046477 Bacteria 1363
382 Ga0495664_0236244 3300046477 Bacteria 1106
383 Ga0495584_0067097 3300046491 Bacteria 1804
384 Ga0495594_0405168 3300046499 Bacteria 776
385 Ga0495607_0010587 3300046501 Bacteria 6190
386 Ga0495607_0181762 3300046501 Bacteria 1054
387 Ga0495607_0198354 3300046501 Bacteria 995
388 Ga0495583_0042178 3300046506 Bacteria 2133
389 Ga0495606_0000244 3300046507 Bacteria 95942
390 Ga0495606_0038954 3300046507 Bacteria 3210
391 Ga0495610_0195644 3300046512 Bacteria 831
392 Ga0495616_0084796 3300046513 Bacteria 1509
393 Ga0495618_0157086 3300046514 Bacteria 1451
394 Ga0495620_0151491 3300046515 Bacteria 904
395 Ga0495628_0047393 3300046516 Bacteria 3410
396 Ga0495628_0140031 3300046516 Bacteria 1846
397 Ga0495630_0052836 3300046517 Bacteria 3042
398 Ga0495630_0083370 3300046517 Bacteria 2413
399 Ga0495630_0120761 3300046517 Bacteria 1988
400 Ga0495630_0259687 3300046517 Bacteria 1327
401 Ga0495631_0223778 3300046518 Bacteria 803
402 Ga0495632_0032127 3300046519 Bacteria 2707
403 Ga0495643_0106753 3300046522 Bacteria 1428
404 Ga0495643_0125291 3300046522 Bacteria 1294
405 Ga0495644_0022222 3300046523 Bacteria 2418
406 Ga0495644_0025885 3300046523 Bacteria 2226
407 Ga0495648_0005323 3300046524 Bacteria 10726
408 Ga0495648_0023182 3300046524 Bacteria 4257
409 Ga0495666_0206112 3300046526 Bacteria 903
410 Ga0495640_0013361 3300046533 Bacteria 6238
411 Ga0495640_0052715 3300046533 Bacteria 2792
412 Ga0495640_0102263 3300046533 Bacteria 1880
413 Ga0495622_0138960 3300046557 Bacteria 1103
414 Ga0495622_0204881 3300046557 Bacteria 878
415 Ga0495633_0174117 3300046558 Bacteria 991
416 Ga0495667_0336510 3300046559 Bacteria 954
417 Ga0495656_0001798 3300046615 Bacteria 7049
418 Ga0495634_0001607 3300046642 Bacteria 19751
419 Ga0495634_0080135 3300046642 Bacteria 2137
420 Ga0495634_0155820 3300046642 Bacteria 1442
421 Ga0495635_0001852 3300046663 Bacteria 14329
422 Ga0495635_0076881 3300046663 Bacteria 2287
423 Ga0495659_0020285 3300046664 Bacteria 2231
424 Ga0495661_0016227 3300046665 Bacteria 4944
425 Ga0495657_0036151 3300046675 Bacteria 3416
426 Ga0495657_0068781 3300046675 Bacteria 2319
427 Ga0495623_0012158 3300046679 Bacteria 5577
428 Ga0495623_0043043 3300046679 Bacteria 2874
429 Ga0495646_0023648 3300046680 Bacteria 3868
430 Ga0495647_0022238 3300046681 Bacteria 2290
431 Ga0495658_0077834 3300046683 Bacteria 1940
432 Ga0495658_0356328 3300046683 Bacteria 930
433 Ga0495669_0012634 3300046684 Bacteria 3596
434 Ga0495669_0180878 3300046684 Bacteria 1005
435 Ga0495613_0163146 3300046689 Bacteria 1584
436 Ga0495613_0696231 3300046689 Bacteria 669
437 Ga0495624_0065656 3300046690 Bacteria 2266
438 Ga0495624_0179642 3300046690 Bacteria 1290
439 Ga0495670_0204905 3300046691 Bacteria 1045
440 Ga0495671_0309544 3300046692 Bacteria 759
441 Ga0495649_0052024 3300046694 Bacteria 2220
442 Ga0495649_0070495 3300046694 Bacteria 1874
443 Ga0495649_0225329 3300046694 Bacteria 969
444 Ga0495649_0424934 3300046694 Bacteria 665
445 Ga0495600_0046345 3300046809 Bacteria 2837
446 Ga0495581_0215579 3300047315 Bacteria 1122
447 Ga0495604_0025541 3300047317 Bacteria 4706
448 Ga0495604_0317208 3300047317 Bacteria 1043
449 Ga0495674_0097572 3300047319 Bacteria 2503
450 Ga0495674_0108537 3300047319 Bacteria 2355
451 Ga0495674_1216093 3300047319 Bacteria 569
452 Ga0495672_0032855 3300047320 Bacteria 3221
453 Ga0495676_0004095 3300047321 Bacteria 13287
454 Ga0495676_0187918 3300047321 Bacteria 1443
455 Ga0495680_0029761 3300047322 Bacteria 4468
456 Ga0495683_0035424 3300047323 Bacteria 2537
457 Ga0495687_028671 3300047443 Bacteria 2586
458 Ga0495675_0031033 3300047444 Bacteria 3411
459 Ga0495677_0028968 3300047445 Bacteria 2013
460 Ga0495673_0068472 3300047469 Bacteria 1500
461 Ga0495684_0072941 3300047471 Bacteria 2608
462 Ga0495686_0013390 3300047472 Bacteria 5692
463 Ga0495686_0270264 3300047472 Bacteria 948
464 Ga0495593_0029238 3300047673 Bacteria 3023
465 Ga0495593_0250213 3300047673 Bacteria 887
466 Ga0495602_0450069 3300048088 Bacteria 909
467 Ga0495626_0201085 3300048091 Bacteria 817
468 Ga0496101_0068982 3300048904 Bacteria 2586
469 Ga0496101_0235213 3300048904 Bacteria 1425
470 Ga0496101_0887954 3300048904 Bacteria 702
471 Ga0496102_0031794 3300048905 Bacteria 4738
472 Ga0496102_0057954 3300048905 Bacteria 3538
473 Ga0496102_0151286 3300048905 Bacteria 2181
474 Ga0496102_0185570 3300048905 Bacteria 1960
475 Ga0496102_0282955 3300048905 Bacteria 1563
476 Ga0496104_0015332 3300048907 Bacteria 6940
477 Ga0496104_0036011 3300048907 Bacteria 4623
478 Ga0496104_0059208 3300048907 Bacteria 3626
479 Ga0496104_0536499 3300048907 Bacteria 1081
480 Ga0496105_0001348 3300048908 Bacteria 17233
481 Ga0496105_0096615 3300048908 Bacteria 2440
482 Ga0496105_0155885 3300048908 Bacteria 1875
483 Ga0496106_0661372 3300048909 Bacteria 834
484 Ga0496107_0113024 3300048910 Bacteria 1997
485 Ga0496107_0166220 3300048910 Bacteria 1636
486 Ga0496107_0336564 3300048910 Bacteria 1123
487 Ga0496107_0586778 3300048910 Bacteria 824
488 Ga0496108_0019143 3300048911 Bacteria 5619
489 Ga0496108_0103789 3300048911 Bacteria 2426
490 Ga0496108_0258575 3300048911 Bacteria 1515
491 Ga0496108_0362990 3300048911 Bacteria 1264
492 Ga0496108_0832084 3300048911 Bacteria 795
493 Ga0496109_0019668 3300048912 Bacteria 5957
494 Ga0496109_0117904 3300048912 Bacteria 2471
495 Ga0496110_0006182 3300048913 Bacteria 9450
496 Ga0496110_0295088 3300048913 Bacteria 1477
497 Ga0496110_0673095 3300048913 Bacteria 935
498 Ga0496111_0064649 3300048914 Bacteria 2654
499 Ga0496111_0112330 3300048914 Bacteria 2007
500 Ga0496111_0192657 3300048914 Bacteria 1515
501 Ga0496112_0026376 3300048915 Bacteria 5589
502 Ga0496112_0159198 3300048915 Bacteria 2224
503 Ga0496113_0052192 3300048916 Bacteria 3053
504 Ga0496113_0302589 3300048916 Bacteria 1280
505 Ga0496114_0038006 3300048917 Bacteria 3982
506 Ga0496114_0091346 3300048917 Bacteria 2586
507 Ga0496114_0203106 3300048917 Bacteria 1736
508 Ga0496114_0697634 3300048917 Bacteria 890
509 Ga0496115_0031237 3300048918 Bacteria 4195
510 Ga0496115_0055326 3300048918 Bacteria 3187
511 Ga0496115_0072319 3300048918 Bacteria 2798
512 Ga0496115_0097770 3300048918 Bacteria 2404
513 Ga0496116_0000934 3300048919 Bacteria 35950
514 Ga0496116_0150003 3300048919 Bacteria 1297
515 Ga0496117_0030441 3300048920 Bacteria 4142
516 Ga0496117_0042679 3300048920 Bacteria 3307
517 Ga0496117_0142435 3300048920 Bacteria 1433
518 Ga0496117_0278506 3300048920 Bacteria 897
519 Ga0496118_0033705 3300048921 Bacteria 4195
520 Ga0496118_0071871 3300048921 Bacteria 2488
521 Ga0496118_0072027 3300048921 Bacteria 2484
522 Ga0496118_0094092 3300048921 Bacteria 2050
523 Ga0496118_0114190 3300048921 Bacteria 1781
524 Ga0496119_0028827 3300048922 Bacteria 3779
525 Ga0496119_0067888 3300048922 Bacteria 2101
526 Ga0496119_0126889 3300048922 Bacteria 1395
527 Ga0496120_0045512 3300048923 Bacteria 2541
528 Ga0496120_0126682 3300048923 Bacteria 1313
529 Ga0496120_0233900 3300048923 Bacteria 871
530 Ga0496121_0026900 3300048924 Bacteria 5400
531 Ga0496121_0173228 3300048924 Bacteria 1565
532 Ga0496121_0415969 3300048924 Bacteria 876
533 Ga0496122_0017032 3300048925 Bacteria 6823
534 Ga0496122_0165783 3300048925 Bacteria 1340
535 Ga0496122_0233814 3300048925 Bacteria 1043
536 Ga0496123_0178061 3300048926 Bacteria 1114
537 Ga0496124_0066939 3300048927 Bacteria 2990
538 Ga0496124_0082532 3300048927 Bacteria 2638
539 Ga0496124_0154379 3300048927 Bacteria 1797
540 Ga0496124_0210672 3300048927 Bacteria 1471
541 Ga0496125_0000048 3300048928 Bacteria 290651
542 Ga0496125_0018611 3300048928 Bacteria 6593
543 Ga0496125_0042187 3300048928 Bacteria 3890
544 Ga0496125_0312954 3300048928 Bacteria 956
545 Ga0496126_0224906 3300048929 Bacteria 1574
546 Ga0496126_0227786 3300048929 Bacteria 1563
547 Ga0496126_0261159 3300048929 Bacteria 1440
548 Ga0495682_0014165 3300049460 Bacteria 3025
549 Ga0495682_0098283 3300049460 Bacteria 1050
550 Ga0501032_0085453 3300049569 Bacteria 2097
551 Ga0501033_0001782 3300049570 Bacteria 18804
552 Ga0501036_0020724 3300049572 Bacteria 5522
553 Ga0501036_0195359 3300049572 Bacteria 1702
554 Ga0501036_0254614 3300049572 Bacteria 1471
555 Ga0501037_0004338 3300049573 Bacteria 10294
556 Ga0501039_0080451 3300049575 Bacteria 2535
557 Ga0501039_0224847 3300049575 Bacteria 1475
558 Ga0501043_0029346 3300049579 Bacteria 4320
559 Ga0501043_0041886 3300049579 Bacteria 3598
560 Ga0501043_0173984 3300049579 Bacteria 1679
561 Ga0501043_0621029 3300049579 Bacteria 796
562 Ga0501046_0047096 3300049580 Bacteria 3419
563 Ga0501067_0188571 3300049583 Bacteria 1148
564 Ga0501067_0394107 3300049583 Bacteria 772
565 Ga0501070_0144782 3300049586 Bacteria 1961
566 Ga0501070_0191217 3300049586 Bacteria 1682
567 Ga0501073_0043078 3300049589 Bacteria 3183
568 Ga0501073_0235563 3300049589 Bacteria 1264
569 Ga0501077_0067288 3300049593 Bacteria 2272
570 Ga0501080_0118001 3300049742 Bacteria 2460
571 Ga0501081_1149187 3300049743 Bacteria 588
572 Ga0501083_0236002 3300049744 Bacteria 1191
573 Ga0501035_0010510 3300049822 Bacteria 8577
574 Ga0501035_0151627 3300049822 Bacteria 2011
575 Ga0501044_0056031 3300049823 Bacteria 4047
576 Ga0501044_0063434 3300049823 Bacteria 3774
577 Ga0501045_0990899 3300049824 Bacteria 616
578 nmdc:mga03683_78707_c1 3300050489 Bacteria 1420
579 nmdc:mga03683_84105_c1 3300050489 Bacteria 1378
580 nmdc:mga00v17_29226_c1 3300050491 Bacteria 3234
581 nmdc:mga0yw44_10769_c1 3300050492 Bacteria 4686
582 nmdc:mga0yw44_34257_c1 3300050492 Bacteria 2974
583 nmdc:mga0k408_73226_c1 3300050493 Bacteria 2001
584 nmdc:mga0k408_84954_c1 3300050493 Bacteria 1857
585 nmdc:mga06z11_124759_c1 3300050494 Bacteria 1440
586 nmdc:mga06z11_155594_c1 3300050494 Bacteria 1303
587 nmdc:mga06z11_19548_c1 3300050494 Bacteria 3117
588 nmdc:mga07m45_131741_c1 3300050496 Bacteria 1447
589 nmdc:mga0sz30_45418_c1 3300050516 Bacteria 1853
590 Ga0495601_0356618 3300053077 Bacteria 950
591 Ga0495612_0008715 3300053078 Bacteria 4114
592 Ga0495612_0031407 3300053078 Bacteria 2141
593 Ga0495595_0018286 3300053084 Bacteria 3027
594 Ga0495619_0112127 3300053085 Bacteria 1864
595 Ga0495619_0213952 3300053085 Bacteria 1335
596 Ga0500646_0004878 3300053090 Bacteria 3399
597 Ga0500651_0136647 3300053093 Bacteria 1480
598 Ga0500566_0004439 3300053094 Bacteria 8374
599 Ga0500641_0034621 3300053096 Bacteria 2011
600 Ga0500554_222313 3300053102 Bacteria 628
601 Ga0500562_069996 3300053108 Bacteria 946
602 Ga0500569_010454 3300053109 Bacteria 2187
603 Ga0500594_0153493 3300053118 Bacteria 741
604 Ga0500595_013004 3300053119 Bacteria 3197
605 Ga0500595_017459 3300053119 Bacteria 2647
606 Ga0500608_000563 3300053122 Bacteria 13830
607 Ga0500618_008426 3300053125 Bacteria 2876
608 Ga0500642_0216620 3300053130 Bacteria 888
609 Ga0500652_000010 3300053131 Bacteria 162810
610 Ga0500559_0002321 3300053136 Bacteria 9983
611 Ga0500559_0010457 3300053136 Bacteria 3983
612 Ga0500559_0049497 3300053136 Bacteria 1851
613 Ga0500559_0054720 3300053136 Bacteria 1768
614 Ga0500577_0338860 3300053142 Bacteria 657
615 Ga0500585_147126 3300053144 Bacteria 825
616 Ga0500619_013249 3300053154 Bacteria 2180
617 Ga0500620_001880 3300053155 Bacteria 4044
618 Ga0500622_0106725 3300053156 Bacteria 1373
619 Ga0500638_194934 3300053162 Bacteria 862
620 Ga0500639_208440 3300053163 Bacteria 831
621 Ga0500636_0000301 3300053177 Bacteria 27451
622 Ga0500636_0162884 3300053177 Bacteria 1214
623 Ga0500625_213096 3300053729 Bacteria 628
624 Ga0500661_012654 3300055283 Bacteria 1522
625 Ga0501082_0222860 3300060353 Bacteria 1641
626 Ga0466962_0039244 3300061719 Bacteria 2268
627 2507505754 2507262055 Bacteria 8048963
628 2508539948 2508501009 Bacteria 7784016
629 2508696014 2508501042 Bacteria 8719808
630 2509150769 2508501128 Bacteria 8613869
631 2513625648 2513237092 Bacteria 8341956
632 2513641754 2513237094 Bacteria 8789602
633 2513678354 2513237098 Bacteria 9902361
634 2513703232 2513237102 Bacteria 7703324
635 2513857130 2513237137 Bacteria 9558895
636 2513874061 2513237139 Bacteria 8737671
637 2515627723 2515154112 Bacteria 8294334
638 2517107031 2517093001 Bacteria 9002274
639 2524435579 2524023205 Bacteria 8918781
640 2524467876 2524023210 Bacteria 9029266
641 2524533223 2524023228 Bacteria 10118060
642 2528854725 2528768022 Bacteria 10457665
643 2603858063 2602042107 Bacteria 6226103
644 2644290013 2643221651 Bacteria 4798932
645 2671119455 2667528175 Bacteria 7532676
646 2723849092 2721755755 Bacteria 8322773
647 2728753738 2728368998 Bacteria 8720350
648 2745079834 2744054633 Bacteria 8678936
649 2793059184 2791355196 Bacteria 7323613
650 2805920418 2802429603 Bacteria 8777136
651 2824682111 2824679649 Bacteria 8248951
652 2824709313 2824704595 Bacteria 9667483
653 2824754872 2824753945 Bacteria 9787441
654 2824765274 2824763712 Bacteria 9792355
655 2844321642 2844315083 Bacteria 8138177
656 2857513175 2857509624 Bacteria 7472071
657 2874607009 2874604998 Bacteria 7834745
658 2874621986 2874620515 Bacteria 8290088
659 2874629355 2874628541 Bacteria 8630250
660 2876762358 2876761206 Bacteria 10111113
661 2881666119 2881665667 Bacteria 8175609
662 2885375887 2885374607 Bacteria 8927485
663 2889034895 2889033259 Bacteria 9099371
664 2893071983 2893066018 Bacteria 6158120
665 2903727783 2903727486 Bacteria 8281579
666 2904669421 2904666416 Bacteria 8226587
667 2904695659 2904690495 Bacteria 9412302
668 2904714462 2904711408 Bacteria 9771557
669 2906602732 2906602504 Bacteria 8295279
670 2906614580
671 2906634721 2906626472 Bacteria 8826946
672 2908746601 2908739725 Bacteria 8628932
673 2908764089 2908756301 Bacteria 8864324
674 2922377685
675 2922400214 2922393267 Bacteria 8285685
676 2932788182 2932784394 Bacteria 9704911
677 2932813553 2932809354 Bacteria 9135765
678 2932820250 2932818245 Bacteria 9955613
679 2932832683 2932828146 Bacteria 9745859
680 2933585249 2933577622 Bacteria 9116884
681 2935614804 2935608549 Bacteria 8203142
682 2935620173 2935616580 Bacteria 9032984
683 2935640492 2935638405 Bacteria 10015038
684 2935649203 2935648319 Bacteria 8801166
685 2935658025 2935656913 Bacteria 8965014
686 2935668685 2935665750 Bacteria 9571747
687 2935697037 2935694250 Bacteria 9291695
688 2935709805 2935703347 Bacteria 10242284
689 2935766857 2935760218 Bacteria 9817913
690 2935804605 2935801545 Bacteria 9301974
691 2935826156 2935819856 Bacteria 8261050
692 2935831998 2935827899 Bacteria 10038562
693 2935841171 2935837841 Bacteria 9454360
694 2935853652 2935847175 Bacteria 8228321
695 2935859059 2935855204 Bacteria 9035059
696 2935864240 2935864058 Bacteria 9784707
697 2935875408 2935873716 Bacteria 9632195
698 2935910873 2935908558 Bacteria 8568796
699 2935922055 2935916978 Bacteria 9113783
700 2935929808 2935926038 Bacteria 8601059
701 2935937476 2935934488 Bacteria 8602579
702 2935948125 2935942939 Bacteria 8599779
703 2935957654 2935951376 Bacteria 8602333
704 2935964308 2935959822 Bacteria 7869783
705 2935971067 2935967501 Bacteria 8603075
706 2935978388 2935975950 Bacteria 8347125
707 2935985481 2935984226 Bacteria 8302647
708 2935995614 2935992306 Bacteria 9802711
709 2936008033 2936002035 Bacteria 9362176
710 2936012244 2936011229 Bacteria 8801034
711 2936020675 2936019824 Bacteria 8804134
712 2936029537 2936028420 Bacteria 8965941
713 2936048139 2936046547 Bacteria 8903709
714 2941543397 2941538514 Bacteria 9402094
715 3005475782 3005474847 Bacteria 9259049
716 3005506458 3005506211 Bacteria 6943378
717 3005594298 3005587118 Bacteria 7794411
718 3005724799 3005718088 Bacteria 8283608
719 8006929221 8006926726 Bacteria 6749210
720 8006972513 8006964411 Bacteria 8966052
721 8006977114 8006973647 Bacteria 10679141
722 8006988539 8006984368 Bacteria 9651211
723 8016517548 8016511872 Bacteria 9921665
724 8016585618 8016583857 Bacteria 10421953
725 8016635080 8016630954 Bacteria 9217207
726 8017059070 8017057580 Bacteria 10023680
727 8019576566 8019576017 Bacteria 10049540
728 8019594440 8019586578 Bacteria 10212056
729 8019607121 8019597564 Bacteria 10041141
730 8019611387 8019608314 Bacteria 10042931
731 8019622146 8019619141 Bacteria 9218857
732 8019631166 8019629233 Bacteria 8687553
733 8019651881 8019648815 Bacteria 10014479
734 8019667974 8019659431 Bacteria 8577854
735 8019677394 8019668869 Bacteria 8791617
736 8019687558 8019678201 Bacteria 8863603
737 8055743288 8055742211 Bacteria 9226248
738 8056679252 8056673599 Bacteria 7871253
739 8056694637 8056689827 Bacteria 6712655
740 8056975520 8056967851 Bacteria 9038162
741 Ga0496121_0020930
742 JGI24739J22299_10038604
743 JGI24737J22298_10137658
744 JGI24034J26672_10047389
745 JGI25406J46586_10000063
746 JGI25160J50197_1003914
747 JGI25160J50197_1018061
748 JGI25404J52841_10003528
749 Ga0055526_1011339
750 Ga0065165_1002895
751 Ga0070658_10047721
752 Ga0070658_10208537
753 Ga0070658_10515322
754 Ga0070670_100023652
755 Ga0068869_100159530
756 Ga0068869_100483201
757 Ga0070680_100089742
758 Ga0070682_100183769
759 Ga0068868_100156062
760 Ga0068868_100233549
761 Ga0068868_100576229
762 Ga0070660_100042497
763 Ga0070660_100215651
764 Ga0070689_100045724
765 Ga0070689_100047229
766 Ga0070689_100085659
767 Ga0070689_100243956
768 Ga0070689_100536341
769 Ga0070691_10149423
770 Ga0070661_100063389
771 Ga0070661_100099459
772 Ga0070668_100131982
773 Ga0070668_100352215
774 Ga0070675_101290533
775 Ga0070671_100002663
776 Ga0070671_100022035
777 Ga0070674_100046286
778 Ga0070673_100001059
779 Ga0070673_100404250
780 Ga0070673_100908879
781 Ga0070688_100096123
782 Ga0070688_100737572
783 Ga0070659_100088617
784 Ga0070659_100226724
785 Ga0070659_100250263
786 Ga0070667_100563394
787 Ga0070709_10026613
788 Ga0070714_100017940
789 Ga0070714_100214333
790 Ga0070713_100756849
791 Ga0070711_100130217
792 Ga0070705_100327388
793 Ga0070700_100164012
794 Ga0070663_100140786
795 Ga0070663_100183465
796 Ga0070663_100239545
797 Ga0070663_100377594
798 Ga0070678_100173902
799 Ga0070678_100836460
800 Ga0070662_100082632
801 Ga0070662_100104488
802 Ga0070681_10006243
803 Ga0068867_100155475
804 Ga0070706_100201134
805 Ga0068853_100007760
806 Ga0068853_100086409
807 Ga0068853_100673287
808 Ga0070693_100050708
809 Ga0070665_100124552
810 Ga0070665_100225647
811 Ga0070665_100417509
812 Ga0070665_100548965
813 Ga0070665_101191018
814 Ga0070664_100292604
815 Ga0070664_100936413
816 Ga0068857_100408926
817 Ga0068856_100185263
818 Ga0068856_100348457
819 Ga0070702_100187724
820 Ga0068852_100010820
821 Ga0068852_100486195
822 Ga0068852_100507518
823 Ga0068852_100945719
824 Ga0068859_100023026
825 Ga0068866_10111415
826 Ga0068861_100088464
827 Ga0068863_100280055
828 Ga0068858_100110662
829 Ga0068860_100851199
830 Ga0068862_100207623
831 Ga0068862_100460353
832 Ga0068862_100544571
833 Ga0081455_10051861
834 Ga0081538_10019361
835 Ga0081538_10038844
836 Ga0081538_10086706
837 Ga0081540_1002214
838 Ga0081540_1183185
839 Ga0081539_10000229
840 Ga0081539_10023917
841 Ga0070717_10204695
842 Ga0070717_10211384
843 Ga0075365_10090648
844 Ga0075365_10284158
845 Ga0075368_10042305
846 Ga0075368_10287341
847 Ga0075363_100338258
848 Ga0075364_10041269
849 Ga0075364_10049976
850 Ga0070715_10227914
851 Ga0070716_100416666
852 Ga0070712_100057650
853 Ga0075362_10046435
854 Ga0075367_10028172
855 Ga0075367_10034085
856 Ga0075367_10069372
857 Ga0075367_10085881
858 Ga0075367_10184009
859 Ga0075369_10020499
860 Ga0075369_10081386
861 Ga0075369_10114669
862 Ga0075369_10202757
863 Ga0075366_10058917
864 Ga0075366_10321837
865 Ga0097621_100127950
866 Ga0068871_100759734
867 Ga0068871_100997735
868 Ga0068865_100242198
869 Ga0075436_100057699
870 Ga0097620_100023027
871 Ga0099824_1047935
872 Ga0099823_1048989
873 Ga0099794_10024063
874 Ga0099794_10155557
875 Ga0099795_10000668
876 Ga0099795_10126062
877 Ga0111539_10587725
878 Ga0105245_10057387
879 Ga0105247_10233409
880 Ga0114129_10652479
881 Ga0105243_10165378
882 Ga0105241_10338164
883 Ga0105237_10209223
884 Ga0105237_10442343
885 Ga0105237_10608552
886 Ga0105237_10707988
887 Ga0105249_10152135
888 Ga0099796_10000771
889 Ga0105239_10087915
890 Ga0105239_10091201
891 Ga0105239_10096232
892 Ga0105239_10307248
893 Ga0105239_11739311
894 Ga0157373_10031988
895 Ga0157374_10679781
896 Ga0157378_10342094
897 Ga0157378_10375375
898 Ga0163162_10386420
899 Ga0163162_12192197
900 Ga0163163_10100908
901 Ga0163163_10231266
902 Ga0163163_10430329
903 Ga0157380_10241441
904 Ga0157377_10124011
905 Ga0157376_10095159
906 Ga0157376_10281519
907 Ga0163161_10079772
908 Ga0163161_10112019
909 Ga0163161_10188180
910 Ga0213876_10131975
911 Ga0209677_103776
912 Ga0209455_1016609
913 Ga0209564_1006792
914 Ga0209758_1017896
915 Ga0209758_1021687
916 Ga0209758_1048939
917 Ga0207426_1000905
918 Ga0207426_1001164
919 Ga0207426_1001422
920 Ga0207697_10015107
921 Ga0207697_10071931
922 Ga0207697_10222323
923 Ga0207692_10579830
924 Ga0207692_10582953
925 Ga0207710_10075580
926 Ga0207688_10043696
927 Ga0207680_10075611
928 Ga0207647_10029503
929 Ga0207647_10162527
930 Ga0207647_10199757
931 Ga0207685_10119180
932 Ga0207699_10037773
933 Ga0207699_10602724
934 Ga0207645_10027318
935 Ga0207643_10133585
936 Ga0207643_10186046
937 Ga0207705_10015453
938 Ga0207705_10050928
939 Ga0207705_10153584
940 Ga0207705_10257635
941 Ga0207654_10058822
942 Ga0207707_10107117
943 Ga0207695_10000059
944 Ga0207695_10152947
945 Ga0207671_10038728
946 Ga0207671_10133859
947 Ga0207693_10003714
948 Ga0207693_10054658
949 Ga0207663_10018774
950 Ga0207663_10081948
951 Ga0207663_10106481
952 Ga0207662_10289094
953 Ga0207657_10067150
954 Ga0207657_10278747
955 Ga0207657_10318100
956 Ga0207687_10027547
957 Ga0207687_10076713
958 Ga0207700_10118412
959 Ga0207700_10905127
960 Ga0207664_10128544
961 Ga0207664_11020549
962 Ga0207644_10005174
963 Ga0207644_10265659
964 Ga0207690_10716078
965 Ga0207706_10045258
966 Ga0207706_10064007
967 Ga0207686_10401743
968 Ga0207709_10114312
969 Ga0207670_10026594
970 Ga0207670_10085153
971 Ga0207669_10061641
972 Ga0207704_10081230
973 Ga0207704_10441286
974 Ga0207665_10250785
975 Ga0207691_10311309
976 Ga0207711_10328191
977 Ga0207679_10052425
978 Ga0207679_10210079
979 Ga0207667_10154622
980 Ga0207667_10266349
981 Ga0207667_10414719
982 Ga0207651_10006538
983 Ga0207651_10248871
984 Ga0207668_10081110
985 Ga0207668_10090654
986 Ga0207668_10105126
987 Ga0207668_10178759
988 Ga0207668_10673037
989 Ga0207658_10672559
990 Ga0207658_11172387
991 Ga0207677_10055825
992 Ga0207677_10184825
993 Ga0207677_10562980
994 Ga0207703_10108810
995 Ga0207703_10200548
996 Ga0207678_10042075
997 Ga0207678_10051479
998 Ga0207678_10317259
999 Ga0207708_10123408
1000 Ga0207708_10200184
1001 Ga0207702_10235312
1002 Ga0207648_10140618
1003 Ga0207676_10493598
1004 Ga0207674_10032546
1005 Ga0207674_10075935
1006 Ga0207675_100037344
1007 Ga0207675_100313588
1008 Ga0207683_10183250
1009 Ga0207683_10446136
1010 Ga0207698_10180090
1011 Ga0207698_11113629
1012 Ga0209389_1000012
1013 Ga0209489_100019
1014 Ga0209700_100018
1015 Ga0209179_1005473
1016 Ga0209179_1056618
1017 Ga0209588_1023538
1018 Ga0268266_10011827
1019 Ga0268266_10054804
1020 Ga0268266_10117604
1021 Ga0268266_10162167
1022 Ga0268266_10724189
1023 Ga0268266_11501032
1024 Ga0268265_10050254
1025 Ga0268265_10241838
1026 Ga0268265_10350639
1027 Ga0307515_10164083
1028 Ga0307515_10294806
1029 Ga0265760_10077114
1030 Ga0265330_10032518
1031 Ga0265325_10174139
1032 Ga0265325_10412017
1033 Ga0265340_10000546
1034 Ga0265340_10018085
1035 Ga0265339_10005522
1036 Ga0265331_10054467
1037 Ga0265316_10112005
1038 Ga0265316_10372258
1039 Ga0307509_10116773
1040 Ga0307408_100568091
1041 Ga0307408_101271146
1042 Ga0265313_10010184
1043 Ga0307508_10230776
1044 Ga0307508_10462365
1045 Ga0265314_10141437
1046 Ga0265342_10255400
1047 Ga0316578_10079539
1048 Ga0307405_10133628
1049 Ga0307405_10420430
1050 Ga0307518_10231873
1051 Ga0307407_10666328
1052 Ga0307412_10515388
1053 Ga0307409_101500880
1054 Ga0307409_101888536
1055 Ga0307415_100962706
1056 Ga0307510_10013788
1057 Ga0307510_10033275
1058 Ga0307510_10101242
1059 Ga0307510_10194874
1060 Ga0373923_0022541
1061 Ga0373936_0012782
1062 Ga0373953_0199399
1063 Ga0373953_0215441
1064 Ga0373954_0009683
1065 Ga0373957_0166731
1066 Ga0373943_0052647
1067 Ga0373946_0007578
1068 Ga0373955_0184265
1069 Ga0373924_0014981
1070 Ga0373935_0008926
1071 Ga0373927_0134392
1072 Ga0373927_0187881
1073 Ga0373947_0053181
1074 Ga0373947_0064904
1075 Ga0373947_0096380
1076 Ga0373937_0061071
1077 Ga0373937_0475015
1078 Ga0373937_0603787
1079 Ga0373925_0138987
1080 Ga0373925_0149464
1081 Ga0373925_0367739
1082 Ga0395899_0237400
1083 Ga0395900_0001392
1084 Ga0395898_0022124
1085 Ga0395905_0381177
1086 Ga0436364_0657395
1087 Ga0395901_0080351
1088 Ga0395901_0228161
1089 Ga0436365_0978755
1090 Ga0436365_1371253
1091 Ga0436365_1481893
1092 Ga0436365_1865997
1093 Ga0436360_0902241
1094 Ga0436360_1239649
1095 Ga0436361_1141498
1096 Ga0451793_0049426
1097 Ga0451849_0560020
1098 Ga0451843_0743394
1099 Ga0439431_0057577
1100 Ga0466970_0269642
1101 Ga0466957_0963261
1102 Ga0495592_0051565
1103 Ga0495592_0068416
1104 Ga0495592_0282133
1105 Ga0495603_0040310
1106 Ga0495590_0068990
1107 Ga0495638_0022483
1108 Ga0495638_0191031
1109 Ga0495641_0050183
1110 Ga0495641_0111150
1111 Ga0495651_0029063
1112 Ga0495651_0043877
1113 Ga0495653_0060512
1114 Ga0495580_0625248
1115 Ga0495582_0034199
1116 Ga0495582_0047026
1117 Ga0495582_0118538
1118 Ga0495639_0109035
1119 Ga0495662_0189508
1120 Ga0495664_0019207
1121 Ga0495664_0160634
1122 Ga0495664_0236244
1123 Ga0495584_0067097
1124 Ga0495594_0405168
1125 Ga0495607_0010587
1126 Ga0495607_0181762
1127 Ga0495607_0198354
1128 Ga0495583_0042178
1129 Ga0495606_0000244
1130 Ga0495606_0038954
1131 Ga0495610_0195644
1132 Ga0495616_0084796
1133 Ga0495618_0157086
1134 Ga0495620_0151491
1135 Ga0495628_0047393
1136 Ga0495628_0140031
1137 Ga0495630_0052836
1138 Ga0495630_0083370
1139 Ga0495630_0120761
1140 Ga0495630_0259687
1141 Ga0495631_0223778
1142 Ga0495632_0032127
1143 Ga0495643_0106753
1144 Ga0495643_0125291
1145 Ga0495644_0022222
1146 Ga0495644_0025885
1147 Ga0495648_0005323
1148 Ga0495648_0023182
1149 Ga0495666_0206112
1150 Ga0495640_0013361
1151 Ga0495640_0052715
1152 Ga0495640_0102263
1153 Ga0495622_0138960
1154 Ga0495622_0204881
1155 Ga0495633_0174117
1156 Ga0495667_0336510
1157 Ga0495656_0001798
1158 Ga0495634_0001607
1159 Ga0495634_0080135
1160 Ga0495634_0155820
1161 Ga0495635_0001852
1162 Ga0495635_0076881
1163 Ga0495659_0020285
1164 Ga0495661_0016227
1165 Ga0495657_0036151
1166 Ga0495657_0068781
1167 Ga0495623_0012158
1168 Ga0495623_0043043
1169 Ga0495646_0023648
1170 Ga0495647_0022238
1171 Ga0495658_0077834
1172 Ga0495658_0356328
1173 Ga0495669_0012634
1174 Ga0495669_0180878
1175 Ga0495613_0163146
1176 Ga0495613_0696231
1177 Ga0495624_0065656
1178 Ga0495624_0179642
1179 Ga0495670_0204905
1180 Ga0495671_0309544
1181 Ga0495649_0052024
1182 Ga0495649_0070495
1183 Ga0495649_0225329
1184 Ga0495649_0424934
1185 Ga0495600_0046345
1186 Ga0495581_0215579
1187 Ga0495604_0025541
1188 Ga0495604_0317208
1189 Ga0495674_0097572
1190 Ga0495674_0108537
1191 Ga0495674_1216093
1192 Ga0495672_0032855
1193 Ga0495676_0004095
1194 Ga0495676_0187918
1195 Ga0495680_0029761
1196 Ga0495683_0035424
1197 Ga0495687_028671
1198 Ga0495675_0031033
1199 Ga0495677_0028968
1200 Ga0495673_0068472
1201 Ga0495684_0072941
1202 Ga0495686_0013390
1203 Ga0495686_0270264
1204 Ga0495593_0029238
1205 Ga0495593_0250213
1206 Ga0495602_0450069
1207 Ga0495626_0201085
1208 Ga0496101_0068982
1209 Ga0496101_0235213
1210 Ga0496101_0887954
1211 Ga0496102_0031794
1212 Ga0496102_0057954
1213 Ga0496102_0151286
1214 Ga0496102_0185570
1215 Ga0496102_0282955
1216 Ga0496104_0015332
1217 Ga0496104_0036011
1218 Ga0496104_0059208
1219 Ga0496104_0536499
1220 Ga0496105_0001348
1221 Ga0496105_0096615
1222 Ga0496105_0155885
1223 Ga0496106_0661372
1224 Ga0496107_0113024
1225 Ga0496107_0166220
1226 Ga0496107_0336564
1227 Ga0496107_0586778
1228 Ga0496108_0019143
1229 Ga0496108_0103789
1230 Ga0496108_0258575
1231 Ga0496108_0362990
1232 Ga0496108_0832084
1233 Ga0496109_0019668
1234 Ga0496109_0117904
1235 Ga0496110_0006182
1236 Ga0496110_0295088
1237 Ga0496110_0673095
1238 Ga0496111_0064649
1239 Ga0496111_0112330
1240 Ga0496111_0192657
1241 Ga0496112_0026376
1242 Ga0496112_0159198
1243 Ga0496113_0052192
1244 Ga0496113_0302589
1245 Ga0496114_0038006
1246 Ga0496114_0091346
1247 Ga0496114_0203106
1248 Ga0496114_0697634
1249 Ga0496115_0031237
1250 Ga0496115_0055326
1251 Ga0496115_0072319
1252 Ga0496115_0097770
1253 Ga0496116_0000934
1254 Ga0496116_0150003
1255 Ga0496117_0030441
1256 Ga0496117_0042679
1257 Ga0496117_0142435
1258 Ga0496117_0278506
1259 Ga0496118_0033705
1260 Ga0496118_0071871
1261 Ga0496118_0072027
1262 Ga0496118_0094092
1263 Ga0496118_0114190
1264 Ga0496119_0028827
1265 Ga0496119_0067888
1266 Ga0496119_0126889
1267 Ga0496120_0045512
1268 Ga0496120_0126682
1269 Ga0496120_0233900
1270 Ga0496121_0026900
1271 Ga0496121_0173228
1272 Ga0496121_0415969
1273 Ga0496122_0017032
1274 Ga0496122_0165783
1275 Ga0496122_0233814
1276 Ga0496123_0178061
1277 Ga0496124_0066939
1278 Ga0496124_0082532
1279 Ga0496124_0154379
1280 Ga0496124_0210672
1281 Ga0496125_0000048
1282 Ga0496125_0018611
1283 Ga0496125_0042187
1284 Ga0496125_0312954
1285 Ga0496126_0224906
1286 Ga0496126_0227786
1287 Ga0496126_0261159
1288 Ga0495682_0014165
1289 Ga0495682_0098283
1290 Ga0501032_0085453
1291 Ga0501033_0001782
1292 Ga0501036_0020724
1293 Ga0501036_0195359
1294 Ga0501036_0254614
1295 Ga0501037_0004338
1296 Ga0501039_0080451
1297 Ga0501039_0224847
1298 Ga0501043_0029346
1299 Ga0501043_0041886
1300 Ga0501043_0173984
1301 Ga0501043_0621029
1302 Ga0501046_0047096
1303 Ga0501067_0188571
1304 Ga0501067_0394107
1305 Ga0501070_0144782
1306 Ga0501070_0191217
1307 Ga0501073_0043078
1308 Ga0501073_0235563
1309 Ga0501077_0067288
1310 Ga0501080_0118001
1311 Ga0501081_1149187
1312 Ga0501083_0236002
1313 Ga0501035_0010510
1314 Ga0501035_0151627
1315 Ga0501044_0056031
1316 Ga0501044_0063434
1317 Ga0501045_0990899
1318 nmdc:mga03683_78707_c1
1319 nmdc:mga03683_84105_c1
1320 nmdc:mga00v17_29226_c1
1321 nmdc:mga0yw44_10769_c1
1322 nmdc:mga0yw44_34257_c1
1323 nmdc:mga0k408_73226_c1
1324 nmdc:mga0k408_84954_c1
1325 nmdc:mga06z11_124759_c1
1326 nmdc:mga06z11_155594_c1
1327 nmdc:mga06z11_19548_c1
1328 nmdc:mga07m45_131741_c1
1329 nmdc:mga0sz30_45418_c1
1330 Ga0495601_0356618
1331 Ga0495612_0008715
1332 Ga0495612_0031407
1333 Ga0495595_0018286
1334 Ga0495619_0112127
1335 Ga0495619_0213952
1336 Ga0500646_0004878
1337 Ga0500651_0136647
1338 Ga0500566_0004439
1339 Ga0500641_0034621
1340 Ga0500554_222313
1341 Ga0500562_069996
1342 Ga0500569_010454
1343 Ga0500594_0153493
1344 Ga0500595_013004
1345 Ga0500595_017459
1346 Ga0500608_000563
1347 Ga0500618_008426
1348 Ga0500642_0216620
1349 Ga0500652_000010
1350 Ga0500559_0002321
1351 Ga0500559_0010457
1352 Ga0500559_0049497
1353 Ga0500559_0054720
1354 Ga0500577_0338860
1355 Ga0500585_147126
1356 Ga0500619_013249
1357 Ga0500620_001880
1358 Ga0500622_0106725
1359 Ga0500638_194934
1360 Ga0500639_208440
1361 Ga0500636_0000301
1362 Ga0500636_0162884
1363 Ga0500625_213096
1364 Ga0500661_012654
1365 Ga0501082_0222860
1366 Ga0466962_0039244
1367 2507505754
1368 2508539948
1369 2508696014
1370 2509150769
1371 2513625648
1372 2513641754
1373 2513678354
1374 2513703232
1375 2513857130
1376 2513874061
1377 2515627723
1378 2517107031
1379 2524435579
1380 2524467876
1381 2524533223
1382 2528854725
1383 2603858063
1384 2644290013
1385 2671119455
1386 2723849092
1387 2728753738
1388 2745079834
1389 2793059184
1390 2805920418
1391 2824682111
1392 2824709313
1393 2824754872
1394 2824765274
1395 2844321642
1396 2857513175
1397 2874607009
1398 2874621986
1399 2874629355
1400 2876762358
1401 2881666119
1402 2885375887
1403 2889034895
1404 2893071983
1405 2903727783
1406 2904669421
1407 2904695659
1408 2904714462
1409 2906602732
1410 2906614580
1411 2906634721
1412 2908746601
1413 2908764089
1414 2922377685
1415 2922400214
1416 2932788182
1417 2932813553
1418 2932820250
1419 2932832683
1420 2933585249
1421 2935614804
1422 2935620173
1423 2935640492
1424 2935649203
1425 2935658025
1426 2935668685
1427 2935697037
1428 2935709805
1429 2935766857
1430 2935804605
1431 2935826156
1432 2935831998
1433 2935841171
1434 2935853652
1435 2935859059
1436 2935864240
1437 2935875408
1438 2935910873
1439 2935922055
1440 2935929808
1441 2935937476
1442 2935948125
1443 2935957654
1444 2935964308
1445 2935971067
1446 2935978388
1447 2935985481
1448 2935995614
1449 2936008033
1450 2936012244
1451 2936020675
1452 2936029537
1453 2936048139
1454 2941543397
1455 3005475782
1456 3005506458
1457 3005594298
1458 3005724799
1459 8006929221
1460 8006972513
1461 8006977114
1462 8006988539
1463 8016517548
1464 8016585618
1465 8016635080
1466 8017059070
1467 8019576566
1468 8019594440
1469 8019607121
1470 8019611387
1471 8019622146
1472 8019631166
1473 8019651881
1474 8019667974
1475 8019677394
1476 8019687558
1477 8055743288
1478 8056679252
1479 8056694637
1480 8056975520

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06776

IalB

Invasion associated locus B (IalB) protein

81

212

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dtd-assembly1.cif.gz_F-1 crystal structure of invasion associated protein b from bartonella henselae 0.7407 41 176
3dtd-assembly1.cif.gz_C-2 crystal structure of invasion associated protein b from bartonella henselae 0.7138 41 176
3dtd-assembly1.cif.gz_G-2 crystal structure of invasion associated protein b from bartonella henselae 0.7078 41 176
3dtd-assembly1.cif.gz_F-1 crystal structure of invasion associated protein b from bartonella henselae 0.6939 41 176
3dtd-assembly1.cif.gz_G-2 crystal structure of invasion associated protein b from bartonella henselae 0.6641 41 176
ID Description Score Start End Superfamily
3dtdF00 Mainly Beta;Sandwich;Immunoglobulin-like;Invasion associated locus B (IalB) protein 0.7407 41 176 2.60.40.1880
3dtdF00 Mainly Beta;Sandwich;Immunoglobulin-like;Invasion associated locus B (IalB) protein 0.6939 41 176 2.60.40.1880
af_M9MMF2_91_184_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6855 75 165 2.60.40.10
af_M9MMF2_91_184_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6506 75 165 2.60.40.10
af_E7F867_116_213_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6449 75 165 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A258CWN6-F1-model_v4 Invasion-associated locus B family protein 0.915 41 177
AF-A0A089NZ13-F1-model_v4 Invasion associated locus B family protein 0.9115 38 177
AF-A0A089NZ13-F1-model_v4 Invasion associated locus B family protein 0.9054 38 177
AF-A0A529Q5V8-F1-model_v4 Invasion associated locus B family protein 0.9051 42 177
AF-A0A2N6BNC2-F1-model_v4 Invasion associated locus B family protein 0.8989 49 177

Map