F478538

General Info

Members Datasets Scaffolds Average Seq Length
740 296 739 386

Family's Representative Sequence

Representative Sequence 3300036647|Ga0316582_0000369|Ga0316582_0000369_10384_11688
Length 434
Sequence MRPEGVESTVSGLLAPIRTGSEEHAGIAFRMVAGVPRSHRKGAISMSEQFTPKPEHKFTFGLWTVGNPGGDPFGPPTRPRLSPVDIVHLLGEVGAYGVNFHDNDLVPIDATPAEHDKIVKDFKKALADTGLKVPMATTNLFSDPIFKDGAFTSNDPRVRAYALSKTMKAMDLGVDLGAKVYVFWGGREGVETDASKNPLEAAKRFRDALNFLTHYAKDQKYDLVFALEAKPNEPRHDIYLPTTGSFLGFIESLDHPEMVGVNPEVAHEHMSGLNFMHAVAQAWDAGKLFHIDLNDQAFGRYDQDLRFGSHSLKSCFFLVKFLEDVGYPGMRHFDSHAYRTEDVDGVKDFARGSMRSYLIYKERAKRWNEDKEIQALVKEIGDVPTDGLPKIDGYSKATADALKGLTVDRQALGARGLRYEKLDQLTIEVLLGVR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
14 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
15 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
19 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
29 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
36 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
40 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
46 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
47 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
48 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
49 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
50 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
62 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
63 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
66 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
67 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
68 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
69 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
70 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
71 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
72 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
73 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
74 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
75 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
76 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
77 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
78 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
79 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
80 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
95 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
96 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
97 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
98 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
99 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
100 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
101 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
109 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
110 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
114 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
162 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
163 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
164 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
165 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
166 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
167 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
168 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
169 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
170 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
171 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
172 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
173 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
174 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
175 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
176 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
177 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
178 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
179 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
180 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
181 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300033524 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300033527 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300033528 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300033529 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
188 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
189 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
190 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
191 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
192 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
195 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
196 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
197 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
198 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
199 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
200 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
201 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
202 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
205 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
206 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
207 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
208 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
211 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
212 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
213 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
214 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
215 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
216 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
217 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
218 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
219 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
220 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
221 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
222 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
223 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
224 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
227 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
228 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
229 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
230 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
231 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
232 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
233 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
234 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
235 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
236 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
237 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
240 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
241 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
242 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
243 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
244 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
245 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
246 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
247 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
248 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
249 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
251 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
252 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
253 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
254 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
255 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
256 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
257 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
259 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
260 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
261 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
262 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
263 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
264 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
265 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
266 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
267 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
268 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
269 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
270 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
271 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
272 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
273 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
274 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
275 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
280 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
281 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
282 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
283 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
284 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
285 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
286 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
287 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
288 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
289 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
290 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
291 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
292 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
293 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
294 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
295 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
296 8056060235 Nocardiopsis endophytica RSe5-2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 1.89
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.24
Nodule 0
Rhizoplane 1.62
Rhizosphere 93.92
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1938809 2162886007 Bacteria 6527
2 JGI25406J46586_10000671 3300003203 Bacteria 15941
3 JGI25406J46586_10055405 3300003203 Unclassified 1307
4 Ga0058860_11303011 3300004801 Unclassified 1637
5 Ga0065704_10000931 3300005289 Bacteria 10822
6 Ga0065704_10103603 3300005289 Bacteria 2167
7 Ga0065715_10152580 3300005293 Bacteria 1677
8 Ga0065707_10001307 3300005295 Bacteria 9543
9 Ga0065707_10007546 3300005295 Bacteria 3961
10 Ga0065707_10009866 3300005295 Bacteria 2276
11 Ga0065707_10108163 3300005295 Bacteria 2522
12 Ga0065707_10124595 3300005295 Bacteria 2041
13 Ga0070683_100006910 3300005329 Bacteria 9535
14 Ga0070683_100334647 3300005329 Bacteria 1441
15 Ga0070690_100235844 3300005330 Bacteria 1288
16 Ga0070670_100059361 3300005331 Bacteria 3283
17 Ga0070677_10077528 3300005333 Bacteria 1414
18 Ga0068869_100058427 3300005334 Bacteria 2820
19 Ga0068869_100153722 3300005334 Bacteria 1786
20 Ga0068869_100187016 3300005334 Bacteria 1626
21 Ga0070680_100008936 3300005336 Bacteria 7681
22 Ga0070680_100038055 3300005336 Bacteria 3889
23 Ga0070680_100145675 3300005336 Bacteria 1987
24 Ga0068868_100059747 3300005338 Bacteria 3016
25 Ga0068868_100159212 3300005338 Bacteria 1864
26 Ga0070660_100020141 3300005339 Bacteria 4898
27 Ga0070689_100035853 3300005340 Bacteria 3791
28 Ga0070661_100011515 3300005344 Bacteria 6160
29 Ga0070661_100023035 3300005344 Bacteria 4462
30 Ga0070668_100050621 3300005347 Bacteria 3199
31 Ga0070668_100139982 3300005347 Bacteria 1949
32 Ga0070675_100101769 3300005354 Bacteria 2421
33 Ga0070671_100023921 3300005355 Bacteria 4999
34 Ga0070674_100036772 3300005356 Bacteria 3289
35 Ga0070673_100025432 3300005364 Unclassified 4357
36 Ga0070673_100067086 3300005364 Bacteria 2868
37 Ga0070688_100086686 3300005365 Bacteria 2037
38 Ga0070659_100017378 3300005366 Bacteria 5411
39 Ga0070659_100052144 3300005366 Bacteria 3217
40 Ga0070667_100070910 3300005367 Bacteria 2967
41 Ga0070709_10133411 3300005434 Bacteria 1698
42 Ga0070714_100008748 3300005435 Bacteria 7915
43 Ga0070713_100010845 3300005436 Bacteria 6605
44 Ga0070713_100066538 3300005436 Bacteria 3031
45 Ga0070701_10028685 3300005438 Bacteria 2737
46 Ga0070705_100001047 3300005440 Bacteria 15425
47 Ga0070705_100012481 3300005440 Bacteria 4320
48 Ga0070705_100027130 3300005440 Bacteria 3124
49 Ga0070694_100002059 3300005444 Bacteria 11922
50 Ga0070694_100004558 3300005444 Bacteria 8329
51 Ga0070694_100016354 3300005444 Bacteria 4669
52 Ga0070694_100103178 3300005444 Bacteria 2020
53 Ga0070708_100003230 3300005445 Bacteria 12715
54 Ga0070708_100004999 3300005445 Bacteria 10483
55 Ga0070708_100079644 3300005445 Bacteria 2964
56 Ga0070678_100214770 3300005456 Bacteria 1596
57 Ga0070681_10127261 3300005458 Bacteria 2480
58 Ga0070681_10134586 3300005458 Bacteria 2402
59 Ga0070681_10226988 3300005458 Bacteria 1782
60 Ga0068867_100019588 3300005459 Bacteria 4820
61 Ga0068867_100100141 3300005459 Bacteria 2212
62 Ga0070685_10045697 3300005466 Bacteria 2512
63 Ga0070706_100002093 3300005467 Bacteria 20344
64 Ga0070706_100002254 3300005467 Bacteria 19538
65 Ga0070706_100002696 3300005467 Bacteria 17765
66 Ga0070706_100004795 3300005467 Bacteria 12963
67 Ga0070707_100000106 3300005468 Bacteria 76457
68 Ga0070707_100017908 3300005468 Bacteria 6660
69 Ga0070707_100018867 3300005468 Bacteria 6495
70 Ga0070707_100033867 3300005468 Bacteria 4871
71 Ga0070707_100034724 3300005468 Bacteria 4811
72 Ga0070707_100152310 3300005468 Bacteria 2252
73 Ga0070698_100001656 3300005471 Bacteria 24850
74 Ga0070698_100012308 3300005471 Bacteria 9059
75 Ga0070698_100020442 3300005471 Bacteria 6939
76 Ga0070698_100025667 3300005471 Bacteria 6139
77 Ga0070698_100035179 3300005471 Bacteria 5180
78 Ga0070698_100037340 3300005471 Bacteria 5009
79 Ga0070698_100039110 3300005471 Bacteria 4884
80 Ga0070698_100068063 3300005471 Bacteria 3580
81 Ga0070698_100092034 3300005471 Bacteria 3014
82 Ga0070698_100137974 3300005471 Bacteria 2392
83 Ga0070699_100002052 3300005518 Bacteria 18213
84 Ga0070699_100004274 3300005518 Bacteria 12627
85 Ga0070699_100004509 3300005518 Bacteria 12321
86 Ga0070699_100017985 3300005518 Bacteria 6071
87 Ga0070699_100040039 3300005518 Bacteria 4058
88 Ga0070699_100043363 3300005518 Bacteria 3894
89 Ga0070699_100099602 3300005518 Bacteria 2547
90 Ga0070699_100110737 3300005518 Bacteria 2410
91 Ga0070699_100121435 3300005518 Bacteria 2298
92 Ga0070699_100218781 3300005518 Unclassified 1697
93 Ga0070699_100339360 3300005518 Bacteria 1352
94 Ga0070679_100030679 3300005530 Bacteria 5309
95 Ga0070679_100038913 3300005530 Bacteria 4729
96 Ga0070679_100058522 3300005530 Bacteria 3840
97 Ga0070684_100000189 3300005535 Bacteria 42780
98 Ga0070684_100035605 3300005535 Bacteria 4261
99 Ga0070684_100195748 3300005535 Bacteria 1840
100 Ga0070697_100000021 3300005536 Bacteria 138216
101 Ga0070697_100018839 3300005536 Bacteria 5446
102 Ga0070697_100215645 3300005536 Bacteria 1635
103 Ga0068853_100057610 3300005539 Bacteria 3354
104 Ga0070686_100015781 3300005544 Bacteria 4384
105 Ga0070695_100008748 3300005545 Bacteria 6012
106 Ga0070695_100061981 3300005545 Bacteria 2428
107 Ga0070696_100002222 3300005546 Bacteria 12795
108 Ga0070693_100000033 3300005547 Bacteria 52337
109 Ga0070704_100003023 3300005549 Bacteria 9569
110 Ga0070704_100025932 3300005549 Bacteria 3865
111 Ga0070704_100244135 3300005549 Bacteria 1471
112 Ga0070664_100001269 3300005564 Bacteria 20199
113 Ga0070664_100084994 3300005564 Bacteria 2732
114 Ga0068857_100000218 3300005577 Bacteria 37864
115 Ga0068857_100042921 3300005577 Bacteria 4012
116 Ga0068852_100149020 3300005616 Bacteria 2174
117 Ga0068859_100017869 3300005617 Bacteria 7129
118 Ga0068859_100079723 3300005617 Bacteria 3315
119 Ga0068859_100190030 3300005617 Bacteria 2138
120 Ga0068859_100241562 3300005617 Bacteria 1895
121 Ga0068859_100279545 3300005617 Unclassified 1762
122 Ga0068864_100020720 3300005618 Bacteria 5502
123 Ga0068864_100028644 3300005618 Bacteria 4710
124 Ga0068861_100030632 3300005719 Bacteria 3945
125 Ga0068861_100330615 3300005719 Bacteria 1330
126 Ga0068870_10010664 3300005840 Bacteria 4229
127 Ga0068863_100145983 3300005841 Bacteria 2263
128 Ga0068858_100018043 3300005842 Bacteria 6608
129 Ga0068858_100116386 3300005842 Bacteria 2498
130 Ga0068858_100155768 3300005842 Bacteria 2149
131 Ga0068858_100177747 3300005842 Bacteria 2009
132 Ga0068860_100002847 3300005843 Bacteria 17956
133 Ga0068860_100046250 3300005843 Unclassified 4149
134 Ga0068860_100132387 3300005843 Bacteria 2394
135 Ga0068860_100135281 3300005843 Bacteria 2367
136 Ga0068860_100174378 3300005843 Bacteria 2078
137 Ga0068862_100011331 3300005844 Bacteria 7361
138 Ga0068862_100077639 3300005844 Bacteria 2876
139 Ga0068862_100161892 3300005844 Bacteria 1998
140 Ga0068862_100231877 3300005844 Bacteria 1675
141 Ga0081455_10005145 3300005937 Bacteria 14409
142 Ga0081455_10020573 3300005937 Bacteria 6209
143 Ga0081455_10170250 3300005937 Bacteria 1660
144 Ga0081538_10006773 3300005981 Bacteria 10013
145 Ga0081540_1002636 3300005983 Bacteria 14577
146 Ga0081539_10000065 3300005985 Bacteria 246571
147 Ga0081539_10001174 3300005985 Bacteria 47435
148 Ga0081539_10001257 3300005985 Bacteria 44920
149 Ga0081539_10002137 3300005985 Bacteria 29184
150 Ga0081539_10006624 3300005985 Bacteria 10996
151 Ga0081539_10008006 3300005985 Bacteria 9380
152 Ga0081539_10062145 3300005985 Bacteria 2042
153 Ga0075365_10003491 3300006038 Bacteria 8117
154 Ga0075365_10082415 3300006038 Bacteria 2181
155 Ga0075368_10040308 3300006042 Bacteria 1833
156 Ga0075363_100042432 3300006048 Bacteria 2404
157 Ga0075364_10009449 3300006051 Bacteria 5852
158 Ga0075364_10009689 3300006051 Bacteria 5788
159 Ga0075364_10018652 3300006051 Bacteria 4346
160 Ga0075364_10067587 3300006051 Bacteria 2349
161 Ga0075364_10175820 3300006051 Bacteria 1448
162 Ga0075432_10004747 3300006058 Bacteria 4627
163 Ga0070715_10000032 3300006163 Bacteria 83594
164 Ga0070716_100027015 3300006173 Bacteria 3079
165 Ga0075362_10002794 3300006177 Bacteria 5951
166 Ga0075362_10009236 3300006177 Bacteria 3804
167 Ga0075362_10037874 3300006177 Bacteria 2116
168 Ga0075367_10019859 3300006178 Bacteria 3732
169 Ga0075367_10058297 3300006178 Bacteria 2297
170 Ga0075427_10007862 3300006194 Bacteria 1573
171 Ga0075366_10000144 3300006195 Bacteria 29999
172 Ga0075366_10067674 3300006195 Bacteria 2125
173 Ga0097621_100003458 3300006237 Bacteria 10883
174 Ga0097621_100145060 3300006237 Bacteria 2032
175 Ga0068871_100002861 3300006358 Bacteria 11824
176 Ga0068871_100009590 3300006358 Bacteria 7026
177 Ga0068871_100171981 3300006358 Bacteria 1858
178 Ga0075428_100011532 3300006844 Bacteria 9829
179 Ga0075428_100037332 3300006844 Bacteria 5349
180 Ga0075428_100037707 3300006844 Bacteria 5319
181 Ga0075428_100039872 3300006844 Bacteria 5169
182 Ga0075428_100215203 3300006844 Bacteria 2076
183 Ga0075430_100011648 3300006846 Bacteria 7482
184 Ga0075430_100026321 3300006846 Bacteria 4950
185 Ga0075430_100066517 3300006846 Unclassified 3026
186 Ga0075431_100000336 3300006847 Bacteria 36980
187 Ga0075431_100008530 3300006847 Bacteria 10261
188 Ga0075431_100036660 3300006847 Bacteria 5051
189 Ga0075431_100069171 3300006847 Bacteria 3643
190 Ga0075431_100132679 3300006847 Bacteria 2568
191 Ga0075431_100153943 3300006847 Bacteria 2366
192 Ga0075433_10002786 3300006852 Bacteria 13377
193 Ga0075433_10010811 3300006852 Bacteria 7341
194 Ga0075433_10027161 3300006852 Bacteria 4852
195 Ga0075433_10049955 3300006852 Bacteria 3640
196 Ga0075429_100010868 3300006880 Bacteria 7872
197 Ga0075429_100011153 3300006880 Bacteria 7780
198 Ga0075429_100048806 3300006880 Bacteria 3681
199 Ga0075429_100057680 3300006880 Bacteria 3381
200 Ga0075429_100069035 3300006880 Bacteria 3077
201 Ga0075429_100095295 3300006880 Bacteria 2595
202 Ga0075429_100132595 3300006880 Bacteria 2180
203 Ga0075429_100283898 3300006880 Bacteria 1450
204 Ga0068865_100003256 3300006881 Bacteria 9730
205 Ga0068865_100082466 3300006881 Bacteria 2311
206 Ga0075436_100012780 3300006914 Bacteria 5756
207 Ga0075436_100055875 3300006914 Bacteria 2727
208 Ga0097620_100017870 3300006931 Bacteria 7129
209 Ga0097620_100079723 3300006931 Bacteria 3315
210 Ga0097620_100190033 3300006931 Bacteria 2138
211 Ga0097620_100241585 3300006931 Bacteria 1895
212 Ga0097620_100279530 3300006931 Unclassified 1762
213 Ga0099794_10045833 3300007265 Bacteria 2093
214 Ga0105240_10213295 3300009093 Bacteria 2254
215 Ga0111539_10008359 3300009094 Bacteria 13169
216 Ga0111539_10020698 3300009094 Bacteria 8100
217 Ga0111539_10029848 3300009094 Bacteria 6634
218 Ga0111539_10030390 3300009094 Bacteria 6565
219 Ga0111539_10042916 3300009094 Bacteria 5427
220 Ga0111539_10063129 3300009094 Bacteria 4383
221 Ga0111539_10106678 3300009094 Bacteria 3286
222 Ga0111539_10107532 3300009094 Bacteria 3273
223 Ga0111539_10122163 3300009094 Bacteria 3052
224 Ga0111539_10258642 3300009094 Bacteria 2027
225 Ga0111539_10312785 3300009094 Bacteria 1828
226 Ga0105245_10008870 3300009098 Bacteria 8774
227 Ga0105245_10378680 3300009098 Bacteria 1409
228 Ga0114129_10003317 3300009147 Bacteria 22611
229 Ga0114129_10004808 3300009147 Bacteria 19092
230 Ga0114129_10008657 3300009147 Bacteria 14506
231 Ga0114129_10031968 3300009147 Bacteria 7440
232 Ga0114129_10047931 3300009147 Bacteria 6003
233 Ga0114129_10054706 3300009147 Bacteria 5595
234 Ga0114129_10074761 3300009147 Bacteria 4719
235 Ga0114129_10094455 3300009147 Bacteria 4141
236 Ga0114129_10127808 3300009147 Bacteria 3493
237 Ga0114129_10130106 3300009147 Bacteria 3458
238 Ga0114129_10160411 3300009147 Bacteria 3072
239 Ga0114129_10167193 3300009147 Bacteria 3000
240 Ga0114129_10171607 3300009147 Bacteria 2956
241 Ga0114129_10194543 3300009147 Bacteria 2751
242 Ga0114129_10239312 3300009147 Bacteria 2440
243 Ga0105243_10035929 3300009148 Bacteria 3843
244 Ga0105243_10094921 3300009148 Unclassified 2464
245 Ga0105243_10112251 3300009148 Bacteria 2283
246 Ga0105243_10152082 3300009148 Bacteria 1986
247 Ga0105243_10175211 3300009148 Bacteria 1861
248 Ga0105243_10244368 3300009148 Bacteria 1599
249 Ga0105243_10312253 3300009148 Unclassified 1429
250 Ga0105242_10004777 3300009176 Bacteria 10489
251 Ga0105242_10019579 3300009176 Bacteria 5305
252 Ga0105242_10163133 3300009176 Bacteria 1952
253 Ga0105242_10182658 3300009176 Bacteria 1852
254 Ga0105248_10009040 3300009177 Bacteria 10958
255 Ga0105248_10012017 3300009177 Bacteria 9548
256 Ga0105248_10013857 3300009177 Bacteria 8870
257 Ga0105248_10014785 3300009177 Bacteria 8594
258 Ga0105248_10351788 3300009177 Unclassified 1659
259 Ga0105248_10399363 3300009177 Bacteria 1548
260 Ga0105237_10011654 3300009545 Bacteria 9302
261 Ga0105237_10126135 3300009545 Bacteria 2554
262 Ga0105237_10309170 3300009545 Bacteria 1584
263 Ga0105249_10003642 3300009553 Bacteria 13316
264 Ga0105249_10018289 3300009553 Bacteria 6231
265 Ga0105249_10055903 3300009553 Bacteria 3613
266 Ga0105249_10075832 3300009553 Bacteria 3115
267 Ga0105249_10118822 3300009553 Bacteria 2510
268 Ga0105249_10163885 3300009553 Bacteria 2150
269 Ga0105239_10025091 3300010375 Bacteria 6567
270 Ga0105239_10031318 3300010375 Bacteria 5850
271 Ga0105246_10014418 3300011119 Bacteria 4971
272 Ga0105246_10052356 3300011119 Bacteria 2806
273 Ga0157373_10087227 3300013100 Bacteria 2199
274 Ga0157370_10011971 3300013104 Bacteria 9044
275 Ga0157369_10004434 3300013105 Bacteria 16566
276 Ga0157374_10007459 3300013296 Bacteria 9327
277 Ga0157378_10000071 3300013297 Bacteria 91313
278 Ga0157378_10076540 3300013297 Bacteria 3015
279 Ga0157378_10166097 3300013297 Bacteria 2067
280 Ga0163162_10001941 3300013306 Bacteria 19426
281 Ga0163162_10013390 3300013306 Bacteria 8009
282 Ga0163162_10071470 3300013306 Bacteria 3523
283 Ga0163162_10268339 3300013306 Bacteria 1838
284 Ga0163162_10279721 3300013306 Bacteria 1801
285 Ga0157372_10011641 3300013307 Bacteria 9365
286 Ga0157372_10223816 3300013307 Bacteria 2181
287 Ga0157375_10023986 3300013308 Bacteria 5638
288 Ga0157375_10342950 3300013308 Bacteria 1659
289 Ga0163163_10000003 3300014325 Bacteria 455102
290 Ga0163163_10056578 3300014325 Bacteria 3877
291 Ga0163163_10148442 3300014325 Bacteria 2389
292 Ga0163163_10152427 3300014325 Bacteria 2355
293 Ga0157380_10018086 3300014326 Bacteria 5228
294 Ga0157380_10073522 3300014326 Bacteria 2772
295 Ga0157380_10178690 3300014326 Bacteria 1863
296 Ga0157380_10351651 3300014326 Bacteria 1379
297 Ga0157377_10028727 3300014745 Bacteria 2996
298 Ga0157376_10002785 3300014969 Bacteria 11941
299 Ga0157376_10033175 3300014969 Bacteria 4153
300 Ga0163161_10121259 3300017792 Bacteria 1965
301 Ga0206350_10082429 3300020080 Bacteria 1990
302 Ga0213873_10002975 3300021358 Bacteria 3001
303 Ga0213876_10006799 3300021384 Bacteria 6246
304 Ga0213876_10045205 3300021384 Bacteria 2329
305 Ga0224712_10049352 3300022467 Bacteria 1629
306 Ga0207680_10153109 3300025903 Bacteria 1539
307 Ga0207647_10022443 3300025904 Bacteria 4192
308 Ga0207685_10000016 3300025905 Bacteria 151990
309 Ga0207643_10000487 3300025908 Bacteria 25547
310 Ga0207643_10004884 3300025908 Bacteria 7175
311 Ga0207684_10001483 3300025910 Bacteria 25222
312 Ga0207684_10002670 3300025910 Bacteria 17833
313 Ga0207684_10004777 3300025910 Bacteria 12691
314 Ga0207684_10004853 3300025910 Bacteria 12581
315 Ga0207684_10103117 3300025910 Bacteria 2439
316 Ga0207684_10184756 3300025910 Bacteria 1798
317 Ga0207707_10070755 3300025912 Bacteria 3040
318 Ga0207707_10094882 3300025912 Bacteria 2607
319 Ga0207707_10184776 3300025912 Bacteria 1819
320 Ga0207695_10000450 3300025913 Bacteria 89495
321 Ga0207671_10080054 3300025914 Bacteria 2448
322 Ga0207662_10007973 3300025918 Bacteria 5772
323 Ga0207662_10054800 3300025918 Bacteria 2379
324 Ga0207657_10021792 3300025919 Bacteria 6020
325 Ga0207649_10016644 3300025920 Bacteria 4152
326 Ga0207652_10028270 3300025921 Bacteria 4678
327 Ga0207646_10006424 3300025922 Bacteria 12138
328 Ga0207646_10020071 3300025922 Bacteria 6197
329 Ga0207646_10034586 3300025922 Bacteria 4566
330 Ga0207646_10060469 3300025922 Bacteria 3383
331 Ga0207646_10112708 3300025922 Bacteria 2441
332 Ga0207646_10244370 3300025922 Bacteria 1621
333 Ga0207659_10000077 3300025926 Bacteria 62077
334 Ga0207687_10009228 3300025927 Bacteria 6455
335 Ga0207687_10063214 3300025927 Bacteria 2620
336 Ga0207700_10053263 3300025928 Bacteria 3031
337 Ga0207664_10025214 3300025929 Bacteria 4476
338 Ga0207690_10016511 3300025932 Bacteria 4493
339 Ga0207690_10082096 3300025932 Bacteria 2254
340 Ga0207706_10051174 3300025933 Bacteria 3649
341 Ga0207686_10010141 3300025934 Bacteria 5122
342 Ga0207686_10012771 3300025934 Bacteria 4625
343 Ga0207686_10054293 3300025934 Bacteria 2509
344 Ga0207686_10081737 3300025934 Bacteria 2110
345 Ga0207709_10175890 3300025935 Bacteria 1507
346 Ga0207704_10004173 3300025938 Bacteria 6594
347 Ga0207704_10074578 3300025938 Bacteria 2165
348 Ga0207691_10043105 3300025940 Bacteria 4159
349 Ga0207711_10019017 3300025941 Bacteria 5716
350 Ga0207711_10054485 3300025941 Bacteria 3432
351 Ga0207711_10061174 3300025941 Bacteria 3247
352 Ga0207711_10141442 3300025941 Bacteria 2165
353 Ga0207689_10002264 3300025942 Bacteria 18044
354 Ga0207689_10008049 3300025942 Bacteria 9200
355 Ga0207661_10005786 3300025944 Bacteria 8718
356 Ga0207661_10015982 3300025944 Bacteria 5531
357 Ga0207661_10261229 3300025944 Bacteria 1542
358 Ga0207679_10042157 3300025945 Bacteria 3278
359 Ga0207679_10074525 3300025945 Bacteria 2572
360 Ga0207667_10166449 3300025949 Bacteria 2266
361 Ga0207667_10169738 3300025949 Bacteria 2242
362 Ga0207651_10023341 3300025960 Bacteria 3803
363 Ga0207651_10080014 3300025960 Bacteria 2350
364 Ga0207651_10140978 3300025960 Bacteria 1862
365 Ga0207712_10027787 3300025961 Bacteria 3780
366 Ga0207712_10043018 3300025961 Bacteria 3113
367 Ga0207712_10171256 3300025961 Bacteria 1697
368 Ga0207668_10103641 3300025972 Bacteria 2119
369 Ga0207658_10049278 3300025986 Bacteria 3094
370 Ga0207658_10301467 3300025986 Bacteria 1381
371 Ga0207677_10147587 3300026023 Bacteria 1809
372 Ga0207703_10036937 3300026035 Bacteria 3891
373 Ga0207703_10133190 3300026035 Bacteria 2149
374 Ga0207639_10033068 3300026041 Bacteria 3812
375 Ga0207639_10218391 3300026041 Bacteria 1645
376 Ga0207678_10010352 3300026067 Bacteria 8186
377 Ga0207708_10001730 3300026075 Bacteria 16111
378 Ga0207708_10025875 3300026075 Bacteria 4440
379 Ga0207708_10060562 3300026075 Bacteria 2889
380 Ga0207708_10071718 3300026075 Bacteria 2654
381 Ga0207708_10254413 3300026075 Bacteria 1416
382 Ga0207702_10269165 3300026078 Bacteria 1606
383 Ga0207641_10036452 3300026088 Bacteria 4105
384 Ga0207641_10140743 3300026088 Bacteria 2177
385 Ga0207641_10232732 3300026088 Bacteria 1713
386 Ga0207648_10028057 3300026089 Bacteria 4993
387 Ga0207648_10043163 3300026089 Bacteria 3959
388 Ga0207648_10091369 3300026089 Bacteria 2661
389 Ga0207648_10101314 3300026089 Bacteria 2524
390 Ga0207676_10025526 3300026095 Bacteria 4384
391 Ga0207676_10030813 3300026095 Bacteria 4029
392 Ga0207676_10078266 3300026095 Bacteria 2678
393 Ga0207674_10000366 3300026116 Bacteria 58754
394 Ga0207674_10002940 3300026116 Bacteria 21169
395 Ga0207674_10022788 3300026116 Bacteria 6720
396 Ga0207674_10052905 3300026116 Bacteria 4140
397 Ga0207674_10070480 3300026116 Bacteria 3515
398 Ga0207675_100005896 3300026118 Bacteria 11695
399 Ga0207675_100017716 3300026118 Bacteria 6645
400 Ga0207675_100128821 3300026118 Bacteria 2399
401 Ga0207428_10006855 3300027907 Bacteria 10440
402 Ga0207428_10097234 3300027907 Bacteria 2279
403 Ga0207428_10129646 3300027907 Bacteria 1931
404 Ga0268266_10323359 3300028379 Bacteria 1444
405 Ga0268265_10132447 3300028380 Bacteria 2074
406 Ga0268264_10031838 3300028381 Bacteria 4325
407 Ga0268264_10175725 3300028381 Bacteria 1941
408 Ga0268264_10429625 3300028381 Bacteria 1275
409 Ga0265322_10032397 3300028654 Bacteria 1491
410 Ga0265340_10009548 3300031247 Bacteria 5202
411 Ga0265331_10007801 3300031250 Bacteria 6145
412 Ga0265331_10012216 3300031250 Bacteria 4660
413 Ga0265327_10002501 3300031251 Bacteria 19213
414 Ga0265327_10013931 3300031251 Bacteria 5301
415 Ga0307408_100054213 3300031548 Bacteria 2898
416 Ga0307408_100055531 3300031548 Bacteria 2868
417 Ga0307408_100176930 3300031548 Bacteria 1708
418 Ga0316575_10031503 3300031665 Bacteria 2076
419 Ga0316575_10063620 3300031665 Unclassified 1476
420 Ga0316579_10001246 3300031691 Bacteria 9156
421 Ga0316579_10001813 3300031691 Bacteria 7877
422 Ga0316579_10017428 3300031691 Bacteria 3148
423 Ga0316579_10026703 3300031691 Bacteria 2616
424 Ga0316579_10046788 3300031691 Bacteria 2019
425 Ga0316579_10047782 3300031691 Bacteria 1998
426 Ga0316576_10000309 3300031727 Bacteria 21640
427 Ga0316576_10004794 3300031727 Bacteria 8171
428 Ga0316576_10027960 3300031727 Bacteria 3969
429 Ga0316576_10030995 3300031727 Bacteria 3791
430 Ga0316576_10040418 3300031727 Bacteria 3353
431 Ga0316576_10041801 3300031727 Bacteria 3302
432 Ga0316576_10049146 3300031727 Bacteria 3062
433 Ga0316576_10077700 3300031727 Bacteria 2459
434 Ga0316576_10083138 3300031727 Unclassified 2378
435 Ga0316576_10129148 3300031727 Bacteria 1901
436 Ga0316578_10000084 3300031728 Bacteria 21499
437 Ga0316578_10022307 3300031728 Bacteria 3528
438 Ga0307405_10006700 3300031731 Bacteria 5691
439 Ga0316577_10001903 3300031733 Bacteria 10091
440 Ga0316577_10003136 3300031733 Bacteria 8308
441 Ga0316577_10011268 3300031733 Bacteria 4842
442 Ga0316577_10053723 3300031733 Bacteria 2248
443 Ga0316577_10158921 3300031733 Unclassified 1275
444 Ga0307410_10076204 3300031852 Bacteria 2341
445 Ga0307406_10051691 3300031901 Bacteria 2610
446 Ga0307406_10099695 3300031901 Bacteria 1975
447 Ga0307409_100005947 3300031995 Bacteria 7101
448 Ga0307409_100072668 3300031995 Bacteria 2740
449 Ga0307409_100082558 3300031995 Bacteria 2602
450 Ga0307409_100181749 3300031995 Bacteria 1863
451 Ga0307416_100006968 3300032002 Bacteria 7126
452 Ga0307416_100042547 3300032002 Bacteria 3547
453 Ga0307416_100169234 3300032002 Bacteria 2031
454 Ga0307416_100392590 3300032002 Bacteria 1422
455 Ga0307414_10029796 3300032004 Bacteria 3556
456 Ga0307414_10082556 3300032004 Bacteria 2357
457 Ga0307411_10060161 3300032005 Bacteria 2521
458 Ga0307411_10073947 3300032005 Bacteria 2320
459 Ga0307411_10108465 3300032005 Bacteria 1981
460 Ga0307415_100021471 3300032126 Bacteria 3969
461 Ga0307415_100024251 3300032126 Bacteria 3783
462 Ga0307415_100218171 3300032126 Unclassified 1527
463 Ga0316583_10004337 3300032133 Bacteria 5058
464 Ga0316580_10000167 3300032139 Bacteria 12961
465 Ga0316580_10031151 3300032139 Bacteria 1651
466 Ga0316580_10053952 3300032139 Bacteria 1237
467 Ga0316593_10000513 3300032168 Bacteria 7170
468 Ga0316593_10001458 3300032168 Bacteria 5225
469 Ga0316593_10039033 3300032168 Bacteria 1574
470 Ga0316593_10049300 3300032168 Bacteria 1419
471 Ga0316592_1002977 3300033524 Bacteria 2994
472 Ga0316586_1006770 3300033527 Bacteria 1653
473 Ga0316588_1001903 3300033528 Bacteria 3548
474 Ga0316587_1008710 3300033529 Bacteria 1599
475 Ga0316596_1002130 3300033541 Bacteria 4182
476 Ga0316596_1003423 3300033541 Bacteria 3475
477 Ga0316596_1018723 3300033541 Bacteria 1753
478 Ga0373953_0018632 3300035117 Bacteria 2572
479 Ga0373954_0036222 3300035118 Bacteria 2290
480 Ga0373956_0006966 3300035119 Bacteria 4544
481 Ga0373957_0002419 3300035120 Bacteria 5321
482 Ga0373955_0008811 3300035172 Bacteria 4702
483 Ga0373955_0017844 3300035172 Bacteria 3518
484 Ga0316574_0002305 3300035398 Bacteria 9510
485 Ga0316574_0026855 3300035398 Unclassified 3464
486 Ga0316574_0043133 3300035398 Bacteria 2786
487 Ga0316574_0054670 3300035398 Bacteria 2494
488 Ga0316574_0060291 3300035398 Bacteria 2381
489 Ga0316574_0076968 3300035398 Bacteria 2114
490 Ga0316574_0079305 3300035398 Unclassified 2082
491 Ga0316574_0160932 3300035398 Bacteria 1446
492 Ga0373931_0039271 3300035691 Bacteria 2480
493 Ga0373931_0097086 3300035691 Bacteria 1652
494 Ga0373933_0007393 3300035724 Bacteria 5990
495 Ga0373937_0009945 3300036401 Bacteria 8294
496 Ga0373937_0240146 3300036401 Bacteria 1707
497 Ga0316582_0000018 3300036647 Bacteria 39444
498 Ga0316582_0000369 3300036647 Bacteria 16140
499 Ga0316582_0000605 3300036647 Bacteria 13943
500 Ga0316582_0016623 3300036647 Bacteria 4236
501 Ga0316582_0026650 3300036647 Bacteria 3481
502 Ga0316582_0114705 3300036647 Bacteria 1797
503 Ga0316582_0125241 3300036647 Bacteria 1722
504 Ga0316582_0227489 3300036647 Bacteria 1276
505 Ga0316584_0000083 3300036712 Bacteria 37190
506 Ga0316584_0004551 3300036712 Bacteria 9183
507 Ga0316584_0008179 3300036712 Bacteria 7192
508 Ga0316584_0018135 3300036712 Bacteria 5074
509 Ga0316584_0026586 3300036712 Bacteria 4254
510 Ga0316584_0034682 3300036712 Bacteria 3741
511 Ga0316584_0037573 3300036712 Bacteria 3598
512 Ga0316584_0043490 3300036712 Bacteria 3349
513 Ga0316584_0051862 3300036712 Bacteria 3068
514 Ga0316584_0076260 3300036712 Bacteria 2512
515 Ga0316584_0082683 3300036712 Bacteria 2405
516 Ga0316584_0152517 3300036712 Unclassified 1720
517 Ga0316584_0174834 3300036712 Bacteria 1591
518 Ga0395900_0022230 3300037418 Bacteria 6488
519 Ga0395898_0086258 3300037466 Bacteria 3026
520 Ga0316581_0000114 3300037588 Bacteria 11382
521 Ga0316581_0019093 3300037588 Bacteria 1996
522 Ga0316581_0022042 3300037588 Bacteria 1877
523 Ga0395901_0023913 3300038443 Bacteria 6267
524 Ga0400489_12788 3300039093 Bacteria 55910
525 Ga0400489_64979 3300039093 Bacteria 4939
526 Ga0436365_0631963 3300039437 Bacteria 2543
527 Ga0436365_1421543 3300039437 Bacteria 10064
528 Ga0436365_1614937 3300039437 Bacteria 2793
529 Ga0436362_0461762 3300039453 Bacteria 5323
530 Ga0450896_006344 3300042133 Bacteria 1622
531 Ga0439464_0018965 3300042439 Bacteria 1875
532 Ga0439460_0030926 3300042461 Bacteria 1525
533 Ga0439460_0051578 3300042461 Bacteria 1235
534 Ga0451577_0001168 3300042876 Bacteria 36979
535 Ga0451577_0006471 3300042876 Bacteria 11671
536 Ga0451577_0026254 3300042876 Bacteria 5276
537 Ga0451577_0028486 3300042876 Bacteria 5051
538 Ga0451577_0037855 3300042876 Bacteria 4341
539 Ga0451577_0082151 3300042876 Bacteria 2874
540 Ga0451577_0152046 3300042876 Bacteria 2083
541 Ga0451577_0212248 3300042876 Bacteria 1749
542 Ga0451577_0492434 3300042876 Bacteria 1113
543 Ga0466969_0139745 3300044656 Bacteria 1120
544 Ga0466972_0050948 3300044658 Bacteria 1998
545 Ga0453683_0006667 3300044673 Bacteria 7900
546 Ga0453683_0009852 3300044673 Bacteria 6367
547 Ga0453683_0033390 3300044673 Bacteria 3244
548 Ga0453683_0035066 3300044673 Bacteria 3162
549 Ga0453683_0040935 3300044673 Bacteria 2909
550 Ga0453683_0091779 3300044673 Bacteria 1904
551 Ga0453683_0121536 3300044673 Bacteria 1644
552 Ga0453683_0133840 3300044673 Bacteria 1563
553 Ga0453683_0138230 3300044673 Bacteria 1537
554 Ga0453684_0000095 3300044712 Bacteria 378681
555 Ga0453684_0000435 3300044712 Bacteria 170233
556 Ga0453684_0000658 3300044712 Bacteria 124108
557 Ga0453684_0002220 3300044712 Bacteria 48195
558 Ga0453684_0003436 3300044712 Bacteria 35721
559 Ga0453684_0003836 3300044712 Bacteria 33167
560 Ga0453684_0003913 3300044712 Bacteria 32729
561 Ga0453684_0003965 3300044712 Bacteria 32341
562 Ga0453684_0004484 3300044712 Bacteria 29353
563 Ga0453684_0005006 3300044712 Bacteria 26923
564 Ga0453684_0007770 3300044712 Bacteria 19567
565 Ga0453684_0008106 3300044712 Bacteria 18986
566 Ga0453684_0019525 3300044712 Bacteria 10308
567 Ga0453684_0020898 3300044712 Bacteria 9823
568 Ga0453684_0024301 3300044712 Bacteria 8863
569 Ga0453684_0030731 3300044712 Bacteria 7577
570 Ga0453684_0041143 3300044712 Bacteria 6258
571 Ga0453684_0065079 3300044712 Bacteria 4652
572 Ga0453684_0078159 3300044712 Bacteria 4142
573 Ga0453684_0108575 3300044712 Bacteria 3377
574 Ga0453684_0134928 3300044712 Bacteria 2957
575 Ga0453684_0145691 3300044712 Bacteria 2822
576 Ga0453684_0162017 3300044712 Bacteria 2644
577 Ga0453684_0171460 3300044712 Bacteria 2557
578 Ga0453684_0221663 3300044712 Bacteria 2190
579 Ga0453684_0232435 3300044712 Bacteria 2128
580 Ga0453684_0252026 3300044712 Bacteria 2027
581 Ga0453684_0272831 3300044712 Bacteria 1932
582 Ga0451576_0000009 3300045051 Bacteria 712666
583 Ga0451576_0004137 3300045051 Bacteria 19130
584 Ga0451576_0013764 3300045051 Bacteria 9036
585 Ga0451576_0039537 3300045051 Bacteria 4992
586 Ga0451576_0100187 3300045051 Bacteria 3013
587 Ga0451576_0112435 3300045051 Bacteria 2834
588 Ga0451576_0362340 3300045051 Bacteria 1518
589 Ga0451576_0487085 3300045051 Bacteria 1295
590 Ga0451576_0799112 3300045051 Bacteria 991
591 Ga0466958_0083916 3300045836 Bacteria 1964
592 Ga0466967_0113928 3300045976 Bacteria 2489
593 Ga0495592_0040849 3300046454 Bacteria 3479
594 Ga0495629_0032995 3300046459 Bacteria 3664
595 Ga0495629_0083396 3300046459 Bacteria 2231
596 Ga0495651_0021110 3300046462 Bacteria 5058
597 Ga0495580_0096768 3300046472 Bacteria 2053
598 Ga0495664_0058025 3300046477 Bacteria 2303
599 Ga0495585_0041323 3300046492 Bacteria 2586
600 Ga0495607_0039078 3300046501 Bacteria 2836
601 Ga0495631_0074918 3300046518 Bacteria 1461
602 Ga0495644_0049478 3300046523 Bacteria 1578
603 Ga0495586_0164446 3300046535 Bacteria 1252
604 Ga0495587_0013497 3300046536 Bacteria 5133
605 Ga0495609_0045025 3300046538 Bacteria 1978
606 Ga0495667_0147987 3300046559 Bacteria 1512
607 Ga0495634_0020169 3300046642 Bacteria 4729
608 Ga0495599_0143843 3300046678 Bacteria 1479
609 Ga0495647_0044483 3300046681 Bacteria 1703
610 Ga0495669_0031718 3300046684 Bacteria 2321
611 Ga0495613_0037349 3300046689 Bacteria 3601
612 Ga0495613_0091922 3300046689 Bacteria 2198
613 Ga0495600_0034985 3300046809 Bacteria 3262
614 Ga0495672_0000950 3300047320 Bacteria 30212
615 Ga0495680_0151811 3300047322 Bacteria 1688
616 Ga0495684_0013272 3300047471 Bacteria 6352
617 Ga0495684_0128210 3300047471 Unclassified 1907
618 Ga0496100_0090488 3300048903 Bacteria 2087
619 Ga0496103_0079054 3300048906 Bacteria 2066
620 Ga0496104_0066776 3300048907 Bacteria 3415
621 Ga0496105_0032388 3300048908 Bacteria 4289
622 Ga0496109_0000050 3300048912 Bacteria 126918
623 Ga0496109_0005550 3300048912 Bacteria 10565
624 Ga0496110_0045619 3300048913 Bacteria 3832
625 Ga0496111_0036468 3300048914 Bacteria 3516
626 Ga0496112_0044568 3300048915 Bacteria 4347
627 Ga0496112_0326263 3300048915 Bacteria 1479
628 Ga0496114_0006966 3300048917 Bacteria 8907
629 Ga0496115_0036066 3300048918 Bacteria 3914
630 Ga0501299_001397 3300049522 Bacteria 3091
631 Ga0501032_0055085 3300049569 Bacteria 2676
632 Ga0501034_0000697 3300049571 Bacteria 51021
633 Ga0501034_0003324 3300049571 Bacteria 18349
634 Ga0501034_0180638 3300049571 Bacteria 2075
635 Ga0501036_0154084 3300049572 Bacteria 1938
636 Ga0501038_0107537 3300049574 Bacteria 2314
637 Ga0501038_0136779 3300049574 Bacteria 2007
638 Ga0501039_0038917 3300049575 Bacteria 3673
639 Ga0501040_0009945 3300049576 Bacteria 6211
640 Ga0501040_0060232 3300049576 Bacteria 2609
641 Ga0501041_0194324 3300049577 Bacteria 1271
642 Ga0501042_0013395 3300049578 Bacteria 5579
643 Ga0501042_0018988 3300049578 Bacteria 4769
644 Ga0501046_0102017 3300049580 Bacteria 2200
645 Ga0501048_0044030 3300049582 Bacteria 3193
646 Ga0501070_0032505 3300049586 Bacteria 4367
647 Ga0501071_0015413 3300049587 Bacteria 5247
648 Ga0501071_0041682 3300049587 Bacteria 3288
649 Ga0501071_0042535 3300049587 Bacteria 3256
650 Ga0501071_0064339 3300049587 Bacteria 2661
651 Ga0501072_0023275 3300049588 Bacteria 4811
652 Ga0501072_0074195 3300049588 Bacteria 2690
653 Ga0501072_0086859 3300049588 Bacteria 2482
654 Ga0501072_0140446 3300049588 Bacteria 1926
655 Ga0501075_0001982 3300049591 Bacteria 13529
656 Ga0501075_0112878 3300049591 Bacteria 2066
657 Ga0501075_0169159 3300049591 Bacteria 1667
658 Ga0501075_0173705 3300049591 Bacteria 1644
659 Ga0501076_0044694 3300049592 Bacteria 3493
660 Ga0501077_0098978 3300049593 Bacteria 1848
661 Ga0501217_000598 3300049661 Bacteria 6090
662 Ga0501233_001709 3300049668 Bacteria 3777
663 Ga0501235_003236 3300049669 Bacteria 3513
664 Ga0501249_012311 3300049679 Bacteria 1807
665 Ga0501225_0006935 3300049705 Bacteria 3299
666 Ga0501225_0009293 3300049705 Bacteria 2802
667 Ga0501079_0023424 3300049741 Bacteria 4738
668 Ga0501079_0174533 3300049741 Bacteria 1676
669 Ga0501079_0250343 3300049741 Bacteria 1385
670 Ga0501080_0115005 3300049742 Bacteria 2495
671 Ga0501081_0046648 3300049743 Bacteria 2979
672 Ga0501081_0048754 3300049743 Bacteria 2915
673 Ga0501268_009470 3300049765 Bacteria 1498
674 Ga0501035_0063591 3300049822 Bacteria 3282
675 nmdc:mga00v17_15302_c1 3300050491 Bacteria 4305
676 nmdc:mga0yw44_124318_c1 3300050492 Bacteria 1664
677 nmdc:mga0k408_73239_c1 3300050493 Bacteria 2001
678 nmdc:mga0k408_8092_c1 3300050493 Bacteria 5637
679 nmdc:mga06z11_35150_c1 3300050494 Bacteria 2465
680 nmdc:mga06z11_91309_c1 3300050494 Bacteria 1653
681 nmdc:mga07m45_186729_c1 3300050496 Bacteria 1205
682 nmdc:mga05p37_11687_c1 3300050507 Bacteria 10462
683 nmdc:mga05p37_118770_c1 3300050507 Bacteria 3249
684 nmdc:mga05p37_146037_c1 3300050507 Bacteria 2897
685 nmdc:mga05p37_148043_c1 3300050507 Bacteria 2874
686 nmdc:mga05p37_169131_c1 3300050507 Bacteria 2666
687 nmdc:mga05p37_22379_c1 3300050507 Bacteria 3009
688 nmdc:mga05p37_237139_c1 3300050507 Bacteria 2195
689 nmdc:mga05p37_25707_c1 3300050507 Bacteria 7160
690 nmdc:mga05p37_26155_c2 3300050507 Bacteria 1759
691 nmdc:mga05p37_35213_c1 3300050507 Bacteria 6137
692 nmdc:mga05p37_379521_c1 3300050507 Bacteria 1657
693 nmdc:mga05p37_574671_c1 3300050507 Bacteria 1278
694 nmdc:mga05p37_72754_c1 3300050507 Bacteria 4230
695 nmdc:mga05p37_7639_c1 3300050507 Bacteria 12758
696 nmdc:mga05p37_81158_c1 3300050507 Bacteria 3995
697 nmdc:mga09592_13586_c1 3300050508 Bacteria 6652
698 nmdc:mga09592_150172_c1 3300050508 Bacteria 2010
699 nmdc:mga09592_167553_c1 3300050508 Bacteria 1899
700 nmdc:mga09592_216305_c1 3300050508 Bacteria 1660
701 nmdc:mga09592_333416_c1 3300050508 Bacteria 1313
702 nmdc:mga09592_63580_c1 3300050508 Bacteria 3124
703 nmdc:mga09592_70468_c1 3300050508 Bacteria 2966
704 nmdc:mga09592_8755_c1 3300050508 Bacteria 8234
705 nmdc:mga0qj67_158450_c1 3300050509 Bacteria 1838
706 nmdc:mga0qj67_22837_c1 3300050509 Bacteria 4806
707 nmdc:mga0qj67_71412_c1 3300050509 Unclassified 2771
708 nmdc:mga06r32_294907_c1 3300050510 Bacteria 1608
709 nmdc:mga06r32_3413_c1 3300050510 Bacteria 14211
710 nmdc:mga06r32_78363_c1 3300050510 Plasmid 3212
711 nmdc:mga06r32_87376_c1 3300050510 Bacteria 3042
712 nmdc:mga06r32_99097_c1 3300050510 Bacteria 2858
713 nmdc:mga08y16_117024_c1 3300050511 Bacteria 2775
714 nmdc:mga08y16_2001_c1 3300050511 Bacteria 20837
715 nmdc:mga08y16_301089_c1 3300050511 Bacteria 1653
716 nmdc:mga08y16_49839_c1 3300050511 Bacteria 4381
717 nmdc:mga08y16_65119_c1 3300050511 Bacteria 3805
718 nmdc:mga08y16_91753_c1 3300050511 Bacteria 3165
719 nmdc:mga08y16_9570_c1 3300050511 Bacteria 10172
720 nmdc:mga0n895_46412_c1 3300050512 Bacteria 4244
721 nmdc:mga08x19_37210_c1 3300050514 Bacteria 3087
722 nmdc:mga08x19_47369_c1 3300050514 Bacteria 2751
723 nmdc:mga0a205_10028_c1 3300050515 Bacteria 8690
724 nmdc:mga0a205_132248_c1 3300050515 Bacteria 2396
725 nmdc:mga0a205_142146_c1 3300050515 Bacteria 2300
726 nmdc:mga0a205_147995_c1 3300050515 Bacteria 2248
727 nmdc:mga0a205_4149_c1 3300050515 Bacteria 12975
728 nmdc:mga0a205_58118_c1 3300050515 Bacteria 3735
729 Ga0495619_0008599 3300053085 Bacteria 6459
730 Ga0495619_0077653 3300053085 Bacteria 2231
731 Ga0500555_002121 3300053103 Bacteria 5806
732 Ga0501084_0101804 3300054114 Bacteria 2412
733 Ga0590071_026465 3300059421 Bacteria 1376
734 Ga0590075_006066 3300059424 Bacteria 2861
735 Ga0590077_001730 3300059426 Bacteria 4940
736 Ga0501082_0123324 3300060353 Bacteria 2247
737 Ga0501082_0160466 3300060353 Bacteria 1954
738 Ga0530510_0029255 3300061734 Bacteria 3954
739 Ga0530510_0041831 3300061734 Bacteria 3309

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300028379 Ga0268266_10323359 Ga0268266_103233591 292
2 3300045051 Ga0451576_0799112 Ga0451576_0799112_32_931 296
3 3300025941 Ga0207711_10019017 Ga0207711_100190174 311
4 3300048906 Ga0496103_0079054 Ga0496103_0079054_1017_2054 326
5 3300050507 nmdc:mga05p37_379521_c1 nmdc:mga05p37_379521_c1_20_1039 327
6 3300042876 Ga0451577_0492434 Ga0451577_0492434_48_1094 345
7 3300060353 Ga0501082_0123324 Ga0501082_0123324_842_1897 348
8 3300044656 Ga0466969_0139745 Ga0466969_0139745_19_1095 350
9 3300036712 Ga0316584_0018135 Ga0316584_0018135_102_1184 351
10 3300036647 Ga0316582_0114705 Ga0316582_0114705_685_1761 355
11 3300050508 nmdc:mga09592_333416_c1 nmdc:mga09592_333416_c1_11_1087 355
12 3300025941 Ga0207711_10141442 Ga0207711_101414422 356
13 3300048907 Ga0496104_0066776 Ga0496104_0066776_1049_2218 356
14 3300048908 Ga0496105_0032388 Ga0496105_0032388_824_1993 356
15 3300048917 Ga0496114_0006966 Ga0496114_0006966_713_1882 356
16 3300048918 Ga0496115_0036066 Ga0496115_0036066_1942_3111 356
17 3300006051 Ga0075364_10018652 Ga0075364_100186522 361
18 3300050493 nmdc:mga0k408_73239_c1 nmdc:mga0k408_73239_c1_170_1315 362
19 3300005985 Ga0081539_10002137 Ga0081539_100021379 363
20 3300005366 Ga0070659_100052144 Ga0070659_1000521441 365
21 3300025932 Ga0207690_10082096 Ga0207690_100820961 365
22 3300048915 Ga0496112_0044568 Ga0496112_0044568_3157_4311 365
23 3300053085 Ga0495619_0077653 Ga0495619_0077653_46_1146 365
24 3300005458 Ga0070681_10226988 Ga0070681_102269882 366
25 3300025938 Ga0207704_10074578 Ga0207704_100745782 366
26 3300036401 Ga0373937_0240146 Ga0373937_0240146_291_1400 366
27 3300042461 Ga0439460_0051578 Ga0439460_0051578_25_1185 366
28 3300006847 Ga0075431_100036660 Ga0075431_1000366602 367
29 3300031995 Ga0307409_100082558 Ga0307409_1000825582 367
30 3300042133 Ga0450896_006344 Ga0450896_006344_325_1491 367
31 3300049577 Ga0501041_0194324 Ga0501041_0194324_11_1123 367
32 3300005333 Ga0070677_10077528 Ga0070677_100775281 368
33 3300005536 Ga0070697_100018839 Ga0070697_1000188392 368
34 3300005616 Ga0068852_100149020 Ga0068852_1001490202 368
35 3300006358 Ga0068871_100009590 Ga0068871_1000095905 368
36 3300006881 Ga0068865_100082466 Ga0068865_1000824663 368
37 3300013296 Ga0157374_10007459 Ga0157374_100074596 368
38 3300014325 Ga0163163_10152427 Ga0163163_101524273 368
39 3300025926 Ga0207659_10000077 Ga0207659_1000007745 368
40 3300026089 Ga0207648_10091369 Ga0207648_100913692 368
41 3300031995 Ga0307409_100181749 Ga0307409_1001817491 368
42 3300048913 Ga0496110_0045619 Ga0496110_0045619_43_1212 368
43 3300035172 Ga0373955_0008811 Ga0373955_0008811_1647_2810 369
44 3300042439 Ga0439464_0018965 Ga0439464_0018965_561_1730 369
45 3300059421 Ga0590071_026465 Ga0590071_026465_91_1269 369
46 3300059424 Ga0590075_006066 Ga0590075_006066_595_1752 369
47 3300059426 Ga0590077_001730 Ga0590077_001730_1713_2870 369
48 3300005330 Ga0070690_100235844 Ga0070690_1002358441 370
49 3300005334 Ga0068869_100153722 Ga0068869_1001537221 370
50 3300005338 Ga0068868_100159212 Ga0068868_1001592122 370
51 3300005434 Ga0070709_10133411 Ga0070709_101334112 370
52 3300005466 Ga0070685_10045697 Ga0070685_100456971 370
53 3300005617 Ga0068859_100079723 Ga0068859_1000797231 370
54 3300005842 Ga0068858_100116386 Ga0068858_1001163862 370
55 3300005843 Ga0068860_100002847 Ga0068860_1000028478 370
56 3300005843 Ga0068860_100132387 Ga0068860_1001323872 370
57 3300006931 Ga0097620_100079723 Ga0097620_1000797231 370
58 3300009148 Ga0105243_10312253 Ga0105243_103122531 370
59 3300009176 Ga0105242_10182658 Ga0105242_101826582 370
60 3300009177 Ga0105248_10013857 Ga0105248_100138573 370
61 3300009177 Ga0105248_10351788 Ga0105248_103517882 370
62 3300009545 Ga0105237_10309170 Ga0105237_103091702 370
63 3300010375 Ga0105239_10025091 Ga0105239_100250914 370
64 3300013297 Ga0157378_10000071 Ga0157378_100000715 370
65 3300013306 Ga0163162_10013390 Ga0163162_100133901 370
66 3300013306 Ga0163162_10279721 Ga0163162_102797212 370
67 3300025904 Ga0207647_10022443 Ga0207647_100224432 370
68 3300025941 Ga0207711_10054485 Ga0207711_100544852 370
69 3300025942 Ga0207689_10002264 Ga0207689_1000226412 370
70 3300025949 Ga0207667_10166449 Ga0207667_101664491 370
71 3300026023 Ga0207677_10147587 Ga0207677_101475871 370
72 3300026035 Ga0207703_10036937 Ga0207703_100369371 370
73 3300026088 Ga0207641_10140743 Ga0207641_101407432 370
74 3300028381 Ga0268264_10031838 Ga0268264_100318381 370
75 3300035172 Ga0373955_0017844 Ga0373955_0017844_113_1282 370
76 3300046809 Ga0495600_0034985 Ga0495600_0034985_220_1389 370
77 3300048903 Ga0496100_0090488 Ga0496100_0090488_97_1272 370
78 3300053085 Ga0495619_0008599 Ga0495619_0008599_2889_4058 370
79 3300021358 Ga0213873_10002975 Ga0213873_100029753 371
80 3300031733 Ga0316577_10053723 Ga0316577_100537232 371
81 3300036712 Ga0316584_0043490 Ga0316584_0043490_633_1793 371
82 3300039453 Ga0436362_0461762 Ga0436362_0461762_1986_3161 371
83 3300050511 nmdc:mga08y16_9570_c1 nmdc:mga08y16_9570_c1_4768_5961 371
84 3300005364 Ga0070673_100025432 Ga0070673_1000254323 372
85 3300009148 Ga0105243_10112251 Ga0105243_101122512 372
86 3300025960 Ga0207651_10080014 Ga0207651_100800142 372
87 3300044712 Ga0453684_0004484 Ga0453684_0004484_21878_23047 373
88 3300044712 Ga0453684_0272831 Ga0453684_0272831_659_1825 373
89 3300005467 Ga0070706_100002696 Ga0070706_1000026968 374
90 3300025910 Ga0207684_10004777 Ga0207684_100047776 374
91 3300009094 Ga0111539_10020698 Ga0111539_100206984 375
92 3300005444 Ga0070694_100103178 Ga0070694_1001031782 376
93 3300009147 Ga0114129_10167193 Ga0114129_101671933 376
94 3300050507 nmdc:mga05p37_22379_c1 nmdc:mga05p37_22379_c1_311_1483 376
95 3300006844 Ga0075428_100039872 Ga0075428_1000398723 377
96 3300006846 Ga0075430_100011648 Ga0075430_1000116483 377
97 3300006880 Ga0075429_100057680 Ga0075429_1000576803 377
98 3300009147 Ga0114129_10003317 Ga0114129_100033177 377
99 3300009147 Ga0114129_10130106 Ga0114129_101301063 377
100 3300050507 nmdc:mga05p37_72754_c1 nmdc:mga05p37_72754_c1_2215_3378 377
101 3300006042 Ga0075368_10040308 Ga0075368_100403081 378
102 3300006051 Ga0075364_10009449 Ga0075364_100094491 378
103 3300006051 Ga0075364_10009689 Ga0075364_100096892 378
104 3300006177 Ga0075362_10002794 Ga0075362_100027942 378
105 3300006178 Ga0075367_10058297 Ga0075367_100582972 378
106 3300049571 Ga0501034_0003324 Ga0501034_0003324_13966_15111 378
107 3300049705 Ga0501225_0009293 Ga0501225_0009293_296_1435 378
108 3300050491 nmdc:mga00v17_15302_c1 nmdc:mga00v17_15302_c1_2931_4076 378
109 3300050494 nmdc:mga06z11_35150_c1 nmdc:mga06z11_35150_c1_1230_2375 378
110 3300050507 nmdc:mga05p37_25707_c1 nmdc:mga05p37_25707_c1_3128_4273 378
111 3300050508 nmdc:mga09592_70468_c1 nmdc:mga09592_70468_c1_493_1677 378
112 iso_pu_bacteria 8056060235 8056066692 378
113 3300031665 Ga0316575_10063620 Ga0316575_100636201 379
114 3300031691 Ga0316579_10001246 Ga0316579_100012464 379
115 3300031727 Ga0316576_10000309 Ga0316576_100003095 379
116 3300031728 Ga0316578_10000084 Ga0316578_100000844 379
117 3300031733 Ga0316577_10003136 Ga0316577_100031363 379
118 3300032005 Ga0307411_10108465 Ga0307411_101084652 379
119 3300032133 Ga0316583_10004337 Ga0316583_100043372 379
120 3300032139 Ga0316580_10000167 Ga0316580_1000016710 379
121 3300033524 Ga0316592_1002977 Ga0316592_10029771 379
122 3300033527 Ga0316586_1006770 Ga0316586_10067702 379
123 3300033528 Ga0316588_1001903 Ga0316588_10019031 379
124 3300033541 Ga0316596_1003423 Ga0316596_10034231 379
125 3300035398 Ga0316574_0002305 Ga0316574_0002305_4068_5237 379
126 3300036647 Ga0316582_0000605 Ga0316582_0000605_7446_8615 379
127 3300036712 Ga0316584_0000083 Ga0316584_0000083_16278_17447 379
128 3300037588 Ga0316581_0000114 Ga0316581_0000114_7193_8362 379
129 3300049765 Ga0501268_009470 Ga0501268_009470_67_1209 379
130 3300006880 Ga0075429_100048806 Ga0075429_1000488063 380
131 3300026075 Ga0207708_10254413 Ga0207708_102544132 380
132 3300026116 Ga0207674_10070480 Ga0207674_100704802 380
133 3300046459 Ga0495629_0032995 Ga0495629_0032995_932_2095 380
134 3300046689 Ga0495613_0091922 Ga0495613_0091922_952_2115 380
135 3300005471 Ga0070698_100068063 Ga0070698_1000680634 381
136 3300021384 Ga0213876_10006799 Ga0213876_100067994 381
137 3300021384 Ga0213876_10045205 Ga0213876_100452052 381
138 3300025903 Ga0207680_10153109 Ga0207680_101531092 381
139 3300027907 Ga0207428_10097234 Ga0207428_100972341 381
140 3300035691 Ga0373931_0097086 Ga0373931_0097086_164_1315 381
141 3300039437 Ga0436365_1421543 Ga0436365_1421543_1208_2371 381
142 3300039437 Ga0436365_1614937 Ga0436365_1614937_755_1906 381
143 3300045051 Ga0451576_0362340 Ga0451576_0362340_62_1234 381
144 3300046642 Ga0495634_0020169 Ga0495634_0020169_2356_3507 381
145 3300046678 Ga0495599_0143843 Ga0495599_0143843_316_1467 381
146 3300050511 nmdc:mga08y16_117024_c1 nmdc:mga08y16_117024_c1_126_1277 381
147 3300050515 nmdc:mga0a205_58118_c1 nmdc:mga0a205_58118_c1_343_1494 381
148 3300005329 Ga0070683_100334647 Ga0070683_1003346472 382
149 3300005436 Ga0070713_100010845 Ga0070713_1000108454 382
150 3300005530 Ga0070679_100058522 Ga0070679_1000585221 382
151 3300005535 Ga0070684_100000189 Ga0070684_10000018929 382
152 3300005577 Ga0068857_100000218 Ga0068857_10000021830 382
153 3300005983 Ga0081540_1002636 Ga0081540_10026366 382
154 3300006852 Ga0075433_10010811 Ga0075433_100108115 382
155 3300007265 Ga0099794_10045833 Ga0099794_100458332 382
156 3300009094 Ga0111539_10042916 Ga0111539_100429165 382
157 3300009094 Ga0111539_10258642 Ga0111539_102586422 382
158 3300013105 Ga0157369_10004434 Ga0157369_1000443413 382
159 3300025912 Ga0207707_10070755 Ga0207707_100707551 382
160 3300025944 Ga0207661_10005786 Ga0207661_100057863 382
161 3300025944 Ga0207661_10261229 Ga0207661_102612291 382
162 3300026116 Ga0207674_10000366 Ga0207674_100003664 382
163 3300031548 Ga0307408_100176930 Ga0307408_1001769301 382
164 3300031691 Ga0316579_10026703 Ga0316579_100267032 382
165 3300031727 Ga0316576_10027960 Ga0316576_100279602 382
166 3300032002 Ga0307416_100169234 Ga0307416_1001692342 382
167 3300032002 Ga0307416_100392590 Ga0307416_1003925901 382
168 3300032005 Ga0307411_10073947 Ga0307411_100739472 382
169 3300032139 Ga0316580_10031151 Ga0316580_100311512 382
170 3300032168 Ga0316593_10039033 Ga0316593_100390332 382
171 3300032168 Ga0316593_10049300 Ga0316593_100493001 382
172 3300033529 Ga0316587_1008710 Ga0316587_10087102 382
173 3300036647 Ga0316582_0125241 Ga0316582_0125241_299_1465 382
174 3300036712 Ga0316584_0037573 Ga0316584_0037573_1674_2840 382
175 3300037588 Ga0316581_0019093 Ga0316581_0019093_537_1703 382
176 3300049522 Ga0501299_001397 Ga0501299_001397_1173_2330 382
177 3300049679 Ga0501249_012311 Ga0501249_012311_143_1300 382
178 3300005458 Ga0070681_10134586 Ga0070681_101345861 383
179 3300005468 Ga0070707_100000106 Ga0070707_10000010654 383
180 3300005937 Ga0081455_10005145 Ga0081455_1000514511 383
181 3300009094 Ga0111539_10063129 Ga0111539_100631291 383
182 3300009147 Ga0114129_10031968 Ga0114129_100319686 383
183 3300025922 Ga0207646_10006424 Ga0207646_100064244 383
184 3300031691 Ga0316579_10017428 Ga0316579_100174283 383
185 3300031727 Ga0316576_10049146 Ga0316576_100491462 383
186 3300031727 Ga0316576_10077700 Ga0316576_100777002 383
187 3300032168 Ga0316593_10001458 Ga0316593_100014583 383
188 3300033541 Ga0316596_1002130 Ga0316596_10021303 383
189 3300035398 Ga0316574_0054670 Ga0316574_0054670_662_1822 383
190 3300036647 Ga0316582_0227489 Ga0316582_0227489_88_1248 383
191 3300036712 Ga0316584_0051862 Ga0316584_0051862_1850_3010 383
192 3300036712 Ga0316584_0174834 Ga0316584_0174834_399_1577 383
193 3300039093 Ga0400489_64979 Ga0400489_64979_285_1445 383
194 3300044673 Ga0453683_0091779 Ga0453683_0091779_83_1243 383
195 3300045051 Ga0451576_0100187 Ga0451576_0100187_1219_2379 383
196 3300045976 Ga0466967_0113928 Ga0466967_0113928_675_1844 383
197 3300046454 Ga0495592_0040849 Ga0495592_0040849_66_1223 383
198 3300050507 nmdc:mga05p37_148043_c1 nmdc:mga05p37_148043_c1_1058_2215 383
199 3300050511 nmdc:mga08y16_65119_c1 nmdc:mga08y16_65119_c1_2385_3542 383
200 3300050515 nmdc:mga0a205_132248_c1 nmdc:mga0a205_132248_c1_103_1260 383
201 3300005329 Ga0070683_100006910 Ga0070683_1000069104 384
202 3300005344 Ga0070661_100011515 Ga0070661_1000115152 384
203 3300005354 Ga0070675_100101769 Ga0070675_1001017692 384
204 3300005364 Ga0070673_100067086 Ga0070673_1000670862 384
205 3300005444 Ga0070694_100002059 Ga0070694_1000020592 384
206 3300005456 Ga0070678_100214770 Ga0070678_1002147702 384
207 3300005459 Ga0068867_100019588 Ga0068867_1000195882 384
208 3300005471 Ga0070698_100001656 Ga0070698_1000016562 384
209 3300005518 Ga0070699_100004274 Ga0070699_1000042743 384
210 3300005518 Ga0070699_100017985 Ga0070699_1000179855 384
211 3300005518 Ga0070699_100040039 Ga0070699_1000400392 384
212 3300005535 Ga0070684_100035605 Ga0070684_1000356052 384
213 3300005535 Ga0070684_100195748 Ga0070684_1001957482 384
214 3300005539 Ga0068853_100057610 Ga0068853_1000576103 384
215 3300005549 Ga0070704_100025932 Ga0070704_1000259322 384
216 3300005564 Ga0070664_100084994 Ga0070664_1000849942 384
217 3300005840 Ga0068870_10010664 Ga0068870_100106641 384
218 3300005841 Ga0068863_100145983 Ga0068863_1001459832 384
219 3300005843 Ga0068860_100135281 Ga0068860_1001352812 384
220 3300005843 Ga0068860_100174378 Ga0068860_1001743782 384
221 3300005937 Ga0081455_10170250 Ga0081455_101702501 384
222 3300005985 Ga0081539_10000065 Ga0081539_10000065122 384
223 3300006051 Ga0075364_10175820 Ga0075364_101758201 384
224 3300006058 Ga0075432_10004747 Ga0075432_100047472 384
225 3300006194 Ga0075427_10007862 Ga0075427_100078622 384
226 3300006237 Ga0097621_100003458 Ga0097621_1000034583 384
227 3300006358 Ga0068871_100002861 Ga0068871_10000286115 384
228 3300006844 Ga0075428_100037332 Ga0075428_1000373323 384
229 3300006846 Ga0075430_100066517 Ga0075430_1000665172 384
230 3300006881 Ga0068865_100003256 Ga0068865_1000032565 384
231 3300006914 Ga0075436_100012780 Ga0075436_1000127804 384
232 3300009093 Ga0105240_10213295 Ga0105240_102132952 384
233 3300009094 Ga0111539_10107532 Ga0111539_101075322 384
234 3300009094 Ga0111539_10122163 Ga0111539_101221632 384
235 3300009148 Ga0105243_10175211 Ga0105243_101752112 384
236 3300009176 Ga0105242_10004777 Ga0105242_100047779 384
237 3300009176 Ga0105242_10019579 Ga0105242_100195792 384
238 3300009177 Ga0105248_10014785 Ga0105248_100147852 384
239 3300009545 Ga0105237_10011654 Ga0105237_100116544 384
240 3300009553 Ga0105249_10018289 Ga0105249_100182894 384
241 3300009553 Ga0105249_10075832 Ga0105249_100758322 384
242 3300009553 Ga0105249_10118822 Ga0105249_101188222 384
243 3300010375 Ga0105239_10031318 Ga0105239_100313184 384
244 3300011119 Ga0105246_10014418 Ga0105246_100144183 384
245 3300013297 Ga0157378_10076540 Ga0157378_100765403 384
246 3300013306 Ga0163162_10071470 Ga0163162_100714702 384
247 3300013307 Ga0157372_10011641 Ga0157372_100116416 384
248 3300014969 Ga0157376_10002785 Ga0157376_100027856 384
249 3300017792 Ga0163161_10121259 Ga0163161_101212592 384
250 3300025908 Ga0207643_10000487 Ga0207643_100004871 384
251 3300025910 Ga0207684_10184756 Ga0207684_101847562 384
252 3300025918 Ga0207662_10054800 Ga0207662_100548002 384
253 3300025920 Ga0207649_10016644 Ga0207649_100166443 384
254 3300025922 Ga0207646_10244370 Ga0207646_102443702 384
255 3300025927 Ga0207687_10063214 Ga0207687_100632142 384
256 3300025934 Ga0207686_10010141 Ga0207686_100101414 384
257 3300025934 Ga0207686_10012771 Ga0207686_100127714 384
258 3300025934 Ga0207686_10081737 Ga0207686_100817372 384
259 3300025938 Ga0207704_10004173 Ga0207704_100041734 384
260 3300025944 Ga0207661_10015982 Ga0207661_100159824 384
261 3300025945 Ga0207679_10074525 Ga0207679_100745252 384
262 3300025961 Ga0207712_10027787 Ga0207712_100277873 384
263 3300025961 Ga0207712_10171256 Ga0207712_101712562 384
264 3300026041 Ga0207639_10033068 Ga0207639_100330683 384
265 3300026075 Ga0207708_10001730 Ga0207708_100017304 384
266 3300026075 Ga0207708_10071718 Ga0207708_100717182 384
267 3300026088 Ga0207641_10036452 Ga0207641_100364522 384
268 3300026088 Ga0207641_10232732 Ga0207641_102327322 384
269 3300026089 Ga0207648_10028057 Ga0207648_100280573 384
270 3300026089 Ga0207648_10101314 Ga0207648_101013143 384
271 3300026095 Ga0207676_10078266 Ga0207676_100782663 384
272 3300026116 Ga0207674_10022788 Ga0207674_100227882 384
273 3300026118 Ga0207675_100005896 Ga0207675_1000058963 384
274 3300027907 Ga0207428_10129646 Ga0207428_101296462 384
275 3300028381 Ga0268264_10429625 Ga0268264_104296252 384
276 3300031250 Ga0265331_10007801 Ga0265331_100078014 384
277 3300031251 Ga0265327_10002501 Ga0265327_1000250110 384
278 3300031901 Ga0307406_10051691 Ga0307406_100516912 384
279 3300031995 Ga0307409_100005947 Ga0307409_1000059478 384
280 3300032004 Ga0307414_10082556 Ga0307414_100825562 384
281 3300032126 Ga0307415_100024251 Ga0307415_1000242512 384
282 3300035117 Ga0373953_0018632 Ga0373953_0018632_21_1181 384
283 3300035118 Ga0373954_0036222 Ga0373954_0036222_894_2054 384
284 3300035119 Ga0373956_0006966 Ga0373956_0006966_940_2100 384
285 3300035120 Ga0373957_0002419 Ga0373957_0002419_3048_4208 384
286 3300035691 Ga0373931_0039271 Ga0373931_0039271_770_1933 384
287 3300035724 Ga0373933_0007393 Ga0373933_0007393_1895_3055 384
288 3300036401 Ga0373937_0009945 Ga0373937_0009945_4185_5345 384
289 3300037418 Ga0395900_0022230 Ga0395900_0022230_4631_5794 384
290 3300037466 Ga0395898_0086258 Ga0395898_0086258_207_1370 384
291 3300038443 Ga0395901_0023913 Ga0395901_0023913_1610_2773 384
292 3300042876 Ga0451577_0001168 Ga0451577_0001168_8877_10040 384
293 3300044712 Ga0453684_0002220 Ga0453684_0002220_28947_30110 384
294 3300044712 Ga0453684_0019525 Ga0453684_0019525_4909_6072 384
295 3300045836 Ga0466958_0083916 Ga0466958_0083916_403_1566 384
296 3300046462 Ga0495651_0021110 Ga0495651_0021110_292_1452 384
297 3300046492 Ga0495585_0041323 Ga0495585_0041323_1243_2406 384
298 3300046501 Ga0495607_0039078 Ga0495607_0039078_284_1447 384
299 3300046518 Ga0495631_0074918 Ga0495631_0074918_272_1435 384
300 3300046538 Ga0495609_0045025 Ga0495609_0045025_645_1808 384
301 3300046684 Ga0495669_0031718 Ga0495669_0031718_520_1683 384
302 3300047322 Ga0495680_0151811 Ga0495680_0151811_399_1559 384
303 3300048912 Ga0496109_0005550 Ga0496109_0005550_4815_5978 384
304 3300048914 Ga0496111_0036468 Ga0496111_0036468_1479_2642 384
305 3300049569 Ga0501032_0055085 Ga0501032_0055085_949_2133 384
306 3300049574 Ga0501038_0107537 Ga0501038_0107537_521_1684 384
307 3300049576 Ga0501040_0009945 Ga0501040_0009945_3291_4454 384
308 3300049578 Ga0501042_0013395 Ga0501042_0013395_2097_3260 384
309 3300049578 Ga0501042_0018988 Ga0501042_0018988_1444_2607 384
310 3300049582 Ga0501048_0044030 Ga0501048_0044030_1871_3034 384
311 3300049586 Ga0501070_0032505 Ga0501070_0032505_194_1357 384
312 3300049587 Ga0501071_0015413 Ga0501071_0015413_3788_4951 384
313 3300049588 Ga0501072_0074195 Ga0501072_0074195_547_1710 384
314 3300049588 Ga0501072_0086859 Ga0501072_0086859_1137_2300 384
315 3300049591 Ga0501075_0001982 Ga0501075_0001982_5876_7039 384
316 3300049592 Ga0501076_0044694 Ga0501076_0044694_1494_2657 384
317 3300049743 Ga0501081_0048754 Ga0501081_0048754_1028_2191 384
318 3300050507 nmdc:mga05p37_81158_c1 nmdc:mga05p37_81158_c1_258_1421 384
319 3300050509 nmdc:mga0qj67_158450_c1 nmdc:mga0qj67_158450_c1_634_1797 384
320 3300050509 nmdc:mga0qj67_71412_c1 nmdc:mga0qj67_71412_c1_248_1402 384
321 3300061734 Ga0530510_0029255 Ga0530510_0029255_1281_2444 384
322 3300003203 JGI25406J46586_10000671 JGI25406J46586_100006719 385
323 3300003203 JGI25406J46586_10055405 JGI25406J46586_100554051 385
324 3300005289 Ga0065704_10103603 Ga0065704_101036032 385
325 3300005295 Ga0065707_10001307 Ga0065707_100013076 385
326 3300005295 Ga0065707_10007546 Ga0065707_100075462 385
327 3300005295 Ga0065707_10108163 Ga0065707_101081632 385
328 3300005295 Ga0065707_10124595 Ga0065707_101245952 385
329 3300005334 Ga0068869_100187016 Ga0068869_1001870162 385
330 3300005336 Ga0070680_100038055 Ga0070680_1000380553 385
331 3300005336 Ga0070680_100145675 Ga0070680_1001456752 385
332 3300005338 Ga0068868_100059747 Ga0068868_1000597472 385
333 3300005340 Ga0070689_100035853 Ga0070689_1000358532 385
334 3300005347 Ga0070668_100139982 Ga0070668_1001399821 385
335 3300005356 Ga0070674_100036772 Ga0070674_1000367723 385
336 3300005365 Ga0070688_100086686 Ga0070688_1000866862 385
337 3300005435 Ga0070714_100008748 Ga0070714_1000087482 385
338 3300005440 Ga0070705_100001047 Ga0070705_1000010475 385
339 3300005440 Ga0070705_100012481 Ga0070705_1000124811 385
340 3300005440 Ga0070705_100027130 Ga0070705_1000271302 385
341 3300005444 Ga0070694_100004558 Ga0070694_1000045585 385
342 3300005444 Ga0070694_100016354 Ga0070694_1000163542 385
343 3300005445 Ga0070708_100003230 Ga0070708_1000032308 385
344 3300005445 Ga0070708_100079644 Ga0070708_1000796442 385
345 3300005467 Ga0070706_100002254 Ga0070706_1000022541 385
346 3300005468 Ga0070707_100152310 Ga0070707_1001523102 385
347 3300005471 Ga0070698_100020442 Ga0070698_1000204421 385
348 3300005471 Ga0070698_100035179 Ga0070698_1000351792 385
349 3300005471 Ga0070698_100037340 Ga0070698_1000373404 385
350 3300005471 Ga0070698_100039110 Ga0070698_1000391102 385
351 3300005471 Ga0070698_100092034 Ga0070698_1000920343 385
352 3300005471 Ga0070698_100137974 Ga0070698_1001379742 385
353 3300005518 Ga0070699_100002052 Ga0070699_1000020529 385
354 3300005518 Ga0070699_100099602 Ga0070699_1000996022 385
355 3300005518 Ga0070699_100110737 Ga0070699_1001107372 385
356 3300005518 Ga0070699_100121435 Ga0070699_1001214352 385
357 3300005518 Ga0070699_100218781 Ga0070699_1002187812 385
358 3300005530 Ga0070679_100038913 Ga0070679_1000389132 385
359 3300005536 Ga0070697_100215645 Ga0070697_1002156452 385
360 3300005544 Ga0070686_100015781 Ga0070686_1000157813 385
361 3300005545 Ga0070695_100008748 Ga0070695_1000087482 385
362 3300005546 Ga0070696_100002222 Ga0070696_1000022228 385
363 3300005547 Ga0070693_100000033 Ga0070693_10000003347 385
364 3300005549 Ga0070704_100003023 Ga0070704_1000030233 385
365 3300005549 Ga0070704_100244135 Ga0070704_1002441351 385
366 3300005617 Ga0068859_100190030 Ga0068859_1001900302 385
367 3300005617 Ga0068859_100241562 Ga0068859_1002415622 385
368 3300005617 Ga0068859_100279545 Ga0068859_1002795451 385
369 3300005719 Ga0068861_100030632 Ga0068861_1000306323 385
370 3300005719 Ga0068861_100330615 Ga0068861_1003306151 385
371 3300005842 Ga0068858_100177747 Ga0068858_1001777472 385
372 3300005844 Ga0068862_100011331 Ga0068862_1000113314 385
373 3300005844 Ga0068862_100077639 Ga0068862_1000776392 385
374 3300005844 Ga0068862_100231877 Ga0068862_1002318772 385
375 3300005981 Ga0081538_10006773 Ga0081538_100067734 385
376 3300005985 Ga0081539_10001257 Ga0081539_1000125721 385
377 3300005985 Ga0081539_10008006 Ga0081539_100080067 385
378 3300006038 Ga0075365_10003491 Ga0075365_100034914 385
379 3300006038 Ga0075365_10082415 Ga0075365_100824151 385
380 3300006051 Ga0075364_10067587 Ga0075364_100675872 385
381 3300006177 Ga0075362_10009236 Ga0075362_100092362 385
382 3300006177 Ga0075362_10037874 Ga0075362_100378743 385
383 3300006178 Ga0075367_10019859 Ga0075367_100198593 385
384 3300006195 Ga0075366_10000144 Ga0075366_100001447 385
385 3300006195 Ga0075366_10067674 Ga0075366_100676742 385
386 3300006237 Ga0097621_100145060 Ga0097621_1001450602 385
387 3300006358 Ga0068871_100171981 Ga0068871_1001719812 385
388 3300006844 Ga0075428_100037707 Ga0075428_1000377073 385
389 3300006844 Ga0075428_100215203 Ga0075428_1002152031 385
390 3300006846 Ga0075430_100026321 Ga0075430_1000263212 385
391 3300006847 Ga0075431_100000336 Ga0075431_1000003364 385
392 3300006847 Ga0075431_100008530 Ga0075431_1000085302 385
393 3300006847 Ga0075431_100132679 Ga0075431_1001326792 385
394 3300006847 Ga0075431_100153943 Ga0075431_1001539433 385
395 3300006880 Ga0075429_100010868 Ga0075429_1000108686 385
396 3300006880 Ga0075429_100011153 Ga0075429_1000111533 385
397 3300006880 Ga0075429_100095295 Ga0075429_1000952952 385
398 3300006880 Ga0075429_100132595 Ga0075429_1001325951 385
399 3300006931 Ga0097620_100190033 Ga0097620_1001900332 385
400 3300006931 Ga0097620_100241585 Ga0097620_1002415851 385
401 3300006931 Ga0097620_100279530 Ga0097620_1002795301 385
402 3300009094 Ga0111539_10029848 Ga0111539_100298482 385
403 3300009098 Ga0105245_10008870 Ga0105245_100088707 385
404 3300009098 Ga0105245_10378680 Ga0105245_103786801 385
405 3300009147 Ga0114129_10004808 Ga0114129_1000480813 385
406 3300009147 Ga0114129_10008657 Ga0114129_1000865712 385
407 3300009147 Ga0114129_10074761 Ga0114129_100747612 385
408 3300009147 Ga0114129_10094455 Ga0114129_100944552 385
409 3300009147 Ga0114129_10127808 Ga0114129_101278082 385
410 3300009147 Ga0114129_10160411 Ga0114129_101604112 385
411 3300009148 Ga0105243_10035929 Ga0105243_100359293 385
412 3300009148 Ga0105243_10094921 Ga0105243_100949212 385
413 3300009148 Ga0105243_10152082 Ga0105243_101520821 385
414 3300009148 Ga0105243_10244368 Ga0105243_102443682 385
415 3300009176 Ga0105242_10163133 Ga0105242_101631331 385
416 3300009177 Ga0105248_10012017 Ga0105248_100120176 385
417 3300009177 Ga0105248_10399363 Ga0105248_103993632 385
418 3300009553 Ga0105249_10003642 Ga0105249_100036428 385
419 3300009553 Ga0105249_10055903 Ga0105249_100559032 385
420 3300009553 Ga0105249_10163885 Ga0105249_101638851 385
421 3300011119 Ga0105246_10052356 Ga0105246_100523562 385
422 3300013297 Ga0157378_10166097 Ga0157378_101660972 385
423 3300013306 Ga0163162_10268339 Ga0163162_102683392 385
424 3300013308 Ga0157375_10342950 Ga0157375_103429501 385
425 3300014326 Ga0157380_10073522 Ga0157380_100735222 385
426 3300014326 Ga0157380_10178690 Ga0157380_101786902 385
427 3300014745 Ga0157377_10028727 Ga0157377_100287273 385
428 3300025910 Ga0207684_10001483 Ga0207684_1000148319 385
429 3300025910 Ga0207684_10103117 Ga0207684_101031174 385
430 3300025913 Ga0207695_10000450 Ga0207695_100004507 385
431 3300025918 Ga0207662_10007973 Ga0207662_100079733 385
432 3300025921 Ga0207652_10028270 Ga0207652_100282702 385
433 3300025922 Ga0207646_10034586 Ga0207646_100345865 385
434 3300025927 Ga0207687_10009228 Ga0207687_100092282 385
435 3300025929 Ga0207664_10025214 Ga0207664_100252142 385
436 3300025933 Ga0207706_10051174 Ga0207706_100511742 385
437 3300025934 Ga0207686_10054293 Ga0207686_100542932 385
438 3300025935 Ga0207709_10175890 Ga0207709_101758901 385
439 3300025940 Ga0207691_10043105 Ga0207691_100431052 385
440 3300025949 Ga0207667_10169738 Ga0207667_101697382 385
441 3300025960 Ga0207651_10023341 Ga0207651_100233413 385
442 3300025960 Ga0207651_10140978 Ga0207651_101409781 385
443 3300025961 Ga0207712_10043018 Ga0207712_100430183 385
444 3300025972 Ga0207668_10103641 Ga0207668_101036412 385
445 3300026067 Ga0207678_10010352 Ga0207678_100103523 385
446 3300026075 Ga0207708_10025875 Ga0207708_100258752 385
447 3300026078 Ga0207702_10269165 Ga0207702_102691652 385
448 3300026118 Ga0207675_100017716 Ga0207675_1000177162 385
449 3300026118 Ga0207675_100128821 Ga0207675_1001288213 385
450 3300028380 Ga0268265_10132447 Ga0268265_101324471 385
451 3300031251 Ga0265327_10013931 Ga0265327_100139312 385
452 3300031665 Ga0316575_10031503 Ga0316575_100315032 385
453 3300031691 Ga0316579_10001813 Ga0316579_100018135 385
454 3300031691 Ga0316579_10046788 Ga0316579_100467882 385
455 3300031727 Ga0316576_10004794 Ga0316576_100047946 385
456 3300031727 Ga0316576_10030995 Ga0316576_100309951 385
457 3300031728 Ga0316578_10022307 Ga0316578_100223071 385
458 3300031733 Ga0316577_10001903 Ga0316577_100019039 385
459 3300031733 Ga0316577_10011268 Ga0316577_100112683 385
460 3300031852 Ga0307410_10076204 Ga0307410_100762042 385
461 3300032126 Ga0307415_100218171 Ga0307415_1002181712 385
462 3300032139 Ga0316580_10053952 Ga0316580_100539521 385
463 3300032168 Ga0316593_10000513 Ga0316593_100005133 385
464 3300035398 Ga0316574_0026855 Ga0316574_0026855_957_2123 385
465 3300035398 Ga0316574_0079305 Ga0316574_0079305_242_1408 385
466 3300036647 Ga0316582_0000018 Ga0316582_0000018_5077_6243 385
467 3300036647 Ga0316582_0016623 Ga0316582_0016623_2758_3924 385
468 3300036647 Ga0316582_0026650 Ga0316582_0026650_1473_2639 385
469 3300036712 Ga0316584_0082683 Ga0316584_0082683_1089_2255 385
470 3300042461 Ga0439460_0030926 Ga0439460_0030926_231_1421 385
471 3300042876 Ga0451577_0028486 Ga0451577_0028486_2085_3251 385
472 3300042876 Ga0451577_0037855 Ga0451577_0037855_2156_3322 385
473 3300042876 Ga0451577_0082151 Ga0451577_0082151_1130_2296 385
474 3300042876 Ga0451577_0152046 Ga0451577_0152046_723_1889 385
475 3300044673 Ga0453683_0006667 Ga0453683_0006667_4684_5850 385
476 3300044673 Ga0453683_0033390 Ga0453683_0033390_154_1320 385
477 3300044673 Ga0453683_0040935 Ga0453683_0040935_325_1491 385
478 3300044673 Ga0453683_0121536 Ga0453683_0121536_73_1239 385
479 3300044673 Ga0453683_0138230 Ga0453683_0138230_92_1258 385
480 3300044712 Ga0453684_0000095 Ga0453684_0000095_157150_158316 385
481 3300044712 Ga0453684_0003913 Ga0453684_0003913_4050_5216 385
482 3300044712 Ga0453684_0005006 Ga0453684_0005006_12768_13934 385
483 3300044712 Ga0453684_0008106 Ga0453684_0008106_8470_9636 385
484 3300044712 Ga0453684_0020898 Ga0453684_0020898_4823_5989 385
485 3300044712 Ga0453684_0024301 Ga0453684_0024301_5018_6184 385
486 3300044712 Ga0453684_0030731 Ga0453684_0030731_1160_2326 385
487 3300044712 Ga0453684_0108575 Ga0453684_0108575_1062_2228 385
488 3300044712 Ga0453684_0134928 Ga0453684_0134928_1775_2941 385
489 3300044712 Ga0453684_0145691 Ga0453684_0145691_890_2056 385
490 3300044712 Ga0453684_0171460 Ga0453684_0171460_421_1587 385
491 3300044712 Ga0453684_0232435 Ga0453684_0232435_471_1637 385
492 3300045051 Ga0451576_0000009 Ga0451576_0000009_546222_547388 385
493 3300045051 Ga0451576_0013764 Ga0451576_0013764_6141_7307 385
494 3300045051 Ga0451576_0112435 Ga0451576_0112435_523_1689 385
495 3300045051 Ga0451576_0487085 Ga0451576_0487085_91_1257 385
496 3300046459 Ga0495629_0083396 Ga0495629_0083396_328_1494 385
497 3300046472 Ga0495580_0096768 Ga0495580_0096768_233_1408 385
498 3300046477 Ga0495664_0058025 Ga0495664_0058025_971_2137 385
499 3300046523 Ga0495644_0049478 Ga0495644_0049478_55_1230 385
500 3300046535 Ga0495586_0164446 Ga0495586_0164446_29_1225 385
501 3300046536 Ga0495587_0013497 Ga0495587_0013497_2968_4137 385
502 3300046559 Ga0495667_0147987 Ga0495667_0147987_296_1462 385
503 3300046681 Ga0495647_0044483 Ga0495647_0044483_234_1400 385
504 3300046689 Ga0495613_0037349 Ga0495613_0037349_1477_2643 385
505 3300047471 Ga0495684_0013272 Ga0495684_0013272_3944_5110 385
506 3300047471 Ga0495684_0128210 Ga0495684_0128210_406_1584 385
507 3300049571 Ga0501034_0000697 Ga0501034_0000697_3719_4885 385
508 3300049572 Ga0501036_0154084 Ga0501036_0154084_88_1257 385
509 3300049574 Ga0501038_0136779 Ga0501038_0136779_555_1748 385
510 3300049575 Ga0501039_0038917 Ga0501039_0038917_880_2073 385
511 3300049576 Ga0501040_0060232 Ga0501040_0060232_71_1264 385
512 3300049580 Ga0501046_0102017 Ga0501046_0102017_522_1715 385
513 3300049587 Ga0501071_0042535 Ga0501071_0042535_1325_2494 385
514 3300049587 Ga0501071_0064339 Ga0501071_0064339_1073_2266 385
515 3300049588 Ga0501072_0023275 Ga0501072_0023275_2568_3761 385
516 3300049588 Ga0501072_0140446 Ga0501072_0140446_290_1462 385
517 3300049591 Ga0501075_0169159 Ga0501075_0169159_15_1208 385
518 3300049591 Ga0501075_0173705 Ga0501075_0173705_366_1532 385
519 3300049593 Ga0501077_0098978 Ga0501077_0098978_256_1449 385
520 3300049741 Ga0501079_0023424 Ga0501079_0023424_2660_3826 385
521 3300049741 Ga0501079_0174533 Ga0501079_0174533_196_1389 385
522 3300049741 Ga0501079_0250343 Ga0501079_0250343_111_1280 385
523 3300049742 Ga0501080_0115005 Ga0501080_0115005_238_1407 385
524 3300049743 Ga0501081_0046648 Ga0501081_0046648_569_1735 385
525 3300049822 Ga0501035_0063591 Ga0501035_0063591_1747_2940 385
526 3300050492 nmdc:mga0yw44_124318_c1 nmdc:mga0yw44_124318_c1_411_1577 385
527 3300050493 nmdc:mga0k408_8092_c1 nmdc:mga0k408_8092_c1_4297_5466 385
528 3300050507 nmdc:mga05p37_11687_c1 nmdc:mga05p37_11687_c1_1411_2577 385
529 3300050507 nmdc:mga05p37_118770_c1 nmdc:mga05p37_118770_c1_676_1842 385
530 3300050507 nmdc:mga05p37_169131_c1 nmdc:mga05p37_169131_c1_1182_2351 385
531 3300050507 nmdc:mga05p37_237139_c1 nmdc:mga05p37_237139_c1_81_1247 385
532 3300050507 nmdc:mga05p37_26155_c2 nmdc:mga05p37_26155_c2_171_1337 385
533 3300050507 nmdc:mga05p37_7639_c1 nmdc:mga05p37_7639_c1_3971_5140 385
534 3300050508 nmdc:mga09592_13586_c1 nmdc:mga09592_13586_c1_519_1685 385
535 3300050508 nmdc:mga09592_167553_c1 nmdc:mga09592_167553_c1_98_1264 385
536 3300050508 nmdc:mga09592_8755_c1 nmdc:mga09592_8755_c1_4823_5992 385
537 3300050509 nmdc:mga0qj67_22837_c1 nmdc:mga0qj67_22837_c1_488_1657 385
538 3300050510 nmdc:mga06r32_294907_c1 nmdc:mga06r32_294907_c1_246_1412 385
539 3300050510 nmdc:mga06r32_3413_c1 nmdc:mga06r32_3413_c1_3576_4745 385
540 3300050510 nmdc:mga06r32_99097_c1 nmdc:mga06r32_99097_c1_1124_2293 385
541 3300050512 nmdc:mga0n895_46412_c1 nmdc:mga0n895_46412_c1_2022_3191 385
542 3300050515 nmdc:mga0a205_142146_c1 nmdc:mga0a205_142146_c1_85_1254 385
543 3300050515 nmdc:mga0a205_147995_c1 nmdc:mga0a205_147995_c1_419_1588 385
544 3300054114 Ga0501084_0101804 Ga0501084_0101804_939_2105 385
545 3300060353 Ga0501082_0160466 Ga0501082_0160466_463_1632 385
546 3300061734 Ga0530510_0041831 Ga0530510_0041831_943_2136 385
547 3300004801 Ga0058860_11303011 Ga0058860_113030111 386
548 3300005347 Ga0070668_100050621 Ga0070668_1000506212 386
549 3300005367 Ga0070667_100070910 Ga0070667_1000709103 386
550 3300005436 Ga0070713_100066538 Ga0070713_1000665384 386
551 3300005438 Ga0070701_10028685 Ga0070701_100286852 386
552 3300005445 Ga0070708_100004999 Ga0070708_1000049996 386
553 3300005459 Ga0068867_100100141 Ga0068867_1001001412 386
554 3300005577 Ga0068857_100042921 Ga0068857_1000429213 386
555 3300005617 Ga0068859_100017869 Ga0068859_1000178695 386
556 3300005842 Ga0068858_100155768 Ga0068858_1001557682 386
557 3300005844 Ga0068862_100161892 Ga0068862_1001618922 386
558 3300005937 Ga0081455_10020573 Ga0081455_100205738 386
559 3300005985 Ga0081539_10001174 Ga0081539_1000117412 386
560 3300005985 Ga0081539_10006624 Ga0081539_100066242 386
561 3300005985 Ga0081539_10062145 Ga0081539_100621453 386
562 3300006847 Ga0075431_100069171 Ga0075431_1000691713 386
563 3300006931 Ga0097620_100017870 Ga0097620_1000178704 386
564 3300009094 Ga0111539_10312785 Ga0111539_103127852 386
565 3300009147 Ga0114129_10171607 Ga0114129_101716072 386
566 3300009545 Ga0105237_10126135 Ga0105237_101261352 386
567 3300013308 Ga0157375_10023986 Ga0157375_100239862 386
568 3300020080 Ga0206350_10082429 Ga0206350_100824291 386
569 3300022467 Ga0224712_10049352 Ga0224712_100493521 386
570 3300025910 Ga0207684_10004853 Ga0207684_100048535 386
571 3300025914 Ga0207671_10080054 Ga0207671_100800541 386
572 3300025928 Ga0207700_10053263 Ga0207700_100532634 386
573 3300025986 Ga0207658_10049278 Ga0207658_100492783 386
574 3300025986 Ga0207658_10301467 Ga0207658_103014671 386
575 3300026035 Ga0207703_10133190 Ga0207703_101331902 386
576 3300026075 Ga0207708_10060562 Ga0207708_100605622 386
577 3300026089 Ga0207648_10043163 Ga0207648_100431633 386
578 3300026116 Ga0207674_10052905 Ga0207674_100529053 386
579 3300028654 Ga0265322_10032397 Ga0265322_100323972 386
580 3300031247 Ga0265340_10009548 Ga0265340_100095483 386
581 3300031250 Ga0265331_10012216 Ga0265331_100122162 386
582 3300031548 Ga0307408_100054213 Ga0307408_1000542132 386
583 3300031548 Ga0307408_100055531 Ga0307408_1000555312 386
584 3300031691 Ga0316579_10047782 Ga0316579_100477822 386
585 3300031727 Ga0316576_10040418 Ga0316576_100404182 386
586 3300031727 Ga0316576_10041801 Ga0316576_100418013 386
587 3300031727 Ga0316576_10083138 Ga0316576_100831381 386
588 3300031727 Ga0316576_10129148 Ga0316576_101291481 386
589 3300031731 Ga0307405_10006700 Ga0307405_100067003 386
590 3300031733 Ga0316577_10158921 Ga0316577_101589211 386
591 3300031901 Ga0307406_10099695 Ga0307406_100996951 386
592 3300031995 Ga0307409_100072668 Ga0307409_1000726682 386
593 3300032002 Ga0307416_100006968 Ga0307416_1000069682 386
594 3300032002 Ga0307416_100042547 Ga0307416_1000425473 386
595 3300032004 Ga0307414_10029796 Ga0307414_100297962 386
596 3300032005 Ga0307411_10060161 Ga0307411_100601611 386
597 3300032126 Ga0307415_100021471 Ga0307415_1000214712 386
598 3300033541 Ga0316596_1018723 Ga0316596_10187232 386
599 3300035398 Ga0316574_0060291 Ga0316574_0060291_515_1684 386
600 3300035398 Ga0316574_0076968 Ga0316574_0076968_179_1351 386
601 3300035398 Ga0316574_0160932 Ga0316574_0160932_16_1185 386
602 3300036647 Ga0316582_0000369 Ga0316582_0000369_10384_11688 386
603 3300036712 Ga0316584_0004551 Ga0316584_0004551_1624_2793 386
604 3300036712 Ga0316584_0008179 Ga0316584_0008179_4279_5448 386
605 3300036712 Ga0316584_0026586 Ga0316584_0026586_2751_4055 386
606 3300036712 Ga0316584_0034682 Ga0316584_0034682_2230_3399 386
607 3300036712 Ga0316584_0076260 Ga0316584_0076260_788_1957 386
608 3300036712 Ga0316584_0152517 Ga0316584_0152517_431_1603 386
609 3300037588 Ga0316581_0022042 Ga0316581_0022042_121_1290 386
610 3300039093 Ga0400489_12788 Ga0400489_12788_54548_55717 386
611 3300039437 Ga0436365_0631963 Ga0436365_0631963_501_1697 386
612 3300042876 Ga0451577_0006471 Ga0451577_0006471_6949_8118 386
613 3300042876 Ga0451577_0026254 Ga0451577_0026254_994_2193 386
614 3300042876 Ga0451577_0212248 Ga0451577_0212248_304_1473 386
615 3300044658 Ga0466972_0050948 Ga0466972_0050948_156_1325 386
616 3300044673 Ga0453683_0009852 Ga0453683_0009852_476_1642 386
617 3300044673 Ga0453683_0035066 Ga0453683_0035066_691_1860 386
618 3300044712 Ga0453684_0000435 Ga0453684_0000435_151288_152457 386
619 3300044712 Ga0453684_0003436 Ga0453684_0003436_22966_24168 386
620 3300044712 Ga0453684_0003965 Ga0453684_0003965_23853_25022 386
621 3300044712 Ga0453684_0078159 Ga0453684_0078159_2603_3772 386
622 3300044712 Ga0453684_0162017 Ga0453684_0162017_1397_2566 386
623 3300044712 Ga0453684_0221663 Ga0453684_0221663_248_1417 386
624 3300044712 Ga0453684_0252026 Ga0453684_0252026_35_1204 386
625 3300045051 Ga0451576_0039537 Ga0451576_0039537_230_1399 386
626 3300048912 Ga0496109_0000050 Ga0496109_0000050_4632_5798 386
627 3300049571 Ga0501034_0180638 Ga0501034_0180638_128_1297 386
628 3300049587 Ga0501071_0041682 Ga0501071_0041682_1634_2803 386
629 3300049591 Ga0501075_0112878 Ga0501075_0112878_104_1273 386
630 3300049661 Ga0501217_000598 Ga0501217_000598_2710_3870 386
631 3300049668 Ga0501233_001709 Ga0501233_001709_1241_2401 386
632 3300049669 Ga0501235_003236 Ga0501235_003236_920_2080 386
633 3300049705 Ga0501225_0006935 Ga0501225_0006935_45_1205 386
634 3300050507 nmdc:mga05p37_146037_c1 nmdc:mga05p37_146037_c1_704_1912 386
635 3300050507 nmdc:mga05p37_35213_c1 nmdc:mga05p37_35213_c1_34_1254 386
636 3300050508 nmdc:mga09592_150172_c1 nmdc:mga09592_150172_c1_28_1230 386
637 3300050510 nmdc:mga06r32_78363_c1 nmdc:mga06r32_78363_c1_992_2212 386
638 3300050510 nmdc:mga06r32_87376_c1 nmdc:mga06r32_87376_c1_1782_2942 386
639 3300050511 nmdc:mga08y16_49839_c1 nmdc:mga08y16_49839_c1_27_1205 386
640 3300053103 Ga0500555_002121 Ga0500555_002121_3755_4921 386
641 3300005293 Ga0065715_10152580 Ga0065715_101525801 387
642 3300005331 Ga0070670_100059361 Ga0070670_1000593612 387
643 3300005334 Ga0068869_100058427 Ga0068869_1000584272 387
644 3300005467 Ga0070706_100004795 Ga0070706_1000047959 387
645 3300005468 Ga0070707_100017908 Ga0070707_1000179089 387
646 3300005468 Ga0070707_100033867 Ga0070707_1000338674 387
647 3300005518 Ga0070699_100043363 Ga0070699_1000433632 387
648 3300005536 Ga0070697_100000021 Ga0070697_10000002147 387
649 3300005545 Ga0070695_100061981 Ga0070695_1000619812 387
650 3300005618 Ga0068864_100028644 Ga0068864_1000286444 387
651 3300006048 Ga0075363_100042432 Ga0075363_1000424322 387
652 3300006163 Ga0070715_10000032 Ga0070715_1000003218 387
653 3300006844 Ga0075428_100011532 Ga0075428_1000115322 387
654 3300006852 Ga0075433_10049955 Ga0075433_100499553 387
655 3300006880 Ga0075429_100069035 Ga0075429_1000690353 387
656 3300006880 Ga0075429_100283898 Ga0075429_1002838981 387
657 3300006914 Ga0075436_100055875 Ga0075436_1000558752 387
658 3300009094 Ga0111539_10030390 Ga0111539_100303901 387
659 3300009094 Ga0111539_10106678 Ga0111539_101066783 387
660 3300009147 Ga0114129_10054706 Ga0114129_100547064 387
661 3300009147 Ga0114129_10239312 Ga0114129_102393122 387
662 3300013104 Ga0157370_10011971 Ga0157370_100119713 387
663 3300013307 Ga0157372_10223816 Ga0157372_102238163 387
664 3300014325 Ga0163163_10000003 Ga0163163_10000003267 387
665 3300014326 Ga0157380_10351651 Ga0157380_103516511 387
666 3300014969 Ga0157376_10033175 Ga0157376_100331752 387
667 3300025905 Ga0207685_10000016 Ga0207685_1000001644 387
668 3300025908 Ga0207643_10004884 Ga0207643_100048842 387
669 3300025910 Ga0207684_10002670 Ga0207684_100026705 387
670 3300025912 Ga0207707_10184776 Ga0207707_101847762 387
671 3300025922 Ga0207646_10020071 Ga0207646_100200714 387
672 3300025941 Ga0207711_10061174 Ga0207711_100611742 387
673 3300026095 Ga0207676_10030813 Ga0207676_100308132 387
674 3300028381 Ga0268264_10175725 Ga0268264_101757251 387
675 3300035398 Ga0316574_0043133 Ga0316574_0043133_162_1358 387
676 3300044673 Ga0453683_0133840 Ga0453683_0133840_201_1373 387
677 3300044712 Ga0453684_0000658 Ga0453684_0000658_93861_95033 387
678 3300044712 Ga0453684_0003836 Ga0453684_0003836_3825_4997 387
679 3300044712 Ga0453684_0007770 Ga0453684_0007770_189_1364 387
680 3300044712 Ga0453684_0041143 Ga0453684_0041143_4409_5581 387
681 3300044712 Ga0453684_0065079 Ga0453684_0065079_3315_4487 387
682 3300045051 Ga0451576_0004137 Ga0451576_0004137_43_1215 387
683 3300047320 Ga0495672_0000950 Ga0495672_0000950_23794_24963 387
684 3300048915 Ga0496112_0326263 Ga0496112_0326263_27_1211 387
685 3300050494 nmdc:mga06z11_91309_c1 nmdc:mga06z11_91309_c1_244_1413 387
686 3300050496 nmdc:mga07m45_186729_c1 nmdc:mga07m45_186729_c1_15_1184 387
687 3300050507 nmdc:mga05p37_574671_c1 nmdc:mga05p37_574671_c1_84_1256 387
688 3300050508 nmdc:mga09592_216305_c1 nmdc:mga09592_216305_c1_42_1211 387
689 3300050508 nmdc:mga09592_63580_c1 nmdc:mga09592_63580_c1_1477_2646 387
690 3300050511 nmdc:mga08y16_301089_c1 nmdc:mga08y16_301089_c1_382_1551 387
691 3300050511 nmdc:mga08y16_91753_c1 nmdc:mga08y16_91753_c1_1455_2624 387
692 3300050514 nmdc:mga08x19_37210_c1 nmdc:mga08x19_37210_c1_678_1850 387
693 3300050514 nmdc:mga08x19_47369_c1 nmdc:mga08x19_47369_c1_342_1514 387
694 3300050515 nmdc:mga0a205_10028_c1 nmdc:mga0a205_10028_c1_1014_2183 387
695 3300005336 Ga0070680_100008936 Ga0070680_1000089365 388
696 3300005339 Ga0070660_100020141 Ga0070660_1000201413 388
697 3300005344 Ga0070661_100023035 Ga0070661_1000230354 388
698 3300005355 Ga0070671_100023921 Ga0070671_1000239213 388
699 3300005366 Ga0070659_100017378 Ga0070659_1000173783 388
700 3300005458 Ga0070681_10127261 Ga0070681_101272612 388
701 3300005467 Ga0070706_100002093 Ga0070706_10000209316 388
702 3300005468 Ga0070707_100018867 Ga0070707_1000188672 388
703 3300005468 Ga0070707_100034724 Ga0070707_1000347242 388
704 3300005471 Ga0070698_100012308 Ga0070698_1000123083 388
705 3300005471 Ga0070698_100025667 Ga0070698_1000256672 388
706 3300005518 Ga0070699_100004509 Ga0070699_1000045094 388
707 3300005518 Ga0070699_100339360 Ga0070699_1003393601 388
708 3300005530 Ga0070679_100030679 Ga0070679_1000306792 388
709 3300005564 Ga0070664_100001269 Ga0070664_1000012694 388
710 3300005618 Ga0068864_100020720 Ga0068864_1000207203 388
711 3300005842 Ga0068858_100018043 Ga0068858_1000180433 388
712 3300005843 Ga0068860_100046250 Ga0068860_1000462501 388
713 3300006173 Ga0070716_100027015 Ga0070716_1000270152 388
714 3300006852 Ga0075433_10002786 Ga0075433_100027864 388
715 3300009147 Ga0114129_10047931 Ga0114129_100479313 388
716 3300009177 Ga0105248_10009040 Ga0105248_100090407 388
717 3300013100 Ga0157373_10087227 Ga0157373_100872272 388
718 3300013306 Ga0163162_10001941 Ga0163162_100019418 388
719 3300014325 Ga0163163_10056578 Ga0163163_100565782 388
720 3300014325 Ga0163163_10148442 Ga0163163_101484422 388
721 3300025912 Ga0207707_10094882 Ga0207707_100948822 388
722 3300025919 Ga0207657_10021792 Ga0207657_100217921 388
723 3300025922 Ga0207646_10060469 Ga0207646_100604694 388
724 3300025922 Ga0207646_10112708 Ga0207646_101127082 388
725 3300025932 Ga0207690_10016511 Ga0207690_100165113 388
726 3300025942 Ga0207689_10008049 Ga0207689_100080496 388
727 3300025945 Ga0207679_10042157 Ga0207679_100421573 388
728 3300026041 Ga0207639_10218391 Ga0207639_102183911 388
729 3300026095 Ga0207676_10025526 Ga0207676_100255262 388
730 3300026116 Ga0207674_10002940 Ga0207674_1000294014 388
731 3300050515 nmdc:mga0a205_4149_c1 nmdc:mga0a205_4149_c1_10201_11373 388
732 2162886007 SwRhRL2b_contig_1938809 SwRhRL2b_0822.00005500 389
733 3300005289 Ga0065704_10000931 Ga0065704_100009314 389
734 3300005295 Ga0065707_10009866 Ga0065707_100098662 389
735 3300006852 Ga0075433_10027161 Ga0075433_100271612 389
736 3300009094 Ga0111539_10008359 Ga0111539_100083594 389
737 3300009147 Ga0114129_10194543 Ga0114129_101945432 389
738 3300014326 Ga0157380_10018086 Ga0157380_100180862 389
739 3300027907 Ga0207428_10006855 Ga0207428_100068552 389
740 3300050511 nmdc:mga08y16_2001_c1 nmdc:mga08y16_2001_c1_12518_13687 389

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01261

AP_endonuc_2

Xylose isomerase-like TIM barrel

87

356

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
1bxb-assembly1.cif.gz_D xylose isomerase from thermus thermophilus 0.9655 6 389
1bxc-assembly1.cif.gz_A xylose isomerase from thermus caldophilus 0.9627 6 389
1muw-assembly1.cif.gz_A the 0.86 angstrom structure of xylose isomerase 0.9612 6 388
1xyb-assembly1.cif.gz_A x-ray crystallographic structures of d-xylose isomerase-substrate complexes position the substrate and provide evidence for metal movement during catalysis 0.9608 7 388
1oad-assembly1.cif.gz_A glucose isomerase from streptomyces rubiginosus in p21212 crystal form 0.9605 5 389
ID Description Score Start End Superfamily
1didA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9533 7 388 3.20.20.150
1didA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.9341 7 388 3.20.20.150
af_A0A1D6QER4_85_310_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8837 13 228 3.20.20.150
af_P45541_1_270_3.20.20.150 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8695 14 312 3.20.20.150
3ktcA00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Divalent-metal-dependent TIM barrel enzymes 0.8604 8 386 3.20.20.150
ID Description Score Start End GO Terms
AF-A0A6I2ZA47-F1-model_v4 deleted 1 7 94
AF-A0A5R8VHC3-F1-model_v4 Xylose isomerase 0.9999 7 72 GO:0005975
GO:0009045
GO:0046872
AF-A0A6L6CAK5-F1-model_v4 Xylose isomerase 0.9955 6 66 GO:0005975
GO:0009045
GO:0046872
AF-A0A6G3D262-F1-model_v4 Xylose isomerase (EC 5.3.1.5) 0.9942 7 140 GO:0005737
GO:0009045
GO:0042732
GO:0046872
AF-A0A2S8MVU0-F1-model_v4 deleted 0.9932 13 107

Feature Viewer

pLDDT pTM Quality
93.25 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map