F478538
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 740 | 296 | 739 | 386 |
Family's Representative Sequence
| Representative Sequence | 3300036647|Ga0316582_0000369|Ga0316582_0000369_10384_11688 |
| Length | 434 |
| Sequence | MRPEGVESTVSGLLAPIRTGSEEHAGIAFRMVAGVPRSHRKGAISMSEQFTPKPEHKFTFGLWTVGNPGGDPFGPPTRPRLSPVDIVHLLGEVGAYGVNFHDNDLVPIDATPAEHDKIVKDFKKALADTGLKVPMATTNLFSDPIFKDGAFTSNDPRVRAYALSKTMKAMDLGVDLGAKVYVFWGGREGVETDASKNPLEAAKRFRDALNFLTHYAKDQKYDLVFALEAKPNEPRHDIYLPTTGSFLGFIESLDHPEMVGVNPEVAHEHMSGLNFMHAVAQAWDAGKLFHIDLNDQAFGRYDQDLRFGSHSLKSCFFLVKFLEDVGYPGMRHFDSHAYRTEDVDGVKDFARGSMRSYLIYKERAKRWNEDKEIQALVKEIGDVPTDGLPKIDGYSKATADALKGLTVDRQALGARGLRYEKLDQLTIEVLLGVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 4 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 5 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 14 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 34 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 35 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 36 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 41 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 42 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 51 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 52 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 53 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 54 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 55 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 56 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 57 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 58 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 59 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 60 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 61 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 62 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 63 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 64 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 65 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 66 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 67 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 68 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 69 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 70 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 71 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 72 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 73 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 74 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 75 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 77 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 78 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 79 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 80 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 81 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 82 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 83 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 84 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 86 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 111 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 112 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 113 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 114 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 162 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 163 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 164 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 165 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 166 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 167 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 168 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 169 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 170 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 171 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 172 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 173 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 174 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 175 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 176 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 177 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 178 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 179 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 180 | 3300032139 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB | Metagenome | Rhizosphere |
| 181 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 182 | 3300033524 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 183 | 3300033527 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 184 | 3300033528 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 185 | 3300033529 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 186 | 3300033541 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 187 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 188 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 189 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 190 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 191 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 192 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 193 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 194 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 195 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 196 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 197 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 198 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 199 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 200 | 3300037588 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA | Metagenome | Rhizosphere |
| 201 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 202 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 205 | 3300042133 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 | Metagenome | Rhizosphere |
| 206 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 207 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 208 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 209 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 210 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 211 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 212 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 213 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 214 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 215 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 216 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 217 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 240 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 241 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 242 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 243 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 244 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 245 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 246 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 247 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 248 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 249 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 251 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 253 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 254 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 256 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 257 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 258 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 259 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 261 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 263 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 264 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 265 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 266 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 267 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 268 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 269 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 270 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 274 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 275 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 276 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 277 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 278 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 279 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 280 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 281 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 284 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 285 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 286 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 287 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 288 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 290 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 292 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 293 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 294 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 295 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 296 | 8056060235 | Nocardiopsis endophytica RSe5-2 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.97 |
| Metatranscriptomes | 1.89 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 3.24 |
| Nodule | 0 |
| Rhizoplane | 1.62 |
| Rhizosphere | 93.92 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | SwRhRL2b_contig_1938809 | 2162886007 | Bacteria | 6527 |
| 2 | JGI25406J46586_10000671 | 3300003203 | Bacteria | 15941 |
| 3 | JGI25406J46586_10055405 | 3300003203 | Unclassified | 1307 |
| 4 | Ga0058860_11303011 | 3300004801 | Unclassified | 1637 |
| 5 | Ga0065704_10000931 | 3300005289 | Bacteria | 10822 |
| 6 | Ga0065704_10103603 | 3300005289 | Bacteria | 2167 |
| 7 | Ga0065715_10152580 | 3300005293 | Bacteria | 1677 |
| 8 | Ga0065707_10001307 | 3300005295 | Bacteria | 9543 |
| 9 | Ga0065707_10007546 | 3300005295 | Bacteria | 3961 |
| 10 | Ga0065707_10009866 | 3300005295 | Bacteria | 2276 |
| 11 | Ga0065707_10108163 | 3300005295 | Bacteria | 2522 |
| 12 | Ga0065707_10124595 | 3300005295 | Bacteria | 2041 |
| 13 | Ga0070683_100006910 | 3300005329 | Bacteria | 9535 |
| 14 | Ga0070683_100334647 | 3300005329 | Bacteria | 1441 |
| 15 | Ga0070690_100235844 | 3300005330 | Bacteria | 1288 |
| 16 | Ga0070670_100059361 | 3300005331 | Bacteria | 3283 |
| 17 | Ga0070677_10077528 | 3300005333 | Bacteria | 1414 |
| 18 | Ga0068869_100058427 | 3300005334 | Bacteria | 2820 |
| 19 | Ga0068869_100153722 | 3300005334 | Bacteria | 1786 |
| 20 | Ga0068869_100187016 | 3300005334 | Bacteria | 1626 |
| 21 | Ga0070680_100008936 | 3300005336 | Bacteria | 7681 |
| 22 | Ga0070680_100038055 | 3300005336 | Bacteria | 3889 |
| 23 | Ga0070680_100145675 | 3300005336 | Bacteria | 1987 |
| 24 | Ga0068868_100059747 | 3300005338 | Bacteria | 3016 |
| 25 | Ga0068868_100159212 | 3300005338 | Bacteria | 1864 |
| 26 | Ga0070660_100020141 | 3300005339 | Bacteria | 4898 |
| 27 | Ga0070689_100035853 | 3300005340 | Bacteria | 3791 |
| 28 | Ga0070661_100011515 | 3300005344 | Bacteria | 6160 |
| 29 | Ga0070661_100023035 | 3300005344 | Bacteria | 4462 |
| 30 | Ga0070668_100050621 | 3300005347 | Bacteria | 3199 |
| 31 | Ga0070668_100139982 | 3300005347 | Bacteria | 1949 |
| 32 | Ga0070675_100101769 | 3300005354 | Bacteria | 2421 |
| 33 | Ga0070671_100023921 | 3300005355 | Bacteria | 4999 |
| 34 | Ga0070674_100036772 | 3300005356 | Bacteria | 3289 |
| 35 | Ga0070673_100025432 | 3300005364 | Unclassified | 4357 |
| 36 | Ga0070673_100067086 | 3300005364 | Bacteria | 2868 |
| 37 | Ga0070688_100086686 | 3300005365 | Bacteria | 2037 |
| 38 | Ga0070659_100017378 | 3300005366 | Bacteria | 5411 |
| 39 | Ga0070659_100052144 | 3300005366 | Bacteria | 3217 |
| 40 | Ga0070667_100070910 | 3300005367 | Bacteria | 2967 |
| 41 | Ga0070709_10133411 | 3300005434 | Bacteria | 1698 |
| 42 | Ga0070714_100008748 | 3300005435 | Bacteria | 7915 |
| 43 | Ga0070713_100010845 | 3300005436 | Bacteria | 6605 |
| 44 | Ga0070713_100066538 | 3300005436 | Bacteria | 3031 |
| 45 | Ga0070701_10028685 | 3300005438 | Bacteria | 2737 |
| 46 | Ga0070705_100001047 | 3300005440 | Bacteria | 15425 |
| 47 | Ga0070705_100012481 | 3300005440 | Bacteria | 4320 |
| 48 | Ga0070705_100027130 | 3300005440 | Bacteria | 3124 |
| 49 | Ga0070694_100002059 | 3300005444 | Bacteria | 11922 |
| 50 | Ga0070694_100004558 | 3300005444 | Bacteria | 8329 |
| 51 | Ga0070694_100016354 | 3300005444 | Bacteria | 4669 |
| 52 | Ga0070694_100103178 | 3300005444 | Bacteria | 2020 |
| 53 | Ga0070708_100003230 | 3300005445 | Bacteria | 12715 |
| 54 | Ga0070708_100004999 | 3300005445 | Bacteria | 10483 |
| 55 | Ga0070708_100079644 | 3300005445 | Bacteria | 2964 |
| 56 | Ga0070678_100214770 | 3300005456 | Bacteria | 1596 |
| 57 | Ga0070681_10127261 | 3300005458 | Bacteria | 2480 |
| 58 | Ga0070681_10134586 | 3300005458 | Bacteria | 2402 |
| 59 | Ga0070681_10226988 | 3300005458 | Bacteria | 1782 |
| 60 | Ga0068867_100019588 | 3300005459 | Bacteria | 4820 |
| 61 | Ga0068867_100100141 | 3300005459 | Bacteria | 2212 |
| 62 | Ga0070685_10045697 | 3300005466 | Bacteria | 2512 |
| 63 | Ga0070706_100002093 | 3300005467 | Bacteria | 20344 |
| 64 | Ga0070706_100002254 | 3300005467 | Bacteria | 19538 |
| 65 | Ga0070706_100002696 | 3300005467 | Bacteria | 17765 |
| 66 | Ga0070706_100004795 | 3300005467 | Bacteria | 12963 |
| 67 | Ga0070707_100000106 | 3300005468 | Bacteria | 76457 |
| 68 | Ga0070707_100017908 | 3300005468 | Bacteria | 6660 |
| 69 | Ga0070707_100018867 | 3300005468 | Bacteria | 6495 |
| 70 | Ga0070707_100033867 | 3300005468 | Bacteria | 4871 |
| 71 | Ga0070707_100034724 | 3300005468 | Bacteria | 4811 |
| 72 | Ga0070707_100152310 | 3300005468 | Bacteria | 2252 |
| 73 | Ga0070698_100001656 | 3300005471 | Bacteria | 24850 |
| 74 | Ga0070698_100012308 | 3300005471 | Bacteria | 9059 |
| 75 | Ga0070698_100020442 | 3300005471 | Bacteria | 6939 |
| 76 | Ga0070698_100025667 | 3300005471 | Bacteria | 6139 |
| 77 | Ga0070698_100035179 | 3300005471 | Bacteria | 5180 |
| 78 | Ga0070698_100037340 | 3300005471 | Bacteria | 5009 |
| 79 | Ga0070698_100039110 | 3300005471 | Bacteria | 4884 |
| 80 | Ga0070698_100068063 | 3300005471 | Bacteria | 3580 |
| 81 | Ga0070698_100092034 | 3300005471 | Bacteria | 3014 |
| 82 | Ga0070698_100137974 | 3300005471 | Bacteria | 2392 |
| 83 | Ga0070699_100002052 | 3300005518 | Bacteria | 18213 |
| 84 | Ga0070699_100004274 | 3300005518 | Bacteria | 12627 |
| 85 | Ga0070699_100004509 | 3300005518 | Bacteria | 12321 |
| 86 | Ga0070699_100017985 | 3300005518 | Bacteria | 6071 |
| 87 | Ga0070699_100040039 | 3300005518 | Bacteria | 4058 |
| 88 | Ga0070699_100043363 | 3300005518 | Bacteria | 3894 |
| 89 | Ga0070699_100099602 | 3300005518 | Bacteria | 2547 |
| 90 | Ga0070699_100110737 | 3300005518 | Bacteria | 2410 |
| 91 | Ga0070699_100121435 | 3300005518 | Bacteria | 2298 |
| 92 | Ga0070699_100218781 | 3300005518 | Unclassified | 1697 |
| 93 | Ga0070699_100339360 | 3300005518 | Bacteria | 1352 |
| 94 | Ga0070679_100030679 | 3300005530 | Bacteria | 5309 |
| 95 | Ga0070679_100038913 | 3300005530 | Bacteria | 4729 |
| 96 | Ga0070679_100058522 | 3300005530 | Bacteria | 3840 |
| 97 | Ga0070684_100000189 | 3300005535 | Bacteria | 42780 |
| 98 | Ga0070684_100035605 | 3300005535 | Bacteria | 4261 |
| 99 | Ga0070684_100195748 | 3300005535 | Bacteria | 1840 |
| 100 | Ga0070697_100000021 | 3300005536 | Bacteria | 138216 |
| 101 | Ga0070697_100018839 | 3300005536 | Bacteria | 5446 |
| 102 | Ga0070697_100215645 | 3300005536 | Bacteria | 1635 |
| 103 | Ga0068853_100057610 | 3300005539 | Bacteria | 3354 |
| 104 | Ga0070686_100015781 | 3300005544 | Bacteria | 4384 |
| 105 | Ga0070695_100008748 | 3300005545 | Bacteria | 6012 |
| 106 | Ga0070695_100061981 | 3300005545 | Bacteria | 2428 |
| 107 | Ga0070696_100002222 | 3300005546 | Bacteria | 12795 |
| 108 | Ga0070693_100000033 | 3300005547 | Bacteria | 52337 |
| 109 | Ga0070704_100003023 | 3300005549 | Bacteria | 9569 |
| 110 | Ga0070704_100025932 | 3300005549 | Bacteria | 3865 |
| 111 | Ga0070704_100244135 | 3300005549 | Bacteria | 1471 |
| 112 | Ga0070664_100001269 | 3300005564 | Bacteria | 20199 |
| 113 | Ga0070664_100084994 | 3300005564 | Bacteria | 2732 |
| 114 | Ga0068857_100000218 | 3300005577 | Bacteria | 37864 |
| 115 | Ga0068857_100042921 | 3300005577 | Bacteria | 4012 |
| 116 | Ga0068852_100149020 | 3300005616 | Bacteria | 2174 |
| 117 | Ga0068859_100017869 | 3300005617 | Bacteria | 7129 |
| 118 | Ga0068859_100079723 | 3300005617 | Bacteria | 3315 |
| 119 | Ga0068859_100190030 | 3300005617 | Bacteria | 2138 |
| 120 | Ga0068859_100241562 | 3300005617 | Bacteria | 1895 |
| 121 | Ga0068859_100279545 | 3300005617 | Unclassified | 1762 |
| 122 | Ga0068864_100020720 | 3300005618 | Bacteria | 5502 |
| 123 | Ga0068864_100028644 | 3300005618 | Bacteria | 4710 |
| 124 | Ga0068861_100030632 | 3300005719 | Bacteria | 3945 |
| 125 | Ga0068861_100330615 | 3300005719 | Bacteria | 1330 |
| 126 | Ga0068870_10010664 | 3300005840 | Bacteria | 4229 |
| 127 | Ga0068863_100145983 | 3300005841 | Bacteria | 2263 |
| 128 | Ga0068858_100018043 | 3300005842 | Bacteria | 6608 |
| 129 | Ga0068858_100116386 | 3300005842 | Bacteria | 2498 |
| 130 | Ga0068858_100155768 | 3300005842 | Bacteria | 2149 |
| 131 | Ga0068858_100177747 | 3300005842 | Bacteria | 2009 |
| 132 | Ga0068860_100002847 | 3300005843 | Bacteria | 17956 |
| 133 | Ga0068860_100046250 | 3300005843 | Unclassified | 4149 |
| 134 | Ga0068860_100132387 | 3300005843 | Bacteria | 2394 |
| 135 | Ga0068860_100135281 | 3300005843 | Bacteria | 2367 |
| 136 | Ga0068860_100174378 | 3300005843 | Bacteria | 2078 |
| 137 | Ga0068862_100011331 | 3300005844 | Bacteria | 7361 |
| 138 | Ga0068862_100077639 | 3300005844 | Bacteria | 2876 |
| 139 | Ga0068862_100161892 | 3300005844 | Bacteria | 1998 |
| 140 | Ga0068862_100231877 | 3300005844 | Bacteria | 1675 |
| 141 | Ga0081455_10005145 | 3300005937 | Bacteria | 14409 |
| 142 | Ga0081455_10020573 | 3300005937 | Bacteria | 6209 |
| 143 | Ga0081455_10170250 | 3300005937 | Bacteria | 1660 |
| 144 | Ga0081538_10006773 | 3300005981 | Bacteria | 10013 |
| 145 | Ga0081540_1002636 | 3300005983 | Bacteria | 14577 |
| 146 | Ga0081539_10000065 | 3300005985 | Bacteria | 246571 |
| 147 | Ga0081539_10001174 | 3300005985 | Bacteria | 47435 |
| 148 | Ga0081539_10001257 | 3300005985 | Bacteria | 44920 |
| 149 | Ga0081539_10002137 | 3300005985 | Bacteria | 29184 |
| 150 | Ga0081539_10006624 | 3300005985 | Bacteria | 10996 |
| 151 | Ga0081539_10008006 | 3300005985 | Bacteria | 9380 |
| 152 | Ga0081539_10062145 | 3300005985 | Bacteria | 2042 |
| 153 | Ga0075365_10003491 | 3300006038 | Bacteria | 8117 |
| 154 | Ga0075365_10082415 | 3300006038 | Bacteria | 2181 |
| 155 | Ga0075368_10040308 | 3300006042 | Bacteria | 1833 |
| 156 | Ga0075363_100042432 | 3300006048 | Bacteria | 2404 |
| 157 | Ga0075364_10009449 | 3300006051 | Bacteria | 5852 |
| 158 | Ga0075364_10009689 | 3300006051 | Bacteria | 5788 |
| 159 | Ga0075364_10018652 | 3300006051 | Bacteria | 4346 |
| 160 | Ga0075364_10067587 | 3300006051 | Bacteria | 2349 |
| 161 | Ga0075364_10175820 | 3300006051 | Bacteria | 1448 |
| 162 | Ga0075432_10004747 | 3300006058 | Bacteria | 4627 |
| 163 | Ga0070715_10000032 | 3300006163 | Bacteria | 83594 |
| 164 | Ga0070716_100027015 | 3300006173 | Bacteria | 3079 |
| 165 | Ga0075362_10002794 | 3300006177 | Bacteria | 5951 |
| 166 | Ga0075362_10009236 | 3300006177 | Bacteria | 3804 |
| 167 | Ga0075362_10037874 | 3300006177 | Bacteria | 2116 |
| 168 | Ga0075367_10019859 | 3300006178 | Bacteria | 3732 |
| 169 | Ga0075367_10058297 | 3300006178 | Bacteria | 2297 |
| 170 | Ga0075427_10007862 | 3300006194 | Bacteria | 1573 |
| 171 | Ga0075366_10000144 | 3300006195 | Bacteria | 29999 |
| 172 | Ga0075366_10067674 | 3300006195 | Bacteria | 2125 |
| 173 | Ga0097621_100003458 | 3300006237 | Bacteria | 10883 |
| 174 | Ga0097621_100145060 | 3300006237 | Bacteria | 2032 |
| 175 | Ga0068871_100002861 | 3300006358 | Bacteria | 11824 |
| 176 | Ga0068871_100009590 | 3300006358 | Bacteria | 7026 |
| 177 | Ga0068871_100171981 | 3300006358 | Bacteria | 1858 |
| 178 | Ga0075428_100011532 | 3300006844 | Bacteria | 9829 |
| 179 | Ga0075428_100037332 | 3300006844 | Bacteria | 5349 |
| 180 | Ga0075428_100037707 | 3300006844 | Bacteria | 5319 |
| 181 | Ga0075428_100039872 | 3300006844 | Bacteria | 5169 |
| 182 | Ga0075428_100215203 | 3300006844 | Bacteria | 2076 |
| 183 | Ga0075430_100011648 | 3300006846 | Bacteria | 7482 |
| 184 | Ga0075430_100026321 | 3300006846 | Bacteria | 4950 |
| 185 | Ga0075430_100066517 | 3300006846 | Unclassified | 3026 |
| 186 | Ga0075431_100000336 | 3300006847 | Bacteria | 36980 |
| 187 | Ga0075431_100008530 | 3300006847 | Bacteria | 10261 |
| 188 | Ga0075431_100036660 | 3300006847 | Bacteria | 5051 |
| 189 | Ga0075431_100069171 | 3300006847 | Bacteria | 3643 |
| 190 | Ga0075431_100132679 | 3300006847 | Bacteria | 2568 |
| 191 | Ga0075431_100153943 | 3300006847 | Bacteria | 2366 |
| 192 | Ga0075433_10002786 | 3300006852 | Bacteria | 13377 |
| 193 | Ga0075433_10010811 | 3300006852 | Bacteria | 7341 |
| 194 | Ga0075433_10027161 | 3300006852 | Bacteria | 4852 |
| 195 | Ga0075433_10049955 | 3300006852 | Bacteria | 3640 |
| 196 | Ga0075429_100010868 | 3300006880 | Bacteria | 7872 |
| 197 | Ga0075429_100011153 | 3300006880 | Bacteria | 7780 |
| 198 | Ga0075429_100048806 | 3300006880 | Bacteria | 3681 |
| 199 | Ga0075429_100057680 | 3300006880 | Bacteria | 3381 |
| 200 | Ga0075429_100069035 | 3300006880 | Bacteria | 3077 |
| 201 | Ga0075429_100095295 | 3300006880 | Bacteria | 2595 |
| 202 | Ga0075429_100132595 | 3300006880 | Bacteria | 2180 |
| 203 | Ga0075429_100283898 | 3300006880 | Bacteria | 1450 |
| 204 | Ga0068865_100003256 | 3300006881 | Bacteria | 9730 |
| 205 | Ga0068865_100082466 | 3300006881 | Bacteria | 2311 |
| 206 | Ga0075436_100012780 | 3300006914 | Bacteria | 5756 |
| 207 | Ga0075436_100055875 | 3300006914 | Bacteria | 2727 |
| 208 | Ga0097620_100017870 | 3300006931 | Bacteria | 7129 |
| 209 | Ga0097620_100079723 | 3300006931 | Bacteria | 3315 |
| 210 | Ga0097620_100190033 | 3300006931 | Bacteria | 2138 |
| 211 | Ga0097620_100241585 | 3300006931 | Bacteria | 1895 |
| 212 | Ga0097620_100279530 | 3300006931 | Unclassified | 1762 |
| 213 | Ga0099794_10045833 | 3300007265 | Bacteria | 2093 |
| 214 | Ga0105240_10213295 | 3300009093 | Bacteria | 2254 |
| 215 | Ga0111539_10008359 | 3300009094 | Bacteria | 13169 |
| 216 | Ga0111539_10020698 | 3300009094 | Bacteria | 8100 |
| 217 | Ga0111539_10029848 | 3300009094 | Bacteria | 6634 |
| 218 | Ga0111539_10030390 | 3300009094 | Bacteria | 6565 |
| 219 | Ga0111539_10042916 | 3300009094 | Bacteria | 5427 |
| 220 | Ga0111539_10063129 | 3300009094 | Bacteria | 4383 |
| 221 | Ga0111539_10106678 | 3300009094 | Bacteria | 3286 |
| 222 | Ga0111539_10107532 | 3300009094 | Bacteria | 3273 |
| 223 | Ga0111539_10122163 | 3300009094 | Bacteria | 3052 |
| 224 | Ga0111539_10258642 | 3300009094 | Bacteria | 2027 |
| 225 | Ga0111539_10312785 | 3300009094 | Bacteria | 1828 |
| 226 | Ga0105245_10008870 | 3300009098 | Bacteria | 8774 |
| 227 | Ga0105245_10378680 | 3300009098 | Bacteria | 1409 |
| 228 | Ga0114129_10003317 | 3300009147 | Bacteria | 22611 |
| 229 | Ga0114129_10004808 | 3300009147 | Bacteria | 19092 |
| 230 | Ga0114129_10008657 | 3300009147 | Bacteria | 14506 |
| 231 | Ga0114129_10031968 | 3300009147 | Bacteria | 7440 |
| 232 | Ga0114129_10047931 | 3300009147 | Bacteria | 6003 |
| 233 | Ga0114129_10054706 | 3300009147 | Bacteria | 5595 |
| 234 | Ga0114129_10074761 | 3300009147 | Bacteria | 4719 |
| 235 | Ga0114129_10094455 | 3300009147 | Bacteria | 4141 |
| 236 | Ga0114129_10127808 | 3300009147 | Bacteria | 3493 |
| 237 | Ga0114129_10130106 | 3300009147 | Bacteria | 3458 |
| 238 | Ga0114129_10160411 | 3300009147 | Bacteria | 3072 |
| 239 | Ga0114129_10167193 | 3300009147 | Bacteria | 3000 |
| 240 | Ga0114129_10171607 | 3300009147 | Bacteria | 2956 |
| 241 | Ga0114129_10194543 | 3300009147 | Bacteria | 2751 |
| 242 | Ga0114129_10239312 | 3300009147 | Bacteria | 2440 |
| 243 | Ga0105243_10035929 | 3300009148 | Bacteria | 3843 |
| 244 | Ga0105243_10094921 | 3300009148 | Unclassified | 2464 |
| 245 | Ga0105243_10112251 | 3300009148 | Bacteria | 2283 |
| 246 | Ga0105243_10152082 | 3300009148 | Bacteria | 1986 |
| 247 | Ga0105243_10175211 | 3300009148 | Bacteria | 1861 |
| 248 | Ga0105243_10244368 | 3300009148 | Bacteria | 1599 |
| 249 | Ga0105243_10312253 | 3300009148 | Unclassified | 1429 |
| 250 | Ga0105242_10004777 | 3300009176 | Bacteria | 10489 |
| 251 | Ga0105242_10019579 | 3300009176 | Bacteria | 5305 |
| 252 | Ga0105242_10163133 | 3300009176 | Bacteria | 1952 |
| 253 | Ga0105242_10182658 | 3300009176 | Bacteria | 1852 |
| 254 | Ga0105248_10009040 | 3300009177 | Bacteria | 10958 |
| 255 | Ga0105248_10012017 | 3300009177 | Bacteria | 9548 |
| 256 | Ga0105248_10013857 | 3300009177 | Bacteria | 8870 |
| 257 | Ga0105248_10014785 | 3300009177 | Bacteria | 8594 |
| 258 | Ga0105248_10351788 | 3300009177 | Unclassified | 1659 |
| 259 | Ga0105248_10399363 | 3300009177 | Bacteria | 1548 |
| 260 | Ga0105237_10011654 | 3300009545 | Bacteria | 9302 |
| 261 | Ga0105237_10126135 | 3300009545 | Bacteria | 2554 |
| 262 | Ga0105237_10309170 | 3300009545 | Bacteria | 1584 |
| 263 | Ga0105249_10003642 | 3300009553 | Bacteria | 13316 |
| 264 | Ga0105249_10018289 | 3300009553 | Bacteria | 6231 |
| 265 | Ga0105249_10055903 | 3300009553 | Bacteria | 3613 |
| 266 | Ga0105249_10075832 | 3300009553 | Bacteria | 3115 |
| 267 | Ga0105249_10118822 | 3300009553 | Bacteria | 2510 |
| 268 | Ga0105249_10163885 | 3300009553 | Bacteria | 2150 |
| 269 | Ga0105239_10025091 | 3300010375 | Bacteria | 6567 |
| 270 | Ga0105239_10031318 | 3300010375 | Bacteria | 5850 |
| 271 | Ga0105246_10014418 | 3300011119 | Bacteria | 4971 |
| 272 | Ga0105246_10052356 | 3300011119 | Bacteria | 2806 |
| 273 | Ga0157373_10087227 | 3300013100 | Bacteria | 2199 |
| 274 | Ga0157370_10011971 | 3300013104 | Bacteria | 9044 |
| 275 | Ga0157369_10004434 | 3300013105 | Bacteria | 16566 |
| 276 | Ga0157374_10007459 | 3300013296 | Bacteria | 9327 |
| 277 | Ga0157378_10000071 | 3300013297 | Bacteria | 91313 |
| 278 | Ga0157378_10076540 | 3300013297 | Bacteria | 3015 |
| 279 | Ga0157378_10166097 | 3300013297 | Bacteria | 2067 |
| 280 | Ga0163162_10001941 | 3300013306 | Bacteria | 19426 |
| 281 | Ga0163162_10013390 | 3300013306 | Bacteria | 8009 |
| 282 | Ga0163162_10071470 | 3300013306 | Bacteria | 3523 |
| 283 | Ga0163162_10268339 | 3300013306 | Bacteria | 1838 |
| 284 | Ga0163162_10279721 | 3300013306 | Bacteria | 1801 |
| 285 | Ga0157372_10011641 | 3300013307 | Bacteria | 9365 |
| 286 | Ga0157372_10223816 | 3300013307 | Bacteria | 2181 |
| 287 | Ga0157375_10023986 | 3300013308 | Bacteria | 5638 |
| 288 | Ga0157375_10342950 | 3300013308 | Bacteria | 1659 |
| 289 | Ga0163163_10000003 | 3300014325 | Bacteria | 455102 |
| 290 | Ga0163163_10056578 | 3300014325 | Bacteria | 3877 |
| 291 | Ga0163163_10148442 | 3300014325 | Bacteria | 2389 |
| 292 | Ga0163163_10152427 | 3300014325 | Bacteria | 2355 |
| 293 | Ga0157380_10018086 | 3300014326 | Bacteria | 5228 |
| 294 | Ga0157380_10073522 | 3300014326 | Bacteria | 2772 |
| 295 | Ga0157380_10178690 | 3300014326 | Bacteria | 1863 |
| 296 | Ga0157380_10351651 | 3300014326 | Bacteria | 1379 |
| 297 | Ga0157377_10028727 | 3300014745 | Bacteria | 2996 |
| 298 | Ga0157376_10002785 | 3300014969 | Bacteria | 11941 |
| 299 | Ga0157376_10033175 | 3300014969 | Bacteria | 4153 |
| 300 | Ga0163161_10121259 | 3300017792 | Bacteria | 1965 |
| 301 | Ga0206350_10082429 | 3300020080 | Bacteria | 1990 |
| 302 | Ga0213873_10002975 | 3300021358 | Bacteria | 3001 |
| 303 | Ga0213876_10006799 | 3300021384 | Bacteria | 6246 |
| 304 | Ga0213876_10045205 | 3300021384 | Bacteria | 2329 |
| 305 | Ga0224712_10049352 | 3300022467 | Bacteria | 1629 |
| 306 | Ga0207680_10153109 | 3300025903 | Bacteria | 1539 |
| 307 | Ga0207647_10022443 | 3300025904 | Bacteria | 4192 |
| 308 | Ga0207685_10000016 | 3300025905 | Bacteria | 151990 |
| 309 | Ga0207643_10000487 | 3300025908 | Bacteria | 25547 |
| 310 | Ga0207643_10004884 | 3300025908 | Bacteria | 7175 |
| 311 | Ga0207684_10001483 | 3300025910 | Bacteria | 25222 |
| 312 | Ga0207684_10002670 | 3300025910 | Bacteria | 17833 |
| 313 | Ga0207684_10004777 | 3300025910 | Bacteria | 12691 |
| 314 | Ga0207684_10004853 | 3300025910 | Bacteria | 12581 |
| 315 | Ga0207684_10103117 | 3300025910 | Bacteria | 2439 |
| 316 | Ga0207684_10184756 | 3300025910 | Bacteria | 1798 |
| 317 | Ga0207707_10070755 | 3300025912 | Bacteria | 3040 |
| 318 | Ga0207707_10094882 | 3300025912 | Bacteria | 2607 |
| 319 | Ga0207707_10184776 | 3300025912 | Bacteria | 1819 |
| 320 | Ga0207695_10000450 | 3300025913 | Bacteria | 89495 |
| 321 | Ga0207671_10080054 | 3300025914 | Bacteria | 2448 |
| 322 | Ga0207662_10007973 | 3300025918 | Bacteria | 5772 |
| 323 | Ga0207662_10054800 | 3300025918 | Bacteria | 2379 |
| 324 | Ga0207657_10021792 | 3300025919 | Bacteria | 6020 |
| 325 | Ga0207649_10016644 | 3300025920 | Bacteria | 4152 |
| 326 | Ga0207652_10028270 | 3300025921 | Bacteria | 4678 |
| 327 | Ga0207646_10006424 | 3300025922 | Bacteria | 12138 |
| 328 | Ga0207646_10020071 | 3300025922 | Bacteria | 6197 |
| 329 | Ga0207646_10034586 | 3300025922 | Bacteria | 4566 |
| 330 | Ga0207646_10060469 | 3300025922 | Bacteria | 3383 |
| 331 | Ga0207646_10112708 | 3300025922 | Bacteria | 2441 |
| 332 | Ga0207646_10244370 | 3300025922 | Bacteria | 1621 |
| 333 | Ga0207659_10000077 | 3300025926 | Bacteria | 62077 |
| 334 | Ga0207687_10009228 | 3300025927 | Bacteria | 6455 |
| 335 | Ga0207687_10063214 | 3300025927 | Bacteria | 2620 |
| 336 | Ga0207700_10053263 | 3300025928 | Bacteria | 3031 |
| 337 | Ga0207664_10025214 | 3300025929 | Bacteria | 4476 |
| 338 | Ga0207690_10016511 | 3300025932 | Bacteria | 4493 |
| 339 | Ga0207690_10082096 | 3300025932 | Bacteria | 2254 |
| 340 | Ga0207706_10051174 | 3300025933 | Bacteria | 3649 |
| 341 | Ga0207686_10010141 | 3300025934 | Bacteria | 5122 |
| 342 | Ga0207686_10012771 | 3300025934 | Bacteria | 4625 |
| 343 | Ga0207686_10054293 | 3300025934 | Bacteria | 2509 |
| 344 | Ga0207686_10081737 | 3300025934 | Bacteria | 2110 |
| 345 | Ga0207709_10175890 | 3300025935 | Bacteria | 1507 |
| 346 | Ga0207704_10004173 | 3300025938 | Bacteria | 6594 |
| 347 | Ga0207704_10074578 | 3300025938 | Bacteria | 2165 |
| 348 | Ga0207691_10043105 | 3300025940 | Bacteria | 4159 |
| 349 | Ga0207711_10019017 | 3300025941 | Bacteria | 5716 |
| 350 | Ga0207711_10054485 | 3300025941 | Bacteria | 3432 |
| 351 | Ga0207711_10061174 | 3300025941 | Bacteria | 3247 |
| 352 | Ga0207711_10141442 | 3300025941 | Bacteria | 2165 |
| 353 | Ga0207689_10002264 | 3300025942 | Bacteria | 18044 |
| 354 | Ga0207689_10008049 | 3300025942 | Bacteria | 9200 |
| 355 | Ga0207661_10005786 | 3300025944 | Bacteria | 8718 |
| 356 | Ga0207661_10015982 | 3300025944 | Bacteria | 5531 |
| 357 | Ga0207661_10261229 | 3300025944 | Bacteria | 1542 |
| 358 | Ga0207679_10042157 | 3300025945 | Bacteria | 3278 |
| 359 | Ga0207679_10074525 | 3300025945 | Bacteria | 2572 |
| 360 | Ga0207667_10166449 | 3300025949 | Bacteria | 2266 |
| 361 | Ga0207667_10169738 | 3300025949 | Bacteria | 2242 |
| 362 | Ga0207651_10023341 | 3300025960 | Bacteria | 3803 |
| 363 | Ga0207651_10080014 | 3300025960 | Bacteria | 2350 |
| 364 | Ga0207651_10140978 | 3300025960 | Bacteria | 1862 |
| 365 | Ga0207712_10027787 | 3300025961 | Bacteria | 3780 |
| 366 | Ga0207712_10043018 | 3300025961 | Bacteria | 3113 |
| 367 | Ga0207712_10171256 | 3300025961 | Bacteria | 1697 |
| 368 | Ga0207668_10103641 | 3300025972 | Bacteria | 2119 |
| 369 | Ga0207658_10049278 | 3300025986 | Bacteria | 3094 |
| 370 | Ga0207658_10301467 | 3300025986 | Bacteria | 1381 |
| 371 | Ga0207677_10147587 | 3300026023 | Bacteria | 1809 |
| 372 | Ga0207703_10036937 | 3300026035 | Bacteria | 3891 |
| 373 | Ga0207703_10133190 | 3300026035 | Bacteria | 2149 |
| 374 | Ga0207639_10033068 | 3300026041 | Bacteria | 3812 |
| 375 | Ga0207639_10218391 | 3300026041 | Bacteria | 1645 |
| 376 | Ga0207678_10010352 | 3300026067 | Bacteria | 8186 |
| 377 | Ga0207708_10001730 | 3300026075 | Bacteria | 16111 |
| 378 | Ga0207708_10025875 | 3300026075 | Bacteria | 4440 |
| 379 | Ga0207708_10060562 | 3300026075 | Bacteria | 2889 |
| 380 | Ga0207708_10071718 | 3300026075 | Bacteria | 2654 |
| 381 | Ga0207708_10254413 | 3300026075 | Bacteria | 1416 |
| 382 | Ga0207702_10269165 | 3300026078 | Bacteria | 1606 |
| 383 | Ga0207641_10036452 | 3300026088 | Bacteria | 4105 |
| 384 | Ga0207641_10140743 | 3300026088 | Bacteria | 2177 |
| 385 | Ga0207641_10232732 | 3300026088 | Bacteria | 1713 |
| 386 | Ga0207648_10028057 | 3300026089 | Bacteria | 4993 |
| 387 | Ga0207648_10043163 | 3300026089 | Bacteria | 3959 |
| 388 | Ga0207648_10091369 | 3300026089 | Bacteria | 2661 |
| 389 | Ga0207648_10101314 | 3300026089 | Bacteria | 2524 |
| 390 | Ga0207676_10025526 | 3300026095 | Bacteria | 4384 |
| 391 | Ga0207676_10030813 | 3300026095 | Bacteria | 4029 |
| 392 | Ga0207676_10078266 | 3300026095 | Bacteria | 2678 |
| 393 | Ga0207674_10000366 | 3300026116 | Bacteria | 58754 |
| 394 | Ga0207674_10002940 | 3300026116 | Bacteria | 21169 |
| 395 | Ga0207674_10022788 | 3300026116 | Bacteria | 6720 |
| 396 | Ga0207674_10052905 | 3300026116 | Bacteria | 4140 |
| 397 | Ga0207674_10070480 | 3300026116 | Bacteria | 3515 |
| 398 | Ga0207675_100005896 | 3300026118 | Bacteria | 11695 |
| 399 | Ga0207675_100017716 | 3300026118 | Bacteria | 6645 |
| 400 | Ga0207675_100128821 | 3300026118 | Bacteria | 2399 |
| 401 | Ga0207428_10006855 | 3300027907 | Bacteria | 10440 |
| 402 | Ga0207428_10097234 | 3300027907 | Bacteria | 2279 |
| 403 | Ga0207428_10129646 | 3300027907 | Bacteria | 1931 |
| 404 | Ga0268266_10323359 | 3300028379 | Bacteria | 1444 |
| 405 | Ga0268265_10132447 | 3300028380 | Bacteria | 2074 |
| 406 | Ga0268264_10031838 | 3300028381 | Bacteria | 4325 |
| 407 | Ga0268264_10175725 | 3300028381 | Bacteria | 1941 |
| 408 | Ga0268264_10429625 | 3300028381 | Bacteria | 1275 |
| 409 | Ga0265322_10032397 | 3300028654 | Bacteria | 1491 |
| 410 | Ga0265340_10009548 | 3300031247 | Bacteria | 5202 |
| 411 | Ga0265331_10007801 | 3300031250 | Bacteria | 6145 |
| 412 | Ga0265331_10012216 | 3300031250 | Bacteria | 4660 |
| 413 | Ga0265327_10002501 | 3300031251 | Bacteria | 19213 |
| 414 | Ga0265327_10013931 | 3300031251 | Bacteria | 5301 |
| 415 | Ga0307408_100054213 | 3300031548 | Bacteria | 2898 |
| 416 | Ga0307408_100055531 | 3300031548 | Bacteria | 2868 |
| 417 | Ga0307408_100176930 | 3300031548 | Bacteria | 1708 |
| 418 | Ga0316575_10031503 | 3300031665 | Bacteria | 2076 |
| 419 | Ga0316575_10063620 | 3300031665 | Unclassified | 1476 |
| 420 | Ga0316579_10001246 | 3300031691 | Bacteria | 9156 |
| 421 | Ga0316579_10001813 | 3300031691 | Bacteria | 7877 |
| 422 | Ga0316579_10017428 | 3300031691 | Bacteria | 3148 |
| 423 | Ga0316579_10026703 | 3300031691 | Bacteria | 2616 |
| 424 | Ga0316579_10046788 | 3300031691 | Bacteria | 2019 |
| 425 | Ga0316579_10047782 | 3300031691 | Bacteria | 1998 |
| 426 | Ga0316576_10000309 | 3300031727 | Bacteria | 21640 |
| 427 | Ga0316576_10004794 | 3300031727 | Bacteria | 8171 |
| 428 | Ga0316576_10027960 | 3300031727 | Bacteria | 3969 |
| 429 | Ga0316576_10030995 | 3300031727 | Bacteria | 3791 |
| 430 | Ga0316576_10040418 | 3300031727 | Bacteria | 3353 |
| 431 | Ga0316576_10041801 | 3300031727 | Bacteria | 3302 |
| 432 | Ga0316576_10049146 | 3300031727 | Bacteria | 3062 |
| 433 | Ga0316576_10077700 | 3300031727 | Bacteria | 2459 |
| 434 | Ga0316576_10083138 | 3300031727 | Unclassified | 2378 |
| 435 | Ga0316576_10129148 | 3300031727 | Bacteria | 1901 |
| 436 | Ga0316578_10000084 | 3300031728 | Bacteria | 21499 |
| 437 | Ga0316578_10022307 | 3300031728 | Bacteria | 3528 |
| 438 | Ga0307405_10006700 | 3300031731 | Bacteria | 5691 |
| 439 | Ga0316577_10001903 | 3300031733 | Bacteria | 10091 |
| 440 | Ga0316577_10003136 | 3300031733 | Bacteria | 8308 |
| 441 | Ga0316577_10011268 | 3300031733 | Bacteria | 4842 |
| 442 | Ga0316577_10053723 | 3300031733 | Bacteria | 2248 |
| 443 | Ga0316577_10158921 | 3300031733 | Unclassified | 1275 |
| 444 | Ga0307410_10076204 | 3300031852 | Bacteria | 2341 |
| 445 | Ga0307406_10051691 | 3300031901 | Bacteria | 2610 |
| 446 | Ga0307406_10099695 | 3300031901 | Bacteria | 1975 |
| 447 | Ga0307409_100005947 | 3300031995 | Bacteria | 7101 |
| 448 | Ga0307409_100072668 | 3300031995 | Bacteria | 2740 |
| 449 | Ga0307409_100082558 | 3300031995 | Bacteria | 2602 |
| 450 | Ga0307409_100181749 | 3300031995 | Bacteria | 1863 |
| 451 | Ga0307416_100006968 | 3300032002 | Bacteria | 7126 |
| 452 | Ga0307416_100042547 | 3300032002 | Bacteria | 3547 |
| 453 | Ga0307416_100169234 | 3300032002 | Bacteria | 2031 |
| 454 | Ga0307416_100392590 | 3300032002 | Bacteria | 1422 |
| 455 | Ga0307414_10029796 | 3300032004 | Bacteria | 3556 |
| 456 | Ga0307414_10082556 | 3300032004 | Bacteria | 2357 |
| 457 | Ga0307411_10060161 | 3300032005 | Bacteria | 2521 |
| 458 | Ga0307411_10073947 | 3300032005 | Bacteria | 2320 |
| 459 | Ga0307411_10108465 | 3300032005 | Bacteria | 1981 |
| 460 | Ga0307415_100021471 | 3300032126 | Bacteria | 3969 |
| 461 | Ga0307415_100024251 | 3300032126 | Bacteria | 3783 |
| 462 | Ga0307415_100218171 | 3300032126 | Unclassified | 1527 |
| 463 | Ga0316583_10004337 | 3300032133 | Bacteria | 5058 |
| 464 | Ga0316580_10000167 | 3300032139 | Bacteria | 12961 |
| 465 | Ga0316580_10031151 | 3300032139 | Bacteria | 1651 |
| 466 | Ga0316580_10053952 | 3300032139 | Bacteria | 1237 |
| 467 | Ga0316593_10000513 | 3300032168 | Bacteria | 7170 |
| 468 | Ga0316593_10001458 | 3300032168 | Bacteria | 5225 |
| 469 | Ga0316593_10039033 | 3300032168 | Bacteria | 1574 |
| 470 | Ga0316593_10049300 | 3300032168 | Bacteria | 1419 |
| 471 | Ga0316592_1002977 | 3300033524 | Bacteria | 2994 |
| 472 | Ga0316586_1006770 | 3300033527 | Bacteria | 1653 |
| 473 | Ga0316588_1001903 | 3300033528 | Bacteria | 3548 |
| 474 | Ga0316587_1008710 | 3300033529 | Bacteria | 1599 |
| 475 | Ga0316596_1002130 | 3300033541 | Bacteria | 4182 |
| 476 | Ga0316596_1003423 | 3300033541 | Bacteria | 3475 |
| 477 | Ga0316596_1018723 | 3300033541 | Bacteria | 1753 |
| 478 | Ga0373953_0018632 | 3300035117 | Bacteria | 2572 |
| 479 | Ga0373954_0036222 | 3300035118 | Bacteria | 2290 |
| 480 | Ga0373956_0006966 | 3300035119 | Bacteria | 4544 |
| 481 | Ga0373957_0002419 | 3300035120 | Bacteria | 5321 |
| 482 | Ga0373955_0008811 | 3300035172 | Bacteria | 4702 |
| 483 | Ga0373955_0017844 | 3300035172 | Bacteria | 3518 |
| 484 | Ga0316574_0002305 | 3300035398 | Bacteria | 9510 |
| 485 | Ga0316574_0026855 | 3300035398 | Unclassified | 3464 |
| 486 | Ga0316574_0043133 | 3300035398 | Bacteria | 2786 |
| 487 | Ga0316574_0054670 | 3300035398 | Bacteria | 2494 |
| 488 | Ga0316574_0060291 | 3300035398 | Bacteria | 2381 |
| 489 | Ga0316574_0076968 | 3300035398 | Bacteria | 2114 |
| 490 | Ga0316574_0079305 | 3300035398 | Unclassified | 2082 |
| 491 | Ga0316574_0160932 | 3300035398 | Bacteria | 1446 |
| 492 | Ga0373931_0039271 | 3300035691 | Bacteria | 2480 |
| 493 | Ga0373931_0097086 | 3300035691 | Bacteria | 1652 |
| 494 | Ga0373933_0007393 | 3300035724 | Bacteria | 5990 |
| 495 | Ga0373937_0009945 | 3300036401 | Bacteria | 8294 |
| 496 | Ga0373937_0240146 | 3300036401 | Bacteria | 1707 |
| 497 | Ga0316582_0000018 | 3300036647 | Bacteria | 39444 |
| 498 | Ga0316582_0000369 | 3300036647 | Bacteria | 16140 |
| 499 | Ga0316582_0000605 | 3300036647 | Bacteria | 13943 |
| 500 | Ga0316582_0016623 | 3300036647 | Bacteria | 4236 |
| 501 | Ga0316582_0026650 | 3300036647 | Bacteria | 3481 |
| 502 | Ga0316582_0114705 | 3300036647 | Bacteria | 1797 |
| 503 | Ga0316582_0125241 | 3300036647 | Bacteria | 1722 |
| 504 | Ga0316582_0227489 | 3300036647 | Bacteria | 1276 |
| 505 | Ga0316584_0000083 | 3300036712 | Bacteria | 37190 |
| 506 | Ga0316584_0004551 | 3300036712 | Bacteria | 9183 |
| 507 | Ga0316584_0008179 | 3300036712 | Bacteria | 7192 |
| 508 | Ga0316584_0018135 | 3300036712 | Bacteria | 5074 |
| 509 | Ga0316584_0026586 | 3300036712 | Bacteria | 4254 |
| 510 | Ga0316584_0034682 | 3300036712 | Bacteria | 3741 |
| 511 | Ga0316584_0037573 | 3300036712 | Bacteria | 3598 |
| 512 | Ga0316584_0043490 | 3300036712 | Bacteria | 3349 |
| 513 | Ga0316584_0051862 | 3300036712 | Bacteria | 3068 |
| 514 | Ga0316584_0076260 | 3300036712 | Bacteria | 2512 |
| 515 | Ga0316584_0082683 | 3300036712 | Bacteria | 2405 |
| 516 | Ga0316584_0152517 | 3300036712 | Unclassified | 1720 |
| 517 | Ga0316584_0174834 | 3300036712 | Bacteria | 1591 |
| 518 | Ga0395900_0022230 | 3300037418 | Bacteria | 6488 |
| 519 | Ga0395898_0086258 | 3300037466 | Bacteria | 3026 |
| 520 | Ga0316581_0000114 | 3300037588 | Bacteria | 11382 |
| 521 | Ga0316581_0019093 | 3300037588 | Bacteria | 1996 |
| 522 | Ga0316581_0022042 | 3300037588 | Bacteria | 1877 |
| 523 | Ga0395901_0023913 | 3300038443 | Bacteria | 6267 |
| 524 | Ga0400489_12788 | 3300039093 | Bacteria | 55910 |
| 525 | Ga0400489_64979 | 3300039093 | Bacteria | 4939 |
| 526 | Ga0436365_0631963 | 3300039437 | Bacteria | 2543 |
| 527 | Ga0436365_1421543 | 3300039437 | Bacteria | 10064 |
| 528 | Ga0436365_1614937 | 3300039437 | Bacteria | 2793 |
| 529 | Ga0436362_0461762 | 3300039453 | Bacteria | 5323 |
| 530 | Ga0450896_006344 | 3300042133 | Bacteria | 1622 |
| 531 | Ga0439464_0018965 | 3300042439 | Bacteria | 1875 |
| 532 | Ga0439460_0030926 | 3300042461 | Bacteria | 1525 |
| 533 | Ga0439460_0051578 | 3300042461 | Bacteria | 1235 |
| 534 | Ga0451577_0001168 | 3300042876 | Bacteria | 36979 |
| 535 | Ga0451577_0006471 | 3300042876 | Bacteria | 11671 |
| 536 | Ga0451577_0026254 | 3300042876 | Bacteria | 5276 |
| 537 | Ga0451577_0028486 | 3300042876 | Bacteria | 5051 |
| 538 | Ga0451577_0037855 | 3300042876 | Bacteria | 4341 |
| 539 | Ga0451577_0082151 | 3300042876 | Bacteria | 2874 |
| 540 | Ga0451577_0152046 | 3300042876 | Bacteria | 2083 |
| 541 | Ga0451577_0212248 | 3300042876 | Bacteria | 1749 |
| 542 | Ga0451577_0492434 | 3300042876 | Bacteria | 1113 |
| 543 | Ga0466969_0139745 | 3300044656 | Bacteria | 1120 |
| 544 | Ga0466972_0050948 | 3300044658 | Bacteria | 1998 |
| 545 | Ga0453683_0006667 | 3300044673 | Bacteria | 7900 |
| 546 | Ga0453683_0009852 | 3300044673 | Bacteria | 6367 |
| 547 | Ga0453683_0033390 | 3300044673 | Bacteria | 3244 |
| 548 | Ga0453683_0035066 | 3300044673 | Bacteria | 3162 |
| 549 | Ga0453683_0040935 | 3300044673 | Bacteria | 2909 |
| 550 | Ga0453683_0091779 | 3300044673 | Bacteria | 1904 |
| 551 | Ga0453683_0121536 | 3300044673 | Bacteria | 1644 |
| 552 | Ga0453683_0133840 | 3300044673 | Bacteria | 1563 |
| 553 | Ga0453683_0138230 | 3300044673 | Bacteria | 1537 |
| 554 | Ga0453684_0000095 | 3300044712 | Bacteria | 378681 |
| 555 | Ga0453684_0000435 | 3300044712 | Bacteria | 170233 |
| 556 | Ga0453684_0000658 | 3300044712 | Bacteria | 124108 |
| 557 | Ga0453684_0002220 | 3300044712 | Bacteria | 48195 |
| 558 | Ga0453684_0003436 | 3300044712 | Bacteria | 35721 |
| 559 | Ga0453684_0003836 | 3300044712 | Bacteria | 33167 |
| 560 | Ga0453684_0003913 | 3300044712 | Bacteria | 32729 |
| 561 | Ga0453684_0003965 | 3300044712 | Bacteria | 32341 |
| 562 | Ga0453684_0004484 | 3300044712 | Bacteria | 29353 |
| 563 | Ga0453684_0005006 | 3300044712 | Bacteria | 26923 |
| 564 | Ga0453684_0007770 | 3300044712 | Bacteria | 19567 |
| 565 | Ga0453684_0008106 | 3300044712 | Bacteria | 18986 |
| 566 | Ga0453684_0019525 | 3300044712 | Bacteria | 10308 |
| 567 | Ga0453684_0020898 | 3300044712 | Bacteria | 9823 |
| 568 | Ga0453684_0024301 | 3300044712 | Bacteria | 8863 |
| 569 | Ga0453684_0030731 | 3300044712 | Bacteria | 7577 |
| 570 | Ga0453684_0041143 | 3300044712 | Bacteria | 6258 |
| 571 | Ga0453684_0065079 | 3300044712 | Bacteria | 4652 |
| 572 | Ga0453684_0078159 | 3300044712 | Bacteria | 4142 |
| 573 | Ga0453684_0108575 | 3300044712 | Bacteria | 3377 |
| 574 | Ga0453684_0134928 | 3300044712 | Bacteria | 2957 |
| 575 | Ga0453684_0145691 | 3300044712 | Bacteria | 2822 |
| 576 | Ga0453684_0162017 | 3300044712 | Bacteria | 2644 |
| 577 | Ga0453684_0171460 | 3300044712 | Bacteria | 2557 |
| 578 | Ga0453684_0221663 | 3300044712 | Bacteria | 2190 |
| 579 | Ga0453684_0232435 | 3300044712 | Bacteria | 2128 |
| 580 | Ga0453684_0252026 | 3300044712 | Bacteria | 2027 |
| 581 | Ga0453684_0272831 | 3300044712 | Bacteria | 1932 |
| 582 | Ga0451576_0000009 | 3300045051 | Bacteria | 712666 |
| 583 | Ga0451576_0004137 | 3300045051 | Bacteria | 19130 |
| 584 | Ga0451576_0013764 | 3300045051 | Bacteria | 9036 |
| 585 | Ga0451576_0039537 | 3300045051 | Bacteria | 4992 |
| 586 | Ga0451576_0100187 | 3300045051 | Bacteria | 3013 |
| 587 | Ga0451576_0112435 | 3300045051 | Bacteria | 2834 |
| 588 | Ga0451576_0362340 | 3300045051 | Bacteria | 1518 |
| 589 | Ga0451576_0487085 | 3300045051 | Bacteria | 1295 |
| 590 | Ga0451576_0799112 | 3300045051 | Bacteria | 991 |
| 591 | Ga0466958_0083916 | 3300045836 | Bacteria | 1964 |
| 592 | Ga0466967_0113928 | 3300045976 | Bacteria | 2489 |
| 593 | Ga0495592_0040849 | 3300046454 | Bacteria | 3479 |
| 594 | Ga0495629_0032995 | 3300046459 | Bacteria | 3664 |
| 595 | Ga0495629_0083396 | 3300046459 | Bacteria | 2231 |
| 596 | Ga0495651_0021110 | 3300046462 | Bacteria | 5058 |
| 597 | Ga0495580_0096768 | 3300046472 | Bacteria | 2053 |
| 598 | Ga0495664_0058025 | 3300046477 | Bacteria | 2303 |
| 599 | Ga0495585_0041323 | 3300046492 | Bacteria | 2586 |
| 600 | Ga0495607_0039078 | 3300046501 | Bacteria | 2836 |
| 601 | Ga0495631_0074918 | 3300046518 | Bacteria | 1461 |
| 602 | Ga0495644_0049478 | 3300046523 | Bacteria | 1578 |
| 603 | Ga0495586_0164446 | 3300046535 | Bacteria | 1252 |
| 604 | Ga0495587_0013497 | 3300046536 | Bacteria | 5133 |
| 605 | Ga0495609_0045025 | 3300046538 | Bacteria | 1978 |
| 606 | Ga0495667_0147987 | 3300046559 | Bacteria | 1512 |
| 607 | Ga0495634_0020169 | 3300046642 | Bacteria | 4729 |
| 608 | Ga0495599_0143843 | 3300046678 | Bacteria | 1479 |
| 609 | Ga0495647_0044483 | 3300046681 | Bacteria | 1703 |
| 610 | Ga0495669_0031718 | 3300046684 | Bacteria | 2321 |
| 611 | Ga0495613_0037349 | 3300046689 | Bacteria | 3601 |
| 612 | Ga0495613_0091922 | 3300046689 | Bacteria | 2198 |
| 613 | Ga0495600_0034985 | 3300046809 | Bacteria | 3262 |
| 614 | Ga0495672_0000950 | 3300047320 | Bacteria | 30212 |
| 615 | Ga0495680_0151811 | 3300047322 | Bacteria | 1688 |
| 616 | Ga0495684_0013272 | 3300047471 | Bacteria | 6352 |
| 617 | Ga0495684_0128210 | 3300047471 | Unclassified | 1907 |
| 618 | Ga0496100_0090488 | 3300048903 | Bacteria | 2087 |
| 619 | Ga0496103_0079054 | 3300048906 | Bacteria | 2066 |
| 620 | Ga0496104_0066776 | 3300048907 | Bacteria | 3415 |
| 621 | Ga0496105_0032388 | 3300048908 | Bacteria | 4289 |
| 622 | Ga0496109_0000050 | 3300048912 | Bacteria | 126918 |
| 623 | Ga0496109_0005550 | 3300048912 | Bacteria | 10565 |
| 624 | Ga0496110_0045619 | 3300048913 | Bacteria | 3832 |
| 625 | Ga0496111_0036468 | 3300048914 | Bacteria | 3516 |
| 626 | Ga0496112_0044568 | 3300048915 | Bacteria | 4347 |
| 627 | Ga0496112_0326263 | 3300048915 | Bacteria | 1479 |
| 628 | Ga0496114_0006966 | 3300048917 | Bacteria | 8907 |
| 629 | Ga0496115_0036066 | 3300048918 | Bacteria | 3914 |
| 630 | Ga0501299_001397 | 3300049522 | Bacteria | 3091 |
| 631 | Ga0501032_0055085 | 3300049569 | Bacteria | 2676 |
| 632 | Ga0501034_0000697 | 3300049571 | Bacteria | 51021 |
| 633 | Ga0501034_0003324 | 3300049571 | Bacteria | 18349 |
| 634 | Ga0501034_0180638 | 3300049571 | Bacteria | 2075 |
| 635 | Ga0501036_0154084 | 3300049572 | Bacteria | 1938 |
| 636 | Ga0501038_0107537 | 3300049574 | Bacteria | 2314 |
| 637 | Ga0501038_0136779 | 3300049574 | Bacteria | 2007 |
| 638 | Ga0501039_0038917 | 3300049575 | Bacteria | 3673 |
| 639 | Ga0501040_0009945 | 3300049576 | Bacteria | 6211 |
| 640 | Ga0501040_0060232 | 3300049576 | Bacteria | 2609 |
| 641 | Ga0501041_0194324 | 3300049577 | Bacteria | 1271 |
| 642 | Ga0501042_0013395 | 3300049578 | Bacteria | 5579 |
| 643 | Ga0501042_0018988 | 3300049578 | Bacteria | 4769 |
| 644 | Ga0501046_0102017 | 3300049580 | Bacteria | 2200 |
| 645 | Ga0501048_0044030 | 3300049582 | Bacteria | 3193 |
| 646 | Ga0501070_0032505 | 3300049586 | Bacteria | 4367 |
| 647 | Ga0501071_0015413 | 3300049587 | Bacteria | 5247 |
| 648 | Ga0501071_0041682 | 3300049587 | Bacteria | 3288 |
| 649 | Ga0501071_0042535 | 3300049587 | Bacteria | 3256 |
| 650 | Ga0501071_0064339 | 3300049587 | Bacteria | 2661 |
| 651 | Ga0501072_0023275 | 3300049588 | Bacteria | 4811 |
| 652 | Ga0501072_0074195 | 3300049588 | Bacteria | 2690 |
| 653 | Ga0501072_0086859 | 3300049588 | Bacteria | 2482 |
| 654 | Ga0501072_0140446 | 3300049588 | Bacteria | 1926 |
| 655 | Ga0501075_0001982 | 3300049591 | Bacteria | 13529 |
| 656 | Ga0501075_0112878 | 3300049591 | Bacteria | 2066 |
| 657 | Ga0501075_0169159 | 3300049591 | Bacteria | 1667 |
| 658 | Ga0501075_0173705 | 3300049591 | Bacteria | 1644 |
| 659 | Ga0501076_0044694 | 3300049592 | Bacteria | 3493 |
| 660 | Ga0501077_0098978 | 3300049593 | Bacteria | 1848 |
| 661 | Ga0501217_000598 | 3300049661 | Bacteria | 6090 |
| 662 | Ga0501233_001709 | 3300049668 | Bacteria | 3777 |
| 663 | Ga0501235_003236 | 3300049669 | Bacteria | 3513 |
| 664 | Ga0501249_012311 | 3300049679 | Bacteria | 1807 |
| 665 | Ga0501225_0006935 | 3300049705 | Bacteria | 3299 |
| 666 | Ga0501225_0009293 | 3300049705 | Bacteria | 2802 |
| 667 | Ga0501079_0023424 | 3300049741 | Bacteria | 4738 |
| 668 | Ga0501079_0174533 | 3300049741 | Bacteria | 1676 |
| 669 | Ga0501079_0250343 | 3300049741 | Bacteria | 1385 |
| 670 | Ga0501080_0115005 | 3300049742 | Bacteria | 2495 |
| 671 | Ga0501081_0046648 | 3300049743 | Bacteria | 2979 |
| 672 | Ga0501081_0048754 | 3300049743 | Bacteria | 2915 |
| 673 | Ga0501268_009470 | 3300049765 | Bacteria | 1498 |
| 674 | Ga0501035_0063591 | 3300049822 | Bacteria | 3282 |
| 675 | nmdc:mga00v17_15302_c1 | 3300050491 | Bacteria | 4305 |
| 676 | nmdc:mga0yw44_124318_c1 | 3300050492 | Bacteria | 1664 |
| 677 | nmdc:mga0k408_73239_c1 | 3300050493 | Bacteria | 2001 |
| 678 | nmdc:mga0k408_8092_c1 | 3300050493 | Bacteria | 5637 |
| 679 | nmdc:mga06z11_35150_c1 | 3300050494 | Bacteria | 2465 |
| 680 | nmdc:mga06z11_91309_c1 | 3300050494 | Bacteria | 1653 |
| 681 | nmdc:mga07m45_186729_c1 | 3300050496 | Bacteria | 1205 |
| 682 | nmdc:mga05p37_11687_c1 | 3300050507 | Bacteria | 10462 |
| 683 | nmdc:mga05p37_118770_c1 | 3300050507 | Bacteria | 3249 |
| 684 | nmdc:mga05p37_146037_c1 | 3300050507 | Bacteria | 2897 |
| 685 | nmdc:mga05p37_148043_c1 | 3300050507 | Bacteria | 2874 |
| 686 | nmdc:mga05p37_169131_c1 | 3300050507 | Bacteria | 2666 |
| 687 | nmdc:mga05p37_22379_c1 | 3300050507 | Bacteria | 3009 |
| 688 | nmdc:mga05p37_237139_c1 | 3300050507 | Bacteria | 2195 |
| 689 | nmdc:mga05p37_25707_c1 | 3300050507 | Bacteria | 7160 |
| 690 | nmdc:mga05p37_26155_c2 | 3300050507 | Bacteria | 1759 |
| 691 | nmdc:mga05p37_35213_c1 | 3300050507 | Bacteria | 6137 |
| 692 | nmdc:mga05p37_379521_c1 | 3300050507 | Bacteria | 1657 |
| 693 | nmdc:mga05p37_574671_c1 | 3300050507 | Bacteria | 1278 |
| 694 | nmdc:mga05p37_72754_c1 | 3300050507 | Bacteria | 4230 |
| 695 | nmdc:mga05p37_7639_c1 | 3300050507 | Bacteria | 12758 |
| 696 | nmdc:mga05p37_81158_c1 | 3300050507 | Bacteria | 3995 |
| 697 | nmdc:mga09592_13586_c1 | 3300050508 | Bacteria | 6652 |
| 698 | nmdc:mga09592_150172_c1 | 3300050508 | Bacteria | 2010 |
| 699 | nmdc:mga09592_167553_c1 | 3300050508 | Bacteria | 1899 |
| 700 | nmdc:mga09592_216305_c1 | 3300050508 | Bacteria | 1660 |
| 701 | nmdc:mga09592_333416_c1 | 3300050508 | Bacteria | 1313 |
| 702 | nmdc:mga09592_63580_c1 | 3300050508 | Bacteria | 3124 |
| 703 | nmdc:mga09592_70468_c1 | 3300050508 | Bacteria | 2966 |
| 704 | nmdc:mga09592_8755_c1 | 3300050508 | Bacteria | 8234 |
| 705 | nmdc:mga0qj67_158450_c1 | 3300050509 | Bacteria | 1838 |
| 706 | nmdc:mga0qj67_22837_c1 | 3300050509 | Bacteria | 4806 |
| 707 | nmdc:mga0qj67_71412_c1 | 3300050509 | Unclassified | 2771 |
| 708 | nmdc:mga06r32_294907_c1 | 3300050510 | Bacteria | 1608 |
| 709 | nmdc:mga06r32_3413_c1 | 3300050510 | Bacteria | 14211 |
| 710 | nmdc:mga06r32_78363_c1 | 3300050510 | Plasmid | 3212 |
| 711 | nmdc:mga06r32_87376_c1 | 3300050510 | Bacteria | 3042 |
| 712 | nmdc:mga06r32_99097_c1 | 3300050510 | Bacteria | 2858 |
| 713 | nmdc:mga08y16_117024_c1 | 3300050511 | Bacteria | 2775 |
| 714 | nmdc:mga08y16_2001_c1 | 3300050511 | Bacteria | 20837 |
| 715 | nmdc:mga08y16_301089_c1 | 3300050511 | Bacteria | 1653 |
| 716 | nmdc:mga08y16_49839_c1 | 3300050511 | Bacteria | 4381 |
| 717 | nmdc:mga08y16_65119_c1 | 3300050511 | Bacteria | 3805 |
| 718 | nmdc:mga08y16_91753_c1 | 3300050511 | Bacteria | 3165 |
| 719 | nmdc:mga08y16_9570_c1 | 3300050511 | Bacteria | 10172 |
| 720 | nmdc:mga0n895_46412_c1 | 3300050512 | Bacteria | 4244 |
| 721 | nmdc:mga08x19_37210_c1 | 3300050514 | Bacteria | 3087 |
| 722 | nmdc:mga08x19_47369_c1 | 3300050514 | Bacteria | 2751 |
| 723 | nmdc:mga0a205_10028_c1 | 3300050515 | Bacteria | 8690 |
| 724 | nmdc:mga0a205_132248_c1 | 3300050515 | Bacteria | 2396 |
| 725 | nmdc:mga0a205_142146_c1 | 3300050515 | Bacteria | 2300 |
| 726 | nmdc:mga0a205_147995_c1 | 3300050515 | Bacteria | 2248 |
| 727 | nmdc:mga0a205_4149_c1 | 3300050515 | Bacteria | 12975 |
| 728 | nmdc:mga0a205_58118_c1 | 3300050515 | Bacteria | 3735 |
| 729 | Ga0495619_0008599 | 3300053085 | Bacteria | 6459 |
| 730 | Ga0495619_0077653 | 3300053085 | Bacteria | 2231 |
| 731 | Ga0500555_002121 | 3300053103 | Bacteria | 5806 |
| 732 | Ga0501084_0101804 | 3300054114 | Bacteria | 2412 |
| 733 | Ga0590071_026465 | 3300059421 | Bacteria | 1376 |
| 734 | Ga0590075_006066 | 3300059424 | Bacteria | 2861 |
| 735 | Ga0590077_001730 | 3300059426 | Bacteria | 4940 |
| 736 | Ga0501082_0123324 | 3300060353 | Bacteria | 2247 |
| 737 | Ga0501082_0160466 | 3300060353 | Bacteria | 1954 |
| 738 | Ga0530510_0029255 | 3300061734 | Bacteria | 3954 |
| 739 | Ga0530510_0041831 | 3300061734 | Bacteria | 3309 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300028379 | Ga0268266_10323359 | Ga0268266_103233591 | 292 |
| 2 | 3300045051 | Ga0451576_0799112 | Ga0451576_0799112_32_931 | 296 |
| 3 | 3300025941 | Ga0207711_10019017 | Ga0207711_100190174 | 311 |
| 4 | 3300048906 | Ga0496103_0079054 | Ga0496103_0079054_1017_2054 | 326 |
| 5 | 3300050507 | nmdc:mga05p37_379521_c1 | nmdc:mga05p37_379521_c1_20_1039 | 327 |
| 6 | 3300042876 | Ga0451577_0492434 | Ga0451577_0492434_48_1094 | 345 |
| 7 | 3300060353 | Ga0501082_0123324 | Ga0501082_0123324_842_1897 | 348 |
| 8 | 3300044656 | Ga0466969_0139745 | Ga0466969_0139745_19_1095 | 350 |
| 9 | 3300036712 | Ga0316584_0018135 | Ga0316584_0018135_102_1184 | 351 |
| 10 | 3300036647 | Ga0316582_0114705 | Ga0316582_0114705_685_1761 | 355 |
| 11 | 3300050508 | nmdc:mga09592_333416_c1 | nmdc:mga09592_333416_c1_11_1087 | 355 |
| 12 | 3300025941 | Ga0207711_10141442 | Ga0207711_101414422 | 356 |
| 13 | 3300048907 | Ga0496104_0066776 | Ga0496104_0066776_1049_2218 | 356 |
| 14 | 3300048908 | Ga0496105_0032388 | Ga0496105_0032388_824_1993 | 356 |
| 15 | 3300048917 | Ga0496114_0006966 | Ga0496114_0006966_713_1882 | 356 |
| 16 | 3300048918 | Ga0496115_0036066 | Ga0496115_0036066_1942_3111 | 356 |
| 17 | 3300006051 | Ga0075364_10018652 | Ga0075364_100186522 | 361 |
| 18 | 3300050493 | nmdc:mga0k408_73239_c1 | nmdc:mga0k408_73239_c1_170_1315 | 362 |
| 19 | 3300005985 | Ga0081539_10002137 | Ga0081539_100021379 | 363 |
| 20 | 3300005366 | Ga0070659_100052144 | Ga0070659_1000521441 | 365 |
| 21 | 3300025932 | Ga0207690_10082096 | Ga0207690_100820961 | 365 |
| 22 | 3300048915 | Ga0496112_0044568 | Ga0496112_0044568_3157_4311 | 365 |
| 23 | 3300053085 | Ga0495619_0077653 | Ga0495619_0077653_46_1146 | 365 |
| 24 | 3300005458 | Ga0070681_10226988 | Ga0070681_102269882 | 366 |
| 25 | 3300025938 | Ga0207704_10074578 | Ga0207704_100745782 | 366 |
| 26 | 3300036401 | Ga0373937_0240146 | Ga0373937_0240146_291_1400 | 366 |
| 27 | 3300042461 | Ga0439460_0051578 | Ga0439460_0051578_25_1185 | 366 |
| 28 | 3300006847 | Ga0075431_100036660 | Ga0075431_1000366602 | 367 |
| 29 | 3300031995 | Ga0307409_100082558 | Ga0307409_1000825582 | 367 |
| 30 | 3300042133 | Ga0450896_006344 | Ga0450896_006344_325_1491 | 367 |
| 31 | 3300049577 | Ga0501041_0194324 | Ga0501041_0194324_11_1123 | 367 |
| 32 | 3300005333 | Ga0070677_10077528 | Ga0070677_100775281 | 368 |
| 33 | 3300005536 | Ga0070697_100018839 | Ga0070697_1000188392 | 368 |
| 34 | 3300005616 | Ga0068852_100149020 | Ga0068852_1001490202 | 368 |
| 35 | 3300006358 | Ga0068871_100009590 | Ga0068871_1000095905 | 368 |
| 36 | 3300006881 | Ga0068865_100082466 | Ga0068865_1000824663 | 368 |
| 37 | 3300013296 | Ga0157374_10007459 | Ga0157374_100074596 | 368 |
| 38 | 3300014325 | Ga0163163_10152427 | Ga0163163_101524273 | 368 |
| 39 | 3300025926 | Ga0207659_10000077 | Ga0207659_1000007745 | 368 |
| 40 | 3300026089 | Ga0207648_10091369 | Ga0207648_100913692 | 368 |
| 41 | 3300031995 | Ga0307409_100181749 | Ga0307409_1001817491 | 368 |
| 42 | 3300048913 | Ga0496110_0045619 | Ga0496110_0045619_43_1212 | 368 |
| 43 | 3300035172 | Ga0373955_0008811 | Ga0373955_0008811_1647_2810 | 369 |
| 44 | 3300042439 | Ga0439464_0018965 | Ga0439464_0018965_561_1730 | 369 |
| 45 | 3300059421 | Ga0590071_026465 | Ga0590071_026465_91_1269 | 369 |
| 46 | 3300059424 | Ga0590075_006066 | Ga0590075_006066_595_1752 | 369 |
| 47 | 3300059426 | Ga0590077_001730 | Ga0590077_001730_1713_2870 | 369 |
| 48 | 3300005330 | Ga0070690_100235844 | Ga0070690_1002358441 | 370 |
| 49 | 3300005334 | Ga0068869_100153722 | Ga0068869_1001537221 | 370 |
| 50 | 3300005338 | Ga0068868_100159212 | Ga0068868_1001592122 | 370 |
| 51 | 3300005434 | Ga0070709_10133411 | Ga0070709_101334112 | 370 |
| 52 | 3300005466 | Ga0070685_10045697 | Ga0070685_100456971 | 370 |
| 53 | 3300005617 | Ga0068859_100079723 | Ga0068859_1000797231 | 370 |
| 54 | 3300005842 | Ga0068858_100116386 | Ga0068858_1001163862 | 370 |
| 55 | 3300005843 | Ga0068860_100002847 | Ga0068860_1000028478 | 370 |
| 56 | 3300005843 | Ga0068860_100132387 | Ga0068860_1001323872 | 370 |
| 57 | 3300006931 | Ga0097620_100079723 | Ga0097620_1000797231 | 370 |
| 58 | 3300009148 | Ga0105243_10312253 | Ga0105243_103122531 | 370 |
| 59 | 3300009176 | Ga0105242_10182658 | Ga0105242_101826582 | 370 |
| 60 | 3300009177 | Ga0105248_10013857 | Ga0105248_100138573 | 370 |
| 61 | 3300009177 | Ga0105248_10351788 | Ga0105248_103517882 | 370 |
| 62 | 3300009545 | Ga0105237_10309170 | Ga0105237_103091702 | 370 |
| 63 | 3300010375 | Ga0105239_10025091 | Ga0105239_100250914 | 370 |
| 64 | 3300013297 | Ga0157378_10000071 | Ga0157378_100000715 | 370 |
| 65 | 3300013306 | Ga0163162_10013390 | Ga0163162_100133901 | 370 |
| 66 | 3300013306 | Ga0163162_10279721 | Ga0163162_102797212 | 370 |
| 67 | 3300025904 | Ga0207647_10022443 | Ga0207647_100224432 | 370 |
| 68 | 3300025941 | Ga0207711_10054485 | Ga0207711_100544852 | 370 |
| 69 | 3300025942 | Ga0207689_10002264 | Ga0207689_1000226412 | 370 |
| 70 | 3300025949 | Ga0207667_10166449 | Ga0207667_101664491 | 370 |
| 71 | 3300026023 | Ga0207677_10147587 | Ga0207677_101475871 | 370 |
| 72 | 3300026035 | Ga0207703_10036937 | Ga0207703_100369371 | 370 |
| 73 | 3300026088 | Ga0207641_10140743 | Ga0207641_101407432 | 370 |
| 74 | 3300028381 | Ga0268264_10031838 | Ga0268264_100318381 | 370 |
| 75 | 3300035172 | Ga0373955_0017844 | Ga0373955_0017844_113_1282 | 370 |
| 76 | 3300046809 | Ga0495600_0034985 | Ga0495600_0034985_220_1389 | 370 |
| 77 | 3300048903 | Ga0496100_0090488 | Ga0496100_0090488_97_1272 | 370 |
| 78 | 3300053085 | Ga0495619_0008599 | Ga0495619_0008599_2889_4058 | 370 |
| 79 | 3300021358 | Ga0213873_10002975 | Ga0213873_100029753 | 371 |
| 80 | 3300031733 | Ga0316577_10053723 | Ga0316577_100537232 | 371 |
| 81 | 3300036712 | Ga0316584_0043490 | Ga0316584_0043490_633_1793 | 371 |
| 82 | 3300039453 | Ga0436362_0461762 | Ga0436362_0461762_1986_3161 | 371 |
| 83 | 3300050511 | nmdc:mga08y16_9570_c1 | nmdc:mga08y16_9570_c1_4768_5961 | 371 |
| 84 | 3300005364 | Ga0070673_100025432 | Ga0070673_1000254323 | 372 |
| 85 | 3300009148 | Ga0105243_10112251 | Ga0105243_101122512 | 372 |
| 86 | 3300025960 | Ga0207651_10080014 | Ga0207651_100800142 | 372 |
| 87 | 3300044712 | Ga0453684_0004484 | Ga0453684_0004484_21878_23047 | 373 |
| 88 | 3300044712 | Ga0453684_0272831 | Ga0453684_0272831_659_1825 | 373 |
| 89 | 3300005467 | Ga0070706_100002696 | Ga0070706_1000026968 | 374 |
| 90 | 3300025910 | Ga0207684_10004777 | Ga0207684_100047776 | 374 |
| 91 | 3300009094 | Ga0111539_10020698 | Ga0111539_100206984 | 375 |
| 92 | 3300005444 | Ga0070694_100103178 | Ga0070694_1001031782 | 376 |
| 93 | 3300009147 | Ga0114129_10167193 | Ga0114129_101671933 | 376 |
| 94 | 3300050507 | nmdc:mga05p37_22379_c1 | nmdc:mga05p37_22379_c1_311_1483 | 376 |
| 95 | 3300006844 | Ga0075428_100039872 | Ga0075428_1000398723 | 377 |
| 96 | 3300006846 | Ga0075430_100011648 | Ga0075430_1000116483 | 377 |
| 97 | 3300006880 | Ga0075429_100057680 | Ga0075429_1000576803 | 377 |
| 98 | 3300009147 | Ga0114129_10003317 | Ga0114129_100033177 | 377 |
| 99 | 3300009147 | Ga0114129_10130106 | Ga0114129_101301063 | 377 |
| 100 | 3300050507 | nmdc:mga05p37_72754_c1 | nmdc:mga05p37_72754_c1_2215_3378 | 377 |
| 101 | 3300006042 | Ga0075368_10040308 | Ga0075368_100403081 | 378 |
| 102 | 3300006051 | Ga0075364_10009449 | Ga0075364_100094491 | 378 |
| 103 | 3300006051 | Ga0075364_10009689 | Ga0075364_100096892 | 378 |
| 104 | 3300006177 | Ga0075362_10002794 | Ga0075362_100027942 | 378 |
| 105 | 3300006178 | Ga0075367_10058297 | Ga0075367_100582972 | 378 |
| 106 | 3300049571 | Ga0501034_0003324 | Ga0501034_0003324_13966_15111 | 378 |
| 107 | 3300049705 | Ga0501225_0009293 | Ga0501225_0009293_296_1435 | 378 |
| 108 | 3300050491 | nmdc:mga00v17_15302_c1 | nmdc:mga00v17_15302_c1_2931_4076 | 378 |
| 109 | 3300050494 | nmdc:mga06z11_35150_c1 | nmdc:mga06z11_35150_c1_1230_2375 | 378 |
| 110 | 3300050507 | nmdc:mga05p37_25707_c1 | nmdc:mga05p37_25707_c1_3128_4273 | 378 |
| 111 | 3300050508 | nmdc:mga09592_70468_c1 | nmdc:mga09592_70468_c1_493_1677 | 378 |
| 112 | iso_pu_bacteria | 8056060235 | 8056066692 | 378 |
| 113 | 3300031665 | Ga0316575_10063620 | Ga0316575_100636201 | 379 |
| 114 | 3300031691 | Ga0316579_10001246 | Ga0316579_100012464 | 379 |
| 115 | 3300031727 | Ga0316576_10000309 | Ga0316576_100003095 | 379 |
| 116 | 3300031728 | Ga0316578_10000084 | Ga0316578_100000844 | 379 |
| 117 | 3300031733 | Ga0316577_10003136 | Ga0316577_100031363 | 379 |
| 118 | 3300032005 | Ga0307411_10108465 | Ga0307411_101084652 | 379 |
| 119 | 3300032133 | Ga0316583_10004337 | Ga0316583_100043372 | 379 |
| 120 | 3300032139 | Ga0316580_10000167 | Ga0316580_1000016710 | 379 |
| 121 | 3300033524 | Ga0316592_1002977 | Ga0316592_10029771 | 379 |
| 122 | 3300033527 | Ga0316586_1006770 | Ga0316586_10067702 | 379 |
| 123 | 3300033528 | Ga0316588_1001903 | Ga0316588_10019031 | 379 |
| 124 | 3300033541 | Ga0316596_1003423 | Ga0316596_10034231 | 379 |
| 125 | 3300035398 | Ga0316574_0002305 | Ga0316574_0002305_4068_5237 | 379 |
| 126 | 3300036647 | Ga0316582_0000605 | Ga0316582_0000605_7446_8615 | 379 |
| 127 | 3300036712 | Ga0316584_0000083 | Ga0316584_0000083_16278_17447 | 379 |
| 128 | 3300037588 | Ga0316581_0000114 | Ga0316581_0000114_7193_8362 | 379 |
| 129 | 3300049765 | Ga0501268_009470 | Ga0501268_009470_67_1209 | 379 |
| 130 | 3300006880 | Ga0075429_100048806 | Ga0075429_1000488063 | 380 |
| 131 | 3300026075 | Ga0207708_10254413 | Ga0207708_102544132 | 380 |
| 132 | 3300026116 | Ga0207674_10070480 | Ga0207674_100704802 | 380 |
| 133 | 3300046459 | Ga0495629_0032995 | Ga0495629_0032995_932_2095 | 380 |
| 134 | 3300046689 | Ga0495613_0091922 | Ga0495613_0091922_952_2115 | 380 |
| 135 | 3300005471 | Ga0070698_100068063 | Ga0070698_1000680634 | 381 |
| 136 | 3300021384 | Ga0213876_10006799 | Ga0213876_100067994 | 381 |
| 137 | 3300021384 | Ga0213876_10045205 | Ga0213876_100452052 | 381 |
| 138 | 3300025903 | Ga0207680_10153109 | Ga0207680_101531092 | 381 |
| 139 | 3300027907 | Ga0207428_10097234 | Ga0207428_100972341 | 381 |
| 140 | 3300035691 | Ga0373931_0097086 | Ga0373931_0097086_164_1315 | 381 |
| 141 | 3300039437 | Ga0436365_1421543 | Ga0436365_1421543_1208_2371 | 381 |
| 142 | 3300039437 | Ga0436365_1614937 | Ga0436365_1614937_755_1906 | 381 |
| 143 | 3300045051 | Ga0451576_0362340 | Ga0451576_0362340_62_1234 | 381 |
| 144 | 3300046642 | Ga0495634_0020169 | Ga0495634_0020169_2356_3507 | 381 |
| 145 | 3300046678 | Ga0495599_0143843 | Ga0495599_0143843_316_1467 | 381 |
| 146 | 3300050511 | nmdc:mga08y16_117024_c1 | nmdc:mga08y16_117024_c1_126_1277 | 381 |
| 147 | 3300050515 | nmdc:mga0a205_58118_c1 | nmdc:mga0a205_58118_c1_343_1494 | 381 |
| 148 | 3300005329 | Ga0070683_100334647 | Ga0070683_1003346472 | 382 |
| 149 | 3300005436 | Ga0070713_100010845 | Ga0070713_1000108454 | 382 |
| 150 | 3300005530 | Ga0070679_100058522 | Ga0070679_1000585221 | 382 |
| 151 | 3300005535 | Ga0070684_100000189 | Ga0070684_10000018929 | 382 |
| 152 | 3300005577 | Ga0068857_100000218 | Ga0068857_10000021830 | 382 |
| 153 | 3300005983 | Ga0081540_1002636 | Ga0081540_10026366 | 382 |
| 154 | 3300006852 | Ga0075433_10010811 | Ga0075433_100108115 | 382 |
| 155 | 3300007265 | Ga0099794_10045833 | Ga0099794_100458332 | 382 |
| 156 | 3300009094 | Ga0111539_10042916 | Ga0111539_100429165 | 382 |
| 157 | 3300009094 | Ga0111539_10258642 | Ga0111539_102586422 | 382 |
| 158 | 3300013105 | Ga0157369_10004434 | Ga0157369_1000443413 | 382 |
| 159 | 3300025912 | Ga0207707_10070755 | Ga0207707_100707551 | 382 |
| 160 | 3300025944 | Ga0207661_10005786 | Ga0207661_100057863 | 382 |
| 161 | 3300025944 | Ga0207661_10261229 | Ga0207661_102612291 | 382 |
| 162 | 3300026116 | Ga0207674_10000366 | Ga0207674_100003664 | 382 |
| 163 | 3300031548 | Ga0307408_100176930 | Ga0307408_1001769301 | 382 |
| 164 | 3300031691 | Ga0316579_10026703 | Ga0316579_100267032 | 382 |
| 165 | 3300031727 | Ga0316576_10027960 | Ga0316576_100279602 | 382 |
| 166 | 3300032002 | Ga0307416_100169234 | Ga0307416_1001692342 | 382 |
| 167 | 3300032002 | Ga0307416_100392590 | Ga0307416_1003925901 | 382 |
| 168 | 3300032005 | Ga0307411_10073947 | Ga0307411_100739472 | 382 |
| 169 | 3300032139 | Ga0316580_10031151 | Ga0316580_100311512 | 382 |
| 170 | 3300032168 | Ga0316593_10039033 | Ga0316593_100390332 | 382 |
| 171 | 3300032168 | Ga0316593_10049300 | Ga0316593_100493001 | 382 |
| 172 | 3300033529 | Ga0316587_1008710 | Ga0316587_10087102 | 382 |
| 173 | 3300036647 | Ga0316582_0125241 | Ga0316582_0125241_299_1465 | 382 |
| 174 | 3300036712 | Ga0316584_0037573 | Ga0316584_0037573_1674_2840 | 382 |
| 175 | 3300037588 | Ga0316581_0019093 | Ga0316581_0019093_537_1703 | 382 |
| 176 | 3300049522 | Ga0501299_001397 | Ga0501299_001397_1173_2330 | 382 |
| 177 | 3300049679 | Ga0501249_012311 | Ga0501249_012311_143_1300 | 382 |
| 178 | 3300005458 | Ga0070681_10134586 | Ga0070681_101345861 | 383 |
| 179 | 3300005468 | Ga0070707_100000106 | Ga0070707_10000010654 | 383 |
| 180 | 3300005937 | Ga0081455_10005145 | Ga0081455_1000514511 | 383 |
| 181 | 3300009094 | Ga0111539_10063129 | Ga0111539_100631291 | 383 |
| 182 | 3300009147 | Ga0114129_10031968 | Ga0114129_100319686 | 383 |
| 183 | 3300025922 | Ga0207646_10006424 | Ga0207646_100064244 | 383 |
| 184 | 3300031691 | Ga0316579_10017428 | Ga0316579_100174283 | 383 |
| 185 | 3300031727 | Ga0316576_10049146 | Ga0316576_100491462 | 383 |
| 186 | 3300031727 | Ga0316576_10077700 | Ga0316576_100777002 | 383 |
| 187 | 3300032168 | Ga0316593_10001458 | Ga0316593_100014583 | 383 |
| 188 | 3300033541 | Ga0316596_1002130 | Ga0316596_10021303 | 383 |
| 189 | 3300035398 | Ga0316574_0054670 | Ga0316574_0054670_662_1822 | 383 |
| 190 | 3300036647 | Ga0316582_0227489 | Ga0316582_0227489_88_1248 | 383 |
| 191 | 3300036712 | Ga0316584_0051862 | Ga0316584_0051862_1850_3010 | 383 |
| 192 | 3300036712 | Ga0316584_0174834 | Ga0316584_0174834_399_1577 | 383 |
| 193 | 3300039093 | Ga0400489_64979 | Ga0400489_64979_285_1445 | 383 |
| 194 | 3300044673 | Ga0453683_0091779 | Ga0453683_0091779_83_1243 | 383 |
| 195 | 3300045051 | Ga0451576_0100187 | Ga0451576_0100187_1219_2379 | 383 |
| 196 | 3300045976 | Ga0466967_0113928 | Ga0466967_0113928_675_1844 | 383 |
| 197 | 3300046454 | Ga0495592_0040849 | Ga0495592_0040849_66_1223 | 383 |
| 198 | 3300050507 | nmdc:mga05p37_148043_c1 | nmdc:mga05p37_148043_c1_1058_2215 | 383 |
| 199 | 3300050511 | nmdc:mga08y16_65119_c1 | nmdc:mga08y16_65119_c1_2385_3542 | 383 |
| 200 | 3300050515 | nmdc:mga0a205_132248_c1 | nmdc:mga0a205_132248_c1_103_1260 | 383 |
| 201 | 3300005329 | Ga0070683_100006910 | Ga0070683_1000069104 | 384 |
| 202 | 3300005344 | Ga0070661_100011515 | Ga0070661_1000115152 | 384 |
| 203 | 3300005354 | Ga0070675_100101769 | Ga0070675_1001017692 | 384 |
| 204 | 3300005364 | Ga0070673_100067086 | Ga0070673_1000670862 | 384 |
| 205 | 3300005444 | Ga0070694_100002059 | Ga0070694_1000020592 | 384 |
| 206 | 3300005456 | Ga0070678_100214770 | Ga0070678_1002147702 | 384 |
| 207 | 3300005459 | Ga0068867_100019588 | Ga0068867_1000195882 | 384 |
| 208 | 3300005471 | Ga0070698_100001656 | Ga0070698_1000016562 | 384 |
| 209 | 3300005518 | Ga0070699_100004274 | Ga0070699_1000042743 | 384 |
| 210 | 3300005518 | Ga0070699_100017985 | Ga0070699_1000179855 | 384 |
| 211 | 3300005518 | Ga0070699_100040039 | Ga0070699_1000400392 | 384 |
| 212 | 3300005535 | Ga0070684_100035605 | Ga0070684_1000356052 | 384 |
| 213 | 3300005535 | Ga0070684_100195748 | Ga0070684_1001957482 | 384 |
| 214 | 3300005539 | Ga0068853_100057610 | Ga0068853_1000576103 | 384 |
| 215 | 3300005549 | Ga0070704_100025932 | Ga0070704_1000259322 | 384 |
| 216 | 3300005564 | Ga0070664_100084994 | Ga0070664_1000849942 | 384 |
| 217 | 3300005840 | Ga0068870_10010664 | Ga0068870_100106641 | 384 |
| 218 | 3300005841 | Ga0068863_100145983 | Ga0068863_1001459832 | 384 |
| 219 | 3300005843 | Ga0068860_100135281 | Ga0068860_1001352812 | 384 |
| 220 | 3300005843 | Ga0068860_100174378 | Ga0068860_1001743782 | 384 |
| 221 | 3300005937 | Ga0081455_10170250 | Ga0081455_101702501 | 384 |
| 222 | 3300005985 | Ga0081539_10000065 | Ga0081539_10000065122 | 384 |
| 223 | 3300006051 | Ga0075364_10175820 | Ga0075364_101758201 | 384 |
| 224 | 3300006058 | Ga0075432_10004747 | Ga0075432_100047472 | 384 |
| 225 | 3300006194 | Ga0075427_10007862 | Ga0075427_100078622 | 384 |
| 226 | 3300006237 | Ga0097621_100003458 | Ga0097621_1000034583 | 384 |
| 227 | 3300006358 | Ga0068871_100002861 | Ga0068871_10000286115 | 384 |
| 228 | 3300006844 | Ga0075428_100037332 | Ga0075428_1000373323 | 384 |
| 229 | 3300006846 | Ga0075430_100066517 | Ga0075430_1000665172 | 384 |
| 230 | 3300006881 | Ga0068865_100003256 | Ga0068865_1000032565 | 384 |
| 231 | 3300006914 | Ga0075436_100012780 | Ga0075436_1000127804 | 384 |
| 232 | 3300009093 | Ga0105240_10213295 | Ga0105240_102132952 | 384 |
| 233 | 3300009094 | Ga0111539_10107532 | Ga0111539_101075322 | 384 |
| 234 | 3300009094 | Ga0111539_10122163 | Ga0111539_101221632 | 384 |
| 235 | 3300009148 | Ga0105243_10175211 | Ga0105243_101752112 | 384 |
| 236 | 3300009176 | Ga0105242_10004777 | Ga0105242_100047779 | 384 |
| 237 | 3300009176 | Ga0105242_10019579 | Ga0105242_100195792 | 384 |
| 238 | 3300009177 | Ga0105248_10014785 | Ga0105248_100147852 | 384 |
| 239 | 3300009545 | Ga0105237_10011654 | Ga0105237_100116544 | 384 |
| 240 | 3300009553 | Ga0105249_10018289 | Ga0105249_100182894 | 384 |
| 241 | 3300009553 | Ga0105249_10075832 | Ga0105249_100758322 | 384 |
| 242 | 3300009553 | Ga0105249_10118822 | Ga0105249_101188222 | 384 |
| 243 | 3300010375 | Ga0105239_10031318 | Ga0105239_100313184 | 384 |
| 244 | 3300011119 | Ga0105246_10014418 | Ga0105246_100144183 | 384 |
| 245 | 3300013297 | Ga0157378_10076540 | Ga0157378_100765403 | 384 |
| 246 | 3300013306 | Ga0163162_10071470 | Ga0163162_100714702 | 384 |
| 247 | 3300013307 | Ga0157372_10011641 | Ga0157372_100116416 | 384 |
| 248 | 3300014969 | Ga0157376_10002785 | Ga0157376_100027856 | 384 |
| 249 | 3300017792 | Ga0163161_10121259 | Ga0163161_101212592 | 384 |
| 250 | 3300025908 | Ga0207643_10000487 | Ga0207643_100004871 | 384 |
| 251 | 3300025910 | Ga0207684_10184756 | Ga0207684_101847562 | 384 |
| 252 | 3300025918 | Ga0207662_10054800 | Ga0207662_100548002 | 384 |
| 253 | 3300025920 | Ga0207649_10016644 | Ga0207649_100166443 | 384 |
| 254 | 3300025922 | Ga0207646_10244370 | Ga0207646_102443702 | 384 |
| 255 | 3300025927 | Ga0207687_10063214 | Ga0207687_100632142 | 384 |
| 256 | 3300025934 | Ga0207686_10010141 | Ga0207686_100101414 | 384 |
| 257 | 3300025934 | Ga0207686_10012771 | Ga0207686_100127714 | 384 |
| 258 | 3300025934 | Ga0207686_10081737 | Ga0207686_100817372 | 384 |
| 259 | 3300025938 | Ga0207704_10004173 | Ga0207704_100041734 | 384 |
| 260 | 3300025944 | Ga0207661_10015982 | Ga0207661_100159824 | 384 |
| 261 | 3300025945 | Ga0207679_10074525 | Ga0207679_100745252 | 384 |
| 262 | 3300025961 | Ga0207712_10027787 | Ga0207712_100277873 | 384 |
| 263 | 3300025961 | Ga0207712_10171256 | Ga0207712_101712562 | 384 |
| 264 | 3300026041 | Ga0207639_10033068 | Ga0207639_100330683 | 384 |
| 265 | 3300026075 | Ga0207708_10001730 | Ga0207708_100017304 | 384 |
| 266 | 3300026075 | Ga0207708_10071718 | Ga0207708_100717182 | 384 |
| 267 | 3300026088 | Ga0207641_10036452 | Ga0207641_100364522 | 384 |
| 268 | 3300026088 | Ga0207641_10232732 | Ga0207641_102327322 | 384 |
| 269 | 3300026089 | Ga0207648_10028057 | Ga0207648_100280573 | 384 |
| 270 | 3300026089 | Ga0207648_10101314 | Ga0207648_101013143 | 384 |
| 271 | 3300026095 | Ga0207676_10078266 | Ga0207676_100782663 | 384 |
| 272 | 3300026116 | Ga0207674_10022788 | Ga0207674_100227882 | 384 |
| 273 | 3300026118 | Ga0207675_100005896 | Ga0207675_1000058963 | 384 |
| 274 | 3300027907 | Ga0207428_10129646 | Ga0207428_101296462 | 384 |
| 275 | 3300028381 | Ga0268264_10429625 | Ga0268264_104296252 | 384 |
| 276 | 3300031250 | Ga0265331_10007801 | Ga0265331_100078014 | 384 |
| 277 | 3300031251 | Ga0265327_10002501 | Ga0265327_1000250110 | 384 |
| 278 | 3300031901 | Ga0307406_10051691 | Ga0307406_100516912 | 384 |
| 279 | 3300031995 | Ga0307409_100005947 | Ga0307409_1000059478 | 384 |
| 280 | 3300032004 | Ga0307414_10082556 | Ga0307414_100825562 | 384 |
| 281 | 3300032126 | Ga0307415_100024251 | Ga0307415_1000242512 | 384 |
| 282 | 3300035117 | Ga0373953_0018632 | Ga0373953_0018632_21_1181 | 384 |
| 283 | 3300035118 | Ga0373954_0036222 | Ga0373954_0036222_894_2054 | 384 |
| 284 | 3300035119 | Ga0373956_0006966 | Ga0373956_0006966_940_2100 | 384 |
| 285 | 3300035120 | Ga0373957_0002419 | Ga0373957_0002419_3048_4208 | 384 |
| 286 | 3300035691 | Ga0373931_0039271 | Ga0373931_0039271_770_1933 | 384 |
| 287 | 3300035724 | Ga0373933_0007393 | Ga0373933_0007393_1895_3055 | 384 |
| 288 | 3300036401 | Ga0373937_0009945 | Ga0373937_0009945_4185_5345 | 384 |
| 289 | 3300037418 | Ga0395900_0022230 | Ga0395900_0022230_4631_5794 | 384 |
| 290 | 3300037466 | Ga0395898_0086258 | Ga0395898_0086258_207_1370 | 384 |
| 291 | 3300038443 | Ga0395901_0023913 | Ga0395901_0023913_1610_2773 | 384 |
| 292 | 3300042876 | Ga0451577_0001168 | Ga0451577_0001168_8877_10040 | 384 |
| 293 | 3300044712 | Ga0453684_0002220 | Ga0453684_0002220_28947_30110 | 384 |
| 294 | 3300044712 | Ga0453684_0019525 | Ga0453684_0019525_4909_6072 | 384 |
| 295 | 3300045836 | Ga0466958_0083916 | Ga0466958_0083916_403_1566 | 384 |
| 296 | 3300046462 | Ga0495651_0021110 | Ga0495651_0021110_292_1452 | 384 |
| 297 | 3300046492 | Ga0495585_0041323 | Ga0495585_0041323_1243_2406 | 384 |
| 298 | 3300046501 | Ga0495607_0039078 | Ga0495607_0039078_284_1447 | 384 |
| 299 | 3300046518 | Ga0495631_0074918 | Ga0495631_0074918_272_1435 | 384 |
| 300 | 3300046538 | Ga0495609_0045025 | Ga0495609_0045025_645_1808 | 384 |
| 301 | 3300046684 | Ga0495669_0031718 | Ga0495669_0031718_520_1683 | 384 |
| 302 | 3300047322 | Ga0495680_0151811 | Ga0495680_0151811_399_1559 | 384 |
| 303 | 3300048912 | Ga0496109_0005550 | Ga0496109_0005550_4815_5978 | 384 |
| 304 | 3300048914 | Ga0496111_0036468 | Ga0496111_0036468_1479_2642 | 384 |
| 305 | 3300049569 | Ga0501032_0055085 | Ga0501032_0055085_949_2133 | 384 |
| 306 | 3300049574 | Ga0501038_0107537 | Ga0501038_0107537_521_1684 | 384 |
| 307 | 3300049576 | Ga0501040_0009945 | Ga0501040_0009945_3291_4454 | 384 |
| 308 | 3300049578 | Ga0501042_0013395 | Ga0501042_0013395_2097_3260 | 384 |
| 309 | 3300049578 | Ga0501042_0018988 | Ga0501042_0018988_1444_2607 | 384 |
| 310 | 3300049582 | Ga0501048_0044030 | Ga0501048_0044030_1871_3034 | 384 |
| 311 | 3300049586 | Ga0501070_0032505 | Ga0501070_0032505_194_1357 | 384 |
| 312 | 3300049587 | Ga0501071_0015413 | Ga0501071_0015413_3788_4951 | 384 |
| 313 | 3300049588 | Ga0501072_0074195 | Ga0501072_0074195_547_1710 | 384 |
| 314 | 3300049588 | Ga0501072_0086859 | Ga0501072_0086859_1137_2300 | 384 |
| 315 | 3300049591 | Ga0501075_0001982 | Ga0501075_0001982_5876_7039 | 384 |
| 316 | 3300049592 | Ga0501076_0044694 | Ga0501076_0044694_1494_2657 | 384 |
| 317 | 3300049743 | Ga0501081_0048754 | Ga0501081_0048754_1028_2191 | 384 |
| 318 | 3300050507 | nmdc:mga05p37_81158_c1 | nmdc:mga05p37_81158_c1_258_1421 | 384 |
| 319 | 3300050509 | nmdc:mga0qj67_158450_c1 | nmdc:mga0qj67_158450_c1_634_1797 | 384 |
| 320 | 3300050509 | nmdc:mga0qj67_71412_c1 | nmdc:mga0qj67_71412_c1_248_1402 | 384 |
| 321 | 3300061734 | Ga0530510_0029255 | Ga0530510_0029255_1281_2444 | 384 |
| 322 | 3300003203 | JGI25406J46586_10000671 | JGI25406J46586_100006719 | 385 |
| 323 | 3300003203 | JGI25406J46586_10055405 | JGI25406J46586_100554051 | 385 |
| 324 | 3300005289 | Ga0065704_10103603 | Ga0065704_101036032 | 385 |
| 325 | 3300005295 | Ga0065707_10001307 | Ga0065707_100013076 | 385 |
| 326 | 3300005295 | Ga0065707_10007546 | Ga0065707_100075462 | 385 |
| 327 | 3300005295 | Ga0065707_10108163 | Ga0065707_101081632 | 385 |
| 328 | 3300005295 | Ga0065707_10124595 | Ga0065707_101245952 | 385 |
| 329 | 3300005334 | Ga0068869_100187016 | Ga0068869_1001870162 | 385 |
| 330 | 3300005336 | Ga0070680_100038055 | Ga0070680_1000380553 | 385 |
| 331 | 3300005336 | Ga0070680_100145675 | Ga0070680_1001456752 | 385 |
| 332 | 3300005338 | Ga0068868_100059747 | Ga0068868_1000597472 | 385 |
| 333 | 3300005340 | Ga0070689_100035853 | Ga0070689_1000358532 | 385 |
| 334 | 3300005347 | Ga0070668_100139982 | Ga0070668_1001399821 | 385 |
| 335 | 3300005356 | Ga0070674_100036772 | Ga0070674_1000367723 | 385 |
| 336 | 3300005365 | Ga0070688_100086686 | Ga0070688_1000866862 | 385 |
| 337 | 3300005435 | Ga0070714_100008748 | Ga0070714_1000087482 | 385 |
| 338 | 3300005440 | Ga0070705_100001047 | Ga0070705_1000010475 | 385 |
| 339 | 3300005440 | Ga0070705_100012481 | Ga0070705_1000124811 | 385 |
| 340 | 3300005440 | Ga0070705_100027130 | Ga0070705_1000271302 | 385 |
| 341 | 3300005444 | Ga0070694_100004558 | Ga0070694_1000045585 | 385 |
| 342 | 3300005444 | Ga0070694_100016354 | Ga0070694_1000163542 | 385 |
| 343 | 3300005445 | Ga0070708_100003230 | Ga0070708_1000032308 | 385 |
| 344 | 3300005445 | Ga0070708_100079644 | Ga0070708_1000796442 | 385 |
| 345 | 3300005467 | Ga0070706_100002254 | Ga0070706_1000022541 | 385 |
| 346 | 3300005468 | Ga0070707_100152310 | Ga0070707_1001523102 | 385 |
| 347 | 3300005471 | Ga0070698_100020442 | Ga0070698_1000204421 | 385 |
| 348 | 3300005471 | Ga0070698_100035179 | Ga0070698_1000351792 | 385 |
| 349 | 3300005471 | Ga0070698_100037340 | Ga0070698_1000373404 | 385 |
| 350 | 3300005471 | Ga0070698_100039110 | Ga0070698_1000391102 | 385 |
| 351 | 3300005471 | Ga0070698_100092034 | Ga0070698_1000920343 | 385 |
| 352 | 3300005471 | Ga0070698_100137974 | Ga0070698_1001379742 | 385 |
| 353 | 3300005518 | Ga0070699_100002052 | Ga0070699_1000020529 | 385 |
| 354 | 3300005518 | Ga0070699_100099602 | Ga0070699_1000996022 | 385 |
| 355 | 3300005518 | Ga0070699_100110737 | Ga0070699_1001107372 | 385 |
| 356 | 3300005518 | Ga0070699_100121435 | Ga0070699_1001214352 | 385 |
| 357 | 3300005518 | Ga0070699_100218781 | Ga0070699_1002187812 | 385 |
| 358 | 3300005530 | Ga0070679_100038913 | Ga0070679_1000389132 | 385 |
| 359 | 3300005536 | Ga0070697_100215645 | Ga0070697_1002156452 | 385 |
| 360 | 3300005544 | Ga0070686_100015781 | Ga0070686_1000157813 | 385 |
| 361 | 3300005545 | Ga0070695_100008748 | Ga0070695_1000087482 | 385 |
| 362 | 3300005546 | Ga0070696_100002222 | Ga0070696_1000022228 | 385 |
| 363 | 3300005547 | Ga0070693_100000033 | Ga0070693_10000003347 | 385 |
| 364 | 3300005549 | Ga0070704_100003023 | Ga0070704_1000030233 | 385 |
| 365 | 3300005549 | Ga0070704_100244135 | Ga0070704_1002441351 | 385 |
| 366 | 3300005617 | Ga0068859_100190030 | Ga0068859_1001900302 | 385 |
| 367 | 3300005617 | Ga0068859_100241562 | Ga0068859_1002415622 | 385 |
| 368 | 3300005617 | Ga0068859_100279545 | Ga0068859_1002795451 | 385 |
| 369 | 3300005719 | Ga0068861_100030632 | Ga0068861_1000306323 | 385 |
| 370 | 3300005719 | Ga0068861_100330615 | Ga0068861_1003306151 | 385 |
| 371 | 3300005842 | Ga0068858_100177747 | Ga0068858_1001777472 | 385 |
| 372 | 3300005844 | Ga0068862_100011331 | Ga0068862_1000113314 | 385 |
| 373 | 3300005844 | Ga0068862_100077639 | Ga0068862_1000776392 | 385 |
| 374 | 3300005844 | Ga0068862_100231877 | Ga0068862_1002318772 | 385 |
| 375 | 3300005981 | Ga0081538_10006773 | Ga0081538_100067734 | 385 |
| 376 | 3300005985 | Ga0081539_10001257 | Ga0081539_1000125721 | 385 |
| 377 | 3300005985 | Ga0081539_10008006 | Ga0081539_100080067 | 385 |
| 378 | 3300006038 | Ga0075365_10003491 | Ga0075365_100034914 | 385 |
| 379 | 3300006038 | Ga0075365_10082415 | Ga0075365_100824151 | 385 |
| 380 | 3300006051 | Ga0075364_10067587 | Ga0075364_100675872 | 385 |
| 381 | 3300006177 | Ga0075362_10009236 | Ga0075362_100092362 | 385 |
| 382 | 3300006177 | Ga0075362_10037874 | Ga0075362_100378743 | 385 |
| 383 | 3300006178 | Ga0075367_10019859 | Ga0075367_100198593 | 385 |
| 384 | 3300006195 | Ga0075366_10000144 | Ga0075366_100001447 | 385 |
| 385 | 3300006195 | Ga0075366_10067674 | Ga0075366_100676742 | 385 |
| 386 | 3300006237 | Ga0097621_100145060 | Ga0097621_1001450602 | 385 |
| 387 | 3300006358 | Ga0068871_100171981 | Ga0068871_1001719812 | 385 |
| 388 | 3300006844 | Ga0075428_100037707 | Ga0075428_1000377073 | 385 |
| 389 | 3300006844 | Ga0075428_100215203 | Ga0075428_1002152031 | 385 |
| 390 | 3300006846 | Ga0075430_100026321 | Ga0075430_1000263212 | 385 |
| 391 | 3300006847 | Ga0075431_100000336 | Ga0075431_1000003364 | 385 |
| 392 | 3300006847 | Ga0075431_100008530 | Ga0075431_1000085302 | 385 |
| 393 | 3300006847 | Ga0075431_100132679 | Ga0075431_1001326792 | 385 |
| 394 | 3300006847 | Ga0075431_100153943 | Ga0075431_1001539433 | 385 |
| 395 | 3300006880 | Ga0075429_100010868 | Ga0075429_1000108686 | 385 |
| 396 | 3300006880 | Ga0075429_100011153 | Ga0075429_1000111533 | 385 |
| 397 | 3300006880 | Ga0075429_100095295 | Ga0075429_1000952952 | 385 |
| 398 | 3300006880 | Ga0075429_100132595 | Ga0075429_1001325951 | 385 |
| 399 | 3300006931 | Ga0097620_100190033 | Ga0097620_1001900332 | 385 |
| 400 | 3300006931 | Ga0097620_100241585 | Ga0097620_1002415851 | 385 |
| 401 | 3300006931 | Ga0097620_100279530 | Ga0097620_1002795301 | 385 |
| 402 | 3300009094 | Ga0111539_10029848 | Ga0111539_100298482 | 385 |
| 403 | 3300009098 | Ga0105245_10008870 | Ga0105245_100088707 | 385 |
| 404 | 3300009098 | Ga0105245_10378680 | Ga0105245_103786801 | 385 |
| 405 | 3300009147 | Ga0114129_10004808 | Ga0114129_1000480813 | 385 |
| 406 | 3300009147 | Ga0114129_10008657 | Ga0114129_1000865712 | 385 |
| 407 | 3300009147 | Ga0114129_10074761 | Ga0114129_100747612 | 385 |
| 408 | 3300009147 | Ga0114129_10094455 | Ga0114129_100944552 | 385 |
| 409 | 3300009147 | Ga0114129_10127808 | Ga0114129_101278082 | 385 |
| 410 | 3300009147 | Ga0114129_10160411 | Ga0114129_101604112 | 385 |
| 411 | 3300009148 | Ga0105243_10035929 | Ga0105243_100359293 | 385 |
| 412 | 3300009148 | Ga0105243_10094921 | Ga0105243_100949212 | 385 |
| 413 | 3300009148 | Ga0105243_10152082 | Ga0105243_101520821 | 385 |
| 414 | 3300009148 | Ga0105243_10244368 | Ga0105243_102443682 | 385 |
| 415 | 3300009176 | Ga0105242_10163133 | Ga0105242_101631331 | 385 |
| 416 | 3300009177 | Ga0105248_10012017 | Ga0105248_100120176 | 385 |
| 417 | 3300009177 | Ga0105248_10399363 | Ga0105248_103993632 | 385 |
| 418 | 3300009553 | Ga0105249_10003642 | Ga0105249_100036428 | 385 |
| 419 | 3300009553 | Ga0105249_10055903 | Ga0105249_100559032 | 385 |
| 420 | 3300009553 | Ga0105249_10163885 | Ga0105249_101638851 | 385 |
| 421 | 3300011119 | Ga0105246_10052356 | Ga0105246_100523562 | 385 |
| 422 | 3300013297 | Ga0157378_10166097 | Ga0157378_101660972 | 385 |
| 423 | 3300013306 | Ga0163162_10268339 | Ga0163162_102683392 | 385 |
| 424 | 3300013308 | Ga0157375_10342950 | Ga0157375_103429501 | 385 |
| 425 | 3300014326 | Ga0157380_10073522 | Ga0157380_100735222 | 385 |
| 426 | 3300014326 | Ga0157380_10178690 | Ga0157380_101786902 | 385 |
| 427 | 3300014745 | Ga0157377_10028727 | Ga0157377_100287273 | 385 |
| 428 | 3300025910 | Ga0207684_10001483 | Ga0207684_1000148319 | 385 |
| 429 | 3300025910 | Ga0207684_10103117 | Ga0207684_101031174 | 385 |
| 430 | 3300025913 | Ga0207695_10000450 | Ga0207695_100004507 | 385 |
| 431 | 3300025918 | Ga0207662_10007973 | Ga0207662_100079733 | 385 |
| 432 | 3300025921 | Ga0207652_10028270 | Ga0207652_100282702 | 385 |
| 433 | 3300025922 | Ga0207646_10034586 | Ga0207646_100345865 | 385 |
| 434 | 3300025927 | Ga0207687_10009228 | Ga0207687_100092282 | 385 |
| 435 | 3300025929 | Ga0207664_10025214 | Ga0207664_100252142 | 385 |
| 436 | 3300025933 | Ga0207706_10051174 | Ga0207706_100511742 | 385 |
| 437 | 3300025934 | Ga0207686_10054293 | Ga0207686_100542932 | 385 |
| 438 | 3300025935 | Ga0207709_10175890 | Ga0207709_101758901 | 385 |
| 439 | 3300025940 | Ga0207691_10043105 | Ga0207691_100431052 | 385 |
| 440 | 3300025949 | Ga0207667_10169738 | Ga0207667_101697382 | 385 |
| 441 | 3300025960 | Ga0207651_10023341 | Ga0207651_100233413 | 385 |
| 442 | 3300025960 | Ga0207651_10140978 | Ga0207651_101409781 | 385 |
| 443 | 3300025961 | Ga0207712_10043018 | Ga0207712_100430183 | 385 |
| 444 | 3300025972 | Ga0207668_10103641 | Ga0207668_101036412 | 385 |
| 445 | 3300026067 | Ga0207678_10010352 | Ga0207678_100103523 | 385 |
| 446 | 3300026075 | Ga0207708_10025875 | Ga0207708_100258752 | 385 |
| 447 | 3300026078 | Ga0207702_10269165 | Ga0207702_102691652 | 385 |
| 448 | 3300026118 | Ga0207675_100017716 | Ga0207675_1000177162 | 385 |
| 449 | 3300026118 | Ga0207675_100128821 | Ga0207675_1001288213 | 385 |
| 450 | 3300028380 | Ga0268265_10132447 | Ga0268265_101324471 | 385 |
| 451 | 3300031251 | Ga0265327_10013931 | Ga0265327_100139312 | 385 |
| 452 | 3300031665 | Ga0316575_10031503 | Ga0316575_100315032 | 385 |
| 453 | 3300031691 | Ga0316579_10001813 | Ga0316579_100018135 | 385 |
| 454 | 3300031691 | Ga0316579_10046788 | Ga0316579_100467882 | 385 |
| 455 | 3300031727 | Ga0316576_10004794 | Ga0316576_100047946 | 385 |
| 456 | 3300031727 | Ga0316576_10030995 | Ga0316576_100309951 | 385 |
| 457 | 3300031728 | Ga0316578_10022307 | Ga0316578_100223071 | 385 |
| 458 | 3300031733 | Ga0316577_10001903 | Ga0316577_100019039 | 385 |
| 459 | 3300031733 | Ga0316577_10011268 | Ga0316577_100112683 | 385 |
| 460 | 3300031852 | Ga0307410_10076204 | Ga0307410_100762042 | 385 |
| 461 | 3300032126 | Ga0307415_100218171 | Ga0307415_1002181712 | 385 |
| 462 | 3300032139 | Ga0316580_10053952 | Ga0316580_100539521 | 385 |
| 463 | 3300032168 | Ga0316593_10000513 | Ga0316593_100005133 | 385 |
| 464 | 3300035398 | Ga0316574_0026855 | Ga0316574_0026855_957_2123 | 385 |
| 465 | 3300035398 | Ga0316574_0079305 | Ga0316574_0079305_242_1408 | 385 |
| 466 | 3300036647 | Ga0316582_0000018 | Ga0316582_0000018_5077_6243 | 385 |
| 467 | 3300036647 | Ga0316582_0016623 | Ga0316582_0016623_2758_3924 | 385 |
| 468 | 3300036647 | Ga0316582_0026650 | Ga0316582_0026650_1473_2639 | 385 |
| 469 | 3300036712 | Ga0316584_0082683 | Ga0316584_0082683_1089_2255 | 385 |
| 470 | 3300042461 | Ga0439460_0030926 | Ga0439460_0030926_231_1421 | 385 |
| 471 | 3300042876 | Ga0451577_0028486 | Ga0451577_0028486_2085_3251 | 385 |
| 472 | 3300042876 | Ga0451577_0037855 | Ga0451577_0037855_2156_3322 | 385 |
| 473 | 3300042876 | Ga0451577_0082151 | Ga0451577_0082151_1130_2296 | 385 |
| 474 | 3300042876 | Ga0451577_0152046 | Ga0451577_0152046_723_1889 | 385 |
| 475 | 3300044673 | Ga0453683_0006667 | Ga0453683_0006667_4684_5850 | 385 |
| 476 | 3300044673 | Ga0453683_0033390 | Ga0453683_0033390_154_1320 | 385 |
| 477 | 3300044673 | Ga0453683_0040935 | Ga0453683_0040935_325_1491 | 385 |
| 478 | 3300044673 | Ga0453683_0121536 | Ga0453683_0121536_73_1239 | 385 |
| 479 | 3300044673 | Ga0453683_0138230 | Ga0453683_0138230_92_1258 | 385 |
| 480 | 3300044712 | Ga0453684_0000095 | Ga0453684_0000095_157150_158316 | 385 |
| 481 | 3300044712 | Ga0453684_0003913 | Ga0453684_0003913_4050_5216 | 385 |
| 482 | 3300044712 | Ga0453684_0005006 | Ga0453684_0005006_12768_13934 | 385 |
| 483 | 3300044712 | Ga0453684_0008106 | Ga0453684_0008106_8470_9636 | 385 |
| 484 | 3300044712 | Ga0453684_0020898 | Ga0453684_0020898_4823_5989 | 385 |
| 485 | 3300044712 | Ga0453684_0024301 | Ga0453684_0024301_5018_6184 | 385 |
| 486 | 3300044712 | Ga0453684_0030731 | Ga0453684_0030731_1160_2326 | 385 |
| 487 | 3300044712 | Ga0453684_0108575 | Ga0453684_0108575_1062_2228 | 385 |
| 488 | 3300044712 | Ga0453684_0134928 | Ga0453684_0134928_1775_2941 | 385 |
| 489 | 3300044712 | Ga0453684_0145691 | Ga0453684_0145691_890_2056 | 385 |
| 490 | 3300044712 | Ga0453684_0171460 | Ga0453684_0171460_421_1587 | 385 |
| 491 | 3300044712 | Ga0453684_0232435 | Ga0453684_0232435_471_1637 | 385 |
| 492 | 3300045051 | Ga0451576_0000009 | Ga0451576_0000009_546222_547388 | 385 |
| 493 | 3300045051 | Ga0451576_0013764 | Ga0451576_0013764_6141_7307 | 385 |
| 494 | 3300045051 | Ga0451576_0112435 | Ga0451576_0112435_523_1689 | 385 |
| 495 | 3300045051 | Ga0451576_0487085 | Ga0451576_0487085_91_1257 | 385 |
| 496 | 3300046459 | Ga0495629_0083396 | Ga0495629_0083396_328_1494 | 385 |
| 497 | 3300046472 | Ga0495580_0096768 | Ga0495580_0096768_233_1408 | 385 |
| 498 | 3300046477 | Ga0495664_0058025 | Ga0495664_0058025_971_2137 | 385 |
| 499 | 3300046523 | Ga0495644_0049478 | Ga0495644_0049478_55_1230 | 385 |
| 500 | 3300046535 | Ga0495586_0164446 | Ga0495586_0164446_29_1225 | 385 |
| 501 | 3300046536 | Ga0495587_0013497 | Ga0495587_0013497_2968_4137 | 385 |
| 502 | 3300046559 | Ga0495667_0147987 | Ga0495667_0147987_296_1462 | 385 |
| 503 | 3300046681 | Ga0495647_0044483 | Ga0495647_0044483_234_1400 | 385 |
| 504 | 3300046689 | Ga0495613_0037349 | Ga0495613_0037349_1477_2643 | 385 |
| 505 | 3300047471 | Ga0495684_0013272 | Ga0495684_0013272_3944_5110 | 385 |
| 506 | 3300047471 | Ga0495684_0128210 | Ga0495684_0128210_406_1584 | 385 |
| 507 | 3300049571 | Ga0501034_0000697 | Ga0501034_0000697_3719_4885 | 385 |
| 508 | 3300049572 | Ga0501036_0154084 | Ga0501036_0154084_88_1257 | 385 |
| 509 | 3300049574 | Ga0501038_0136779 | Ga0501038_0136779_555_1748 | 385 |
| 510 | 3300049575 | Ga0501039_0038917 | Ga0501039_0038917_880_2073 | 385 |
| 511 | 3300049576 | Ga0501040_0060232 | Ga0501040_0060232_71_1264 | 385 |
| 512 | 3300049580 | Ga0501046_0102017 | Ga0501046_0102017_522_1715 | 385 |
| 513 | 3300049587 | Ga0501071_0042535 | Ga0501071_0042535_1325_2494 | 385 |
| 514 | 3300049587 | Ga0501071_0064339 | Ga0501071_0064339_1073_2266 | 385 |
| 515 | 3300049588 | Ga0501072_0023275 | Ga0501072_0023275_2568_3761 | 385 |
| 516 | 3300049588 | Ga0501072_0140446 | Ga0501072_0140446_290_1462 | 385 |
| 517 | 3300049591 | Ga0501075_0169159 | Ga0501075_0169159_15_1208 | 385 |
| 518 | 3300049591 | Ga0501075_0173705 | Ga0501075_0173705_366_1532 | 385 |
| 519 | 3300049593 | Ga0501077_0098978 | Ga0501077_0098978_256_1449 | 385 |
| 520 | 3300049741 | Ga0501079_0023424 | Ga0501079_0023424_2660_3826 | 385 |
| 521 | 3300049741 | Ga0501079_0174533 | Ga0501079_0174533_196_1389 | 385 |
| 522 | 3300049741 | Ga0501079_0250343 | Ga0501079_0250343_111_1280 | 385 |
| 523 | 3300049742 | Ga0501080_0115005 | Ga0501080_0115005_238_1407 | 385 |
| 524 | 3300049743 | Ga0501081_0046648 | Ga0501081_0046648_569_1735 | 385 |
| 525 | 3300049822 | Ga0501035_0063591 | Ga0501035_0063591_1747_2940 | 385 |
| 526 | 3300050492 | nmdc:mga0yw44_124318_c1 | nmdc:mga0yw44_124318_c1_411_1577 | 385 |
| 527 | 3300050493 | nmdc:mga0k408_8092_c1 | nmdc:mga0k408_8092_c1_4297_5466 | 385 |
| 528 | 3300050507 | nmdc:mga05p37_11687_c1 | nmdc:mga05p37_11687_c1_1411_2577 | 385 |
| 529 | 3300050507 | nmdc:mga05p37_118770_c1 | nmdc:mga05p37_118770_c1_676_1842 | 385 |
| 530 | 3300050507 | nmdc:mga05p37_169131_c1 | nmdc:mga05p37_169131_c1_1182_2351 | 385 |
| 531 | 3300050507 | nmdc:mga05p37_237139_c1 | nmdc:mga05p37_237139_c1_81_1247 | 385 |
| 532 | 3300050507 | nmdc:mga05p37_26155_c2 | nmdc:mga05p37_26155_c2_171_1337 | 385 |
| 533 | 3300050507 | nmdc:mga05p37_7639_c1 | nmdc:mga05p37_7639_c1_3971_5140 | 385 |
| 534 | 3300050508 | nmdc:mga09592_13586_c1 | nmdc:mga09592_13586_c1_519_1685 | 385 |
| 535 | 3300050508 | nmdc:mga09592_167553_c1 | nmdc:mga09592_167553_c1_98_1264 | 385 |
| 536 | 3300050508 | nmdc:mga09592_8755_c1 | nmdc:mga09592_8755_c1_4823_5992 | 385 |
| 537 | 3300050509 | nmdc:mga0qj67_22837_c1 | nmdc:mga0qj67_22837_c1_488_1657 | 385 |
| 538 | 3300050510 | nmdc:mga06r32_294907_c1 | nmdc:mga06r32_294907_c1_246_1412 | 385 |
| 539 | 3300050510 | nmdc:mga06r32_3413_c1 | nmdc:mga06r32_3413_c1_3576_4745 | 385 |
| 540 | 3300050510 | nmdc:mga06r32_99097_c1 | nmdc:mga06r32_99097_c1_1124_2293 | 385 |
| 541 | 3300050512 | nmdc:mga0n895_46412_c1 | nmdc:mga0n895_46412_c1_2022_3191 | 385 |
| 542 | 3300050515 | nmdc:mga0a205_142146_c1 | nmdc:mga0a205_142146_c1_85_1254 | 385 |
| 543 | 3300050515 | nmdc:mga0a205_147995_c1 | nmdc:mga0a205_147995_c1_419_1588 | 385 |
| 544 | 3300054114 | Ga0501084_0101804 | Ga0501084_0101804_939_2105 | 385 |
| 545 | 3300060353 | Ga0501082_0160466 | Ga0501082_0160466_463_1632 | 385 |
| 546 | 3300061734 | Ga0530510_0041831 | Ga0530510_0041831_943_2136 | 385 |
| 547 | 3300004801 | Ga0058860_11303011 | Ga0058860_113030111 | 386 |
| 548 | 3300005347 | Ga0070668_100050621 | Ga0070668_1000506212 | 386 |
| 549 | 3300005367 | Ga0070667_100070910 | Ga0070667_1000709103 | 386 |
| 550 | 3300005436 | Ga0070713_100066538 | Ga0070713_1000665384 | 386 |
| 551 | 3300005438 | Ga0070701_10028685 | Ga0070701_100286852 | 386 |
| 552 | 3300005445 | Ga0070708_100004999 | Ga0070708_1000049996 | 386 |
| 553 | 3300005459 | Ga0068867_100100141 | Ga0068867_1001001412 | 386 |
| 554 | 3300005577 | Ga0068857_100042921 | Ga0068857_1000429213 | 386 |
| 555 | 3300005617 | Ga0068859_100017869 | Ga0068859_1000178695 | 386 |
| 556 | 3300005842 | Ga0068858_100155768 | Ga0068858_1001557682 | 386 |
| 557 | 3300005844 | Ga0068862_100161892 | Ga0068862_1001618922 | 386 |
| 558 | 3300005937 | Ga0081455_10020573 | Ga0081455_100205738 | 386 |
| 559 | 3300005985 | Ga0081539_10001174 | Ga0081539_1000117412 | 386 |
| 560 | 3300005985 | Ga0081539_10006624 | Ga0081539_100066242 | 386 |
| 561 | 3300005985 | Ga0081539_10062145 | Ga0081539_100621453 | 386 |
| 562 | 3300006847 | Ga0075431_100069171 | Ga0075431_1000691713 | 386 |
| 563 | 3300006931 | Ga0097620_100017870 | Ga0097620_1000178704 | 386 |
| 564 | 3300009094 | Ga0111539_10312785 | Ga0111539_103127852 | 386 |
| 565 | 3300009147 | Ga0114129_10171607 | Ga0114129_101716072 | 386 |
| 566 | 3300009545 | Ga0105237_10126135 | Ga0105237_101261352 | 386 |
| 567 | 3300013308 | Ga0157375_10023986 | Ga0157375_100239862 | 386 |
| 568 | 3300020080 | Ga0206350_10082429 | Ga0206350_100824291 | 386 |
| 569 | 3300022467 | Ga0224712_10049352 | Ga0224712_100493521 | 386 |
| 570 | 3300025910 | Ga0207684_10004853 | Ga0207684_100048535 | 386 |
| 571 | 3300025914 | Ga0207671_10080054 | Ga0207671_100800541 | 386 |
| 572 | 3300025928 | Ga0207700_10053263 | Ga0207700_100532634 | 386 |
| 573 | 3300025986 | Ga0207658_10049278 | Ga0207658_100492783 | 386 |
| 574 | 3300025986 | Ga0207658_10301467 | Ga0207658_103014671 | 386 |
| 575 | 3300026035 | Ga0207703_10133190 | Ga0207703_101331902 | 386 |
| 576 | 3300026075 | Ga0207708_10060562 | Ga0207708_100605622 | 386 |
| 577 | 3300026089 | Ga0207648_10043163 | Ga0207648_100431633 | 386 |
| 578 | 3300026116 | Ga0207674_10052905 | Ga0207674_100529053 | 386 |
| 579 | 3300028654 | Ga0265322_10032397 | Ga0265322_100323972 | 386 |
| 580 | 3300031247 | Ga0265340_10009548 | Ga0265340_100095483 | 386 |
| 581 | 3300031250 | Ga0265331_10012216 | Ga0265331_100122162 | 386 |
| 582 | 3300031548 | Ga0307408_100054213 | Ga0307408_1000542132 | 386 |
| 583 | 3300031548 | Ga0307408_100055531 | Ga0307408_1000555312 | 386 |
| 584 | 3300031691 | Ga0316579_10047782 | Ga0316579_100477822 | 386 |
| 585 | 3300031727 | Ga0316576_10040418 | Ga0316576_100404182 | 386 |
| 586 | 3300031727 | Ga0316576_10041801 | Ga0316576_100418013 | 386 |
| 587 | 3300031727 | Ga0316576_10083138 | Ga0316576_100831381 | 386 |
| 588 | 3300031727 | Ga0316576_10129148 | Ga0316576_101291481 | 386 |
| 589 | 3300031731 | Ga0307405_10006700 | Ga0307405_100067003 | 386 |
| 590 | 3300031733 | Ga0316577_10158921 | Ga0316577_101589211 | 386 |
| 591 | 3300031901 | Ga0307406_10099695 | Ga0307406_100996951 | 386 |
| 592 | 3300031995 | Ga0307409_100072668 | Ga0307409_1000726682 | 386 |
| 593 | 3300032002 | Ga0307416_100006968 | Ga0307416_1000069682 | 386 |
| 594 | 3300032002 | Ga0307416_100042547 | Ga0307416_1000425473 | 386 |
| 595 | 3300032004 | Ga0307414_10029796 | Ga0307414_100297962 | 386 |
| 596 | 3300032005 | Ga0307411_10060161 | Ga0307411_100601611 | 386 |
| 597 | 3300032126 | Ga0307415_100021471 | Ga0307415_1000214712 | 386 |
| 598 | 3300033541 | Ga0316596_1018723 | Ga0316596_10187232 | 386 |
| 599 | 3300035398 | Ga0316574_0060291 | Ga0316574_0060291_515_1684 | 386 |
| 600 | 3300035398 | Ga0316574_0076968 | Ga0316574_0076968_179_1351 | 386 |
| 601 | 3300035398 | Ga0316574_0160932 | Ga0316574_0160932_16_1185 | 386 |
| 602 | 3300036647 | Ga0316582_0000369 | Ga0316582_0000369_10384_11688 | 386 |
| 603 | 3300036712 | Ga0316584_0004551 | Ga0316584_0004551_1624_2793 | 386 |
| 604 | 3300036712 | Ga0316584_0008179 | Ga0316584_0008179_4279_5448 | 386 |
| 605 | 3300036712 | Ga0316584_0026586 | Ga0316584_0026586_2751_4055 | 386 |
| 606 | 3300036712 | Ga0316584_0034682 | Ga0316584_0034682_2230_3399 | 386 |
| 607 | 3300036712 | Ga0316584_0076260 | Ga0316584_0076260_788_1957 | 386 |
| 608 | 3300036712 | Ga0316584_0152517 | Ga0316584_0152517_431_1603 | 386 |
| 609 | 3300037588 | Ga0316581_0022042 | Ga0316581_0022042_121_1290 | 386 |
| 610 | 3300039093 | Ga0400489_12788 | Ga0400489_12788_54548_55717 | 386 |
| 611 | 3300039437 | Ga0436365_0631963 | Ga0436365_0631963_501_1697 | 386 |
| 612 | 3300042876 | Ga0451577_0006471 | Ga0451577_0006471_6949_8118 | 386 |
| 613 | 3300042876 | Ga0451577_0026254 | Ga0451577_0026254_994_2193 | 386 |
| 614 | 3300042876 | Ga0451577_0212248 | Ga0451577_0212248_304_1473 | 386 |
| 615 | 3300044658 | Ga0466972_0050948 | Ga0466972_0050948_156_1325 | 386 |
| 616 | 3300044673 | Ga0453683_0009852 | Ga0453683_0009852_476_1642 | 386 |
| 617 | 3300044673 | Ga0453683_0035066 | Ga0453683_0035066_691_1860 | 386 |
| 618 | 3300044712 | Ga0453684_0000435 | Ga0453684_0000435_151288_152457 | 386 |
| 619 | 3300044712 | Ga0453684_0003436 | Ga0453684_0003436_22966_24168 | 386 |
| 620 | 3300044712 | Ga0453684_0003965 | Ga0453684_0003965_23853_25022 | 386 |
| 621 | 3300044712 | Ga0453684_0078159 | Ga0453684_0078159_2603_3772 | 386 |
| 622 | 3300044712 | Ga0453684_0162017 | Ga0453684_0162017_1397_2566 | 386 |
| 623 | 3300044712 | Ga0453684_0221663 | Ga0453684_0221663_248_1417 | 386 |
| 624 | 3300044712 | Ga0453684_0252026 | Ga0453684_0252026_35_1204 | 386 |
| 625 | 3300045051 | Ga0451576_0039537 | Ga0451576_0039537_230_1399 | 386 |
| 626 | 3300048912 | Ga0496109_0000050 | Ga0496109_0000050_4632_5798 | 386 |
| 627 | 3300049571 | Ga0501034_0180638 | Ga0501034_0180638_128_1297 | 386 |
| 628 | 3300049587 | Ga0501071_0041682 | Ga0501071_0041682_1634_2803 | 386 |
| 629 | 3300049591 | Ga0501075_0112878 | Ga0501075_0112878_104_1273 | 386 |
| 630 | 3300049661 | Ga0501217_000598 | Ga0501217_000598_2710_3870 | 386 |
| 631 | 3300049668 | Ga0501233_001709 | Ga0501233_001709_1241_2401 | 386 |
| 632 | 3300049669 | Ga0501235_003236 | Ga0501235_003236_920_2080 | 386 |
| 633 | 3300049705 | Ga0501225_0006935 | Ga0501225_0006935_45_1205 | 386 |
| 634 | 3300050507 | nmdc:mga05p37_146037_c1 | nmdc:mga05p37_146037_c1_704_1912 | 386 |
| 635 | 3300050507 | nmdc:mga05p37_35213_c1 | nmdc:mga05p37_35213_c1_34_1254 | 386 |
| 636 | 3300050508 | nmdc:mga09592_150172_c1 | nmdc:mga09592_150172_c1_28_1230 | 386 |
| 637 | 3300050510 | nmdc:mga06r32_78363_c1 | nmdc:mga06r32_78363_c1_992_2212 | 386 |
| 638 | 3300050510 | nmdc:mga06r32_87376_c1 | nmdc:mga06r32_87376_c1_1782_2942 | 386 |
| 639 | 3300050511 | nmdc:mga08y16_49839_c1 | nmdc:mga08y16_49839_c1_27_1205 | 386 |
| 640 | 3300053103 | Ga0500555_002121 | Ga0500555_002121_3755_4921 | 386 |
| 641 | 3300005293 | Ga0065715_10152580 | Ga0065715_101525801 | 387 |
| 642 | 3300005331 | Ga0070670_100059361 | Ga0070670_1000593612 | 387 |
| 643 | 3300005334 | Ga0068869_100058427 | Ga0068869_1000584272 | 387 |
| 644 | 3300005467 | Ga0070706_100004795 | Ga0070706_1000047959 | 387 |
| 645 | 3300005468 | Ga0070707_100017908 | Ga0070707_1000179089 | 387 |
| 646 | 3300005468 | Ga0070707_100033867 | Ga0070707_1000338674 | 387 |
| 647 | 3300005518 | Ga0070699_100043363 | Ga0070699_1000433632 | 387 |
| 648 | 3300005536 | Ga0070697_100000021 | Ga0070697_10000002147 | 387 |
| 649 | 3300005545 | Ga0070695_100061981 | Ga0070695_1000619812 | 387 |
| 650 | 3300005618 | Ga0068864_100028644 | Ga0068864_1000286444 | 387 |
| 651 | 3300006048 | Ga0075363_100042432 | Ga0075363_1000424322 | 387 |
| 652 | 3300006163 | Ga0070715_10000032 | Ga0070715_1000003218 | 387 |
| 653 | 3300006844 | Ga0075428_100011532 | Ga0075428_1000115322 | 387 |
| 654 | 3300006852 | Ga0075433_10049955 | Ga0075433_100499553 | 387 |
| 655 | 3300006880 | Ga0075429_100069035 | Ga0075429_1000690353 | 387 |
| 656 | 3300006880 | Ga0075429_100283898 | Ga0075429_1002838981 | 387 |
| 657 | 3300006914 | Ga0075436_100055875 | Ga0075436_1000558752 | 387 |
| 658 | 3300009094 | Ga0111539_10030390 | Ga0111539_100303901 | 387 |
| 659 | 3300009094 | Ga0111539_10106678 | Ga0111539_101066783 | 387 |
| 660 | 3300009147 | Ga0114129_10054706 | Ga0114129_100547064 | 387 |
| 661 | 3300009147 | Ga0114129_10239312 | Ga0114129_102393122 | 387 |
| 662 | 3300013104 | Ga0157370_10011971 | Ga0157370_100119713 | 387 |
| 663 | 3300013307 | Ga0157372_10223816 | Ga0157372_102238163 | 387 |
| 664 | 3300014325 | Ga0163163_10000003 | Ga0163163_10000003267 | 387 |
| 665 | 3300014326 | Ga0157380_10351651 | Ga0157380_103516511 | 387 |
| 666 | 3300014969 | Ga0157376_10033175 | Ga0157376_100331752 | 387 |
| 667 | 3300025905 | Ga0207685_10000016 | Ga0207685_1000001644 | 387 |
| 668 | 3300025908 | Ga0207643_10004884 | Ga0207643_100048842 | 387 |
| 669 | 3300025910 | Ga0207684_10002670 | Ga0207684_100026705 | 387 |
| 670 | 3300025912 | Ga0207707_10184776 | Ga0207707_101847762 | 387 |
| 671 | 3300025922 | Ga0207646_10020071 | Ga0207646_100200714 | 387 |
| 672 | 3300025941 | Ga0207711_10061174 | Ga0207711_100611742 | 387 |
| 673 | 3300026095 | Ga0207676_10030813 | Ga0207676_100308132 | 387 |
| 674 | 3300028381 | Ga0268264_10175725 | Ga0268264_101757251 | 387 |
| 675 | 3300035398 | Ga0316574_0043133 | Ga0316574_0043133_162_1358 | 387 |
| 676 | 3300044673 | Ga0453683_0133840 | Ga0453683_0133840_201_1373 | 387 |
| 677 | 3300044712 | Ga0453684_0000658 | Ga0453684_0000658_93861_95033 | 387 |
| 678 | 3300044712 | Ga0453684_0003836 | Ga0453684_0003836_3825_4997 | 387 |
| 679 | 3300044712 | Ga0453684_0007770 | Ga0453684_0007770_189_1364 | 387 |
| 680 | 3300044712 | Ga0453684_0041143 | Ga0453684_0041143_4409_5581 | 387 |
| 681 | 3300044712 | Ga0453684_0065079 | Ga0453684_0065079_3315_4487 | 387 |
| 682 | 3300045051 | Ga0451576_0004137 | Ga0451576_0004137_43_1215 | 387 |
| 683 | 3300047320 | Ga0495672_0000950 | Ga0495672_0000950_23794_24963 | 387 |
| 684 | 3300048915 | Ga0496112_0326263 | Ga0496112_0326263_27_1211 | 387 |
| 685 | 3300050494 | nmdc:mga06z11_91309_c1 | nmdc:mga06z11_91309_c1_244_1413 | 387 |
| 686 | 3300050496 | nmdc:mga07m45_186729_c1 | nmdc:mga07m45_186729_c1_15_1184 | 387 |
| 687 | 3300050507 | nmdc:mga05p37_574671_c1 | nmdc:mga05p37_574671_c1_84_1256 | 387 |
| 688 | 3300050508 | nmdc:mga09592_216305_c1 | nmdc:mga09592_216305_c1_42_1211 | 387 |
| 689 | 3300050508 | nmdc:mga09592_63580_c1 | nmdc:mga09592_63580_c1_1477_2646 | 387 |
| 690 | 3300050511 | nmdc:mga08y16_301089_c1 | nmdc:mga08y16_301089_c1_382_1551 | 387 |
| 691 | 3300050511 | nmdc:mga08y16_91753_c1 | nmdc:mga08y16_91753_c1_1455_2624 | 387 |
| 692 | 3300050514 | nmdc:mga08x19_37210_c1 | nmdc:mga08x19_37210_c1_678_1850 | 387 |
| 693 | 3300050514 | nmdc:mga08x19_47369_c1 | nmdc:mga08x19_47369_c1_342_1514 | 387 |
| 694 | 3300050515 | nmdc:mga0a205_10028_c1 | nmdc:mga0a205_10028_c1_1014_2183 | 387 |
| 695 | 3300005336 | Ga0070680_100008936 | Ga0070680_1000089365 | 388 |
| 696 | 3300005339 | Ga0070660_100020141 | Ga0070660_1000201413 | 388 |
| 697 | 3300005344 | Ga0070661_100023035 | Ga0070661_1000230354 | 388 |
| 698 | 3300005355 | Ga0070671_100023921 | Ga0070671_1000239213 | 388 |
| 699 | 3300005366 | Ga0070659_100017378 | Ga0070659_1000173783 | 388 |
| 700 | 3300005458 | Ga0070681_10127261 | Ga0070681_101272612 | 388 |
| 701 | 3300005467 | Ga0070706_100002093 | Ga0070706_10000209316 | 388 |
| 702 | 3300005468 | Ga0070707_100018867 | Ga0070707_1000188672 | 388 |
| 703 | 3300005468 | Ga0070707_100034724 | Ga0070707_1000347242 | 388 |
| 704 | 3300005471 | Ga0070698_100012308 | Ga0070698_1000123083 | 388 |
| 705 | 3300005471 | Ga0070698_100025667 | Ga0070698_1000256672 | 388 |
| 706 | 3300005518 | Ga0070699_100004509 | Ga0070699_1000045094 | 388 |
| 707 | 3300005518 | Ga0070699_100339360 | Ga0070699_1003393601 | 388 |
| 708 | 3300005530 | Ga0070679_100030679 | Ga0070679_1000306792 | 388 |
| 709 | 3300005564 | Ga0070664_100001269 | Ga0070664_1000012694 | 388 |
| 710 | 3300005618 | Ga0068864_100020720 | Ga0068864_1000207203 | 388 |
| 711 | 3300005842 | Ga0068858_100018043 | Ga0068858_1000180433 | 388 |
| 712 | 3300005843 | Ga0068860_100046250 | Ga0068860_1000462501 | 388 |
| 713 | 3300006173 | Ga0070716_100027015 | Ga0070716_1000270152 | 388 |
| 714 | 3300006852 | Ga0075433_10002786 | Ga0075433_100027864 | 388 |
| 715 | 3300009147 | Ga0114129_10047931 | Ga0114129_100479313 | 388 |
| 716 | 3300009177 | Ga0105248_10009040 | Ga0105248_100090407 | 388 |
| 717 | 3300013100 | Ga0157373_10087227 | Ga0157373_100872272 | 388 |
| 718 | 3300013306 | Ga0163162_10001941 | Ga0163162_100019418 | 388 |
| 719 | 3300014325 | Ga0163163_10056578 | Ga0163163_100565782 | 388 |
| 720 | 3300014325 | Ga0163163_10148442 | Ga0163163_101484422 | 388 |
| 721 | 3300025912 | Ga0207707_10094882 | Ga0207707_100948822 | 388 |
| 722 | 3300025919 | Ga0207657_10021792 | Ga0207657_100217921 | 388 |
| 723 | 3300025922 | Ga0207646_10060469 | Ga0207646_100604694 | 388 |
| 724 | 3300025922 | Ga0207646_10112708 | Ga0207646_101127082 | 388 |
| 725 | 3300025932 | Ga0207690_10016511 | Ga0207690_100165113 | 388 |
| 726 | 3300025942 | Ga0207689_10008049 | Ga0207689_100080496 | 388 |
| 727 | 3300025945 | Ga0207679_10042157 | Ga0207679_100421573 | 388 |
| 728 | 3300026041 | Ga0207639_10218391 | Ga0207639_102183911 | 388 |
| 729 | 3300026095 | Ga0207676_10025526 | Ga0207676_100255262 | 388 |
| 730 | 3300026116 | Ga0207674_10002940 | Ga0207674_1000294014 | 388 |
| 731 | 3300050515 | nmdc:mga0a205_4149_c1 | nmdc:mga0a205_4149_c1_10201_11373 | 388 |
| 732 | 2162886007 | SwRhRL2b_contig_1938809 | SwRhRL2b_0822.00005500 | 389 |
| 733 | 3300005289 | Ga0065704_10000931 | Ga0065704_100009314 | 389 |
| 734 | 3300005295 | Ga0065707_10009866 | Ga0065707_100098662 | 389 |
| 735 | 3300006852 | Ga0075433_10027161 | Ga0075433_100271612 | 389 |
| 736 | 3300009094 | Ga0111539_10008359 | Ga0111539_100083594 | 389 |
| 737 | 3300009147 | Ga0114129_10194543 | Ga0114129_101945432 | 389 |
| 738 | 3300014326 | Ga0157380_10018086 | Ga0157380_100180862 | 389 |
| 739 | 3300027907 | Ga0207428_10006855 | Ga0207428_100068552 | 389 |
| 740 | 3300050511 | nmdc:mga08y16_2001_c1 | nmdc:mga08y16_2001_c1_12518_13687 | 389 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1bxb-assembly1.cif.gz_D | xylose isomerase from thermus thermophilus | 0.9655 | 6 | 389 |
| 1bxc-assembly1.cif.gz_A | xylose isomerase from thermus caldophilus | 0.9627 | 6 | 389 |
| 1muw-assembly1.cif.gz_A | the 0.86 angstrom structure of xylose isomerase | 0.9612 | 6 | 388 |
| 1xyb-assembly1.cif.gz_A | x-ray crystallographic structures of d-xylose isomerase-substrate complexes position the substrate and provide evidence for metal movement during catalysis | 0.9608 | 7 | 388 |
| 1oad-assembly1.cif.gz_A | glucose isomerase from streptomyces rubiginosus in p21212 crystal form | 0.9605 | 5 | 389 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1didA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9533 | 7 | 388 | 3.20.20.150 |
| 1didA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.9341 | 7 | 388 | 3.20.20.150 |
| af_A0A1D6QER4_85_310_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8837 | 13 | 228 | 3.20.20.150 |
| af_P45541_1_270_3.20.20.150 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8695 | 14 | 312 | 3.20.20.150 |
| 3ktcA00 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes | 0.8604 | 8 | 386 | 3.20.20.150 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I2ZA47-F1-model_v4 | deleted | 1 | 7 | 94 |
|
| AF-A0A5R8VHC3-F1-model_v4 | Xylose isomerase | 0.9999 | 7 | 72 |
GO:0005975
GO:0009045 GO:0046872 |
| AF-A0A6L6CAK5-F1-model_v4 | Xylose isomerase | 0.9955 | 6 | 66 |
GO:0005975
GO:0009045 GO:0046872 |
| AF-A0A6G3D262-F1-model_v4 | Xylose isomerase (EC 5.3.1.5) | 0.9942 | 7 | 140 |
GO:0005737
GO:0009045 GO:0042732 GO:0046872 |
| AF-A0A2S8MVU0-F1-model_v4 | deleted | 0.9932 | 13 | 107 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar