F478532

General Info

Members Datasets Scaffolds Average Seq Length
740 256 736 197

Family's Representative Sequence

Representative Sequence 3300025937|Ga0207669_10225191|Ga0207669_102251912
Length 231
Sequence MLDVRYALACRGVRGVSLGGHDKLKHIGHKSISDISTMNSFHQHTGIVVALDRPNVDTDQIIPKQFLKRIERTGFGEFLFFDWRYLPDGSPNPKFILNEPRYKGASILVAAKNFGCGSSREHAPWALAEYGFRVVIAPSFADIFANNCFKNGMLPIVLPELTVLEIMQRTQENEGYTLSIDLEKQTVSDSIGLSTLFQVSDFQKYCLLEGLDDIGLTLRHENDISAFEAKR

Samples

Sample ID Description Type Environment
1 2739367655 Pusillimonas sp. YR330 Isolate Unclassified
2 2751185897 Sphingomonas panacis DCY99 Isolate Unclassified
3 2881927736 Candidimonas sp. SYP-B2681 Isolate Rhizosphere
4 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
5 3300000532 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNA_Illumina_Assembled Metagenome Rhizosphere
6 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
16 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
101 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
102 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
103 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
104 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
105 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
106 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
119 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
120 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
176 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
177 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
178 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
179 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
180 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
181 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
182 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
183 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
184 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
185 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
186 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
187 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
188 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
189 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
190 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
191 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
192 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
193 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
194 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
195 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
196 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
197 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
198 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
199 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
200 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
201 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
202 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
205 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
206 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
211 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
212 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
213 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
214 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
215 3300049518 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control Metagenome Rhizosphere
216 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
217 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
218 3300049525 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F21_B_7_control Metagenome Rhizosphere
219 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
220 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
221 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
222 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
223 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
224 3300049655 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_B_0_drought Metagenome Rhizosphere
225 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
226 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
227 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
228 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
229 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
230 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
231 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
232 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
233 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
234 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
235 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
236 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
237 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
238 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
239 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
240 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
241 3300049768 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_B_4_drought Metagenome Rhizosphere
242 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
243 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
246 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
247 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
248 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
249 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
250 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
253 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.32
Metatranscriptomes 0.14
Isolates 0.54

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.3
Rhizosphere 96.62
Stem 0
Stem Tuber 0
Unclassified 1.08

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNAas_1000715 3300000532 Bacteria 3192
2 JGI24751J29686_10000011 3300002459 Bacteria 117978
3 JGI25406J46586_10004101 3300003203 Bacteria 6810
4 Ga0065714_10064575 3300005288 Bacteria 33064
5 Ga0065704_10007842 3300005289 Bacteria 2948
6 Ga0065704_10076151 3300005289 Bacteria 5243
7 Ga0065712_10000114 3300005290 Bacteria 191810
8 Ga0065712_10024075 3300005290 Bacteria 1469
9 Ga0065712_10081658 3300005290 Bacteria 2987
10 Ga0065712_10139285 3300005290 Bacteria 1466
11 Ga0065715_10034336 3300005293 Bacteria 1181
12 Ga0065715_10045643 3300005293 Bacteria 1108
13 Ga0065715_10094320 3300005293 Bacteria 4375
14 Ga0065715_10141858 3300005293 Bacteria 1842
15 Ga0065715_10170491 3300005293 Bacteria 1551
16 Ga0065715_10284971 3300005293 Bacteria 1077
17 Ga0065715_10412670 3300005293 Bacteria 862
18 Ga0065707_10002951 3300005295 Bacteria 8056
19 Ga0065707_10086903 3300005295 Bacteria 5250
20 Ga0065707_10177045 3300005295 Bacteria 1443
21 Ga0065707_10227342 3300005295 Bacteria 1201
22 Ga0070676_10209820 3300005328 Bacteria 1281
23 Ga0070690_100022540 3300005330 Bacteria 3853
24 Ga0070690_100026478 3300005330 Bacteria 3577
25 Ga0070690_100058075 3300005330 Bacteria 2484
26 Ga0070690_100090431 3300005330 Bacteria 2015
27 Ga0070690_100318876 3300005330 Bacteria 1119
28 Ga0070670_100000295 3300005331 Bacteria 43851
29 Ga0070670_100037109 3300005331 Bacteria 4193
30 Ga0070670_100046766 3300005331 Bacteria 3722
31 Ga0070670_100319756 3300005331 Bacteria 1360
32 Ga0070670_100593937 3300005331 Bacteria 990
33 Ga0070677_10484952 3300005333 Bacteria 667
34 Ga0068869_100071490 3300005334 Bacteria 2569
35 Ga0068869_100136996 3300005334 Bacteria 1887
36 Ga0068869_100204666 3300005334 Bacteria 1558
37 Ga0068869_100220008 3300005334 Bacteria 1505
38 Ga0068869_101355515 3300005334 Bacteria 629
39 Ga0070666_10279378 3300005335 Bacteria 1187
40 Ga0070680_100004466 3300005336 Bacteria 10538
41 Ga0070680_100021047 3300005336 Bacteria 5179
42 Ga0070680_100044920 3300005336 Bacteria 3591
43 Ga0070680_100665446 3300005336 Bacteria 895
44 Ga0070682_100057606 3300005337 Bacteria 2448
45 Ga0068868_100930440 3300005338 Bacteria 792
46 Ga0070660_100948385 3300005339 Bacteria 726
47 Ga0070689_100000802 3300005340 Bacteria 19335
48 Ga0070689_100818979 3300005340 Bacteria 820
49 Ga0070689_101083081 3300005340 Bacteria 716
50 Ga0070687_100064802 3300005343 Bacteria 1942
51 Ga0070687_100636495 3300005343 Bacteria 737
52 Ga0070687_100718248 3300005343 Bacteria 700
53 Ga0070687_100840004 3300005343 Bacteria 654
54 Ga0070661_100265058 3300005344 Bacteria 1329
55 Ga0070692_10004565 3300005345 Bacteria 5797
56 Ga0070692_10124632 3300005345 Bacteria 1441
57 Ga0070692_10184153 3300005345 Bacteria 1212
58 Ga0070692_10425772 3300005345 Bacteria 844
59 Ga0070668_101176724 3300005347 Bacteria 694
60 Ga0070669_100003897 3300005353 Bacteria 10792
61 Ga0070669_100074739 3300005353 Bacteria 2512
62 Ga0070669_100144525 3300005353 Bacteria 1837
63 Ga0070669_100187897 3300005353 Bacteria 1619
64 Ga0070669_100574434 3300005353 Bacteria 942
65 Ga0070669_100827495 3300005353 Bacteria 788
66 Ga0070675_100220027 3300005354 Bacteria 1653
67 Ga0070675_100623294 3300005354 Bacteria 979
68 Ga0070675_100877055 3300005354 Bacteria 822
69 Ga0070675_101088806 3300005354 Bacteria 735
70 Ga0070671_100005927 3300005355 Bacteria 9741
71 Ga0070671_100090299 3300005355 Bacteria 2565
72 Ga0070674_101206512 3300005356 Bacteria 672
73 Ga0070673_100053956 3300005364 Bacteria 3160
74 Ga0070673_100110228 3300005364 Bacteria 2281
75 Ga0070673_100305771 3300005364 Bacteria 1401
76 Ga0070673_100595570 3300005364 Bacteria 1008
77 Ga0070673_101281636 3300005364 Bacteria 688
78 Ga0070659_100022112 3300005366 Bacteria 4852
79 Ga0070659_100467151 3300005366 Bacteria 1072
80 Ga0070659_100829997 3300005366 Bacteria 805
81 Ga0070703_10000155 3300005406 Bacteria 34756
82 Ga0070703_10006381 3300005406 Bacteria 3306
83 Ga0070701_10167938 3300005438 Bacteria 1276
84 Ga0070705_100007756 3300005440 Bacteria 5298
85 Ga0070705_100056709 3300005440 Bacteria 2308
86 Ga0070705_100438398 3300005440 Bacteria 977
87 Ga0070705_100467240 3300005440 Bacteria 950
88 Ga0070700_100000103 3300005441 Bacteria 53591
89 Ga0070700_100028833 3300005441 Bacteria 3306
90 Ga0070700_100035519 3300005441 Bacteria 3017
91 Ga0070700_100269508 3300005441 Bacteria 1229
92 Ga0070700_100308446 3300005441 Bacteria 1158
93 Ga0070700_100578111 3300005441 Bacteria 877
94 Ga0070694_100011565 3300005444 Bacteria 5465
95 Ga0070694_100041970 3300005444 Bacteria 3054
96 Ga0070694_100140483 3300005444 Bacteria 1754
97 Ga0070694_100155329 3300005444 Bacteria 1674
98 Ga0070694_100199466 3300005444 Bacteria 1491
99 Ga0070694_100597622 3300005444 Bacteria 888
100 Ga0070694_100764465 3300005444 Bacteria 790
101 Ga0070708_100028774 3300005445 Bacteria 4784
102 Ga0070708_100031789 3300005445 Bacteria 4572
103 Ga0070708_100098624 3300005445 Bacteria 2672
104 Ga0070708_100542530 3300005445 Bacteria 1097
105 Ga0070663_100115628 3300005455 Bacteria 2021
106 Ga0070678_100491894 3300005456 Bacteria 1081
107 Ga0070662_100250219 3300005457 Bacteria 1424
108 Ga0070681_10007211 3300005458 Bacteria 10841
109 Ga0070681_10030012 3300005458 Bacteria 5456
110 Ga0068867_100103236 3300005459 Bacteria 2180
111 Ga0068867_100142006 3300005459 Bacteria 1878
112 Ga0068867_100511781 3300005459 Bacteria 1033
113 Ga0068867_100605455 3300005459 Bacteria 956
114 Ga0068867_101339533 3300005459 Bacteria 662
115 Ga0070706_100000001 3300005467 Bacteria 342302
116 Ga0070706_100006646 3300005467 Bacteria 10910
117 Ga0070706_100171535 3300005467 Bacteria 2026
118 Ga0070706_100460366 3300005467 Bacteria 1183
119 Ga0070707_100000304 3300005468 Bacteria 48115
120 Ga0070707_100023639 3300005468 Bacteria 5813
121 Ga0070707_100074638 3300005468 Bacteria 3270
122 Ga0070707_100107142 3300005468 Bacteria 2711
123 Ga0070707_100421578 3300005468 Bacteria 1295
124 Ga0070698_100016097 3300005471 Bacteria 7896
125 Ga0070698_100072936 3300005471 Bacteria 3440
126 Ga0070698_100088779 3300005471 Bacteria 3076
127 Ga0070698_100481865 3300005471 Bacteria 1177
128 Ga0070699_100008562 3300005518 Bacteria 8862
129 Ga0070699_100010760 3300005518 Bacteria 7918
130 Ga0070699_100106716 3300005518 Bacteria 2457
131 Ga0070699_100159196 3300005518 Bacteria 1998
132 Ga0070699_100195015 3300005518 Bacteria 1800
133 Ga0070699_100365176 3300005518 Bacteria 1302
134 Ga0070699_100478173 3300005518 Bacteria 1130
135 Ga0070679_100000081 3300005530 Bacteria 71191
136 Ga0070679_100058182 3300005530 Bacteria 3851
137 Ga0070679_100064583 3300005530 Bacteria 3648
138 Ga0070684_100293799 3300005535 Bacteria 1490
139 Ga0070697_100006579 3300005536 Bacteria 9006
140 Ga0070697_100018690 3300005536 Bacteria 5467
141 Ga0070697_100653491 3300005536 Bacteria 926
142 Ga0068853_100005674 3300005539 Bacteria 9816
143 Ga0068853_100223411 3300005539 Bacteria 1721
144 Ga0070672_100240988 3300005543 Bacteria 1521
145 Ga0070672_100741224 3300005543 Bacteria 862
146 Ga0070672_101158866 3300005543 Bacteria 688
147 Ga0070686_100002830 3300005544 Bacteria 9561
148 Ga0070686_100103677 3300005544 Bacteria 1925
149 Ga0070695_100378952 3300005545 Bacteria 1067
150 Ga0070695_100393646 3300005545 Bacteria 1049
151 Ga0070695_100530376 3300005545 Bacteria 915
152 Ga0070696_100161961 3300005546 Bacteria 1649
153 Ga0070696_100393372 3300005546 Bacteria 1083
154 Ga0070693_100002692 3300005547 Bacteria 8175
155 Ga0070693_100024429 3300005547 Bacteria 3241
156 Ga0070693_100146442 3300005547 Bacteria 1492
157 Ga0070693_100193296 3300005547 Bacteria 1317
158 Ga0070693_100404188 3300005547 Bacteria 948
159 Ga0070693_100460216 3300005547 Bacteria 895
160 Ga0070704_100016541 3300005549 Bacteria 4663
161 Ga0070704_100030712 3300005549 Bacteria 3603
162 Ga0070704_100097889 3300005549 Bacteria 2203
163 Ga0070704_100152556 3300005549 Bacteria 1818
164 Ga0070704_100199804 3300005549 Bacteria 1613
165 Ga0070704_100242811 3300005549 Bacteria 1475
166 Ga0070704_100267848 3300005549 Bacteria 1410
167 Ga0070704_100280354 3300005549 Bacteria 1380
168 Ga0070704_100423984 3300005549 Bacteria 1140
169 Ga0068855_100021196 3300005563 Bacteria 7791
170 Ga0068855_100669932 3300005563 Bacteria 1113
171 Ga0070664_100053442 3300005564 Bacteria 3424
172 Ga0070664_100116749 3300005564 Bacteria 2334
173 Ga0068857_100029256 3300005577 Bacteria 4861
174 Ga0068857_100082407 3300005577 Bacteria 2873
175 Ga0068857_100503725 3300005577 Bacteria 1137
176 Ga0068857_101309812 3300005577 Bacteria 703
177 Ga0068854_100140953 3300005578 Bacteria 1850
178 Ga0068854_101223208 3300005578 Bacteria 674
179 Ga0068856_100048459 3300005614 Bacteria 4187
180 Ga0070702_100065737 3300005615 Bacteria 2125
181 Ga0070702_100101277 3300005615 Bacteria 1767
182 Ga0070702_100417641 3300005615 Bacteria 964
183 Ga0070702_100547860 3300005615 Bacteria 858
184 Ga0068852_100059475 3300005616 Bacteria 3314
185 Ga0068859_100027475 3300005617 Bacteria 5707
186 Ga0068859_100041760 3300005617 Bacteria 4606
187 Ga0068859_100061737 3300005617 Bacteria 3776
188 Ga0068859_100069443 3300005617 Bacteria 3558
189 Ga0068859_100116320 3300005617 Bacteria 2738
190 Ga0068859_100146737 3300005617 Bacteria 2434
191 Ga0068859_100535023 3300005617 Bacteria 1266
192 Ga0068859_100542378 3300005617 Bacteria 1258
193 Ga0068859_100643400 3300005617 Bacteria 1152
194 Ga0068859_100882662 3300005617 Bacteria 979
195 Ga0068859_100939381 3300005617 Bacteria 948
196 Ga0068859_100970167 3300005617 Bacteria 933
197 Ga0068859_101374821 3300005617 Bacteria 779
198 Ga0068864_100022752 3300005618 Bacteria 5256
199 Ga0068864_100074377 3300005618 Bacteria 2964
200 Ga0068864_100104013 3300005618 Bacteria 2522
201 Ga0068864_100113584 3300005618 Bacteria 2414
202 Ga0068864_100141417 3300005618 Bacteria 2171
203 Ga0068864_100184629 3300005618 Bacteria 1908
204 Ga0068864_100361045 3300005618 Bacteria 1373
205 Ga0068864_100377003 3300005618 Bacteria 1343
206 Ga0068864_100497153 3300005618 Bacteria 1173
207 Ga0068864_101413115 3300005618 Bacteria 698
208 Ga0068866_10026909 3300005718 Bacteria 2722
209 Ga0068866_10068035 3300005718 Bacteria 1871
210 Ga0068866_10618254 3300005718 Bacteria 734
211 Ga0068861_100022312 3300005719 Bacteria 4559
212 Ga0068861_100024817 3300005719 Bacteria 4340
213 Ga0068861_100141670 3300005719 Bacteria 1963
214 Ga0068861_100172645 3300005719 Bacteria 1793
215 Ga0068861_100503067 3300005719 Bacteria 1096
216 Ga0068861_101281385 3300005719 Bacteria 712
217 Ga0068851_10001817 3300005834 Bacteria 9333
218 Ga0068870_10005641 3300005840 Bacteria 5475
219 Ga0068870_10555653 3300005840 Bacteria 773
220 Ga0068863_100025949 3300005841 Bacteria 5591
221 Ga0068863_100039389 3300005841 Bacteria 4497
222 Ga0068863_100255391 3300005841 Bacteria 1694
223 Ga0068863_100633281 3300005841 Bacteria 1060
224 Ga0068863_100792227 3300005841 Bacteria 945
225 Ga0068863_101078190 3300005841 Bacteria 807
226 Ga0068863_101250350 3300005841 Bacteria 749
227 Ga0068858_100053959 3300005842 Bacteria 3717
228 Ga0068858_100067791 3300005842 Bacteria 3306
229 Ga0068858_100075190 3300005842 Bacteria 3137
230 Ga0068858_100138268 3300005842 Bacteria 2286
231 Ga0068858_100180448 3300005842 Bacteria 1993
232 Ga0068858_100265503 3300005842 Bacteria 1632
233 Ga0068858_100299686 3300005842 Bacteria 1533
234 Ga0068858_100307723 3300005842 Bacteria 1513
235 Ga0068860_100013630 3300005843 Bacteria 7968
236 Ga0068860_100024107 3300005843 Bacteria 5881
237 Ga0068860_100073865 3300005843 Bacteria 3242
238 Ga0068860_100506123 3300005843 Bacteria 1206
239 Ga0068860_100511586 3300005843 Bacteria 1200
240 Ga0068860_101022953 3300005843 Bacteria 844
241 Ga0068860_101174023 3300005843 Bacteria 788
242 Ga0068860_101601653 3300005843 Bacteria 673
243 Ga0068862_100030270 3300005844 Bacteria 4561
244 Ga0068862_100040124 3300005844 Bacteria 3979
245 Ga0068862_100188471 3300005844 Bacteria 1855
246 Ga0081540_1130821 3300005983 Bacteria 1025
247 Ga0081539_10000413 3300005985 Bacteria 91117
248 Ga0081539_10002856 3300005985 Bacteria 22992
249 Ga0070715_10000023 3300006163 Bacteria 117771
250 Ga0070715_10118924 3300006163 Bacteria 1257
251 Ga0070716_100000004 3300006173 Bacteria 296614
252 Ga0097621_100001200 3300006237 Bacteria 17937
253 Ga0097621_100183147 3300006237 Bacteria 1810
254 Ga0097621_100721976 3300006237 Bacteria 919
255 Ga0068871_100040286 3300006358 Bacteria 3741
256 Ga0068871_100345662 3300006358 Bacteria 1314
257 Ga0075428_100463905 3300006844 Bacteria 1356
258 Ga0075431_100076030 3300006847 Bacteria 3465
259 Ga0075431_100488760 3300006847 Bacteria 1223
260 Ga0075431_100727948 3300006847 Bacteria 968
261 Ga0075433_10094620 3300006852 Bacteria 2644
262 Ga0075433_10181376 3300006852 Bacteria 1874
263 Ga0075433_10201665 3300006852 Bacteria 1769
264 Ga0075433_10308148 3300006852 Bacteria 1402
265 Ga0075433_10348460 3300006852 Bacteria 1309
266 Ga0075433_10358881 3300006852 Bacteria 1287
267 Ga0075433_10786128 3300006852 Bacteria 832
268 Ga0075434_100017221 3300006871 Bacteria 6958
269 Ga0075434_100065142 3300006871 Bacteria 3629
270 Ga0075434_100115541 3300006871 Bacteria 2696
271 Ga0075434_100451628 3300006871 Bacteria 1306
272 Ga0075434_100532513 3300006871 Bacteria 1195
273 Ga0075434_100795350 3300006871 Bacteria 962
274 Ga0075429_100121587 3300006880 Bacteria 2282
275 Ga0075429_100279299 3300006880 Bacteria 1463
276 Ga0068865_100021864 3300006881 Bacteria 4165
277 Ga0068865_100581542 3300006881 Bacteria 944
278 Ga0075436_100022625 3300006914 Bacteria 4318
279 Ga0075436_100186766 3300006914 Bacteria 1466
280 Ga0075436_100401656 3300006914 Bacteria 993
281 Ga0097620_100027475 3300006931 Bacteria 5707
282 Ga0097620_100041765 3300006931 Bacteria 4606
283 Ga0097620_100061742 3300006931 Bacteria 3776
284 Ga0097620_100069444 3300006931 Bacteria 3558
285 Ga0097620_100116326 3300006931 Bacteria 2738
286 Ga0097620_100146736 3300006931 Bacteria 2434
287 Ga0097620_100222628 3300006931 Bacteria 1975
288 Ga0097620_100535037 3300006931 Bacteria 1266
289 Ga0097620_100542377 3300006931 Bacteria 1258
290 Ga0097620_100643400 3300006931 Bacteria 1152
291 Ga0097620_100882677 3300006931 Bacteria 979
292 Ga0097620_100939340 3300006931 Bacteria 948
293 Ga0097620_100970184 3300006931 Bacteria 933
294 Ga0097620_101374799 3300006931 Bacteria 779
295 Ga0075435_100093104 3300007076 Bacteria 2489
296 Ga0075435_100252483 3300007076 Bacteria 1501
297 Ga0105240_10080635 3300009093 Bacteria 4001
298 Ga0111539_11372497 3300009094 Bacteria 820
299 Ga0105245_10004491 3300009098 Bacteria 12334
300 Ga0105247_10001637 3300009101 Bacteria 15835
301 Ga0105247_10130041 3300009101 Bacteria 1640
302 Ga0105247_10211225 3300009101 Bacteria 1309
303 Ga0105247_10539900 3300009101 Bacteria 856
304 Ga0105247_10870963 3300009101 Bacteria 693
305 Ga0114129_10002902 3300009147 Bacteria 23984
306 Ga0114129_10017252 3300009147 Bacteria 10283
307 Ga0114129_10044756 3300009147 Bacteria 6226
308 Ga0114129_10209513 3300009147 Bacteria 2636
309 Ga0114129_10233366 3300009147 Bacteria 2477
310 Ga0114129_10572513 3300009147 Bacteria 1466
311 Ga0114129_11485473 3300009147 Bacteria 833
312 Ga0114129_11820173 3300009147 Bacteria 740
313 Ga0105243_10009675 3300009148 Bacteria 7339
314 Ga0105243_10015106 3300009148 Bacteria 5844
315 Ga0105243_10263596 3300009148 Bacteria 1544
316 Ga0105243_10281892 3300009148 Bacteria 1497
317 Ga0105243_11074046 3300009148 Bacteria 812
318 Ga0105241_10065073 3300009174 Bacteria 2817
319 Ga0105241_10351760 3300009174 Bacteria 1279
320 Ga0105242_10068784 3300009176 Bacteria 2931
321 Ga0105242_10160862 3300009176 Bacteria 1965
322 Ga0105242_10206558 3300009176 Bacteria 1747
323 Ga0105242_10769474 3300009176 Bacteria 950
324 Ga0105242_11447126 3300009176 Bacteria 716
325 Ga0105248_10017138 3300009177 Bacteria 7981
326 Ga0105248_10024309 3300009177 Bacteria 6737
327 Ga0105248_10120178 3300009177 Bacteria 2964
328 Ga0105248_10180644 3300009177 Bacteria 2378
329 Ga0105248_10828720 3300009177 Bacteria 1044
330 Ga0105248_10967034 3300009177 Bacteria 962
331 Ga0105237_10002156 3300009545 Bacteria 24760
332 Ga0105237_10050165 3300009545 Bacteria 4194
333 Ga0105237_10115733 3300009545 Bacteria 2674
334 Ga0105237_10166597 3300009545 Bacteria 2203
335 Ga0105238_10011841 3300009551 Bacteria 8787
336 Ga0105238_10016762 3300009551 Bacteria 7427
337 Ga0105238_10405574 3300009551 Bacteria 1357
338 Ga0105249_10002537 3300009553 Bacteria 15802
339 Ga0105249_10019994 3300009553 Bacteria 5978
340 Ga0105249_10028837 3300009553 Bacteria 5010
341 Ga0105249_10044364 3300009553 Bacteria 4044
342 Ga0099796_10216603 3300010159 Bacteria 783
343 Ga0105239_10158821 3300010375 Bacteria 2525
344 Ga0105239_10161227 3300010375 Bacteria 2505
345 Ga0105239_11945909 3300010375 Bacteria 682
346 Ga0105239_12335612 3300010375 Bacteria 622
347 Ga0105246_10998676 3300011119 Bacteria 757
348 Ga0157373_10008998 3300013100 Bacteria 7388
349 Ga0157373_10014022 3300013100 Bacteria 5876
350 Ga0157373_10106703 3300013100 Bacteria 1969
351 Ga0157373_10348676 3300013100 Bacteria 1056
352 Ga0157373_10589425 3300013100 Bacteria 809
353 Ga0157373_10741491 3300013100 Bacteria 722
354 Ga0157374_10034604 3300013296 Bacteria 4616
355 Ga0157378_10008861 3300013297 Bacteria 8755
356 Ga0157378_10011290 3300013297 Bacteria 7818
357 Ga0157378_10042354 3300013297 Bacteria 4042
358 Ga0157378_10105099 3300013297 Bacteria 2581
359 Ga0157378_10193418 3300013297 Bacteria 1920
360 Ga0157378_10373776 3300013297 Bacteria 1398
361 Ga0157378_10672816 3300013297 Bacteria 1052
362 Ga0157378_10822103 3300013297 Bacteria 956
363 Ga0157378_11023933 3300013297 Bacteria 861
364 Ga0163162_10004780 3300013306 Bacteria 13075
365 Ga0163162_10007623 3300013306 Bacteria 10539
366 Ga0163162_10010613 3300013306 Bacteria 8955
367 Ga0163162_10031187 3300013306 Bacteria 5286
368 Ga0163162_10160012 3300013306 Bacteria 2373
369 Ga0163162_10236501 3300013306 Bacteria 1957
370 Ga0163162_10290076 3300013306 Bacteria 1768
371 Ga0163162_10932005 3300013306 Bacteria 980
372 Ga0163162_11336425 3300013306 Bacteria 815
373 Ga0157372_10006550 3300013307 Bacteria 12389
374 Ga0157372_10066906 3300013307 Bacteria 4037
375 Ga0157372_10111909 3300013307 Bacteria 3128
376 Ga0157372_10867720 3300013307 Bacteria 1047
377 Ga0157375_10018319 3300013308 Bacteria 6348
378 Ga0157375_10026902 3300013308 Bacteria 5369
379 Ga0157375_10026947 3300013308 Bacteria 5365
380 Ga0157375_10249173 3300013308 Bacteria 1937
381 Ga0157375_10651788 3300013308 Bacteria 1209
382 Ga0157375_11749490 3300013308 Bacteria 736
383 Ga0163163_10001637 3300014325 Bacteria 18849
384 Ga0163163_10015616 3300014325 Bacteria 7026
385 Ga0163163_10023021 3300014325 Bacteria 5907
386 Ga0163163_10037165 3300014325 Bacteria 4736
387 Ga0163163_10106605 3300014325 Bacteria 2828
388 Ga0163163_10133544 3300014325 Bacteria 2522
389 Ga0163163_10208023 3300014325 Bacteria 2005
390 Ga0163163_10682075 3300014325 Bacteria 1091
391 Ga0163163_10719831 3300014325 Bacteria 1062
392 Ga0163163_11683406 3300014325 Bacteria 695
393 Ga0163163_11754565 3300014325 Bacteria 681
394 Ga0157380_10001162 3300014326 Bacteria 17050
395 Ga0157380_10027623 3300014326 Bacteria 4317
396 Ga0157380_10112632 3300014326 Bacteria 2289
397 Ga0157380_10198360 3300014326 Bacteria 1778
398 Ga0157380_10241783 3300014326 Bacteria 1628
399 Ga0157380_10267954 3300014326 Bacteria 1555
400 Ga0157380_10318748 3300014326 Bacteria 1440
401 Ga0157377_10012621 3300014745 Bacteria 4252
402 Ga0157377_10029331 3300014745 Bacteria 2969
403 Ga0157377_10108866 3300014745 Bacteria 1663
404 Ga0157377_10217299 3300014745 Bacteria 1222
405 Ga0157379_10207918 3300014968 Bacteria 1771
406 Ga0157379_10323831 3300014968 Bacteria 1407
407 Ga0157376_10161211 3300014969 Bacteria 2033
408 Ga0163161_10000635 3300017792 Bacteria 27964
409 Ga0163161_10010068 3300017792 Bacteria 6544
410 Ga0163161_10153241 3300017792 Bacteria 1753
411 Ga0163161_10312251 3300017792 Bacteria 1241
412 Ga0163161_10867704 3300017792 Bacteria 763
413 Ga0213876_10010880 3300021384 Bacteria 4873
414 Ga0213875_10044318 3300021388 Bacteria 2089
415 Ga0207656_10057177 3300025321 Bacteria 1701
416 Ga0207653_10000116 3300025885 Bacteria 56010
417 Ga0207653_10003126 3300025885 Bacteria 5238
418 Ga0207682_10322991 3300025893 Bacteria 725
419 Ga0207710_10001401 3300025900 Bacteria 12075
420 Ga0207710_10311802 3300025900 Bacteria 796
421 Ga0207680_10413990 3300025903 Bacteria 954
422 Ga0207680_10552035 3300025903 Bacteria 822
423 Ga0207647_10020484 3300025904 Bacteria 4432
424 Ga0207647_10102358 3300025904 Bacteria 1698
425 Ga0207685_10000002 3300025905 Bacteria 438088
426 Ga0207643_10106808 3300025908 Bacteria 1646
427 Ga0207643_10123077 3300025908 Bacteria 1538
428 Ga0207684_10000030 3300025910 Bacteria 300037
429 Ga0207684_10007963 3300025910 Bacteria 9470
430 Ga0207684_10087394 3300025910 Bacteria 2656
431 Ga0207684_10137717 3300025910 Bacteria 2097
432 Ga0207684_10139191 3300025910 Bacteria 2086
433 Ga0207684_10403420 3300025910 Unclassified 1175
434 Ga0207654_10059141 3300025911 Bacteria 2234
435 Ga0207654_10127417 3300025911 Bacteria 1607
436 Ga0207654_10146251 3300025911 Bacteria 1513
437 Ga0207707_10000007 3300025912 Bacteria 368555
438 Ga0207707_10018505 3300025912 Bacteria 6072
439 Ga0207707_10275545 3300025912 Bacteria 1458
440 Ga0207695_10176129 3300025913 Bacteria 2061
441 Ga0207695_10265793 3300025913 Bacteria 1612
442 Ga0207695_10404766 3300025913 Bacteria 1249
443 Ga0207671_10003800 3300025914 Bacteria 14811
444 Ga0207671_10180858 3300025914 Bacteria 1641
445 Ga0207660_10000803 3300025917 Bacteria 20728
446 Ga0207660_10006014 3300025917 Bacteria 7876
447 Ga0207660_10049954 3300025917 Bacteria 2968
448 Ga0207660_10760276 3300025917 Bacteria 791
449 Ga0207662_10041980 3300025918 Bacteria 2695
450 Ga0207662_10049080 3300025918 Bacteria 2503
451 Ga0207662_10084065 3300025918 Bacteria 1947
452 Ga0207662_10284947 3300025918 Bacteria 1094
453 Ga0207652_10000062 3300025921 Bacteria 113255
454 Ga0207652_10158563 3300025921 Bacteria 2028
455 Ga0207652_10238530 3300025921 Bacteria 1639
456 Ga0207646_10002545 3300025922 Bacteria 21525
457 Ga0207646_10007391 3300025922 Bacteria 11179
458 Ga0207646_10138598 3300025922 Bacteria 2191
459 Ga0207646_10395998 3300025922 Bacteria 1247
460 Ga0207646_10536739 3300025922 Bacteria 1052
461 Ga0207681_10146241 3300025923 Bacteria 1766
462 Ga0207681_10165992 3300025923 Bacteria 1669
463 Ga0207681_10173014 3300025923 Bacteria 1638
464 Ga0207681_11057336 3300025923 Bacteria 681
465 Ga0207694_10007364 3300025924 Bacteria 8348
466 Ga0207694_10411234 3300025924 Bacteria 1126
467 Ga0207650_10000001 3300025925 Bacteria 1545726
468 Ga0207650_10011331 3300025925 Bacteria 6135
469 Ga0207650_10464413 3300025925 Bacteria 1055
470 Ga0207650_10932315 3300025925 Bacteria 738
471 Ga0207659_10419818 3300025926 Bacteria 1122
472 Ga0207659_10536978 3300025926 Bacteria 993
473 Ga0207659_10805322 3300025926 Bacteria 807
474 Ga0207687_10210243 3300025927 Bacteria 1526
475 Ga0207644_10009918 3300025931 Bacteria 6266
476 Ga0207644_10559897 3300025931 Bacteria 947
477 Ga0207690_10132586 3300025932 Bacteria 1825
478 Ga0207690_10291089 3300025932 Bacteria 1275
479 Ga0207706_10060537 3300025933 Bacteria 3334
480 Ga0207686_10356917 3300025934 Bacteria 1102
481 Ga0207686_10475577 3300025934 Bacteria 965
482 Ga0207709_10011684 3300025935 Bacteria 4841
483 Ga0207670_10000663 3300025936 Bacteria 18187
484 Ga0207670_10395846 3300025936 Bacteria 1103
485 Ga0207670_11146751 3300025936 Bacteria 657
486 Ga0207669_10225191 3300025937 Bacteria 1379
487 Ga0207704_10419254 3300025938 Bacteria 1061
488 Ga0207665_10000006 3300025939 Bacteria 184957
489 Ga0207691_10100519 3300025940 Bacteria 2581
490 Ga0207691_10147627 3300025940 Bacteria 2069
491 Ga0207691_10478731 3300025940 Bacteria 1058
492 Ga0207711_10007369 3300025941 Bacteria 9207
493 Ga0207711_10070686 3300025941 Bacteria 3027
494 Ga0207711_10120579 3300025941 Bacteria 2341
495 Ga0207711_10347948 3300025941 Bacteria 1372
496 Ga0207689_10026939 3300025942 Bacteria 4812
497 Ga0207689_10097481 3300025942 Bacteria 2415
498 Ga0207689_10150284 3300025942 Bacteria 1920
499 Ga0207689_10233205 3300025942 Bacteria 1521
500 Ga0207689_10503066 3300025942 Bacteria 1015
501 Ga0207689_10687607 3300025942 Bacteria 862
502 Ga0207689_10706780 3300025942 Bacteria 850
503 Ga0207689_10979970 3300025942 Bacteria 713
504 Ga0207679_10033891 3300025945 Bacteria 3597
505 Ga0207679_10893279 3300025945 Bacteria 812
506 Ga0207679_11345189 3300025945 Bacteria 655
507 Ga0207667_11060065 3300025949 Bacteria 795
508 Ga0207651_10532565 3300025960 Bacteria 1019
509 Ga0207712_10004208 3300025961 Bacteria 9078
510 Ga0207712_10006936 3300025961 Bacteria 7147
511 Ga0207712_10045583 3300025961 Bacteria 3037
512 Ga0207712_10453210 3300025961 Bacteria 1088
513 Ga0207712_10851449 3300025961 Bacteria 804
514 Ga0207640_10203942 3300025981 Bacteria 1501
515 Ga0207640_10724154 3300025981 Bacteria 855
516 Ga0207677_10307518 3300026023 Bacteria 1312
517 Ga0207677_10641241 3300026023 Bacteria 936
518 Ga0207677_10672810 3300026023 Bacteria 916
519 Ga0207703_10016056 3300026035 Bacteria 5840
520 Ga0207703_10027476 3300026035 Bacteria 4482
521 Ga0207703_10049831 3300026035 Bacteria 3387
522 Ga0207703_10111203 3300026035 Bacteria 2338
523 Ga0207703_10173868 3300026035 Bacteria 1896
524 Ga0207703_10195812 3300026035 Bacteria 1793
525 Ga0207703_10326501 3300026035 Bacteria 1406
526 Ga0207703_10420777 3300026035 Bacteria 1243
527 Ga0207639_10079027 3300026041 Bacteria 2599
528 Ga0207639_10205926 3300026041 Bacteria 1690
529 Ga0207639_11207108 3300026041 Bacteria 710
530 Ga0207708_10000224 3300026075 Bacteria 44906
531 Ga0207708_10010718 3300026075 Bacteria 6813
532 Ga0207708_10012671 3300026075 Bacteria 6287
533 Ga0207708_10034485 3300026075 Bacteria 3849
534 Ga0207708_10058344 3300026075 Bacteria 2945
535 Ga0207708_10128073 3300026075 Bacteria 1983
536 Ga0207708_10525354 3300026075 Bacteria 995
537 Ga0207702_10330832 3300026078 Bacteria 1453
538 Ga0207641_10018800 3300026088 Bacteria 5666
539 Ga0207641_10035811 3300026088 Bacteria 4138
540 Ga0207641_10113336 3300026088 Bacteria 2408
541 Ga0207641_10242318 3300026088 Bacteria 1681
542 Ga0207648_10019956 3300026089 Bacteria 6048
543 Ga0207648_10138461 3300026089 Bacteria 2145
544 Ga0207648_10145575 3300026089 Bacteria 2090
545 Ga0207648_10153334 3300026089 Bacteria 2033
546 Ga0207648_10161700 3300026089 Bacteria 1977
547 Ga0207648_10317787 3300026089 Bacteria 1399
548 Ga0207648_10406293 3300026089 Bacteria 1235
549 Ga0207648_10635832 3300026089 Bacteria 985
550 Ga0207676_10009208 3300026095 Bacteria 7026
551 Ga0207676_10031884 3300026095 Bacteria 3965
552 Ga0207676_10152230 3300026095 Bacteria 1993
553 Ga0207676_10169222 3300026095 Bacteria 1902
554 Ga0207676_10509409 3300026095 Bacteria 1144
555 Ga0207674_10000683 3300026116 Bacteria 44086
556 Ga0207674_10022817 3300026116 Bacteria 6715
557 Ga0207674_10153927 3300026116 Bacteria 2255
558 Ga0207674_10516653 3300026116 Bacteria 1154
559 Ga0207675_100027166 3300026118 Bacteria 5330
560 Ga0207675_100027470 3300026118 Bacteria 5300
561 Ga0207675_100052580 3300026118 Bacteria 3800
562 Ga0207675_100167983 3300026118 Bacteria 2096
563 Ga0207675_100206931 3300026118 Bacteria 1886
564 Ga0207675_100265112 3300026118 Bacteria 1666
565 Ga0207675_100297985 3300026118 Bacteria 1570
566 Ga0207675_100399130 3300026118 Bacteria 1355
567 Ga0207675_100476678 3300026118 Bacteria 1240
568 Ga0207683_10465480 3300026121 Bacteria 1166
569 Ga0207698_10220233 3300026142 Bacteria 1714
570 Ga0207698_10471977 3300026142 Bacteria 1215
571 Ga0207698_11218154 3300026142 Bacteria 767
572 Ga0207428_10033549 3300027907 Bacteria 4214
573 Ga0268265_10347878 3300028380 Bacteria 1352
574 Ga0268265_10382904 3300028380 Bacteria 1295
575 Ga0268265_10678834 3300028380 Bacteria 993
576 Ga0268265_10977781 3300028380 Bacteria 835
577 Ga0268265_11390497 3300028380 Bacteria 704
578 Ga0268264_10019069 3300028381 Bacteria 5608
579 Ga0268264_10046474 3300028381 Bacteria 3605
580 Ga0268264_10071243 3300028381 Bacteria 2944
581 Ga0268264_10168591 3300028381 Bacteria 1978
582 Ga0268264_10261445 3300028381 Bacteria 1612
583 Ga0268264_10339547 3300028381 Bacteria 1426
584 Ga0268264_10393457 3300028381 Bacteria 1330
585 Ga0268264_10435037 3300028381 Bacteria 1268
586 Ga0268264_11093320 3300028381 Bacteria 806
587 Ga0268264_11167060 3300028381 Bacteria 779
588 Ga0265760_10011541 3300031090 Bacteria 2524
589 Ga0307408_100072974 3300031548 Bacteria 2542
590 Ga0307408_100296169 3300031548 Bacteria 1353
591 Ga0307408_100376733 3300031548 Bacteria 1212
592 Ga0307408_100588258 3300031548 Bacteria 987
593 Ga0307408_100986835 3300031548 Bacteria 775
594 Ga0307405_10051584 3300031731 Bacteria 2553
595 Ga0307405_10590834 3300031731 Bacteria 904
596 Ga0307405_11070305 3300031731 Bacteria 692
597 Ga0307413_10164392 3300031824 Bacteria 1563
598 Ga0307410_10144594 3300031852 Bacteria 1763
599 Ga0307410_10356537 3300031852 Bacteria 1170
600 Ga0307406_10062137 3300031901 Bacteria 2415
601 Ga0307406_10111186 3300031901 Bacteria 1887
602 Ga0307406_10209486 3300031901 Bacteria 1441
603 Ga0307412_10017431 3300031911 Bacteria 4298
604 Ga0307412_10245507 3300031911 Bacteria 1387
605 Ga0307409_100143413 3300031995 Bacteria 2062
606 Ga0307409_100185373 3300031995 Bacteria 1847
607 Ga0307409_100336863 3300031995 Bacteria 1418
608 Ga0307409_100446393 3300031995 Bacteria 1247
609 Ga0307416_100127106 3300032002 Bacteria 2285
610 Ga0307416_100141270 3300032002 Bacteria 2189
611 Ga0307416_100607242 3300032002 Bacteria 1174
612 Ga0307416_100662836 3300032002 Bacteria 1129
613 Ga0307416_100663840 3300032002 Bacteria 1128
614 Ga0307414_10036486 3300032004 Bacteria 3283
615 Ga0307414_10072335 3300032004 Bacteria 2490
616 Ga0307414_10389667 3300032004 Bacteria 1207
617 Ga0307414_10537247 3300032004 Bacteria 1040
618 Ga0307414_10605023 3300032004 Bacteria 983
619 Ga0307414_10700876 3300032004 Bacteria 917
620 Ga0307411_10148460 3300032005 Bacteria 1739
621 Ga0307411_11296227 3300032005 Bacteria 663
622 Ga0307415_100011984 3300032126 Bacteria 4993
623 Ga0307415_100224014 3300032126 Bacteria 1510
624 Ga0373951_0004521 3300035091 Bacteria 3297
625 Ga0373941_0281594 3300035115 Bacteria 658
626 Ga0373942_0004861 3300035207 Bacteria 3117
627 Ga0395900_0230265 3300037418 Bacteria 1864
628 Ga0395898_0048189 3300037466 Bacteria 4180
629 Ga0395898_0510709 3300037466 Bacteria 1143
630 Ga0395898_0880923 3300037466 Bacteria 834
631 Ga0395905_0912654 3300037471 Bacteria 781
632 Ga0436364_0610855 3300037853 Bacteria 31434
633 Ga0395901_0255941 3300038443 Bacteria 1823
634 Ga0242420_001275 3300038996 Bacteria 3311
635 Ga0436365_1066791 3300039437 Bacteria 1159
636 Ga0436365_1897421 3300039437 Bacteria 19356
637 Ga0439458_0014038 3300042157 Bacteria 1806
638 Ga0439460_0009080 3300042461 Bacteria 2518
639 Ga0451577_0065859 3300042876 Bacteria 3231
640 Ga0453683_0406608 3300044673 Bacteria 878
641 Ga0451576_0250864 3300045051 Bacteria 1850
642 Ga0451576_0786091 3300045051 Bacteria 999
643 Ga0466967_0886247 3300045976 Bacteria 887
644 Ga0496100_0429488 3300048903 Bacteria 1010
645 Ga0496102_0538861 3300048905 Bacteria 1090
646 Ga0496103_0184833 3300048906 Bacteria 1340
647 Ga0496104_0077279 3300048907 Bacteria 3172
648 Ga0496104_0620276 3300048907 Bacteria 991
649 Ga0496104_0754876 3300048907 Bacteria 880
650 Ga0496107_0254879 3300048910 Bacteria 1306
651 Ga0496107_0519763 3300048910 Bacteria 883
652 Ga0496108_0456095 3300048911 Bacteria 1117
653 Ga0496109_0053681 3300048912 Bacteria 3676
654 Ga0496110_0115327 3300048913 Bacteria 2418
655 Ga0496110_0784844 3300048913 Bacteria 857
656 Ga0496111_0809929 3300048914 Bacteria 677
657 Ga0496112_0194459 3300048915 Bacteria 1990
658 Ga0496112_0466553 3300048915 Bacteria 1200
659 Ga0496112_0545023 3300048915 Bacteria 1094
660 Ga0496112_1099648 3300048915 Bacteria 713
661 Ga0496126_0029167 3300048929 Bacteria 5244
662 Ga0501291_063023 3300049514 Bacteria 702
663 Ga0501291_105095 3300049514 Bacteria 594
664 Ga0501292_034005 3300049515 Bacteria 864
665 Ga0501295_090034 3300049518 Bacteria 708
666 Ga0501296_021796 3300049519 Bacteria 822
667 Ga0501298_007472 3300049521 Bacteria 1813
668 Ga0501298_009033 3300049521 Bacteria 1687
669 Ga0501302_006526 3300049525 Bacteria 759
670 Ga0501038_0011511 3300049574 Bacteria 8072
671 Ga0501071_0943746 3300049587 Bacteria 666
672 Ga0501075_0277308 3300049591 Bacteria 1278
673 Ga0501202_008743 3300049652 Bacteria 1850
674 Ga0501207_008303 3300049654 Bacteria 1498
675 Ga0501208_070329 3300049655 Bacteria 703
676 Ga0501209_023951 3300049656 Bacteria 1481
677 Ga0501217_010637 3300049661 Bacteria 2019
678 Ga0501223_002413 3300049663 Bacteria 4158
679 Ga0501223_015163 3300049663 Bacteria 1527
680 Ga0501227_004116 3300049665 Bacteria 3129
681 Ga0501227_026330 3300049665 Bacteria 1370
682 Ga0501230_028223 3300049667 Bacteria 1030
683 Ga0501233_002587 3300049668 Bacteria 3199
684 Ga0501233_018951 3300049668 Bacteria 1452
685 Ga0501235_009384 3300049669 Bacteria 2139
686 Ga0501235_022815 3300049669 Bacteria 1393
687 Ga0501243_044500 3300049675 Bacteria 787
688 Ga0501249_042384 3300049679 Bacteria 1034
689 Ga0501253_093948 3300049683 Bacteria 694
690 Ga0501257_025359 3300049686 Bacteria 1411
691 Ga0501261_020082 3300049690 Bacteria 953
692 Ga0501261_036783 3300049690 Bacteria 759
693 Ga0501221_010070 3300049704 Bacteria 1672
694 Ga0501221_050515 3300049704 Bacteria 935
695 Ga0501225_0022068 3300049705 Bacteria 1757
696 Ga0501225_0048293 3300049705 Bacteria 1182
697 Ga0501225_0051533 3300049705 Bacteria 1146
698 Ga0501234_040472 3300049707 Bacteria 762
699 Ga0501245_020697 3300049708 Bacteria 1028
700 Ga0501271_012787 3300049768 Bacteria 913
701 Ga0501283_011559 3300049779 Bacteria 1315
702 Ga0501283_046632 3300049779 Bacteria 760
703 Ga0501226_001760 3300049853 Bacteria 2726
704 nmdc:mga05p37_100735_c2 3300050507 Bacteria 2488
705 nmdc:mga05p37_1535974_c1 3300050507 Bacteria 660
706 nmdc:mga05p37_808433_c1 3300050507 Bacteria 1024
707 nmdc:mga05p37_886874_c1 3300050507 Bacteria 964
708 nmdc:mga05p37_957035_c1 3300050507 Bacteria 915
709 nmdc:mga0qj67_504280_c1 3300050509 Bacteria 973
710 nmdc:mga06r32_348182_c1 3300050510 Bacteria 1466
711 nmdc:mga06r32_486406_c1 3300050510 Bacteria 1212
712 nmdc:mga06r32_792476_c1 3300050510 Bacteria 909
713 nmdc:mga08y16_269465_c1 3300050511 Bacteria 1758
714 nmdc:mga08y16_450979_c1 3300050511 Bacteria 1312
715 nmdc:mga08y16_54025_c1 3300050511 Bacteria 4199
716 nmdc:mga08y16_61269_c1 3300050511 Bacteria 3929
717 nmdc:mga0n895_340307_c1 3300050512 Bacteria 1519
718 nmdc:mga0n895_420155_c1 3300050512 Bacteria 1351
719 nmdc:mga0n895_44864_c1 3300050512 Bacteria 4311
720 nmdc:mga0n895_661436_c1 3300050512 Bacteria 1043
721 nmdc:mga0n895_89411_c1 3300050512 Bacteria 3080
722 nmdc:mga0rr50_36856_c1 3300050513 Bacteria 3525
723 nmdc:mga0rr50_450322_c1 3300050513 Bacteria 1091
724 nmdc:mga08x19_328659_c1 3300050514 Bacteria 1065
725 nmdc:mga0a205_1198884_c1 3300050515 Bacteria 607
726 nmdc:mga0a205_184944_c1 3300050515 Bacteria 1977
727 nmdc:mga0a205_361682_c1 3300050515 Bacteria 1318
728 nmdc:mga0a205_40543_c1 3300050515 Bacteria 4482
729 nmdc:mga0a205_469365_c1 3300050515 Bacteria 1117
730 nmdc:mga0a205_489848_c1 3300050515 Bacteria 1087
731 nmdc:mga0a205_710408_c1 3300050515 Bacteria 855
732 Ga0495619_0371775 3300053085 Bacteria 988
733 Ga0590071_002151 3300059421 Bacteria 5015
734 Ga0590074_063407 3300059423 Bacteria 689
735 Ga0590077_050813 3300059426 Bacteria 930
736 Ga0530510_0111380 3300061734 Bacteria 2005

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049652 Ga0501202_008743 Ga0501202_008743_29_595 185
2 3300049661 Ga0501217_010637 Ga0501217_010637_1410_1976 185
3 3300049665 Ga0501227_004116 Ga0501227_004116_2534_3100 185
4 3300049667 Ga0501230_028223 Ga0501230_028223_44_610 185
5 3300049668 Ga0501233_018951 Ga0501233_018951_847_1413 185
6 3300049704 Ga0501221_050515 Ga0501221_050515_345_911 185
7 3300049705 Ga0501225_0022068 Ga0501225_0022068_1156_1722 185
8 3300049707 Ga0501234_040472 Ga0501234_040472_33_599 185
9 3300049779 Ga0501283_046632 Ga0501283_046632_38_604 185
10 3300049853 Ga0501226_001760 Ga0501226_001760_1081_1647 185
11 3300049768 Ga0501271_012787 Ga0501271_012787_105_665 186
12 3300049656 Ga0501209_023951 Ga0501209_023951_675_1373 187
13 3300050515 nmdc:mga0a205_1198884_c1 nmdc:mga0a205_1198884_c1_26_589 187
14 iso_pu_bacteria 2751185897 2753764113 187
15 3300031548 Ga0307408_100296169 Ga0307408_1002961692 188
16 3300031731 Ga0307405_10051584 Ga0307405_100515842 188
17 3300032002 Ga0307416_100663840 Ga0307416_1006638402 188
18 3300032004 Ga0307414_10700876 Ga0307414_107008762 188
19 3300032005 Ga0307411_10148460 Ga0307411_101484602 188
20 3300049514 Ga0501291_105095 Ga0501291_105095_17_583 188
21 3300049515 Ga0501292_034005 Ga0501292_034005_220_786 188
22 3300049655 Ga0501208_070329 Ga0501208_070329_46_612 188
23 3300049665 Ga0501227_026330 Ga0501227_026330_339_905 188
24 3300049675 Ga0501243_044500 Ga0501243_044500_125_691 188
25 3300049705 Ga0501225_0051533 Ga0501225_0051533_438_1007 188
26 3300002459 JGI24751J29686_10000011 JGI24751J29686_1000001147 189
27 3300003203 JGI25406J46586_10004101 JGI25406J46586_100041015 189
28 3300005290 Ga0065712_10081658 Ga0065712_100816583 189
29 3300005293 Ga0065715_10284971 Ga0065715_102849712 189
30 3300005331 Ga0070670_100000295 Ga0070670_10000029528 189
31 3300005331 Ga0070670_100037109 Ga0070670_1000371092 189
32 3300005331 Ga0070670_100319756 Ga0070670_1003197562 189
33 3300005334 Ga0068869_101355515 Ga0068869_1013555151 189
34 3300005340 Ga0070689_100818979 Ga0070689_1008189791 189
35 3300005343 Ga0070687_100064802 Ga0070687_1000648022 189
36 3300005353 Ga0070669_100144525 Ga0070669_1001445252 189
37 3300005354 Ga0070675_101088806 Ga0070675_1010888061 189
38 3300005364 Ga0070673_100110228 Ga0070673_1001102283 189
39 3300005366 Ga0070659_100467151 Ga0070659_1004671511 189
40 3300005366 Ga0070659_100829997 Ga0070659_1008299971 189
41 3300005440 Ga0070705_100438398 Ga0070705_1004383982 189
42 3300005441 Ga0070700_100000103 Ga0070700_10000010354 189
43 3300005441 Ga0070700_100308446 Ga0070700_1003084461 189
44 3300005444 Ga0070694_100140483 Ga0070694_1001404832 189
45 3300005456 Ga0070678_100491894 Ga0070678_1004918941 189
46 3300005543 Ga0070672_101158866 Ga0070672_1011588661 189
47 3300005547 Ga0070693_100193296 Ga0070693_1001932961 189
48 3300005549 Ga0070704_100199804 Ga0070704_1001998042 189
49 3300005577 Ga0068857_100503725 Ga0068857_1005037252 189
50 3300005615 Ga0070702_100065737 Ga0070702_1000657373 189
51 3300005615 Ga0070702_100547860 Ga0070702_1005478602 189
52 3300005617 Ga0068859_100069443 Ga0068859_1000694432 189
53 3300005617 Ga0068859_100116320 Ga0068859_1001163202 189
54 3300005617 Ga0068859_100882662 Ga0068859_1008826622 189
55 3300005719 Ga0068861_100141670 Ga0068861_1001416702 189
56 3300005842 Ga0068858_100067791 Ga0068858_1000677913 189
57 3300005842 Ga0068858_100075190 Ga0068858_1000751902 189
58 3300005843 Ga0068860_100024107 Ga0068860_1000241073 189
59 3300005843 Ga0068860_101174023 Ga0068860_1011740231 189
60 3300005985 Ga0081539_10000413 Ga0081539_1000041313 189
61 3300006847 Ga0075431_100488760 Ga0075431_1004887602 189
62 3300006931 Ga0097620_100069444 Ga0097620_1000694443 189
63 3300006931 Ga0097620_100116326 Ga0097620_1001163262 189
64 3300006931 Ga0097620_100882677 Ga0097620_1008826772 189
65 3300009101 Ga0105247_10001637 Ga0105247_100016373 189
66 3300009148 Ga0105243_10263596 Ga0105243_102635961 189
67 3300009174 Ga0105241_10351760 Ga0105241_103517602 189
68 3300009176 Ga0105242_10160862 Ga0105242_101608623 189
69 3300009177 Ga0105248_10024309 Ga0105248_100243093 189
70 3300009177 Ga0105248_10120178 Ga0105248_101201784 189
71 3300009177 Ga0105248_10967034 Ga0105248_109670341 189
72 3300009545 Ga0105237_10166597 Ga0105237_101665972 189
73 3300009551 Ga0105238_10011841 Ga0105238_100118418 189
74 3300009551 Ga0105238_10405574 Ga0105238_104055742 189
75 3300009553 Ga0105249_10002537 Ga0105249_100025376 189
76 3300010375 Ga0105239_11945909 Ga0105239_119459091 189
77 3300013306 Ga0163162_10031187 Ga0163162_100311873 189
78 3300013308 Ga0157375_10249173 Ga0157375_102491732 189
79 3300014325 Ga0163163_10001637 Ga0163163_1000163712 189
80 3300014325 Ga0163163_11683406 Ga0163163_116834062 189
81 3300014745 Ga0157377_10217299 Ga0157377_102172992 189
82 3300017792 Ga0163161_10153241 Ga0163161_101532413 189
83 3300025900 Ga0207710_10001401 Ga0207710_100014019 189
84 3300025900 Ga0207710_10311802 Ga0207710_103118021 189
85 3300025911 Ga0207654_10059141 Ga0207654_100591412 189
86 3300025911 Ga0207654_10146251 Ga0207654_101462512 189
87 3300025914 Ga0207671_10180858 Ga0207671_101808582 189
88 3300025924 Ga0207694_10007364 Ga0207694_100073643 189
89 3300025924 Ga0207694_10411234 Ga0207694_104112342 189
90 3300025925 Ga0207650_10000001 Ga0207650_10000001736 189
91 3300025926 Ga0207659_10419818 Ga0207659_104198182 189
92 3300025932 Ga0207690_10132586 Ga0207690_101325862 189
93 3300025934 Ga0207686_10356917 Ga0207686_103569172 189
94 3300025936 Ga0207670_10395846 Ga0207670_103958461 189
95 3300025940 Ga0207691_10478731 Ga0207691_104787311 189
96 3300025941 Ga0207711_10007369 Ga0207711_100073693 189
97 3300025941 Ga0207711_10070686 Ga0207711_100706861 189
98 3300025941 Ga0207711_10347948 Ga0207711_103479482 189
99 3300025942 Ga0207689_10706780 Ga0207689_107067801 189
100 3300025960 Ga0207651_10532565 Ga0207651_105325652 189
101 3300025961 Ga0207712_10006936 Ga0207712_100069365 189
102 3300025961 Ga0207712_10453210 Ga0207712_104532102 189
103 3300025981 Ga0207640_10203942 Ga0207640_102039422 189
104 3300026035 Ga0207703_10027476 Ga0207703_100274762 189
105 3300026035 Ga0207703_10173868 Ga0207703_101738682 189
106 3300026035 Ga0207703_10420777 Ga0207703_104207772 189
107 3300026041 Ga0207639_10205926 Ga0207639_102059262 189
108 3300026075 Ga0207708_10000224 Ga0207708_100002242 189
109 3300026075 Ga0207708_10034485 Ga0207708_100344851 189
110 3300026075 Ga0207708_10058344 Ga0207708_100583443 189
111 3300026088 Ga0207641_10242318 Ga0207641_102423182 189
112 3300026089 Ga0207648_10138461 Ga0207648_101384613 189
113 3300026089 Ga0207648_10161700 Ga0207648_101617002 189
114 3300026095 Ga0207676_10509409 Ga0207676_105094091 189
115 3300026116 Ga0207674_10516653 Ga0207674_105166532 189
116 3300026118 Ga0207675_100265112 Ga0207675_1002651122 189
117 3300026142 Ga0207698_10471977 Ga0207698_104719772 189
118 3300028380 Ga0268265_10678834 Ga0268265_106788342 189
119 3300028380 Ga0268265_11390497 Ga0268265_113904971 189
120 3300028381 Ga0268264_10046474 Ga0268264_100464742 189
121 3300028381 Ga0268264_11167060 Ga0268264_111670602 189
122 3300031731 Ga0307405_11070305 Ga0307405_110703052 189
123 3300035115 Ga0373941_0281594 Ga0373941_0281594_79_648 189
124 3300035207 Ga0373942_0004861 Ga0373942_0004861_1758_2327 189
125 3300042157 Ga0439458_0014038 Ga0439458_0014038_154_723 189
126 3300048915 Ga0496112_0194459 Ga0496112_0194459_56_625 189
127 3300049514 Ga0501291_063023 Ga0501291_063023_39_608 189
128 3300049669 Ga0501235_022815 Ga0501235_022815_388_957 189
129 3300050507 nmdc:mga05p37_808433_c1 nmdc:mga05p37_808433_c1_128_697 189
130 3300050513 nmdc:mga0rr50_36856_c1 nmdc:mga0rr50_36856_c1_2526_3095 189
131 3300025942 Ga0207689_10979970 Ga0207689_109799701 190
132 3300005289 Ga0065704_10076151 Ga0065704_100761512 191
133 3300005293 Ga0065715_10034336 Ga0065715_100343362 191
134 3300005293 Ga0065715_10045643 Ga0065715_100456432 191
135 3300005295 Ga0065707_10002951 Ga0065707_100029516 191
136 3300005337 Ga0070682_100057606 Ga0070682_1000576062 191
137 3300005340 Ga0070689_101083081 Ga0070689_1010830811 191
138 3300005345 Ga0070692_10184153 Ga0070692_101841531 191
139 3300005440 Ga0070705_100056709 Ga0070705_1000567093 191
140 3300005441 Ga0070700_100578111 Ga0070700_1005781111 191
141 3300005545 Ga0070695_100393646 Ga0070695_1003936462 191
142 3300005546 Ga0070696_100161961 Ga0070696_1001619612 191
143 3300005547 Ga0070693_100002692 Ga0070693_1000026925 191
144 3300005549 Ga0070704_100280354 Ga0070704_1002803542 191
145 3300005549 Ga0070704_100423984 Ga0070704_1004239841 191
146 3300005719 Ga0068861_100503067 Ga0068861_1005030672 191
147 3300005842 Ga0068858_100138268 Ga0068858_1001382682 191
148 3300005842 Ga0068858_100307723 Ga0068858_1003077232 191
149 3300005843 Ga0068860_101022953 Ga0068860_1010229532 191
150 3300006237 Ga0097621_100001200 Ga0097621_10000120010 191
151 3300006852 Ga0075433_10201665 Ga0075433_102016653 191
152 3300006852 Ga0075433_10786128 Ga0075433_107861281 191
153 3300009101 Ga0105247_10211225 Ga0105247_102112252 191
154 3300009551 Ga0105238_10016762 Ga0105238_100167625 191
155 3300010375 Ga0105239_12335612 Ga0105239_123356121 191
156 3300014745 Ga0157377_10108866 Ga0157377_101088662 191
157 3300014968 Ga0157379_10323831 Ga0157379_103238312 191
158 3300017792 Ga0163161_10000635 Ga0163161_1000063517 191
159 3300025904 Ga0207647_10020484 Ga0207647_100204845 191
160 3300025912 Ga0207707_10275545 Ga0207707_102755452 191
161 3300026023 Ga0207677_10641241 Ga0207677_106412412 191
162 3300026035 Ga0207703_10111203 Ga0207703_101112032 191
163 3300026075 Ga0207708_10525354 Ga0207708_105253542 191
164 3300026118 Ga0207675_100476678 Ga0207675_1004766782 191
165 3300026142 Ga0207698_10220233 Ga0207698_102202332 191
166 3300027907 Ga0207428_10033549 Ga0207428_100335492 191
167 3300028381 Ga0268264_10168591 Ga0268264_101685911 191
168 3300028381 Ga0268264_11093320 Ga0268264_110933202 191
169 3300031548 Ga0307408_100588258 Ga0307408_1005882582 191
170 3300031911 Ga0307412_10017431 Ga0307412_100174312 191
171 3300045051 Ga0451576_0250864 Ga0451576_0250864_1088_1663 191
172 3300048906 Ga0496103_0184833 Ga0496103_0184833_30_605 191
173 3300048907 Ga0496104_0754876 Ga0496104_0754876_181_756 191
174 3300048911 Ga0496108_0456095 Ga0496108_0456095_100_675 191
175 3300048915 Ga0496112_1099648 Ga0496112_1099648_62_637 191
176 3300049574 Ga0501038_0011511 Ga0501038_0011511_3620_4195 191
177 3300050511 nmdc:mga08y16_54025_c1 nmdc:mga08y16_54025_c1_172_747 191
178 3300050515 nmdc:mga0a205_40543_c1 nmdc:mga0a205_40543_c1_2453_3028 191
179 3300005340 Ga0070689_100000802 Ga0070689_10000080215 192
180 3300005438 Ga0070701_10167938 Ga0070701_101679382 192
181 3300005467 Ga0070706_100000001 Ga0070706_10000000150 192
182 3300005543 Ga0070672_100741224 Ga0070672_1007412242 192
183 3300005617 Ga0068859_100970167 Ga0068859_1009701672 192
184 3300005840 Ga0068870_10555653 Ga0068870_105556531 192
185 3300005841 Ga0068863_100039389 Ga0068863_1000393893 192
186 3300005843 Ga0068860_100511586 Ga0068860_1005115861 192
187 3300006931 Ga0097620_100970184 Ga0097620_1009701842 192
188 3300009147 Ga0114129_10233366 Ga0114129_102333662 192
189 3300009177 Ga0105248_10828720 Ga0105248_108287201 192
190 3300011119 Ga0105246_10998676 Ga0105246_109986762 192
191 3300013306 Ga0163162_10290076 Ga0163162_102900761 192
192 3300014325 Ga0163163_10719831 Ga0163163_107198312 192
193 3300014326 Ga0157380_10112632 Ga0157380_101126322 192
194 3300025908 Ga0207643_10123077 Ga0207643_101230772 192
195 3300025910 Ga0207684_10000030 Ga0207684_10000030191 192
196 3300025936 Ga0207670_10000663 Ga0207670_100006639 192
197 3300026041 Ga0207639_11207108 Ga0207639_112071081 192
198 3300026088 Ga0207641_10035811 Ga0207641_100358114 192
199 3300026095 Ga0207676_10031884 Ga0207676_100318842 192
200 3300031901 Ga0307406_10111186 Ga0307406_101111862 192
201 3300031995 Ga0307409_100185373 Ga0307409_1001853731 192
202 3300032004 Ga0307414_10036486 Ga0307414_100364862 192
203 3300049519 Ga0501296_021796 Ga0501296_021796_156_734 192
204 3300049521 Ga0501298_009033 Ga0501298_009033_559_1137 192
205 3300049663 Ga0501223_015163 Ga0501223_015163_691_1269 192
206 3300049686 Ga0501257_025359 Ga0501257_025359_765_1343 192
207 3300049690 Ga0501261_036783 Ga0501261_036783_32_610 192
208 3300049705 Ga0501225_0048293 Ga0501225_0048293_81_659 192
209 3300049779 Ga0501283_011559 Ga0501283_011559_73_651 192
210 3300048915 Ga0496112_0466553 Ga0496112_0466553_32_613 193
211 3300005289 Ga0065704_10007842 Ga0065704_100078423 194
212 3300005295 Ga0065707_10227342 Ga0065707_102273421 194
213 3300005339 Ga0070660_100948385 Ga0070660_1009483851 194
214 3300005343 Ga0070687_100840004 Ga0070687_1008400041 194
215 3300005345 Ga0070692_10004565 Ga0070692_100045654 194
216 3300005345 Ga0070692_10124632 Ga0070692_101246321 194
217 3300005353 Ga0070669_100003897 Ga0070669_1000038975 194
218 3300005406 Ga0070703_10006381 Ga0070703_100063812 194
219 3300005440 Ga0070705_100007756 Ga0070705_1000077564 194
220 3300005441 Ga0070700_100035519 Ga0070700_1000355192 194
221 3300005444 Ga0070694_100011565 Ga0070694_1000115655 194
222 3300005518 Ga0070699_100159196 Ga0070699_1001591961 194
223 3300005543 Ga0070672_100240988 Ga0070672_1002409881 194
224 3300005547 Ga0070693_100024429 Ga0070693_1000244293 194
225 3300005549 Ga0070704_100030712 Ga0070704_1000307123 194
226 3300005615 Ga0070702_100101277 Ga0070702_1001012772 194
227 3300005616 Ga0068852_100059475 Ga0068852_1000594751 194
228 3300005718 Ga0068866_10618254 Ga0068866_106182542 194
229 3300005719 Ga0068861_100022312 Ga0068861_1000223126 194
230 3300005834 Ga0068851_10001817 Ga0068851_100018173 194
231 3300005844 Ga0068862_100030270 Ga0068862_1000302702 194
232 3300005985 Ga0081539_10002856 Ga0081539_1000285613 194
233 3300009093 Ga0105240_10080635 Ga0105240_100806355 194
234 3300009177 Ga0105248_10180644 Ga0105248_101806443 194
235 3300009545 Ga0105237_10002156 Ga0105237_1000215614 194
236 3300009553 Ga0105249_10019994 Ga0105249_100199945 194
237 3300013100 Ga0157373_10741491 Ga0157373_107414911 194
238 3300013306 Ga0163162_10160012 Ga0163162_101600122 194
239 3300013307 Ga0157372_10006550 Ga0157372_100065508 194
240 3300013308 Ga0157375_10026947 Ga0157375_100269474 194
241 3300014326 Ga0157380_10001162 Ga0157380_100011625 194
242 3300014326 Ga0157380_10318748 Ga0157380_103187481 194
243 3300025321 Ga0207656_10057177 Ga0207656_100571773 194
244 3300025885 Ga0207653_10003126 Ga0207653_100031262 194
245 3300025913 Ga0207695_10265793 Ga0207695_102657932 194
246 3300025914 Ga0207671_10003800 Ga0207671_100038007 194
247 3300025923 Ga0207681_10146241 Ga0207681_101462412 194
248 3300025937 Ga0207669_10225191 Ga0207669_102251912 194
249 3300025940 Ga0207691_10100519 Ga0207691_101005193 194
250 3300025941 Ga0207711_10120579 Ga0207711_101205793 194
251 3300025942 Ga0207689_10687607 Ga0207689_106876072 194
252 3300025981 Ga0207640_10724154 Ga0207640_107241541 194
253 3300026075 Ga0207708_10010718 Ga0207708_100107185 194
254 3300026089 Ga0207648_10406293 Ga0207648_104062932 194
255 3300026118 Ga0207675_100027470 Ga0207675_1000274708 194
256 3300026142 Ga0207698_11218154 Ga0207698_112181541 194
257 3300031548 Ga0307408_100376733 Ga0307408_1003767332 194
258 3300031548 Ga0307408_100986835 Ga0307408_1009868352 194
259 3300031731 Ga0307405_10590834 Ga0307405_105908342 194
260 3300031824 Ga0307413_10164392 Ga0307413_101643922 194
261 3300031911 Ga0307412_10245507 Ga0307412_102455071 194
262 3300032002 Ga0307416_100127106 Ga0307416_1001271063 194
263 3300032002 Ga0307416_100662836 Ga0307416_1006628362 194
264 3300032004 Ga0307414_10072335 Ga0307414_100723352 194
265 3300032005 Ga0307411_11296227 Ga0307411_112962271 194
266 3300048903 Ga0496100_0429488 Ga0496100_0429488_323_907 194
267 3300049518 Ga0501295_090034 Ga0501295_090034_80_664 194
268 3300049669 Ga0501235_009384 Ga0501235_009384_1283_1867 194
269 3300049708 Ga0501245_020697 Ga0501245_020697_172_756 194
270 3300050511 nmdc:mga08y16_269465_c1 nmdc:mga08y16_269465_c1_225_809 194
271 3300050511 nmdc:mga08y16_450979_c1 nmdc:mga08y16_450979_c1_602_1186 194
272 3300050512 nmdc:mga0n895_661436_c1 nmdc:mga0n895_661436_c1_155_739 194
273 3300005293 Ga0065715_10141858 Ga0065715_101418582 195
274 3300005293 Ga0065715_10170491 Ga0065715_101704912 195
275 3300005334 Ga0068869_100204666 Ga0068869_1002046662 195
276 3300005338 Ga0068868_100930440 Ga0068868_1009304401 195
277 3300005356 Ga0070674_101206512 Ga0070674_1012065121 195
278 3300005364 Ga0070673_101281636 Ga0070673_1012816361 195
279 3300005444 Ga0070694_100199466 Ga0070694_1001994662 195
280 3300005445 Ga0070708_100031789 Ga0070708_1000317894 195
281 3300005468 Ga0070707_100107142 Ga0070707_1001071423 195
282 3300005471 Ga0070698_100072936 Ga0070698_1000729363 195
283 3300005518 Ga0070699_100008562 Ga0070699_1000085628 195
284 3300005518 Ga0070699_100478173 Ga0070699_1004781732 195
285 3300005530 Ga0070679_100064583 Ga0070679_1000645832 195
286 3300005547 Ga0070693_100404188 Ga0070693_1004041881 195
287 3300005549 Ga0070704_100097889 Ga0070704_1000978892 195
288 3300005577 Ga0068857_100029256 Ga0068857_1000292565 195
289 3300005617 Ga0068859_100041760 Ga0068859_1000417602 195
290 3300005617 Ga0068859_100146737 Ga0068859_1001467372 195
291 3300005618 Ga0068864_100074377 Ga0068864_1000743773 195
292 3300005618 Ga0068864_100113584 Ga0068864_1001135843 195
293 3300005618 Ga0068864_100141417 Ga0068864_1001414172 195
294 3300005618 Ga0068864_100377003 Ga0068864_1003770032 195
295 3300005618 Ga0068864_101413115 Ga0068864_1014131151 195
296 3300005841 Ga0068863_100025949 Ga0068863_1000259497 195
297 3300005841 Ga0068863_100255391 Ga0068863_1002553912 195
298 3300005841 Ga0068863_100633281 Ga0068863_1006332811 195
299 3300005841 Ga0068863_101250350 Ga0068863_1012503502 195
300 3300006844 Ga0075428_100463905 Ga0075428_1004639052 195
301 3300006852 Ga0075433_10348460 Ga0075433_103484602 195
302 3300006871 Ga0075434_100115541 Ga0075434_1001155413 195
303 3300006931 Ga0097620_100041765 Ga0097620_1000417654 195
304 3300006931 Ga0097620_100146736 Ga0097620_1001467362 195
305 3300009101 Ga0105247_10870963 Ga0105247_108709631 195
306 3300009148 Ga0105243_10015106 Ga0105243_100151066 195
307 3300009176 Ga0105242_10068784 Ga0105242_100687844 195
308 3300009545 Ga0105237_10050165 Ga0105237_100501652 195
309 3300013297 Ga0157378_10373776 Ga0157378_103737762 195
310 3300014325 Ga0163163_10133544 Ga0163163_101335444 195
311 3300014325 Ga0163163_10208023 Ga0163163_102080233 195
312 3300014326 Ga0157380_10267954 Ga0157380_102679542 195
313 3300025911 Ga0207654_10127417 Ga0207654_101274173 195
314 3300025913 Ga0207695_10176129 Ga0207695_101761292 195
315 3300025918 Ga0207662_10084065 Ga0207662_100840652 195
316 3300025921 Ga0207652_10158563 Ga0207652_101585633 195
317 3300025921 Ga0207652_10238530 Ga0207652_102385302 195
318 3300025922 Ga0207646_10395998 Ga0207646_103959982 195
319 3300025942 Ga0207689_10097481 Ga0207689_100974813 195
320 3300025942 Ga0207689_10503066 Ga0207689_105030661 195
321 3300025945 Ga0207679_10893279 Ga0207679_108932792 195
322 3300025945 Ga0207679_11345189 Ga0207679_113451891 195
323 3300026023 Ga0207677_10307518 Ga0207677_103075181 195
324 3300026035 Ga0207703_10195812 Ga0207703_101958121 195
325 3300026035 Ga0207703_10326501 Ga0207703_103265012 195
326 3300026088 Ga0207641_10018800 Ga0207641_100188002 195
327 3300026088 Ga0207641_10113336 Ga0207641_101133363 195
328 3300026089 Ga0207648_10153334 Ga0207648_101533342 195
329 3300026095 Ga0207676_10009208 Ga0207676_100092082 195
330 3300026095 Ga0207676_10169222 Ga0207676_101692222 195
331 3300026116 Ga0207674_10022817 Ga0207674_100228173 195
332 3300026116 Ga0207674_10153927 Ga0207674_101539272 195
333 3300028381 Ga0268264_10019069 Ga0268264_100190694 195
334 3300031548 Ga0307408_100072974 Ga0307408_1000729742 195
335 3300031852 Ga0307410_10144594 Ga0307410_101445941 195
336 3300031852 Ga0307410_10356537 Ga0307410_103565372 195
337 3300031901 Ga0307406_10062137 Ga0307406_100621372 195
338 3300031901 Ga0307406_10209486 Ga0307406_102094862 195
339 3300031995 Ga0307409_100143413 Ga0307409_1001434132 195
340 3300031995 Ga0307409_100446393 Ga0307409_1004463932 195
341 3300032002 Ga0307416_100141270 Ga0307416_1001412702 195
342 3300032002 Ga0307416_100607242 Ga0307416_1006072422 195
343 3300032004 Ga0307414_10389667 Ga0307414_103896672 195
344 3300032126 Ga0307415_100011984 Ga0307415_1000119844 195
345 3300032126 Ga0307415_100224014 Ga0307415_1002240142 195
346 3300035091 Ga0373951_0004521 Ga0373951_0004521_1181_1768 195
347 3300037418 Ga0395900_0230265 Ga0395900_0230265_938_1525 195
348 3300037466 Ga0395898_0048189 Ga0395898_0048189_611_1198 195
349 3300037466 Ga0395898_0510709 Ga0395898_0510709_358_945 195
350 3300038443 Ga0395901_0255941 Ga0395901_0255941_1196_1783 195
351 3300049521 Ga0501298_007472 Ga0501298_007472_270_866 195
352 3300049525 Ga0501302_006526 Ga0501302_006526_99_728 195
353 3300049587 Ga0501071_0943746 Ga0501071_0943746_20_640 195
354 3300049683 Ga0501253_093948 Ga0501253_093948_50_646 195
355 3300050512 nmdc:mga0n895_420155_c1 nmdc:mga0n895_420155_c1_45_632 195
356 3300053085 Ga0495619_0371775 Ga0495619_0371775_54_659 195
357 3300059421 Ga0590071_002151 Ga0590071_002151_3772_4362 195
358 3300059423 Ga0590074_063407 Ga0590074_063407_60_650 195
359 3300059426 Ga0590077_050813 Ga0590077_050813_49_639 195
360 3300005290 Ga0065712_10024075 Ga0065712_100240752 196
361 3300005293 Ga0065715_10412670 Ga0065715_104126701 196
362 3300005330 Ga0070690_100318876 Ga0070690_1003188761 196
363 3300005334 Ga0068869_100220008 Ga0068869_1002200082 196
364 3300005335 Ga0070666_10279378 Ga0070666_102793781 196
365 3300005344 Ga0070661_100265058 Ga0070661_1002650582 196
366 3300005347 Ga0070668_101176724 Ga0070668_1011767241 196
367 3300005353 Ga0070669_100074739 Ga0070669_1000747393 196
368 3300005354 Ga0070675_100220027 Ga0070675_1002200272 196
369 3300005354 Ga0070675_100877055 Ga0070675_1008770551 196
370 3300005355 Ga0070671_100005927 Ga0070671_1000059273 196
371 3300005355 Ga0070671_100090299 Ga0070671_1000902991 196
372 3300005364 Ga0070673_100595570 Ga0070673_1005955701 196
373 3300005459 Ga0068867_100142006 Ga0068867_1001420061 196
374 3300005459 Ga0068867_100511781 Ga0068867_1005117812 196
375 3300005459 Ga0068867_100605455 Ga0068867_1006054551 196
376 3300005544 Ga0070686_100103677 Ga0070686_1001036772 196
377 3300005545 Ga0070695_100378952 Ga0070695_1003789522 196
378 3300005547 Ga0070693_100146442 Ga0070693_1001464422 196
379 3300005547 Ga0070693_100460216 Ga0070693_1004602161 196
380 3300005563 Ga0068855_100021196 Ga0068855_1000211965 196
381 3300005564 Ga0070664_100116749 Ga0070664_1001167492 196
382 3300005578 Ga0068854_101223208 Ga0068854_1012232081 196
383 3300005617 Ga0068859_100027475 Ga0068859_1000274754 196
384 3300005617 Ga0068859_100061737 Ga0068859_1000617373 196
385 3300005617 Ga0068859_100535023 Ga0068859_1005350231 196
386 3300005617 Ga0068859_100939381 Ga0068859_1009393811 196
387 3300005618 Ga0068864_100022752 Ga0068864_1000227523 196
388 3300005718 Ga0068866_10068035 Ga0068866_100680353 196
389 3300005841 Ga0068863_101078190 Ga0068863_1010781901 196
390 3300005842 Ga0068858_100053959 Ga0068858_1000539592 196
391 3300005842 Ga0068858_100299686 Ga0068858_1002996862 196
392 3300005843 Ga0068860_100013630 Ga0068860_1000136307 196
393 3300006237 Ga0097621_100183147 Ga0097621_1001831472 196
394 3300006237 Ga0097621_100721976 Ga0097621_1007219762 196
395 3300006358 Ga0068871_100040286 Ga0068871_1000402861 196
396 3300006358 Ga0068871_100345662 Ga0068871_1003456621 196
397 3300006881 Ga0068865_100021864 Ga0068865_1000218644 196
398 3300006914 Ga0075436_100022625 Ga0075436_1000226252 196
399 3300006914 Ga0075436_100401656 Ga0075436_1004016562 196
400 3300006931 Ga0097620_100027475 Ga0097620_1000274754 196
401 3300006931 Ga0097620_100061742 Ga0097620_1000617423 196
402 3300006931 Ga0097620_100535037 Ga0097620_1005350372 196
403 3300006931 Ga0097620_100939340 Ga0097620_1009393401 196
404 3300009098 Ga0105245_10004491 Ga0105245_100044912 196
405 3300009148 Ga0105243_11074046 Ga0105243_110740461 196
406 3300009174 Ga0105241_10065073 Ga0105241_100650731 196
407 3300009176 Ga0105242_10206558 Ga0105242_102065581 196
408 3300009177 Ga0105248_10017138 Ga0105248_100171384 196
409 3300010375 Ga0105239_10158821 Ga0105239_101588212 196
410 3300013100 Ga0157373_10106703 Ga0157373_101067032 196
411 3300013296 Ga0157374_10034604 Ga0157374_100346042 196
412 3300013297 Ga0157378_10105099 Ga0157378_101050992 196
413 3300013297 Ga0157378_10672816 Ga0157378_106728161 196
414 3300013306 Ga0163162_10004780 Ga0163162_100047802 196
415 3300013306 Ga0163162_10007623 Ga0163162_100076233 196
416 3300013308 Ga0157375_10018319 Ga0157375_100183195 196
417 3300013308 Ga0157375_10651788 Ga0157375_106517882 196
418 3300014325 Ga0163163_10037165 Ga0163163_100371652 196
419 3300014325 Ga0163163_10682075 Ga0163163_106820752 196
420 3300014325 Ga0163163_11754565 Ga0163163_117545651 196
421 3300014326 Ga0157380_10241783 Ga0157380_102417831 196
422 3300014745 Ga0157377_10012621 Ga0157377_100126215 196
423 3300014745 Ga0157377_10029331 Ga0157377_100293311 196
424 3300014968 Ga0157379_10207918 Ga0157379_102079182 196
425 3300014969 Ga0157376_10161211 Ga0157376_101612113 196
426 3300017792 Ga0163161_10010068 Ga0163161_100100681 196
427 3300025903 Ga0207680_10552035 Ga0207680_105520351 196
428 3300025918 Ga0207662_10049080 Ga0207662_100490802 196
429 3300025923 Ga0207681_10165992 Ga0207681_101659921 196
430 3300025926 Ga0207659_10805322 Ga0207659_108053221 196
431 3300025927 Ga0207687_10210243 Ga0207687_102102431 196
432 3300025931 Ga0207644_10009918 Ga0207644_100099186 196
433 3300025931 Ga0207644_10559897 Ga0207644_105598972 196
434 3300025934 Ga0207686_10475577 Ga0207686_104755772 196
435 3300025936 Ga0207670_11146751 Ga0207670_111467511 196
436 3300025938 Ga0207704_10419254 Ga0207704_104192541 196
437 3300025940 Ga0207691_10147627 Ga0207691_101476273 196
438 3300025942 Ga0207689_10026939 Ga0207689_100269392 196
439 3300025942 Ga0207689_10233205 Ga0207689_102332051 196
440 3300025961 Ga0207712_10045583 Ga0207712_100455832 196
441 3300026023 Ga0207677_10672810 Ga0207677_106728101 196
442 3300026035 Ga0207703_10016056 Ga0207703_100160564 196
443 3300026089 Ga0207648_10019956 Ga0207648_100199566 196
444 3300026089 Ga0207648_10145575 Ga0207648_101455753 196
445 3300026089 Ga0207648_10635832 Ga0207648_106358322 196
446 3300026095 Ga0207676_10152230 Ga0207676_101522301 196
447 3300026118 Ga0207675_100167983 Ga0207675_1001679833 196
448 3300026121 Ga0207683_10465480 Ga0207683_104654802 196
449 3300028380 Ga0268265_10347878 Ga0268265_103478782 196
450 3300028381 Ga0268264_10071243 Ga0268264_100712433 196
451 3300028381 Ga0268264_10435037 Ga0268264_104350372 196
452 3300031090 Ga0265760_10011541 Ga0265760_100115413 196
453 3300048915 Ga0496112_0545023 Ga0496112_0545023_186_776 196
454 3300050513 nmdc:mga0rr50_450322_c1 nmdc:mga0rr50_450322_c1_364_957 196
455 3300050514 nmdc:mga08x19_328659_c1 nmdc:mga08x19_328659_c1_244_921 196
456 3300005288 Ga0065714_10064575 Ga0065714_1006457515 197
457 3300005290 Ga0065712_10000114 Ga0065712_1000011415 197
458 3300005290 Ga0065712_10139285 Ga0065712_101392852 197
459 3300005293 Ga0065715_10094320 Ga0065715_100943203 197
460 3300005328 Ga0070676_10209820 Ga0070676_102098201 197
461 3300005331 Ga0070670_100046766 Ga0070670_1000467663 197
462 3300005333 Ga0070677_10484952 Ga0070677_104849521 197
463 3300005334 Ga0068869_100136996 Ga0068869_1001369962 197
464 3300005336 Ga0070680_100004466 Ga0070680_1000044666 197
465 3300005336 Ga0070680_100021047 Ga0070680_1000210474 197
466 3300005364 Ga0070673_100305771 Ga0070673_1003057712 197
467 3300005441 Ga0070700_100269508 Ga0070700_1002695082 197
468 3300005444 Ga0070694_100155329 Ga0070694_1001553292 197
469 3300005444 Ga0070694_100764465 Ga0070694_1007644651 197
470 3300005445 Ga0070708_100542530 Ga0070708_1005425301 197
471 3300005458 Ga0070681_10007211 Ga0070681_100072118 197
472 3300005459 Ga0068867_100103236 Ga0068867_1001032362 197
473 3300005468 Ga0070707_100421578 Ga0070707_1004215782 197
474 3300005518 Ga0070699_100365176 Ga0070699_1003651762 197
475 3300005530 Ga0070679_100000081 Ga0070679_10000008136 197
476 3300005539 Ga0068853_100223411 Ga0068853_1002234112 197
477 3300005546 Ga0070696_100393372 Ga0070696_1003933722 197
478 3300005563 Ga0068855_100669932 Ga0068855_1006699322 197
479 3300005577 Ga0068857_101309812 Ga0068857_1013098121 197
480 3300005578 Ga0068854_100140953 Ga0068854_1001409532 197
481 3300005614 Ga0068856_100048459 Ga0068856_1000484592 197
482 3300005617 Ga0068859_100542378 Ga0068859_1005423782 197
483 3300005617 Ga0068859_100643400 Ga0068859_1006434002 197
484 3300005618 Ga0068864_100361045 Ga0068864_1003610452 197
485 3300005844 Ga0068862_100188471 Ga0068862_1001884712 197
486 3300006852 Ga0075433_10094620 Ga0075433_100946203 197
487 3300006852 Ga0075433_10358881 Ga0075433_103588812 197
488 3300006871 Ga0075434_100065142 Ga0075434_1000651422 197
489 3300006871 Ga0075434_100451628 Ga0075434_1004516281 197
490 3300006871 Ga0075434_100532513 Ga0075434_1005325132 197
491 3300006914 Ga0075436_100186766 Ga0075436_1001867662 197
492 3300006931 Ga0097620_100542377 Ga0097620_1005423772 197
493 3300006931 Ga0097620_100643400 Ga0097620_1006434001 197
494 3300007076 Ga0075435_100252483 Ga0075435_1002524832 197
495 3300009101 Ga0105247_10539900 Ga0105247_105399001 197
496 3300009147 Ga0114129_10044756 Ga0114129_100447563 197
497 3300009147 Ga0114129_11820173 Ga0114129_118201732 197
498 3300009545 Ga0105237_10115733 Ga0105237_101157333 197
499 3300009553 Ga0105249_10028837 Ga0105249_100288372 197
500 3300013100 Ga0157373_10348676 Ga0157373_103486762 197
501 3300013306 Ga0163162_11336425 Ga0163162_113364251 197
502 3300013307 Ga0157372_10111909 Ga0157372_101119093 197
503 3300013307 Ga0157372_10867720 Ga0157372_108677201 197
504 3300013308 Ga0157375_10026902 Ga0157375_100269026 197
505 3300014325 Ga0163163_10023021 Ga0163163_100230215 197
506 3300025893 Ga0207682_10322991 Ga0207682_103229911 197
507 3300025912 Ga0207707_10000007 Ga0207707_1000000776 197
508 3300025917 Ga0207660_10000803 Ga0207660_100008038 197
509 3300025917 Ga0207660_10049954 Ga0207660_100499542 197
510 3300025921 Ga0207652_10000062 Ga0207652_1000006222 197
511 3300025925 Ga0207650_10011331 Ga0207650_100113312 197
512 3300025933 Ga0207706_10060537 Ga0207706_100605373 197
513 3300025942 Ga0207689_10150284 Ga0207689_101502842 197
514 3300025949 Ga0207667_11060065 Ga0207667_110600652 197
515 3300025961 Ga0207712_10004208 Ga0207712_100042082 197
516 3300026075 Ga0207708_10128073 Ga0207708_101280732 197
517 3300026078 Ga0207702_10330832 Ga0207702_103308322 197
518 3300026089 Ga0207648_10317787 Ga0207648_103177872 197
519 3300037466 Ga0395898_0880923 Ga0395898_0880923_25_618 197
520 3300038996 Ga0242420_001275 Ga0242420_001275_1061_1654 197
521 3300042461 Ga0439460_0009080 Ga0439460_0009080_1628_2248 197
522 3300048907 Ga0496104_0620276 Ga0496104_0620276_295_888 197
523 3300048910 Ga0496107_0254879 Ga0496107_0254879_153_746 197
524 3300048913 Ga0496110_0784844 Ga0496110_0784844_199_792 197
525 3300049654 Ga0501207_008303 Ga0501207_008303_297_890 197
526 3300049663 Ga0501223_002413 Ga0501223_002413_1125_1718 197
527 3300049668 Ga0501233_002587 Ga0501233_002587_718_1311 197
528 3300049679 Ga0501249_042384 Ga0501249_042384_237_830 197
529 3300049690 Ga0501261_020082 Ga0501261_020082_12_605 197
530 3300049704 Ga0501221_010070 Ga0501221_010070_336_929 197
531 3300050507 nmdc:mga05p37_100735_c2 nmdc:mga05p37_100735_c2_758_1351 197
532 3300050512 nmdc:mga0n895_340307_c1 nmdc:mga0n895_340307_c1_691_1284 197
533 3300050512 nmdc:mga0n895_89411_c1 nmdc:mga0n895_89411_c1_2215_2817 197
534 3300050515 nmdc:mga0a205_184944_c1 nmdc:mga0a205_184944_c1_37_630 197
535 3300050515 nmdc:mga0a205_361682_c1 nmdc:mga0a205_361682_c1_198_791 197
536 3300050515 nmdc:mga0a205_489848_c1 nmdc:mga0a205_489848_c1_332_925 197
537 3300005295 Ga0065707_10086903 Ga0065707_100869034 198
538 3300005467 Ga0070706_100171535 Ga0070706_1001715352 198
539 3300005618 Ga0068864_100184629 Ga0068864_1001846292 198
540 3300005719 Ga0068861_101281385 Ga0068861_1012813851 198
541 3300005842 Ga0068858_100265503 Ga0068858_1002655032 198
542 3300005843 Ga0068860_100506123 Ga0068860_1005061232 198
543 3300006163 Ga0070715_10118924 Ga0070715_101189242 198
544 3300006847 Ga0075431_100076030 Ga0075431_1000760302 198
545 3300006880 Ga0075429_100121587 Ga0075429_1001215872 198
546 3300009101 Ga0105247_10130041 Ga0105247_101300413 198
547 3300009147 Ga0114129_10209513 Ga0114129_102095132 198
548 3300010375 Ga0105239_10161227 Ga0105239_101612274 198
549 3300013100 Ga0157373_10589425 Ga0157373_105894252 198
550 3300013297 Ga0157378_10042354 Ga0157378_100423543 198
551 3300013306 Ga0163162_10010613 Ga0163162_100106137 198
552 3300013308 Ga0157375_11749490 Ga0157375_117494901 198
553 3300014325 Ga0163163_10106605 Ga0163163_101066052 198
554 3300025903 Ga0207680_10413990 Ga0207680_104139902 198
555 3300025904 Ga0207647_10102358 Ga0207647_101023582 198
556 3300025910 Ga0207684_10137717 Ga0207684_101377172 198
557 3300025925 Ga0207650_10932315 Ga0207650_109323152 198
558 3300026118 Ga0207675_100297985 Ga0207675_1002979852 198
559 3300028381 Ga0268264_10393457 Ga0268264_103934571 198
560 3300048905 Ga0496102_0538861 Ga0496102_0538861_110_706 198
561 3300048907 Ga0496104_0077279 Ga0496104_0077279_1479_2078 198
562 3300050509 nmdc:mga0qj67_504280_c1 nmdc:mga0qj67_504280_c1_260_856 198
563 3300050510 nmdc:mga06r32_486406_c1 nmdc:mga06r32_486406_c1_549_1145 198
564 3300061734 Ga0530510_0111380 Ga0530510_0111380_159_755 198
565 iso_pu_bacteria 2739367655 2739613146 198
566 iso_pu_bacteria 2881927736 2881931000 198
567 iso_pu_bacteria 2887375801 2887378680 198
568 3300005295 Ga0065707_10177045 Ga0065707_101770452 199
569 3300005330 Ga0070690_100022540 Ga0070690_1000225405 199
570 3300005330 Ga0070690_100026478 Ga0070690_1000264782 199
571 3300005330 Ga0070690_100090431 Ga0070690_1000904311 199
572 3300005343 Ga0070687_100636495 Ga0070687_1006364951 199
573 3300005343 Ga0070687_100718248 Ga0070687_1007182481 199
574 3300005353 Ga0070669_100187897 Ga0070669_1001878972 199
575 3300005353 Ga0070669_100827495 Ga0070669_1008274951 199
576 3300005406 Ga0070703_10000155 Ga0070703_1000015519 199
577 3300005441 Ga0070700_100028833 Ga0070700_1000288332 199
578 3300005445 Ga0070708_100028774 Ga0070708_1000287744 199
579 3300005467 Ga0070706_100006646 Ga0070706_1000066461 199
580 3300005468 Ga0070707_100000304 Ga0070707_1000003049 199
581 3300005468 Ga0070707_100023639 Ga0070707_1000236395 199
582 3300005471 Ga0070698_100016097 Ga0070698_1000160975 199
583 3300005471 Ga0070698_100088779 Ga0070698_1000887794 199
584 3300005536 Ga0070697_100018690 Ga0070697_1000186903 199
585 3300005545 Ga0070695_100530376 Ga0070695_1005303761 199
586 3300005549 Ga0070704_100016541 Ga0070704_1000165411 199
587 3300005549 Ga0070704_100242811 Ga0070704_1002428112 199
588 3300005549 Ga0070704_100267848 Ga0070704_1002678482 199
589 3300005841 Ga0068863_100792227 Ga0068863_1007922272 199
590 3300005842 Ga0068858_100180448 Ga0068858_1001804481 199
591 3300005843 Ga0068860_100073865 Ga0068860_1000738652 199
592 3300005843 Ga0068860_101601653 Ga0068860_1016016531 199
593 3300006871 Ga0075434_100795350 Ga0075434_1007953502 199
594 3300007076 Ga0075435_100093104 Ga0075435_1000931042 199
595 3300009148 Ga0105243_10009675 Ga0105243_100096753 199
596 3300009148 Ga0105243_10281892 Ga0105243_102818922 199
597 3300009176 Ga0105242_10769474 Ga0105242_107694741 199
598 3300009553 Ga0105249_10044364 Ga0105249_100443643 199
599 3300013297 Ga0157378_10822103 Ga0157378_108221031 199
600 3300013297 Ga0157378_11023933 Ga0157378_110239332 199
601 3300013306 Ga0163162_10236501 Ga0163162_102365013 199
602 3300014326 Ga0157380_10198360 Ga0157380_101983602 199
603 3300017792 Ga0163161_10312251 Ga0163161_103122512 199
604 3300025885 Ga0207653_10000116 Ga0207653_1000011614 199
605 3300025910 Ga0207684_10007963 Ga0207684_100079632 199
606 3300025910 Ga0207684_10087394 Ga0207684_100873942 199
607 3300025918 Ga0207662_10041980 Ga0207662_100419803 199
608 3300025918 Ga0207662_10284947 Ga0207662_102849472 199
609 3300025922 Ga0207646_10002545 Ga0207646_1000254523 199
610 3300025922 Ga0207646_10007391 Ga0207646_100073912 199
611 3300025923 Ga0207681_10173014 Ga0207681_101730142 199
612 3300025923 Ga0207681_11057336 Ga0207681_110573361 199
613 3300025935 Ga0207709_10011684 Ga0207709_100116844 199
614 3300025961 Ga0207712_10851449 Ga0207712_108514491 199
615 3300026035 Ga0207703_10049831 Ga0207703_100498312 199
616 3300026075 Ga0207708_10012671 Ga0207708_100126718 199
617 3300026118 Ga0207675_100052580 Ga0207675_1000525803 199
618 3300026118 Ga0207675_100399130 Ga0207675_1003991302 199
619 3300028380 Ga0268265_10977781 Ga0268265_109777811 199
620 3300028381 Ga0268264_10261445 Ga0268264_102614452 199
621 3300028381 Ga0268264_10339547 Ga0268264_103395472 199
622 3300042876 Ga0451577_0065859 Ga0451577_0065859_1624_2223 199
623 3300045051 Ga0451576_0786091 Ga0451576_0786091_293_892 199
624 3300050507 nmdc:mga05p37_1535974_c1 nmdc:mga05p37_1535974_c1_17_616 199
625 3300005334 Ga0068869_100071490 Ga0068869_1000714901 200
626 3300005345 Ga0070692_10425772 Ga0070692_104257721 200
627 3300005444 Ga0070694_100041970 Ga0070694_1000419702 200
628 3300005459 Ga0068867_101339533 Ga0068867_1013395331 200
629 3300005544 Ga0070686_100002830 Ga0070686_1000028306 200
630 3300005549 Ga0070704_100152556 Ga0070704_1001525562 200
631 3300005617 Ga0068859_101374821 Ga0068859_1013748212 200
632 3300005719 Ga0068861_100024817 Ga0068861_1000248174 200
633 3300006931 Ga0097620_101374799 Ga0097620_1013747991 200
634 3300009094 Ga0111539_11372497 Ga0111539_113724971 200
635 3300013297 Ga0157378_10008861 Ga0157378_100088615 200
636 3300013306 Ga0163162_10932005 Ga0163162_109320051 200
637 3300017792 Ga0163161_10867704 Ga0163161_108677041 200
638 3300026118 Ga0207675_100027166 Ga0207675_1000271663 200
639 3300048929 Ga0496126_0029167 Ga0496126_0029167_4536_5174 200
640 3300049591 Ga0501075_0277308 Ga0501075_0277308_400_1032 200
641 3300050511 nmdc:mga08y16_61269_c1 nmdc:mga08y16_61269_c1_123_725 200
642 3300006847 Ga0075431_100727948 Ga0075431_1007279481 201
643 3300006880 Ga0075429_100279299 Ga0075429_1002792992 201
644 3300037471 Ga0395905_0912654 Ga0395905_0912654_117_725 201
645 3300050510 nmdc:mga06r32_348182_c1 nmdc:mga06r32_348182_c1_599_1207 201
646 3300050510 nmdc:mga06r32_792476_c1 nmdc:mga06r32_792476_c1_273_878 201
647 3300050515 nmdc:mga0a205_469365_c1 nmdc:mga0a205_469365_c1_48_653 201
648 3300000532 CNAas_1000715 CNAas_10007152 202
649 3300005330 Ga0070690_100058075 Ga0070690_1000580752 202
650 3300005331 Ga0070670_100593937 Ga0070670_1005939372 202
651 3300005336 Ga0070680_100044920 Ga0070680_1000449202 202
652 3300005336 Ga0070680_100665446 Ga0070680_1006654462 202
653 3300005353 Ga0070669_100574434 Ga0070669_1005744342 202
654 3300005354 Ga0070675_100623294 Ga0070675_1006232942 202
655 3300005364 Ga0070673_100053956 Ga0070673_1000539562 202
656 3300005366 Ga0070659_100022112 Ga0070659_1000221124 202
657 3300005440 Ga0070705_100467240 Ga0070705_1004672402 202
658 3300005444 Ga0070694_100597622 Ga0070694_1005976222 202
659 3300005445 Ga0070708_100098624 Ga0070708_1000986244 202
660 3300005455 Ga0070663_100115628 Ga0070663_1001156281 202
661 3300005457 Ga0070662_100250219 Ga0070662_1002502191 202
662 3300005458 Ga0070681_10030012 Ga0070681_100300125 202
663 3300005467 Ga0070706_100460366 Ga0070706_1004603662 202
664 3300005468 Ga0070707_100074638 Ga0070707_1000746383 202
665 3300005471 Ga0070698_100481865 Ga0070698_1004818651 202
666 3300005518 Ga0070699_100010760 Ga0070699_1000107608 202
667 3300005518 Ga0070699_100106716 Ga0070699_1001067163 202
668 3300005518 Ga0070699_100195015 Ga0070699_1001950152 202
669 3300005530 Ga0070679_100058182 Ga0070679_1000581823 202
670 3300005535 Ga0070684_100293799 Ga0070684_1002937992 202
671 3300005536 Ga0070697_100006579 Ga0070697_1000065796 202
672 3300005536 Ga0070697_100653491 Ga0070697_1006534911 202
673 3300005539 Ga0068853_100005674 Ga0068853_1000056743 202
674 3300005564 Ga0070664_100053442 Ga0070664_1000534422 202
675 3300005577 Ga0068857_100082407 Ga0068857_1000824073 202
676 3300005615 Ga0070702_100417641 Ga0070702_1004176412 202
677 3300005618 Ga0068864_100104013 Ga0068864_1001040134 202
678 3300005618 Ga0068864_100497153 Ga0068864_1004971532 202
679 3300005718 Ga0068866_10026909 Ga0068866_100269091 202
680 3300005719 Ga0068861_100172645 Ga0068861_1001726452 202
681 3300005840 Ga0068870_10005641 Ga0068870_100056414 202
682 3300005844 Ga0068862_100040124 Ga0068862_1000401242 202
683 3300005983 Ga0081540_1130821 Ga0081540_11308212 202
684 3300006163 Ga0070715_10000023 Ga0070715_1000002384 202
685 3300006173 Ga0070716_100000004 Ga0070716_100000004182 202
686 3300006852 Ga0075433_10181376 Ga0075433_101813762 202
687 3300006852 Ga0075433_10308148 Ga0075433_103081482 202
688 3300006871 Ga0075434_100017221 Ga0075434_1000172215 202
689 3300006881 Ga0068865_100581542 Ga0068865_1005815422 202
690 3300006931 Ga0097620_100222628 Ga0097620_1002226282 202
691 3300009147 Ga0114129_10002902 Ga0114129_1000290223 202
692 3300009147 Ga0114129_10017252 Ga0114129_100172522 202
693 3300009147 Ga0114129_10572513 Ga0114129_105725132 202
694 3300009147 Ga0114129_11485473 Ga0114129_114854731 202
695 3300009176 Ga0105242_11447126 Ga0105242_114471261 202
696 3300010159 Ga0099796_10216603 Ga0099796_102166031 202
697 3300013100 Ga0157373_10008998 Ga0157373_100089985 202
698 3300013100 Ga0157373_10014022 Ga0157373_100140224 202
699 3300013297 Ga0157378_10011290 Ga0157378_100112907 202
700 3300013297 Ga0157378_10193418 Ga0157378_101934185 202
701 3300013307 Ga0157372_10066906 Ga0157372_100669062 202
702 3300014325 Ga0163163_10015616 Ga0163163_100156162 202
703 3300014326 Ga0157380_10027623 Ga0157380_100276231 202
704 3300021384 Ga0213876_10010880 Ga0213876_100108803 202
705 3300021388 Ga0213875_10044318 Ga0213875_100443182 202
706 3300025905 Ga0207685_10000002 Ga0207685_1000000222 202
707 3300025908 Ga0207643_10106808 Ga0207643_101068082 202
708 3300025910 Ga0207684_10139191 Ga0207684_101391912 202
709 3300025910 Ga0207684_10403420 Ga0207684_104034201 202
710 3300025912 Ga0207707_10018505 Ga0207707_100185054 202
711 3300025913 Ga0207695_10404766 Ga0207695_104047662 202
712 3300025917 Ga0207660_10006014 Ga0207660_100060146 202
713 3300025917 Ga0207660_10760276 Ga0207660_107602762 202
714 3300025922 Ga0207646_10138598 Ga0207646_101385983 202
715 3300025922 Ga0207646_10536739 Ga0207646_105367391 202
716 3300025925 Ga0207650_10464413 Ga0207650_104644131 202
717 3300025926 Ga0207659_10536978 Ga0207659_105369781 202
718 3300025932 Ga0207690_10291089 Ga0207690_102910892 202
719 3300025939 Ga0207665_10000006 Ga0207665_1000000631 202
720 3300025945 Ga0207679_10033891 Ga0207679_100338912 202
721 3300026041 Ga0207639_10079027 Ga0207639_100790272 202
722 3300026116 Ga0207674_10000683 Ga0207674_1000068313 202
723 3300026118 Ga0207675_100206931 Ga0207675_1002069312 202
724 3300028380 Ga0268265_10382904 Ga0268265_103829042 202
725 3300031995 Ga0307409_100336863 Ga0307409_1003368632 202
726 3300032004 Ga0307414_10537247 Ga0307414_105372472 202
727 3300032004 Ga0307414_10605023 Ga0307414_106050231 202
728 3300037853 Ga0436364_0610855 Ga0436364_0610855_16141_16749 202
729 3300039437 Ga0436365_1066791 Ga0436365_1066791_249_872 202
730 3300039437 Ga0436365_1897421 Ga0436365_1897421_16803_17411 202
731 3300044673 Ga0453683_0406608 Ga0453683_0406608_56_670 202
732 3300045976 Ga0466967_0886247 Ga0466967_0886247_108_716 202
733 3300048910 Ga0496107_0519763 Ga0496107_0519763_259_873 202
734 3300048912 Ga0496109_0053681 Ga0496109_0053681_2721_3335 202
735 3300048913 Ga0496110_0115327 Ga0496110_0115327_887_1501 202
736 3300048914 Ga0496111_0809929 Ga0496111_0809929_32_646 202
737 3300050507 nmdc:mga05p37_886874_c1 nmdc:mga05p37_886874_c1_91_714 202
738 3300050507 nmdc:mga05p37_957035_c1 nmdc:mga05p37_957035_c1_174_782 202
739 3300050512 nmdc:mga0n895_44864_c1 nmdc:mga0n895_44864_c1_2003_2614 202
740 3300050515 nmdc:mga0a205_710408_c1 nmdc:mga0a205_710408_c1_185_808 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00694

Aconitase_C

Aconitase C-terminal domain

38

161

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.963 4 162
3q3w-assembly1.cif.gz_A isopropylmalate isomerase small subunit from campylobacter jejuni. 0.9616 1 176
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9577 1 175
3h5e-assembly2.cif.gz_B leud_1-156 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9569 4 162
3h5j-assembly1.cif.gz_A leud_1-168 small subunit of isopropylmalate isomerase (rv2987c) from mycobacterium tuberculosis 0.9522 1 175
ID Description Score Start End Superfamily
af_O14289_535_712_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9632 1 178 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9577 1 175 3.20.19.10
3q3wA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9547 1 176 3.20.19.10
3h5jA00 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9522 1 175 3.20.19.10
af_Q2FWK0_1_171_3.20.19.10 Alpha Beta;Alpha-Beta Barrel;Aconitase; domain 4;Aconitase, domain 4 0.9502 2 175 3.20.19.10
ID Description Score Start End GO Terms
AF-A0A533XLR3-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9931 51 139 GO:0003861
GO:0009098
GO:0009316
AF-A0A659SHW6-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9852 64 192 GO:0003861
GO:0009098
GO:0009316
AF-A0A6L5DFL6-F1-model_v4 deleted 0.9806 55 165
AF-A0A3M1RCP5-F1-model_v4 3-isopropylmalate dehydratase small subunit (EC 4.2.1.33) (Alpha-IPM isomerase) (IPMI) (Isopropylmalate isomerase) 0.9779 1 193 GO:0003861
GO:0009098
GO:0009316
AF-A0A3D2AVN8-F1-model_v4 3-isopropylmalate dehydratase (EC 4.2.1.33) 0.9775 1 156 GO:0003861
GO:0009098
GO:0009316

Feature Viewer

pLDDT pTM Quality
92.11 0.87 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map