F478520

General Info

Members Datasets Scaffolds Average Seq Length
740 386 591 288

Family's Representative Sequence

Representative Sequence 3300009092|Ga0105250_10000042|Ga0105250_100000428
Length 307
Sequence MRQFFMAMITQEKGEIMSQTGSQKEIWYETLHASFGQYFSIEKELYRDKTEHQDLVIFENAALGRVMALDGVVQTTERDEFIYHEMMTHVPLLAHGSARKVLIIGGGDGGMLREVCRHKTVEHITMVEIDAGVVEFCRQYLPNHSAGSYDDARFNLVIDDGVNFVNQTSETFDVIISDCTDPIGPGESLFTSRFYEGCARCLKPGGIFVAQNGVCFLQQEEAVNSHQKLTHYFQDVSFYQAAIPTYYGGIMTFAWATNNPQYRQLDTGTLQARFAASGIISRYYNPAIHYGSFALPQYLLNALSASR

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2506520007 Serratia plymuthica AS9 Isolate Rhizosphere
3 2506520008 Serratia plymuthica AS12 Isolate Unclassified
4 2508501050 Microvirga lupini Lut6 Isolate Nodule
5 2508501071 Serratia proteamaculans S4 Isolate Rhizosphere
6 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
7 2522572158 Azospirillum halopraeferens DSM 3675 Isolate Unclassified
8 2547132181 Kosakonia sacchari SP1 Isolate Stem
9 2547132416 Enterobacter sp. MR1 Isolate Rhizoplane
10 2554235234 Klebsiella michiganensis SA2 Isolate Unclassified
11 2561511199 Enterobacter sp. R4-368 Isolate Nodule
12 2585427591 Rahnella aquatilis OV744 Isolate Rhizosphere
13 2585427592 Rahnella aquatilis OV588 Isolate Rhizosphere
14 2599185169 Klebsiella quasipneumoniae NFPP35 Isolate Rhizoplane
15 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
16 2600255254 Klebsiella quasipneumoniae NFIX15 Isolate Rhizoplane
17 2600255255 Klebsiella quasipneumoniae NFIX23 Isolate Rhizoplane
18 2600255256 Enterobacter sp. NFIX08 Isolate Rhizoplane
19 2600255257 Enterobacter sp. NFIX03 Isolate Rhizoplane
20 2600255280 Klebsiella quasipneumoniae NFIX42 Isolate Rhizoplane
21 2600255281 Klebsiella quasipneumoniae NFIX43 Isolate Rhizoplane
22 2600255287 Klebsiella quasipneumoniae NFIX11 Isolate Rhizoplane
23 2600255288 Klebsiella quasipneumoniae NFIX14 Isolate Rhizoplane
24 2600255289 Klebsiella quasipneumoniae NFIX16 Isolate Rhizoplane
25 2600255290 Klebsiella quasipneumoniae NFIX17 Isolate Rhizoplane
26 2600255291 Klebsiella quasipneumoniae NFIX19 Isolate Rhizoplane
27 2600255298 Klebsiella quasipneumoniae NFIX21 Isolate Rhizoplane
28 2600255299 Klebsiella quasipneumoniae NFIX22 Isolate Rhizoplane
29 2600255300 Klebsiella quasipneumoniae NFIX30 Isolate Rhizoplane
30 2600255301 Klebsiella quasipneumoniae NFIX33 Isolate Rhizoplane
31 2600255302 Klebsiella quasipneumoniae NFIX35 Isolate Rhizoplane
32 2600255303 Klebsiella quasipneumoniae NFIX36 Isolate Rhizoplane
33 2600255304 Klebsiella quasipneumoniae NFIX37 Isolate Rhizoplane
34 2600255305 Klebsiella quasipneumoniae NFIX41 Isolate Rhizoplane
35 2600255306 Klebsiella quasipneumoniae NFIX44 Isolate Rhizoplane
36 2600255307 Klebsiella quasipneumoniae NFIX56 Isolate Rhizoplane
37 2600255309 Klebsiella sp. NFIX53 Isolate Rhizoplane
38 2600255310 Enterobacter sp. NFIX06 Isolate Rhizoplane
39 2600255311 Enterobacter sp. NFIX04 Isolate Rhizoplane
40 2600255392 Klebsiella quasipneumoniae NFIX54 Isolate Rhizoplane
41 2602042046 Enterobacter sp. NFIX09 Isolate Rhizoplane
42 2602042047 Enterobacter sp. NFIX59 Isolate Rhizoplane
43 2602042052 Klebsiella quasipneumoniae NFIX18 Isolate Rhizoplane
44 2602042053 Klebsiella quasipneumoniae NFIX12 Isolate Rhizoplane
45 2602042066 Enterobacter sp. NFIX45 Isolate Rhizoplane
46 2602042067 Enterobacter sp. NFIX58 Isolate Rhizoplane
47 2602042103 Klebsiella quasipneumoniae NFIX29 Isolate Rhizoplane
48 2602042104 Klebsiella quasipneumoniae NFIX26 Isolate Rhizoplane
49 2602042105 Klebsiella quasipneumoniae NFIX25 Isolate Rhizoplane
50 2602042106 Klebsiella quasipneumoniae NFIX13 Isolate Rhizoplane
51 2602042109 Klebsiella aerogenes NFIX39 Isolate Rhizoplane
52 2602042110 Klebsiella quasipneumoniae NFIX40 Isolate Rhizoplane
53 2602042111 Klebsiella quasipneumoniae NFIX20 Isolate Rhizoplane
54 2603880178 Klebsiella quasipneumoniae NFIX34 Isolate Rhizoplane
55 2603880184 Klebsiella quasipneumoniae NFIX27 Isolate Rhizoplane
56 2603880202 Klebsiella quasipneumoniae NFIX38 Isolate Rhizoplane
57 2603880211 Klebsiella quasipneumoniae NFIX24 Isolate Rhizoplane
58 2608642108 Pantoea agglomerans NFPP29 Isolate Rhizoplane
59 2609459761 Enterobacter sp. NFR05 Isolate Rhizoplane
60 2636415599 Klebsiella variicola DX120E Isolate Unclassified
61 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
62 2667528172 Enterobacteriaceae bacterium NFIX31 Isolate Rhizoplane
63 2667528173 Rahnella sp. NFIX50 Isolate Rhizoplane
64 2675903046 Klebsiella quasipneumoniae NFIX52 Isolate Rhizoplane
65 2681812866 Enterobacter asburiae NFIX55 Isolate Rhizoplane
66 2681812869 Enterobacter ludwigii NFPP41 Isolate Rhizoplane
67 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
68 2687453601 Serratia plymuthica 3Rp8 Isolate Unclassified
69 2706794495 Dickeya zeae ZJU1202 Isolate Unclassified
70 2711768156 Atlantibacter hermannii DDE1 Isolate Unclassified
71 2751185917 Enterobacter sp. HK169 Isolate Unclassified
72 2765235842 Enterobacter ludwigii AA4 Isolate Unclassified
73 2772190666 Serratia surfactantfaciens YD25 Isolate Unclassified
74 2775506706 Enterobacter asburiae 1216 Isolate Unclassified
75 2775507074 Klebsiella sp. D5A Isolate Unclassified
76 2791354903 Mangrovibacter phragmitis MP23 Isolate Unclassified
77 2791355010 Kosakonia pseudosacchari NN143 Isolate Unclassified
78 2791355275 Enterobacter sp. Sa187 Isolate Unclassified
79 2806310673 Serratia quinivorans NCTC 13189 Isolate Rhizosphere
80 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
81 2811995292 Kosakonia oryzae Ola 51 Isolate Unclassified
82 2814123068 Kosakonia radicincitans GXGL-4A Isolate Rhizosphere
83 2821118458 Enterobacter asburiae 609 Isolate Unclassified
84 2823373977 Enterobacter ludwigii NCR3 Isolate Rhizosphere
85 2842775625 Roseomonas sp. R-71825 Isolate Unclassified
86 2844425489 Enterobacter cloacae SBP-8 Isolate Rhizosphere
87 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
88 2846540461 Photorhabdus luminescens HIM3 Isolate Rhizosphere
89 2847085930 Erwinia persicina B64 Isolate Bulb
90 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
91 2852103415 Edaphovirga cremea DSM 105170 Isolate Rhizosphere
92 2854601825 Dickeya dianthicola SS70 Isolate Stem Tuber
93 2855195626 Pectobacterium atrosepticum SS26 Isolate Stem Tuber
94 2858466076 Pectobacterium polaris SS28 Isolate Stem Tuber
95 2865014394 Pantoea sp. R-71966 Isolate Unclassified
96 2869551831 Serratia inhibens PRI-2C Isolate Rhizosphere
97 2871272651 Pectobacterium carotovorum SS96 Isolate Stem Tuber
98 2881609920 Pantoea sp. ARC607 Isolate Rhizosphere
99 2883577096 Roseococcus sp. SYP-B2431 Isolate Rhizosphere
100 2888366609 Serratia sp. NGAS9 Isolate Rhizosphere
101 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
102 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
103 2900051742 Pectobacterium zantedeschiae 2M Isolate Stem Tuber
104 2904474040 Rahnella aquatilis 4485 Isolate Rhizosphere
105 2904504865 Serratia marcescens 1822 Isolate Unclassified
106 2904513164 Klebsiella variicola 1431 Isolate Rhizosphere
107 2908669403 Pantoea coffeiphila 1480 Isolate Rhizosphere
108 2909399089 Nguyenibacter vanlangensis LMG 31431 Isolate Unclassified
109 2919108558 Klebsiella sp. 1400 Isolate Rhizosphere
110 2919150387 Rahnella aceris 1817 Isolate Unclassified
111 2923634449 Enterobacter kobei SLBN-76 Isolate Rhizosphere
112 2927143783 Rahnella sp. 2050 Isolate Unclassified
113 2927833300 Enterobacter sp. SLBN-59 Isolate Rhizosphere
114 2929199973 Roseomonas sp. R-73070 Hybrid assembly Isolate Unclassified
115 2932406140 Serratia sp. 2723 Isolate Rhizosphere
116 2935625433 Kosakonia sp. 1610 Isolate Rhizosphere
117 2937539931 Pantoea sp. LS15 Isolate Unclassified
118 2937967321 Serratia sp. YC16 Isolate Unclassified
119 2939568625 Lelliottia sp. 489 Isolate Rhizosphere
120 2939577877 Serratia sp. 509 Isolate Rhizosphere
121 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
122 2939607340 Leclercia sp. 1548 Isolate Rhizosphere
123 2939617950 Kosakonia cowanii 2056 Isolate Rhizosphere
124 2939642701 Lelliottia nimipressuralis 2756 Isolate Rhizosphere
125 2945874760 Phytobacter diazotrophicus UAEU22 Isolate Rhizosphere
126 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
127 2969079654 Klebsiella variicola E57-7 Isolate Unclassified
128 2971820967 Klebsiella sp. MPUS7 Isolate Rhizosphere
129 2974310843 Enterobacter sp. SORGH_AS 287 Isolate Unclassified
130 2974435778 Kosakonia cowanii SORGH_AS 304 Isolate Unclassified
131 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
132 2984559226 Klebsiella variicola SORGH_AS834 Isolate Aerial Root
133 2984595703 Klebsiella variicola SORGH_AS1070 Isolate Aerial Root
134 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
135 3000376612 Enterobacteriaceae bacterium 4M9 Isolate Rhizosphere
136 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
137 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
138 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
139 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
140 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
141 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
142 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
143 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
144 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
145 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
146 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
147 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
148 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
149 3300005272 Switchgrass rhizosphere microbial communities from Buena Vista Grasslands Wildlife Area, Michigan, USA - BV2.1 v1 Metagenome Rhizosphere
150 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
151 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
152 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
153 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
154 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
155 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
156 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
157 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
158 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
159 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
160 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
161 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
162 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
163 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
164 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
165 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
166 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
167 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
168 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
169 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
170 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
171 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
172 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
173 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
174 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
175 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
176 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
177 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
178 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
179 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
180 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
181 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
182 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
183 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
184 3300009993 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG Metagenome Rhizosphere
185 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
186 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
187 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
188 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
189 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
190 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
191 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
192 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
193 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
194 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
195 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
196 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
197 3300015679 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.4_F08 Metagenome Unclassified
198 3300015680 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.2_H03 Metagenome Rhizosphere
199 3300015685 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.5_G12 Metagenome Unclassified
200 3300015687 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 002.1_G08 Metagenome Rhizosphere
201 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
202 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
203 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
204 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
205 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
206 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
207 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
208 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
209 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
210 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
211 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
212 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
213 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
214 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
227 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
229 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
230 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
232 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300033541 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
238 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
239 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
240 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
242 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
243 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
244 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
245 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
246 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
247 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
248 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
249 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
250 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
251 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
252 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
253 3300038727 Seagrass microbial communities from Seahorse Key, FL, USA - TV0818 Metagenome Unclassified
254 3300038735 Seagrass microbial communities from Seahorse Key, FL, USA - SH0319 Metagenome Unclassified
255 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
256 3300038742 Seagrass microbial communities from Seahorse Key, FL, USA - SH0818 Metagenome Unclassified
257 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
258 3300039110 Seagrass microbial communities from Seahorse Key, FL, USA - SV0319 Metagenome Unclassified
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
261 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
262 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
263 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
264 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
265 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
266 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
267 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
268 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
269 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
270 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
271 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
272 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
273 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
274 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
277 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
278 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
279 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
280 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
281 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
282 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
283 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
284 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
285 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
286 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
287 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
288 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
291 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
292 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
293 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
294 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
295 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
296 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
297 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
298 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
299 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
302 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
303 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
304 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
305 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
306 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
307 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
308 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
309 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
318 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
319 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
320 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
321 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
322 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
323 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
324 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
325 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
326 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
327 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
328 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
329 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
330 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
331 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
341 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
347 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
348 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
349 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
350 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
351 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
352 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
353 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
354 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
355 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
356 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
357 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
361 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
362 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
363 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
364 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
365 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
366 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
367 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
368 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
369 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
370 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
371 640753048 Serratia proteamaculans 568 Isolate Endosphere
372 641228493 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
373 643348555 Gluconacetobacter diazotrophicus PA1 5 Isolate Unclassified
374 8004592986 Serratia sp. S119 Isolate Unclassified
375 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
376 8015394850 Serratia sp. PGPR-27 Isolate Rhizosphere
377 8018221730 Enterobacter sp. CM29 Isolate Unclassified
378 8018405270 Enterobacter sp. 198 Isolate Rhizosphere
379 8019504834 Atlantibacter hermannii 1903 Isolate Rhizosphere
380 8054844752 Dryocola boscaweniae H18W14 Isolate Rhizosphere
381 8054849141 Dryocola clanedunensis H11S18 Isolate Rhizosphere
382 8055087960 Silvania hatchlandensis H19S6 Isolate Rhizosphere
383 8055092621 Silvania confinis H4N4 Isolate Rhizosphere
384 8055097453 Leclercia tamurae H6W5 Isolate Rhizosphere
385 8055909800 Plastoroseomonas hellenica LMG 31523 Isolate Unclassified
386 8057304971 Scandinavium manionii H17S15 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 79.59
Metatranscriptomes 0.14
Isolates 20.27

Biome Distribution

Category Percentage (%)
Aerial Root 0.54
Bulb 0.14
Endosphere 4.19
Nodule 3.24
Rhizoplane 8.65
Rhizosphere 55.68
Stem 0.14
Stem Tuber 0.68
Unclassified 26.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_3631014 2162886007 Bacteria 3414
2 SwRhRL2b_contig_419289 2162886007 Bacteria 3003
3 SwRhRL2b_contig_541451 2162886007 Bacteria 2061
4 JGI24739J22299_10000061 3300001989 Bacteria 30056
5 JGI25162J39368_1000006 3300002737 Bacteria 405267
6 JGI25162J39368_1005659 3300002737 Bacteria 2370
7 JGI25163J39215_1000001 3300002771 Bacteria 314282
8 JGI25164J39214_1000001 3300002772 Bacteria 477015
9 JGI25152J39213_1000194 3300002773 Bacteria 41017
10 JGI25406J46586_10005938 3300003203 Bacteria 5650
11 rootH1_10041192 3300003316 Bacteria 1521
12 rootH1_10041192 3300003323 Bacteria 2081
13 Ga0055538_1000004 3300003751 Bacteria 615646
14 Ga0055539_1000004 3300003752 Bacteria 615646
15 Ga0055533_1000007 3300003756 Bacteria 615646
16 Ga0055525_1000007 3300003759 Bacteria 615646
17 Ga0055541_1000004 3300003841 Bacteria 615646
18 Ga0058692_1000183 3300003856 Bacteria 38266
19 Ga0058692_1000306 3300003856 Bacteria 24787
20 Ga0058692_1003055 3300003856 Bacteria 5338
21 Ga0058692_1003144 3300003856 Bacteria 5236
22 Ga0058692_1005138 3300003856 Bacteria 3767
23 Ga0058692_1008784 3300003856 Bacteria 2591
24 Ga0058692_1008820 3300003856 Bacteria 2585
25 Ga0058692_1008822 3300003856 Bacteria 2585
26 Ga0058692_1017826 3300003856 Bacteria 1549
27 Ga0065703_1019625 3300005272 Bacteria 2638
28 Ga0065704_10001139 3300005289 Bacteria 16584
29 Ga0065704_10001780 3300005289 Bacteria 9988
30 Ga0065704_10004251 3300005289 Bacteria 5610
31 Ga0065704_10083800 3300005289 Bacteria 3415
32 Ga0070666_10050539 3300005335 Bacteria 2796
33 Ga0070668_100085212 3300005347 Bacteria 2483
34 Ga0070714_100059870 3300005435 Bacteria 3267
35 Ga0070713_100225231 3300005436 Bacteria 1702
36 Ga0070710_10008024 3300005437 Bacteria 5132
37 Ga0070711_100024350 3300005439 Bacteria 3948
38 Ga0070663_100060388 3300005455 Unclassified 2727
39 Ga0070678_100028534 3300005456 Bacteria 3808
40 Ga0070679_100013358 3300005530 Bacteria 7864
41 Ga0070684_100432053 3300005535 Bacteria 1216
42 Ga0068853_100185998 3300005539 Bacteria 1886
43 Ga0070693_100199562 3300005547 Unclassified 1298
44 Ga0070665_100009321 3300005548 Bacteria 9935
45 Ga0070665_100158052 3300005548 Bacteria 2268
46 Ga0068857_100000004 3300005577 Bacteria 171895
47 Ga0068856_100030542 3300005614 Bacteria 5267
48 Ga0081455_10070490 3300005937 Bacteria 2902
49 Ga0081538_10001815 3300005981 Bacteria 21494
50 Ga0081538_10040497 3300005981 Bacteria 2971
51 Ga0081539_10000054 3300005985 Bacteria 259053
52 Ga0075368_10137208 3300006042 Bacteria 1018
53 Ga0075364_10002478 3300006051 Bacteria 10335
54 Ga0075364_10002674 3300006051 Bacteria 10002
55 Ga0070712_100017993 3300006175 Bacteria 4583
56 Ga0075366_10074589 3300006195 Bacteria 2023
57 Ga0075370_10035566 3300006353 Bacteria 2796
58 Ga0079104_1000238 3300006946 Bacteria 73159
59 Ga0079104_1000406 3300006946 Bacteria 49721
60 Ga0079104_1001044 3300006946 Bacteria 21144
61 Ga0079104_1001079 3300006946 Bacteria 20446
62 Ga0079104_1001282 3300006946 Bacteria 17375
63 Ga0079104_1005238 3300006946 Bacteria 5236
64 Ga0079104_1005520 3300006946 Bacteria 5035
65 Ga0079104_1006147 3300006946 Bacteria 4621
66 Ga0079104_1011898 3300006946 Bacteria 2767
67 Ga0079104_1012465 3300006946 Bacteria 2668
68 Ga0105251_10000595 3300009011 Bacteria 33132
69 Ga0105251_10001239 3300009011 Bacteria 22107
70 Ga0105251_10002066 3300009011 Bacteria 16214
71 Ga0105251_10002260 3300009011 Bacteria 15297
72 Ga0105251_10002440 3300009011 Bacteria 14629
73 Ga0105251_10007155 3300009011 Bacteria 6938
74 Ga0105251_10008398 3300009011 Bacteria 6217
75 Ga0105251_10009331 3300009011 Bacteria 5802
76 Ga0105251_10027865 3300009011 Bacteria 2858
77 Ga0105251_10035432 3300009011 Bacteria 2462
78 Ga0105251_10049628 3300009011 Bacteria 2008
79 Ga0105251_10107428 3300009011 Bacteria 1273
80 Ga0105244_10000023 3300009036 Bacteria 233110
81 Ga0105244_10000256 3300009036 Bacteria 54425
82 Ga0105244_10000713 3300009036 Bacteria 28708
83 Ga0105244_10001617 3300009036 Bacteria 17859
84 Ga0105244_10004325 3300009036 Bacteria 9821
85 Ga0105244_10010532 3300009036 Bacteria 5602
86 Ga0105244_10013293 3300009036 Bacteria 4818
87 Ga0105244_10025204 3300009036 Bacteria 3236
88 Ga0105244_10031767 3300009036 Bacteria 2801
89 Ga0105244_10044987 3300009036 Bacteria 2272
90 Ga0105244_10058404 3300009036 Bacteria 1947
91 Ga0105244_10083418 3300009036 Bacteria 1579
92 Ga0105250_10000042 3300009092 Bacteria 130495
93 Ga0105250_10000378 3300009092 Bacteria 33263
94 Ga0105250_10001245 3300009092 Bacteria 14110
95 Ga0105250_10004843 3300009092 Bacteria 6125
96 Ga0105250_10005593 3300009092 Bacteria 5621
97 Ga0105250_10071736 3300009092 Bacteria 1399
98 Ga0105250_10091952 3300009092 Bacteria 1234
99 Ga0105240_10423701 3300009093 Bacteria 1495
100 Ga0105247_10000223 3300009101 Bacteria 54349
101 Ga0105243_10002183 3300009148 Bacteria 16513
102 Ga0105241_10000006 3300009174 Bacteria 373608
103 Ga0105237_10142485 3300009545 Bacteria 2391
104 Ga0105237_10236123 3300009545 Bacteria 1829
105 Ga0105237_10446636 3300009545 Unclassified 1299
106 Ga0105238_10547892 3300009551 Bacteria 1161
107 Ga0105028_102434 3300009993 Bacteria 1950
108 Ga0105239_10391296 3300010375 Bacteria 1572
109 Ga0105246_10020546 3300011119 Bacteria 4237
110 Ga0105246_10027407 3300011119 Bacteria 3732
111 Ga0157373_10003696 3300013100 Bacteria 11578
112 Ga0157373_10013207 3300013100 Bacteria 6062
113 Ga0157373_10065768 3300013100 Bacteria 2566
114 Ga0157373_10078071 3300013100 Bacteria 2335
115 Ga0157373_10078180 3300013100 Bacteria 2333
116 Ga0157373_10185192 3300013100 Bacteria 1467
117 Ga0157371_10000020 3300013102 Bacteria 304987
118 Ga0157371_10002582 3300013102 Bacteria 17186
119 Ga0157371_10005708 3300013102 Bacteria 10433
120 Ga0157371_10026573 3300013102 Bacteria 4206
121 Ga0157371_10115385 3300013102 Bacteria 1907
122 Ga0157371_10261783 3300013102 Bacteria 1247
123 Ga0157370_10000142 3300013104 Bacteria 87393
124 Ga0157370_10002701 3300013104 Bacteria 21260
125 Ga0157370_10019363 3300013104 Bacteria 6829
126 Ga0157369_10010151 3300013105 Bacteria 10747
127 Ga0157369_10012225 3300013105 Bacteria 9747
128 Ga0157374_10606852 3300013296 Bacteria 1104
129 Ga0163162_10025666 3300013306 Bacteria 5825
130 Ga0163162_10266504 3300013306 Bacteria 1844
131 Ga0157372_10002392 3300013307 Bacteria 20313
132 Ga0157372_10012060 3300013307 Bacteria 9205
133 Ga0157372_10097925 3300013307 Bacteria 3346
134 Ga0157372_10130235 3300013307 Bacteria 2894
135 Ga0157372_10182711 3300013307 Bacteria 2428
136 Ga0163163_10027306 3300014325 Bacteria 5466
137 Ga0182008_10032881 3300014497 Bacteria 2604
138 Ga0182006_1000045 3300015261 Bacteria 197248
139 Ga0182006_1006250 3300015261 Bacteria 5551
140 Ga0183366_1003 3300015679 Bacteria 453474
141 Ga0183370_1003 3300015680 Bacteria 454044
142 Ga0183369_1005 3300015685 Bacteria 453680
143 Ga0183368_1006 3300015687 Bacteria 551576
144 Ga0163161_10000050 3300017792 Bacteria 125396
145 Ga0163161_10035907 3300017792 Bacteria 3548
146 Ga0163161_10110402 3300017792 Bacteria 2056
147 Ga0213876_10000026 3300021384 Bacteria 231892
148 Ga0213875_10000536 3300021388 Bacteria 31187
149 Ga0213875_10009199 3300021388 Bacteria 5013
150 Ga0213875_10018935 3300021388 Bacteria 3314
151 Ga0213875_10027882 3300021388 Bacteria 2686
152 Ga0213875_10112042 3300021388 Bacteria 1274
153 Ga0209760_100044 3300025207 Bacteria 111537
154 Ga0209784_100001 3300025224 Bacteria 3600592
155 Ga0209566_100001 3300025225 Bacteria 3600765
156 Ga0209674_100002 3300025226 Bacteria 3600592
157 Ga0209563_100008 3300025230 Bacteria 1554545
158 Ga0207427_100002 3300025231 Bacteria 1355321
159 Ga0209437_100046 3300025233 Bacteria 405293
160 Ga0209437_100063 3300025233 Bacteria 335477
161 Ga0209677_100004 3300025253 Bacteria 1554545
162 Ga0209129_1000008 3300025258 Bacteria 640959
163 Ga0209233_1001000 3300025261 Bacteria 12086
164 Ga0207696_1000014 3300025711 Bacteria 517939
165 Ga0207696_1000027 3300025711 Bacteria 412783
166 Ga0207696_1000066 3300025711 Bacteria 231203
167 Ga0207696_1000598 3300025711 Bacteria 27197
168 Ga0207696_1001272 3300025711 Bacteria 14110
169 Ga0207696_1003590 3300025711 Bacteria 7005
170 Ga0207696_1027228 3300025711 Bacteria 1763
171 Ga0207655_1000017 3300025728 Bacteria 544403
172 Ga0207655_1000026 3300025728 Bacteria 445528
173 Ga0207655_1000028 3300025728 Bacteria 437324
174 Ga0207655_1000056 3300025728 Bacteria 279166
175 Ga0207655_1000223 3300025728 Bacteria 96651
176 Ga0207655_1000436 3300025728 Bacteria 55864
177 Ga0207655_1001219 3300025728 Bacteria 24788
178 Ga0207655_1003013 3300025728 Bacteria 12894
179 Ga0207655_1005240 3300025728 Bacteria 8899
180 Ga0207655_1006410 3300025728 Bacteria 7801
181 Ga0207655_1021860 3300025728 Bacteria 3229
182 Ga0207655_1044688 3300025728 Bacteria 1859
183 Ga0207655_1081662 3300025728 Bacteria 1164
184 Ga0207713_1000007 3300025735 Bacteria 564979
185 Ga0207713_1000048 3300025735 Bacteria 228272
186 Ga0207713_1000057 3300025735 Bacteria 217090
187 Ga0207713_1000164 3300025735 Bacteria 98195
188 Ga0207713_1000362 3300025735 Bacteria 49304
189 Ga0207713_1000420 3300025735 Bacteria 45109
190 Ga0207713_1001415 3300025735 Bacteria 19260
191 Ga0207713_1024793 3300025735 Bacteria 2785
192 Ga0207713_1037599 3300025735 Bacteria 2062
193 Ga0207692_10007580 3300025898 Bacteria 4450
194 Ga0207710_10000007 3300025900 Bacteria 488292
195 Ga0207654_10000008 3300025911 Bacteria 375871
196 Ga0207663_10048880 3300025916 Bacteria 2620
197 Ga0207652_10026822 3300025921 Bacteria 4801
198 Ga0207709_10001680 3300025935 Bacteria 14910
199 Ga0207709_10022920 3300025935 Bacteria 3548
200 Ga0207668_10076015 3300025972 Bacteria 2416
201 Ga0207639_10016715 3300026041 Bacteria 5198
202 Ga0207678_10026907 3300026067 Bacteria 5017
203 Ga0207674_10000009 3300026116 Bacteria 202730
204 Ga0207674_10318224 3300026116 Unclassified 1505
205 Ga0207683_10048655 3300026121 Bacteria 3712
206 Ga0209281_1000058 3300027111 Bacteria 300244
207 Ga0209281_1000060 3300027111 Bacteria 295683
208 Ga0209281_1000137 3300027111 Bacteria 182134
209 Ga0209281_1000146 3300027111 Bacteria 169237
210 Ga0209281_1000260 3300027111 Bacteria 101875
211 Ga0209281_1000298 3300027111 Bacteria 90323
212 Ga0209281_1000891 3300027111 Bacteria 25418
213 Ga0209281_1001324 3300027111 Bacteria 15636
214 Ga0209281_1003504 3300027111 Bacteria 5156
215 Ga0209281_1003533 3300027111 Bacteria 5112
216 Ga0209371_1000014 3300027312 Bacteria 661118
217 Ga0209371_1000030 3300027312 Bacteria 423605
218 Ga0209371_1000053 3300027312 Bacteria 264616
219 Ga0209371_1000096 3300027312 Bacteria 160552
220 Ga0209371_1000276 3300027312 Bacteria 59687
221 Ga0209371_1000300 3300027312 Bacteria 55324
222 Ga0209371_1000435 3300027312 Bacteria 42480
223 Ga0209371_1000612 3300027312 Bacteria 31913
224 Ga0209371_1001319 3300027312 Bacteria 17337
225 Ga0209371_1001390 3300027312 Bacteria 16613
226 Ga0209371_1001468 3300027312 Bacteria 15875
227 Ga0209371_1002708 3300027312 Bacteria 9568
228 Ga0209371_1003617 3300027312 Bacteria 7375
229 Ga0209371_1003846 3300027312 Bacteria 6961
230 Ga0209371_1004348 3300027312 Bacteria 6226
231 Ga0209371_1008943 3300027312 Bacteria 3249
232 Ga0209371_1010252 3300027312 Bacteria 2898
233 Ga0268266_10000307 3300028379 Bacteria 77625
234 Ga0268266_10062117 3300028379 Bacteria 3223
235 Ga0268266_10108839 3300028379 Bacteria 2453
236 Ga0265338_10065674 3300028800 Bacteria 3145
237 Ga0268256_1000012 3300030500 Bacteria 794553
238 Ga0268256_1000021 3300030500 Bacteria 542735
239 Ga0268256_1000025 3300030500 Bacteria 484317
240 Ga0268256_1000053 3300030500 Bacteria 264616
241 Ga0268256_1000086 3300030500 Bacteria 160533
242 Ga0268256_1000230 3300030500 Bacteria 59687
243 Ga0268256_1001193 3300030500 Bacteria 16613
244 Ga0268256_1001251 3300030500 Bacteria 15875
245 Ga0268256_1001533 3300030500 Bacteria 13631
246 Ga0268256_1002281 3300030500 Bacteria 9957
247 Ga0268256_1002409 3300030500 Bacteria 9568
248 Ga0268256_1003295 3300030500 Bacteria 7410
249 Ga0268256_1004026 3300030500 Bacteria 6315
250 Ga0268256_1010421 3300030500 Bacteria 3015
251 Ga0268256_1010999 3300030500 Bacteria 2898
252 Ga0265327_10000005 3300031251 Bacteria 790146
253 Ga0316596_1020950 3300033541 Bacteria 1664
254 Ga0373923_0089620 3300035111 Bacteria 1344
255 Ga0373936_0090420 3300035113 Bacteria 1283
256 Ga0373954_0018028 3300035118 Bacteria 3175
257 Ga0373956_0013301 3300035119 Bacteria 3423
258 Ga0373943_0128516 3300035170 Bacteria 1354
259 Ga0373935_0027822 3300035692 Bacteria 3494
260 Ga0373927_0092500 3300035695 Bacteria 1965
261 Ga0373927_0288074 3300035695 Bacteria 1081
262 Ga0373933_0084219 3300035724 Bacteria 1953
263 Ga0373947_0026694 3300035725 Bacteria 3377
264 Ga0373937_0002383 3300036401 Bacteria 15644
265 Ga0373937_0028846 3300036401 Bacteria 5025
266 Ga0373937_0068801 3300036401 Bacteria 3264
267 Ga0373937_0115411 3300036401 Bacteria 2500
268 Ga0373925_0113983 3300037068 Bacteria 2091
269 Ga0395900_0002398 3300037418 Bacteria 20667
270 Ga0395898_0001825 3300037466 Bacteria 27453
271 Ga0395905_0451877 3300037471 Bacteria 1183
272 Ga0436364_0198397 3300037853 Bacteria 19149
273 Ga0436364_0208582 3300037853 Bacteria 2851
274 Ga0436364_0405011 3300037853 Bacteria 22368
275 Ga0436364_0667984 3300037853 Bacteria 6995
276 Ga0436364_0741160 3300037853 Bacteria 51330
277 Ga0436364_1288521 3300037853 Bacteria 2769
278 Ga0436364_1531217 3300037853 Bacteria 3680
279 Ga0395901_0017766 3300038443 Bacteria 7261
280 Ga0400484_04096 3300038725 Bacteria 1457
281 Ga0400484_06151 3300038725 Bacteria 1500
282 Ga0400490_29135 3300038726 Bacteria 2741
283 Ga0400490_40217 3300038726 Bacteria 16781
284 Ga0400490_43619 3300038726 Bacteria 2765
285 Ga0400491_03645 3300038727 Bacteria 6512
286 Ga0400491_29171 3300038727 Bacteria 10447
287 Ga0400485_06546 3300038735 Bacteria 2008
288 Ga0400485_09580 3300038735 Bacteria 4176
289 Ga0400488_00944 3300038741 Bacteria 15786
290 Ga0400488_11837 3300038741 Bacteria 2681
291 Ga0400488_18901 3300038741 Bacteria 4289
292 Ga0400486_07742 3300038742 Bacteria 5387
293 Ga0400486_19440 3300038742 Bacteria 1705
294 Ga0400486_30702 3300038742 Bacteria 3204
295 Ga0400483_023305 3300039062 Bacteria 8932
296 Ga0400483_076810 3300039062 Bacteria 4755
297 Ga0400483_121902 3300039062 Bacteria 14709
298 Ga0400483_160274 3300039062 Bacteria 3040
299 Ga0400483_190732 3300039062 Bacteria 13601
300 Ga0400483_225534 3300039062 Bacteria 6239
301 Ga0400483_248273 3300039062 Bacteria 9853
302 Ga0400487_08845 3300039110 Bacteria 4220
303 Ga0400487_13066 3300039110 Bacteria 4236
304 Ga0400487_22077 3300039110 Bacteria 4700
305 Ga0400487_27647 3300039110 Bacteria 3281
306 Ga0400487_32270 3300039110 Bacteria 1190
307 Ga0400487_46184 3300039110 Bacteria 4068
308 Ga0436365_0084998 3300039437 Bacteria 507888
309 Ga0436365_0372100 3300039437 Bacteria 1569
310 Ga0436360_0305121 3300039438 Bacteria 3224
311 Ga0436360_0447382 3300039438 Bacteria 3801
312 Ga0436361_0167940 3300039447 Bacteria 3541
313 Ga0436363_0682075 3300039450 Bacteria 1527
314 Ga0436363_1106425 3300039450 Bacteria 1830
315 Ga0439438_000003 3300041405 Bacteria 464587
316 Ga0439438_003055 3300041405 Bacteria 6881
317 Ga0439438_005093 3300041405 Bacteria 4898
318 Ga0439447_002288 3300041407 Bacteria 7030
319 Ga0439466_0000107 3300041411 Bacteria 31816
320 Ga0451849_0294755 3300041505 Bacteria 1241
321 Ga0451853_1620505 3300041512 Bacteria 1610
322 Ga0439432_013400 3300042006 Bacteria 2789
323 Ga0439432_015476 3300042006 Bacteria 2574
324 Ga0439432_018585 3300042006 Bacteria 2321
325 Ga0439432_018713 3300042006 Bacteria 2312
326 Ga0439452_000004 3300042010 Bacteria 764268
327 Ga0439452_000005 3300042010 Bacteria 646919
328 Ga0439452_000007 3300042010 Bacteria 613625
329 Ga0439452_000074 3300042010 Bacteria 88357
330 Ga0439452_003675 3300042010 Bacteria 5314
331 Ga0439452_004058 3300042010 Bacteria 4977
332 Ga0439456_021223 3300042013 Bacteria 1373
333 Ga0439463_005527 3300042016 Bacteria 3141
334 Ga0450907_000034 3300042146 Bacteria 61803
335 Ga0439464_0003743 3300042439 Bacteria 3860
336 Ga0439464_0003850 3300042439 Bacteria 3817
337 Ga0439464_0009420 3300042439 Bacteria 2571
338 Ga0466981_0000042 3300044669 Bacteria 40532
339 Ga0451576_0001725 3300045051 Bacteria 36003
340 Ga0451576_0159440 3300045051 Bacteria 2354
341 Ga0451576_0467730 3300045051 Bacteria 1324
342 Ga0466958_0137584 3300045836 Bacteria 1537
343 Ga0495627_000266 3300046453 Bacteria 53407
344 Ga0495627_051127 3300046453 Bacteria 1243
345 Ga0495591_000047 3300046458 Bacteria 140371
346 Ga0495591_007463 3300046458 Bacteria 4644
347 Ga0495591_013879 3300046458 Bacteria 2923
348 Ga0495638_0076348 3300046460 Bacteria 2041
349 Ga0495651_0023002 3300046462 Bacteria 4847
350 Ga0495650_0000004 3300046471 Bacteria 779487
351 Ga0495650_0000028 3300046471 Bacteria 473012
352 Ga0495650_0000377 3300046471 Bacteria 77543
353 Ga0495605_0143931 3300046474 Bacteria 1067
354 Ga0495664_0021889 3300046477 Bacteria 3696
355 Ga0495584_0021408 3300046491 Bacteria 3285
356 Ga0495585_0011226 3300046492 Bacteria 5307
357 Ga0495596_0069970 3300046500 Bacteria 1363
358 Ga0495607_0022330 3300046501 Bacteria 3976
359 Ga0495606_0000954 3300046507 Bacteria 42555
360 Ga0495608_0028125 3300046511 Bacteria 3822
361 Ga0495643_0024885 3300046522 Bacteria 3392
362 Ga0495643_0164251 3300046522 Bacteria 1090
363 Ga0495648_0006699 3300046524 Bacteria 9327
364 Ga0495648_0010621 3300046524 Bacteria 6997
365 Ga0495652_0071513 3300046529 Bacteria 2895
366 Ga0495654_0000546 3300046530 Bacteria 30342
367 Ga0495654_0001218 3300046530 Bacteria 18240
368 Ga0495587_0089351 3300046536 Bacteria 1781
369 Ga0495645_0013221 3300046543 Bacteria 5833
370 Ga0495667_0011711 3300046559 Bacteria 5938
371 Ga0495635_0069175 3300046663 Bacteria 2421
372 Ga0495657_0060803 3300046675 Bacteria 2501
373 Ga0495671_0002990 3300046692 Bacteria 10507
374 Ga0495649_0012306 3300046694 Bacteria 4985
375 Ga0495649_0030599 3300046694 Bacteria 2973
376 Ga0495649_0031182 3300046694 Bacteria 2940
377 Ga0495589_0000028 3300046794 Bacteria 179523
378 Ga0495660_0000013 3300046810 Bacteria 350283
379 Ga0495660_0000516 3300046810 Bacteria 31688
380 Ga0495660_0008020 3300046810 Bacteria 6202
381 Ga0495674_0008309 3300047319 Bacteria 9896
382 Ga0495672_0000029 3300047320 Bacteria 305231
383 Ga0495672_0000054 3300047320 Bacteria 230777
384 Ga0495683_0001353 3300047323 Bacteria 16343
385 Ga0495675_0002915 3300047444 Bacteria 10276
386 Ga0495679_000606 3300047446 Bacteria 24321
387 Ga0495673_0000047 3300047469 Bacteria 266522
388 Ga0495673_0000092 3300047469 Bacteria 187963
389 Ga0495684_0023050 3300047471 Bacteria 4789
390 Ga0495602_0002111 3300048088 Bacteria 20026
391 Ga0495602_0062218 3300048088 Bacteria 3239
392 Ga0496100_0053559 3300048903 Bacteria 2628
393 Ga0496102_0014967 3300048905 Bacteria 6751
394 Ga0496102_0145276 3300048905 Bacteria 2226
395 Ga0496103_0035083 3300048906 Bacteria 3070
396 Ga0496104_0001075 3300048907 Bacteria 23321
397 Ga0496104_0011029 3300048907 Bacteria 8084
398 Ga0496104_0155030 3300048907 Bacteria 2199
399 Ga0496105_0002003 3300048908 Bacteria 14699
400 Ga0496105_0067341 3300048908 Bacteria 2956
401 Ga0496106_0059225 3300048909 Bacteria 2901
402 Ga0496108_0156293 3300048911 Bacteria 1970
403 Ga0496116_0000009 3300048919 Bacteria 716119
404 Ga0496116_0000016 3300048919 Bacteria 555146
405 Ga0496116_0000214 3300048919 Bacteria 109085
406 Ga0496116_0000368 3300048919 Bacteria 69066
407 Ga0496116_0015068 3300048919 Bacteria 6129
408 Ga0496116_0020768 3300048919 Bacteria 4974
409 Ga0496116_0025582 3300048919 Bacteria 4337
410 Ga0496116_0026248 3300048919 Bacteria 4264
411 Ga0496116_0030687 3300048919 Bacteria 3857
412 Ga0496116_0030916 3300048919 Bacteria 3841
413 Ga0496117_0000350 3300048920 Bacteria 81439
414 Ga0496117_0000753 3300048920 Bacteria 51060
415 Ga0496117_0000772 3300048920 Bacteria 50588
416 Ga0496117_0003500 3300048920 Bacteria 18205
417 Ga0496117_0007185 3300048920 Bacteria 10985
418 Ga0496117_0019017 3300048920 Bacteria 5660
419 Ga0496117_0021006 3300048920 Bacteria 5304
420 Ga0496117_0021419 3300048920 Bacteria 5229
421 Ga0496117_0029129 3300048920 Bacteria 4262
422 Ga0496117_0056339 3300048920 Bacteria 2738
423 Ga0496117_0187593 3300048920 Bacteria 1181
424 Ga0496118_0000821 3300048921 Bacteria 49444
425 Ga0496118_0001525 3300048921 Bacteria 34487
426 Ga0496118_0001665 3300048921 Bacteria 32618
427 Ga0496118_0002391 3300048921 Bacteria 25363
428 Ga0496118_0003425 3300048921 Bacteria 20012
429 Ga0496118_0017152 3300048921 Bacteria 6606
430 Ga0496118_0035218 3300048921 Bacteria 4070
431 Ga0496118_0041118 3300048921 Bacteria 3664
432 Ga0496118_0082275 3300048921 Bacteria 2256
433 Ga0496118_0218761 3300048921 Bacteria 1110
434 Ga0496119_0000134 3300048922 Bacteria 104139
435 Ga0496119_0000171 3300048922 Bacteria 91583
436 Ga0496119_0000226 3300048922 Bacteria 78974
437 Ga0496119_0000516 3300048922 Bacteria 52621
438 Ga0496119_0002114 3300048922 Bacteria 22380
439 Ga0496119_0004720 3300048922 Bacteria 13398
440 Ga0496119_0005631 3300048922 Bacteria 11907
441 Ga0496119_0007240 3300048922 Bacteria 10041
442 Ga0496119_0008294 3300048922 Bacteria 9161
443 Ga0496119_0009817 3300048922 Bacteria 8139
444 Ga0496119_0009873 3300048922 Bacteria 8108
445 Ga0496119_0010529 3300048922 Bacteria 7766
446 Ga0496119_0101112 3300048922 Bacteria 1618
447 Ga0496119_0136414 3300048922 Bacteria 1330
448 Ga0496120_0000017 3300048923 Bacteria 269222
449 Ga0496120_0000032 3300048923 Bacteria 220255
450 Ga0496120_0000330 3300048923 Bacteria 78975
451 Ga0496120_0002452 3300048923 Bacteria 18740
452 Ga0496120_0002661 3300048923 Bacteria 17615
453 Ga0496120_0002723 3300048923 Bacteria 17271
454 Ga0496120_0003940 3300048923 Bacteria 12942
455 Ga0496120_0006300 3300048923 Bacteria 9143
456 Ga0496120_0010281 3300048923 Bacteria 6546
457 Ga0496120_0010797 3300048923 Bacteria 6327
458 Ga0496120_0044727 3300048923 Bacteria 2570
459 Ga0496120_0054607 3300048923 Bacteria 2263
460 Ga0496120_0121416 3300048923 Bacteria 1350
461 Ga0496121_0000336 3300048924 Bacteria 97792
462 Ga0496121_0018475 3300048924 Bacteria 7028
463 Ga0496121_0023839 3300048924 Bacteria 5873
464 Ga0496121_0030318 3300048924 Bacteria 4968
465 Ga0496121_0093404 3300048924 Bacteria 2342
466 Ga0496121_0366545 3300048924 Bacteria 954
467 Ga0496122_0000419 3300048925 Bacteria 89990
468 Ga0496122_0000481 3300048925 Bacteria 82890
469 Ga0496122_0006694 3300048925 Bacteria 13120
470 Ga0496122_0018182 3300048925 Bacteria 6509
471 Ga0496122_0020442 3300048925 Bacteria 5981
472 Ga0496122_0039415 3300048925 Bacteria 3767
473 Ga0496122_0043391 3300048925 Bacteria 3524
474 Ga0496122_0155714 3300048925 Bacteria 1402
475 Ga0496122_0250544 3300048925 Bacteria 990
476 Ga0496122_0250545 3300048925 Bacteria 990
477 Ga0496122_0261333 3300048925 Bacteria 960
478 Ga0496122_0268072 3300048925 Bacteria 942
479 Ga0496123_0000385 3300048926 Bacteria 82890
480 Ga0496123_0000467 3300048926 Bacteria 70890
481 Ga0496123_0000746 3300048926 Bacteria 52614
482 Ga0496123_0001433 3300048926 Bacteria 33269
483 Ga0496123_0001855 3300048926 Bacteria 27728
484 Ga0496123_0015833 3300048926 Bacteria 6159
485 Ga0496123_0027778 3300048926 Bacteria 4206
486 Ga0496123_0193575 3300048926 Bacteria 1049
487 Ga0496123_0215389 3300048926 Bacteria 972
488 Ga0496123_0219285 3300048926 Bacteria 960
489 Ga0496124_0000096 3300048927 Bacteria 183847
490 Ga0496124_0000142 3300048927 Bacteria 147311
491 Ga0496124_0000305 3300048927 Bacteria 90763
492 Ga0496124_0002318 3300048927 Bacteria 25111
493 Ga0496124_0009520 3300048927 Bacteria 9993
494 Ga0496124_0019237 3300048927 Bacteria 6364
495 Ga0496124_0022697 3300048927 Bacteria 5746
496 Ga0496124_0035850 3300048927 Bacteria 4334
497 Ga0496124_0052610 3300048927 Bacteria 3458
498 Ga0496124_0089566 3300048927 Bacteria 2512
499 Ga0496124_0094226 3300048927 Bacteria 2435
500 Ga0496124_0195571 3300048927 Bacteria 1543
501 Ga0496124_0219650 3300048927 Bacteria 1430
502 Ga0496125_0000943 3300048928 Bacteria 45676
503 Ga0496125_0002656 3300048928 Bacteria 22857
504 Ga0496125_0007084 3300048928 Bacteria 11972
505 Ga0496125_0016546 3300048928 Bacteria 7075
506 Ga0496125_0018353 3300048928 Bacteria 6647
507 Ga0496125_0027825 3300048928 Bacteria 5115
508 Ga0496126_0002156 3300048929 Bacteria 27382
509 Ga0496126_0002622 3300048929 Bacteria 23930
510 Ga0496126_0005699 3300048929 Bacteria 14110
511 Ga0496126_0055459 3300048929 Bacteria 3585
512 Ga0496126_0117545 3300048929 Bacteria 2309
513 Ga0496126_0496716 3300048929 Bacteria 975
514 Ga0495678_001668 3300049459 Bacteria 16877
515 Ga0495682_0000003 3300049460 Bacteria 515787
516 Ga0495682_0049768 3300049460 Bacteria 1527
517 Ga0501031_0003830 3300049568 Bacteria 9674
518 Ga0501031_0025891 3300049568 Bacteria 3827
519 Ga0501032_0001253 3300049569 Bacteria 20381
520 Ga0501032_0219066 3300049569 Bacteria 1239
521 Ga0501033_0094538 3300049570 Bacteria 2185
522 Ga0501034_0004241 3300049571 Bacteria 15996
523 Ga0501034_0090455 3300049571 Bacteria 3058
524 Ga0501034_0420918 3300049571 Bacteria 1257
525 Ga0501036_0002474 3300049572 Bacteria 14483
526 Ga0501036_0014883 3300049572 Bacteria 6490
527 Ga0501036_0300442 3300049572 Bacteria 1343
528 Ga0501037_0001982 3300049573 Bacteria 14825
529 Ga0501037_0170775 3300049573 Bacteria 1546
530 Ga0501037_0402482 3300049573 Bacteria 939
531 Ga0501038_0015281 3300049574 Bacteria 6979
532 Ga0501038_0129811 3300049574 Bacteria 2070
533 Ga0501039_0002264 3300049575 Bacteria 14294
534 Ga0501039_0007563 3300049575 Bacteria 8298
535 Ga0501039_0021728 3300049575 Bacteria 4924
536 Ga0501039_0254074 3300049575 Bacteria 1382
537 Ga0501040_0017996 3300049576 Bacteria 4691
538 Ga0501040_0126011 3300049576 Bacteria 1799
539 Ga0501040_0130161 3300049576 Bacteria 1769
540 Ga0501041_0022287 3300049577 Bacteria 3791
541 Ga0501041_0068167 3300049577 Bacteria 2181
542 Ga0501042_0002861 3300049578 Bacteria 10698
543 Ga0501042_0083209 3300049578 Bacteria 2294
544 Ga0501043_0002743 3300049579 Bacteria 14727
545 Ga0501043_0052137 3300049579 Bacteria 3214
546 Ga0501046_0003540 3300049580 Bacteria 14303
547 Ga0501046_0052412 3300049580 Bacteria 3215
548 Ga0501046_0352322 3300049580 Bacteria 1069
549 Ga0501047_0003226 3300049581 Bacteria 15461
550 Ga0501047_0260683 3300049581 Bacteria 1581
551 Ga0501048_0002463 3300049582 Bacteria 14124
552 Ga0501048_0026738 3300049582 Bacteria 4199
553 Ga0501067_0048692 3300049583 Bacteria 2350
554 Ga0501068_0036500 3300049584 Bacteria 2939
555 Ga0501069_0060197 3300049585 Bacteria 2120
556 Ga0501070_0101171 3300049586 Bacteria 2384
557 Ga0501070_0176398 3300049586 Bacteria 1759
558 Ga0501071_0080113 3300049587 Bacteria 2387
559 Ga0501071_0198523 3300049587 Bacteria 1506
560 Ga0501072_0013382 3300049588 Bacteria 6279
561 Ga0501072_0326222 3300049588 Bacteria 1220
562 Ga0501073_0005133 3300049589 Bacteria 9827
563 Ga0501075_0030049 3300049591 Bacteria 4021
564 Ga0501075_0244798 3300049591 Bacteria 1367
565 Ga0501076_0006976 3300049592 Bacteria 8212
566 Ga0501077_0033802 3300049593 Bacteria 3255
567 Ga0501079_0010056 3300049741 Bacteria 7183
568 Ga0501079_0291528 3300049741 Bacteria 1276
569 Ga0501080_0004260 3300049742 Bacteria 12696
570 Ga0501080_0035786 3300049742 Bacteria 4635
571 Ga0501080_0507020 3300049742 Bacteria 1078
572 Ga0501035_0003236 3300049822 Bacteria 15603
573 Ga0501035_0249113 3300049822 Bacteria 1509
574 Ga0501044_0000112 3300049823 Bacteria 98748
575 Ga0501044_0034164 3300049823 Bacteria 5336
576 Ga0501044_0079580 3300049823 Bacteria 3321
577 Ga0501045_0001940 3300049824 Bacteria 13976
578 Ga0501045_0091384 3300049824 Bacteria 2250
579 nmdc:mga00v17_59361_c1 3300050491 Bacteria 2347
580 nmdc:mga0k408_79317_c1 3300050493 Bacteria 1921
581 nmdc:mga07m45_121983_c1 3300050496 Bacteria 1505
582 Ga0495601_0000760 3300053077 Bacteria 17417
583 Ga0495612_0001008 3300053078 Bacteria 11600
584 Ga0495619_0014692 3300053085 Bacteria 4946
585 Ga0495619_0231098 3300053085 Bacteria 1281
586 Ga0500621_000006 3300053126 Bacteria 245480
587 Ga0501084_0030038 3300054114 Bacteria 4546
588 Ga0501082_0004715 3300060353 Bacteria 11890
589 Ga0501082_0009707 3300060353 Bacteria 8288
590 Ga0501082_0373801 3300060353 Unclassified 1243
591 Ga0530510_0006320 3300061734 Bacteria 8241

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300039450 Ga0436363_1106425 Ga0436363_1106425_645_1370 238
2 3300049573 Ga0501037_0402482 Ga0501037_0402482_187_924 245
3 3300021388 Ga0213875_10018935 Ga0213875_100189352 253
4 3300037853 Ga0436364_0667984 Ga0436364_0667984_3448_4218 253
5 3300053085 Ga0495619_0231098 Ga0495619_0231098_21_806 258
6 3300038735 Ga0400485_06546 Ga0400485_06546_1147_1926 259
7 3300009551 Ga0105238_10547892 Ga0105238_105478922 262
8 3300038725 Ga0400484_06151 Ga0400484_06151_437_1288 263
9 3300039062 Ga0400483_121902 Ga0400483_121902_1420_2271 263
10 3300039062 Ga0400483_225534 Ga0400483_225534_2503_3354 263
11 3300039450 Ga0436363_0682075 Ga0436363_0682075_355_1155 263
12 3300005289 Ga0065704_10083800 Ga0065704_100838001 265
13 3300009092 Ga0105250_10091952 Ga0105250_100919522 265
14 3300041405 Ga0439438_005093 Ga0439438_005093_1636_2493 265
15 3300048903 Ga0496100_0053559 Ga0496100_0053559_141_998 265
16 3300048927 Ga0496124_0195571 Ga0496124_0195571_676_1533 265
17 3300033541 Ga0316596_1020950 Ga0316596_10209502 267
18 3300038726 Ga0400490_43619 Ga0400490_43619_506_1360 269
19 3300039062 Ga0400483_160274 Ga0400483_160274_153_1007 269
20 3300038742 Ga0400486_19440 Ga0400486_19440_788_1642 270
21 3300049742 Ga0501080_0507020 Ga0501080_0507020_140_1009 272
22 3300038726 Ga0400490_40217 Ga0400490_40217_11370_12212 273
23 iso_pu_bacteria 2508501050 2508730646 274
24 iso_pu_bacteria 2508501114 2509074515 274
25 3300039062 Ga0400483_190732 Ga0400483_190732_2951_3802 277
26 3300047469 Ga0495673_0000047 Ga0495673_0000047_189434_190303 278
27 3300005539 Ga0068853_100185998 Ga0068853_1001859982 279
28 3300009545 Ga0105237_10446636 Ga0105237_104466362 279
29 3300026041 Ga0207639_10016715 Ga0207639_100167156 279
30 3300027312 Ga0209371_1002708 Ga0209371_10027082 279
31 3300030500 Ga0268256_1002409 Ga0268256_10024092 279
32 3300048911 Ga0496108_0156293 Ga0496108_0156293_644_1492 279
33 iso_pu_bacteria 8006964411 8006969195 279
34 3300005981 Ga0081538_10001815 Ga0081538_100018155 280
35 3300005981 Ga0081538_10040497 Ga0081538_100404972 280
36 3300009993 Ga0105028_102434 Ga0105028_1024342 280
37 3300049568 Ga0501031_0003830 Ga0501031_0003830_8220_9071 280
38 3300049568 Ga0501031_0025891 Ga0501031_0025891_410_1252 280
39 3300049569 Ga0501032_0001253 Ga0501032_0001253_12849_13700 280
40 3300049569 Ga0501032_0219066 Ga0501032_0219066_124_966 280
41 3300049570 Ga0501033_0094538 Ga0501033_0094538_731_1582 280
42 3300049571 Ga0501034_0004241 Ga0501034_0004241_13716_14567 280
43 3300049571 Ga0501034_0420918 Ga0501034_0420918_234_1109 280
44 3300049572 Ga0501036_0002474 Ga0501036_0002474_12849_13700 280
45 3300049572 Ga0501036_0014883 Ga0501036_0014883_2906_3748 280
46 3300049572 Ga0501036_0300442 Ga0501036_0300442_378_1220 280
47 3300049573 Ga0501037_0001982 Ga0501037_0001982_1053_1904 280
48 3300049574 Ga0501038_0015281 Ga0501038_0015281_1211_2053 280
49 3300049574 Ga0501038_0129811 Ga0501038_0129811_361_1212 280
50 3300049575 Ga0501039_0002264 Ga0501039_0002264_595_1446 280
51 3300049575 Ga0501039_0007563 Ga0501039_0007563_4829_5671 280
52 3300049575 Ga0501039_0254074 Ga0501039_0254074_34_876 280
53 3300049576 Ga0501040_0017996 Ga0501040_0017996_2696_3538 280
54 3300049576 Ga0501040_0126011 Ga0501040_0126011_646_1497 280
55 3300049577 Ga0501041_0022287 Ga0501041_0022287_1024_1866 280
56 3300049578 Ga0501042_0002861 Ga0501042_0002861_5013_5855 280
57 3300049579 Ga0501043_0002743 Ga0501043_0002743_12849_13700 280
58 3300049579 Ga0501043_0052137 Ga0501043_0052137_1362_2204 280
59 3300049580 Ga0501046_0003540 Ga0501046_0003540_12849_13700 280
60 3300049580 Ga0501046_0052412 Ga0501046_0052412_1407_2249 280
61 3300049581 Ga0501047_0003226 Ga0501047_0003226_1762_2613 280
62 3300049582 Ga0501048_0002463 Ga0501048_0002463_12872_13723 280
63 3300049582 Ga0501048_0026738 Ga0501048_0026738_2394_3236 280
64 3300049583 Ga0501067_0048692 Ga0501067_0048692_186_1037 280
65 3300049584 Ga0501068_0036500 Ga0501068_0036500_959_1801 280
66 3300049585 Ga0501069_0060197 Ga0501069_0060197_292_1134 280
67 3300049586 Ga0501070_0101171 Ga0501070_0101171_1126_1968 280
68 3300049586 Ga0501070_0176398 Ga0501070_0176398_650_1501 280
69 3300049587 Ga0501071_0080113 Ga0501071_0080113_409_1251 280
70 3300049588 Ga0501072_0013382 Ga0501072_0013382_3740_4582 280
71 3300049589 Ga0501073_0005133 Ga0501073_0005133_7899_8750 280
72 3300049591 Ga0501075_0030049 Ga0501075_0030049_2068_2910 280
73 3300049591 Ga0501075_0244798 Ga0501075_0244798_47_889 280
74 3300049592 Ga0501076_0006976 Ga0501076_0006976_2623_3465 280
75 3300049593 Ga0501077_0033802 Ga0501077_0033802_158_1000 280
76 3300049741 Ga0501079_0010056 Ga0501079_0010056_953_1795 280
77 3300049742 Ga0501080_0004260 Ga0501080_0004260_1688_2539 280
78 3300049742 Ga0501080_0035786 Ga0501080_0035786_2635_3477 280
79 3300049822 Ga0501035_0003236 Ga0501035_0003236_1359_2210 280
80 3300049823 Ga0501044_0034164 Ga0501044_0034164_604_1455 280
81 3300049824 Ga0501045_0001940 Ga0501045_0001940_7692_8534 280
82 3300049824 Ga0501045_0091384 Ga0501045_0091384_313_1164 280
83 3300054114 Ga0501084_0030038 Ga0501084_0030038_1010_1852 280
84 3300060353 Ga0501082_0004715 Ga0501082_0004715_7960_8802 280
85 3300060353 Ga0501082_0373801 Ga0501082_0373801_41_892 280
86 3300061734 Ga0530510_0006320 Ga0530510_0006320_5979_6821 280
87 iso_pu_bacteria 2522572158 2523103318 280
88 iso_pu_bacteria 2883577096 2883580731 280
89 iso_pu_bacteria 2939602548 2939605254 280
90 iso_pu_bacteria 2847085930 2847088992 281
91 iso_pu_bacteria 2852103415 2852106270 281
92 iso_pu_bacteria 2908669403 2908673245 281
93 iso_pu_bacteria 2939607340 2939609375 281
94 iso_pu_bacteria 3000376612 3000380436 281
95 iso_pu_bacteria 8055097453 8055100577 281
96 3300013100 Ga0157373_10078180 Ga0157373_100781802 282
97 3300038725 Ga0400484_04096 Ga0400484_04096_563_1411 282
98 3300038726 Ga0400490_29135 Ga0400490_29135_637_1485 282
99 3300038727 Ga0400491_03645 Ga0400491_03645_5231_6079 282
100 3300038727 Ga0400491_29171 Ga0400491_29171_7096_7944 282
101 3300038741 Ga0400488_00944 Ga0400488_00944_12740_13588 282
102 3300038741 Ga0400488_11837 Ga0400488_11837_706_1554 282
103 3300038742 Ga0400486_30702 Ga0400486_30702_2067_2915 282
104 3300039110 Ga0400487_27647 Ga0400487_27647_1875_2723 282
105 3300039110 Ga0400487_32270 Ga0400487_32270_286_1134 282
106 3300039110 Ga0400487_46184 Ga0400487_46184_554_1402 282
107 3300041405 Ga0439438_000003 Ga0439438_000003_72625_73473 282
108 3300041407 Ga0439447_002288 Ga0439447_002288_541_1389 282
109 3300042006 Ga0439432_018713 Ga0439432_018713_282_1130 282
110 3300060353 Ga0501082_0009707 Ga0501082_0009707_2264_3151 282
111 iso_pu_bacteria 2547132181 2547696653 282
112 iso_pu_bacteria 2561511199 2562466014 282
113 iso_pu_bacteria 2599185169 2599412235 282
114 iso_pu_bacteria 2600255254 2601525424 282
115 iso_pu_bacteria 2600255255 2601530603 282
116 iso_pu_bacteria 2600255256 2601534063 282
117 iso_pu_bacteria 2600255257 2601540231 282
118 iso_pu_bacteria 2600255280 2601617546 282
119 iso_pu_bacteria 2600255281 2601622579 282
120 iso_pu_bacteria 2600255287 2601644512 282
121 iso_pu_bacteria 2600255288 2601650854 282
122 iso_pu_bacteria 2600255289 2601655904 282
123 iso_pu_bacteria 2600255290 2601660816 282
124 iso_pu_bacteria 2600255291 2601664677 282
125 iso_pu_bacteria 2600255298 2601697455 282
126 iso_pu_bacteria 2600255299 2601702843 282
127 iso_pu_bacteria 2600255300 2601708669 282
128 iso_pu_bacteria 2600255301 2601713528 282
129 iso_pu_bacteria 2600255302 2601718753 282
130 iso_pu_bacteria 2600255303 2601722498 282
131 iso_pu_bacteria 2600255304 2601728766 282
132 iso_pu_bacteria 2600255305 2601733689 282
133 iso_pu_bacteria 2600255306 2601738664 282
134 iso_pu_bacteria 2600255307 2601743004 282
135 iso_pu_bacteria 2600255309 2601753797 282
136 iso_pu_bacteria 2600255310 2601758786 282
137 iso_pu_bacteria 2600255311 2601762863 282
138 iso_pu_bacteria 2600255392 2602020672 282
139 iso_pu_bacteria 2602042046 2603640716 282
140 iso_pu_bacteria 2602042052 2603663006 282
141 iso_pu_bacteria 2602042053 2603667903 282
142 iso_pu_bacteria 2602042103 2603841222 282
143 iso_pu_bacteria 2602042104 2603846295 282
144 iso_pu_bacteria 2602042105 2603851369 282
145 iso_pu_bacteria 2602042106 2603856437 282
146 iso_pu_bacteria 2602042109 2603868663 282
147 iso_pu_bacteria 2602042110 2603874017 282
148 iso_pu_bacteria 2602042111 2603878712 282
149 iso_pu_bacteria 2603880178 2606051196 282
150 iso_pu_bacteria 2603880184 2606072166 282
151 iso_pu_bacteria 2603880202 2606148872 282
152 iso_pu_bacteria 2603880211 2606179088 282
153 iso_pu_bacteria 2636415599 2637227045 282
154 iso_pu_bacteria 2675903046 2676409467 282
155 iso_pu_bacteria 2775507074 2777021443 282
156 iso_pu_bacteria 2791355010 2792313429 282
157 iso_pu_bacteria 2791355275 2793406802 282
158 iso_pu_bacteria 2811995292 2813730522 282
159 iso_pu_bacteria 2814123068 2814698130 282
160 iso_pu_bacteria 2842775625 2842775953 282
161 iso_pu_bacteria 2894772417 2894773023 282
162 iso_pu_bacteria 2904513164 2904516234 282
163 iso_pu_bacteria 2909399089 2909401860 282
164 iso_pu_bacteria 2929199973 2929203889 282
165 iso_pu_bacteria 2935625433 2935628019 282
166 iso_pu_bacteria 2939617950 2939619562 282
167 iso_pu_bacteria 2969079654 2969084056 282
168 iso_pu_bacteria 2974435778 2974437046 282
169 iso_pu_bacteria 2984559226 2984561133 282
170 iso_pu_bacteria 2984595703 2984599206 282
171 iso_pu_bacteria 641228493 641336271 282
172 iso_pu_bacteria 643348555 643390068 282
173 iso_pu_bacteria 8019504834 8019506917 282
174 iso_pu_bacteria 8055909800 8055912907 282
175 3300006042 Ga0075368_10137208 Ga0075368_101372081 283
176 3300006353 Ga0075370_10035566 Ga0075370_100355663 283
177 3300010375 Ga0105239_10391296 Ga0105239_103912962 283
178 3300014497 Ga0182008_10032881 Ga0182008_100328812 283
179 3300021388 Ga0213875_10027882 Ga0213875_100278821 283
180 3300021388 Ga0213875_10112042 Ga0213875_101120421 283
181 3300028800 Ga0265338_10065674 Ga0265338_100656742 283
182 3300035692 Ga0373935_0027822 Ga0373935_0027822_2535_3395 283
183 3300035695 Ga0373927_0092500 Ga0373927_0092500_570_1430 283
184 3300036401 Ga0373937_0115411 Ga0373937_0115411_1313_2173 283
185 3300037853 Ga0436364_0208582 Ga0436364_0208582_288_1148 283
186 3300037853 Ga0436364_1531217 Ga0436364_1531217_1812_2672 283
187 3300038735 Ga0400485_09580 Ga0400485_09580_1261_2112 283
188 3300038741 Ga0400488_18901 Ga0400488_18901_2184_3035 283
189 3300038742 Ga0400486_07742 Ga0400486_07742_3194_4045 283
190 3300039062 Ga0400483_023305 Ga0400483_023305_1791_2642 283
191 3300039062 Ga0400483_076810 Ga0400483_076810_2540_3391 283
192 3300039062 Ga0400483_248273 Ga0400483_248273_2134_2985 283
193 3300039110 Ga0400487_08845 Ga0400487_08845_2959_3810 283
194 3300039110 Ga0400487_13066 Ga0400487_13066_345_1196 283
195 3300039110 Ga0400487_22077 Ga0400487_22077_2076_2927 283
196 3300042010 Ga0439452_003675 Ga0439452_003675_1791_2642 283
197 3300046462 Ga0495651_0023002 Ga0495651_0023002_2807_3667 283
198 3300050496 nmdc:mga07m45_121983_c1 nmdc:mga07m45_121983_c1_154_1068 283
199 iso_pu_bacteria 2508501071 2508854086 283
200 iso_pu_bacteria 2554235234 2555261874 283
201 iso_pu_bacteria 2599185299 2599928247 283
202 iso_pu_bacteria 2608642108 2608670415 283
203 iso_pu_bacteria 2648501693 2650900096 283
204 iso_pu_bacteria 2684622997 2686354335 283
205 iso_pu_bacteria 2706794495 2707100021 283
206 iso_pu_bacteria 2772190666 2772440740 283
207 iso_pu_bacteria 2806310673 2807178725 283
208 iso_pu_bacteria 2808606414 2809124376 283
209 iso_pu_bacteria 2844528606 2844532490 283
210 iso_pu_bacteria 2846540461 2846541308 283
211 iso_pu_bacteria 2847797336 2847801185 283
212 iso_pu_bacteria 2854601825 2854603731 283
213 iso_pu_bacteria 2855195626 2855196090 283
214 iso_pu_bacteria 2858466076 2858467319 283
215 iso_pu_bacteria 2865014394 2865018271 283
216 iso_pu_bacteria 2869551831 2869556215 283
217 iso_pu_bacteria 2871272651 2871276922 283
218 iso_pu_bacteria 2881609920 2881613082 283
219 iso_pu_bacteria 2888366609 2888370839 283
220 iso_pu_bacteria 2900051742 2900053371 283
221 iso_pu_bacteria 2919108558 2919112559 283
222 iso_pu_bacteria 2932406140 2932406852 283
223 iso_pu_bacteria 2937967321 2937969327 283
224 iso_pu_bacteria 2939577877 2939579740 283
225 iso_pu_bacteria 2945951305 2945954219 283
226 iso_pu_bacteria 2971820967 2971825534 283
227 iso_pu_bacteria 2984494565 2984498012 283
228 iso_pu_bacteria 2990261002 2990264472 283
229 iso_pu_bacteria 640753048 640939561 283
230 iso_pu_bacteria 8004592986 8004593640 283
231 iso_pu_bacteria 8015394850 8015398736 283
232 3300006946 Ga0079104_1000406 Ga0079104_10004067 284
233 3300027111 Ga0209281_1000060 Ga0209281_100006038 284
234 3300027312 Ga0209371_1001390 Ga0209371_10013905 284
235 3300030500 Ga0268256_1001193 Ga0268256_100119313 284
236 3300049571 Ga0501034_0090455 Ga0501034_0090455_262_1131 284
237 3300049573 Ga0501037_0170775 Ga0501037_0170775_462_1358 284
238 3300049580 Ga0501046_0352322 Ga0501046_0352322_127_996 284
239 3300049581 Ga0501047_0260683 Ga0501047_0260683_275_1144 284
240 3300049823 Ga0501044_0079580 Ga0501044_0079580_513_1382 284
241 iso_pu_bacteria 2609459761 2609911851 284
242 iso_pu_bacteria 2711768156 2712470819 284
243 iso_pu_bacteria 2791354903 2791924341 284
244 iso_pu_bacteria 2888373701 2888376723 284
245 iso_pu_bacteria 2945874760 2945879674 284
246 iso_pu_bacteria 8054844752 8054846388 284
247 iso_pu_bacteria 8054849141 8054853808 284
248 iso_pu_bacteria 8055087960 8055092511 284
249 iso_pu_bacteria 8055092621 8055092931 284
250 3300003203 JGI25406J46586_10005938 JGI25406J46586_100059383 285
251 3300003316 rootH1_10041192 rootH1_100411922 285
252 3300005435 Ga0070714_100059870 Ga0070714_1000598703 285
253 3300005436 Ga0070713_100225231 Ga0070713_1002252311 285
254 3300005437 Ga0070710_10008024 Ga0070710_100080243 285
255 3300005439 Ga0070711_100024350 Ga0070711_1000243503 285
256 3300005455 Ga0070663_100060388 Ga0070663_1000603884 285
257 3300005530 Ga0070679_100013358 Ga0070679_1000133585 285
258 3300005535 Ga0070684_100432053 Ga0070684_1004320531 285
259 3300005547 Ga0070693_100199562 Ga0070693_1001995622 285
260 3300005614 Ga0068856_100030542 Ga0068856_1000305423 285
261 3300005937 Ga0081455_10070490 Ga0081455_100704903 285
262 3300005985 Ga0081539_10000054 Ga0081539_1000005434 285
263 3300006175 Ga0070712_100017993 Ga0070712_1000179933 285
264 3300013104 Ga0157370_10019363 Ga0157370_100193635 285
265 3300021388 Ga0213875_10009199 Ga0213875_100091992 285
266 3300025898 Ga0207692_10007580 Ga0207692_100075803 285
267 3300025916 Ga0207663_10048880 Ga0207663_100488801 285
268 3300025921 Ga0207652_10026822 Ga0207652_100268223 285
269 3300026067 Ga0207678_10026907 Ga0207678_100269071 285
270 3300026116 Ga0207674_10318224 Ga0207674_103182242 285
271 3300035118 Ga0373954_0018028 Ga0373954_0018028_1525_2391 285
272 3300035119 Ga0373956_0013301 Ga0373956_0013301_351_1217 285
273 3300035695 Ga0373927_0288074 Ga0373927_0288074_130_996 285
274 3300035724 Ga0373933_0084219 Ga0373933_0084219_882_1748 285
275 3300036401 Ga0373937_0002383 Ga0373937_0002383_10630_11496 285
276 3300036401 Ga0373937_0028846 Ga0373937_0028846_2851_3717 285
277 3300037418 Ga0395900_0002398 Ga0395900_0002398_8924_9826 285
278 3300037466 Ga0395898_0001825 Ga0395898_0001825_14964_15866 285
279 3300037471 Ga0395905_0451877 Ga0395905_0451877_185_1087 285
280 3300037853 Ga0436364_0198397 Ga0436364_0198397_2609_3475 285
281 3300037853 Ga0436364_0405011 Ga0436364_0405011_13824_14690 285
282 3300038443 Ga0395901_0017766 Ga0395901_0017766_2595_3497 285
283 3300039437 Ga0436365_0372100 Ga0436365_0372100_12_878 285
284 3300046477 Ga0495664_0021889 Ga0495664_0021889_408_1274 285
285 3300046511 Ga0495608_0028125 Ga0495608_0028125_556_1422 285
286 3300046529 Ga0495652_0071513 Ga0495652_0071513_530_1396 285
287 3300046536 Ga0495587_0089351 Ga0495587_0089351_98_964 285
288 3300046543 Ga0495645_0013221 Ga0495645_0013221_3583_4449 285
289 3300046559 Ga0495667_0011711 Ga0495667_0011711_3754_4620 285
290 3300046663 Ga0495635_0069175 Ga0495635_0069175_1167_2033 285
291 3300046675 Ga0495657_0060803 Ga0495657_0060803_338_1204 285
292 3300047319 Ga0495674_0008309 Ga0495674_0008309_8506_9372 285
293 3300047444 Ga0495675_0002915 Ga0495675_0002915_9360_10226 285
294 3300048088 Ga0495602_0002111 Ga0495602_0002111_8459_9325 285
295 3300048088 Ga0495602_0062218 Ga0495602_0062218_1835_2701 285
296 3300048919 Ga0496116_0000214 Ga0496116_0000214_29444_30301 285
297 3300048922 Ga0496119_0000134 Ga0496119_0000134_18777_19673 285
298 3300048922 Ga0496119_0000516 Ga0496119_0000516_37502_38359 285
299 3300048922 Ga0496119_0009817 Ga0496119_0009817_3733_4599 285
300 3300048923 Ga0496120_0000017 Ga0496120_0000017_84467_85363 285
301 3300048923 Ga0496120_0000032 Ga0496120_0000032_140635_141492 285
302 3300048923 Ga0496120_0054607 Ga0496120_0054607_595_1461 285
303 3300049575 Ga0501039_0021728 Ga0501039_0021728_1893_2795 285
304 3300049576 Ga0501040_0130161 Ga0501040_0130161_231_1133 285
305 3300049577 Ga0501041_0068167 Ga0501041_0068167_276_1178 285
306 3300049578 Ga0501042_0083209 Ga0501042_0083209_75_977 285
307 3300049587 Ga0501071_0198523 Ga0501071_0198523_204_1106 285
308 3300049588 Ga0501072_0326222 Ga0501072_0326222_157_1059 285
309 3300049741 Ga0501079_0291528 Ga0501079_0291528_45_947 285
310 3300053077 Ga0495601_0000760 Ga0495601_0000760_11197_12063 285
311 3300053078 Ga0495612_0001008 Ga0495612_0001008_92_958 285
312 3300053085 Ga0495619_0014692 Ga0495619_0014692_581_1447 285
313 iso_pu_bacteria 2547132416 2548651519 285
314 iso_pu_bacteria 2602042047 2603644503 285
315 iso_pu_bacteria 2602042066 2603700357 285
316 iso_pu_bacteria 2602042067 2603706036 285
317 iso_pu_bacteria 2667528172 2671103605 285
318 iso_pu_bacteria 2681812866 2681996945 285
319 iso_pu_bacteria 2681812869 2682008731 285
320 iso_pu_bacteria 2751185917 2753854663 285
321 iso_pu_bacteria 2765235842 2765587528 285
322 iso_pu_bacteria 2775506706 2775540911 285
323 iso_pu_bacteria 2821118458 2821121526 285
324 iso_pu_bacteria 2823373977 2823377351 285
325 iso_pu_bacteria 2844425489 2844426217 285
326 iso_pu_bacteria 2923634449 2923638064 285
327 iso_pu_bacteria 2927833300 2927835504 285
328 iso_pu_bacteria 2937539931 2937544524 285
329 iso_pu_bacteria 2939568625 2939571485 285
330 iso_pu_bacteria 2939642701 2939646106 285
331 iso_pu_bacteria 2974310843 2974313537 285
332 iso_pu_bacteria 8018221730 8018223569 285
333 iso_pu_bacteria 8018405270 8018410119 285
334 iso_pu_bacteria 8057304971 8057307245 285
335 3300002773 JGI25152J39213_1000194 JGI25152J39213_100019420 286
336 3300003856 Ga0058692_1003055 Ga0058692_10030552 286
337 3300003856 Ga0058692_1017826 Ga0058692_10178261 286
338 3300009011 Ga0105251_10002440 Ga0105251_1000244015 286
339 3300009036 Ga0105244_10001617 Ga0105244_1000161711 286
340 3300013102 Ga0157371_10026573 Ga0157371_100265733 286
341 3300013105 Ga0157369_10010151 Ga0157369_1001015110 286
342 3300013307 Ga0157372_10002392 Ga0157372_100023929 286
343 3300015261 Ga0182006_1000045 Ga0182006_100004573 286
344 3300025258 Ga0209129_1000008 Ga0209129_1000008507 286
345 3300025728 Ga0207655_1000028 Ga0207655_1000028341 286
346 3300025735 Ga0207713_1001415 Ga0207713_100141515 286
347 3300027312 Ga0209371_1000014 Ga0209371_100001472 286
348 3300027312 Ga0209371_1000300 Ga0209371_100030039 286
349 3300030500 Ga0268256_1000012 Ga0268256_1000012700 286
350 3300030500 Ga0268256_1000021 Ga0268256_100002166 286
351 3300031251 Ga0265327_10000005 Ga0265327_10000005302 286
352 3300037853 Ga0436364_1288521 Ga0436364_1288521_1516_2385 286
353 3300039438 Ga0436360_0447382 Ga0436360_0447382_862_1731 286
354 3300042010 Ga0439452_000005 Ga0439452_000005_76833_77693 286
355 3300042010 Ga0439452_000007 Ga0439452_000007_82582_83442 286
356 3300042439 Ga0439464_0009420 Ga0439464_0009420_64_924 286
357 3300045051 Ga0451576_0001725 Ga0451576_0001725_3244_4113 286
358 3300045051 Ga0451576_0159440 Ga0451576_0159440_581_1462 286
359 3300045051 Ga0451576_0467730 Ga0451576_0467730_352_1227 286
360 3300047471 Ga0495684_0023050 Ga0495684_0023050_3122_3991 286
361 3300048919 Ga0496116_0030916 Ga0496116_0030916_2600_3460 286
362 3300048920 Ga0496117_0056339 Ga0496117_0056339_572_1432 286
363 3300048920 Ga0496117_0187593 Ga0496117_0187593_98_958 286
364 3300048921 Ga0496118_0082275 Ga0496118_0082275_849_1709 286
365 3300048922 Ga0496119_0000171 Ga0496119_0000171_13650_14510 286
366 3300048923 Ga0496120_0010281 Ga0496120_0010281_2955_3815 286
367 3300048925 Ga0496122_0020442 Ga0496122_0020442_5109_5969 286
368 3300048927 Ga0496124_0000142 Ga0496124_0000142_133416_134276 286
369 3300048928 Ga0496125_0016546 Ga0496125_0016546_5599_6459 286
370 3300048929 Ga0496126_0055459 Ga0496126_0055459_2154_3014 286
371 2162886007 SwRhRL2b_contig_419289 SwRhRL2b_0947.00007370 287
372 3300001989 JGI24739J22299_10000061 JGI24739J22299_1000006119 287
373 3300002737 JGI25162J39368_1000006 JGI25162J39368_1000006230 287
374 3300002737 JGI25162J39368_1005659 JGI25162J39368_10056593 287
375 3300002771 JGI25163J39215_1000001 JGI25163J39215_1000001129 287
376 3300002772 JGI25164J39214_1000001 JGI25164J39214_1000001299 287
377 3300003751 Ga0055538_1000004 Ga0055538_1000004429 287
378 3300003752 Ga0055539_1000004 Ga0055539_1000004129 287
379 3300003756 Ga0055533_1000007 Ga0055533_1000007429 287
380 3300003759 Ga0055525_1000007 Ga0055525_1000007429 287
381 3300003841 Ga0055541_1000004 Ga0055541_1000004429 287
382 3300003856 Ga0058692_1000306 Ga0058692_100030612 287
383 3300003856 Ga0058692_1008784 Ga0058692_10087842 287
384 3300005272 Ga0065703_1019625 Ga0065703_10196253 287
385 3300005289 Ga0065704_10001139 Ga0065704_100011396 287
386 3300005335 Ga0070666_10050539 Ga0070666_100505393 287
387 3300005347 Ga0070668_100085212 Ga0070668_1000852122 287
388 3300005548 Ga0070665_100158052 Ga0070665_1001580522 287
389 3300006946 Ga0079104_1001282 Ga0079104_10012823 287
390 3300009011 Ga0105251_10000595 Ga0105251_1000059519 287
391 3300009011 Ga0105251_10001239 Ga0105251_1000123919 287
392 3300009011 Ga0105251_10002066 Ga0105251_1000206618 287
393 3300009011 Ga0105251_10007155 Ga0105251_100071557 287
394 3300009011 Ga0105251_10008398 Ga0105251_100083983 287
395 3300009011 Ga0105251_10009331 Ga0105251_100093314 287
396 3300009011 Ga0105251_10027865 Ga0105251_100278653 287
397 3300009036 Ga0105244_10000023 Ga0105244_10000023155 287
398 3300009036 Ga0105244_10000713 Ga0105244_1000071318 287
399 3300009036 Ga0105244_10004325 Ga0105244_100043253 287
400 3300009036 Ga0105244_10031767 Ga0105244_100317673 287
401 3300009036 Ga0105244_10083418 Ga0105244_100834182 287
402 3300009092 Ga0105250_10000042 Ga0105250_100000428 287
403 3300009092 Ga0105250_10001245 Ga0105250_100012457 287
404 3300009092 Ga0105250_10071736 Ga0105250_100717362 287
405 3300009101 Ga0105247_10000223 Ga0105247_1000022348 287
406 3300009174 Ga0105241_10000006 Ga0105241_10000006310 287
407 3300009545 Ga0105237_10142485 Ga0105237_101424853 287
408 3300009545 Ga0105237_10236123 Ga0105237_102361233 287
409 3300011119 Ga0105246_10020546 Ga0105246_100205465 287
410 3300013100 Ga0157373_10003696 Ga0157373_100036964 287
411 3300013100 Ga0157373_10013207 Ga0157373_100132074 287
412 3300013100 Ga0157373_10078071 Ga0157373_100780712 287
413 3300013102 Ga0157371_10000020 Ga0157371_10000020249 287
414 3300013102 Ga0157371_10002582 Ga0157371_1000258213 287
415 3300013102 Ga0157371_10261783 Ga0157371_102617832 287
416 3300013104 Ga0157370_10000142 Ga0157370_1000014237 287
417 3300013104 Ga0157370_10002701 Ga0157370_1000270115 287
418 3300013105 Ga0157369_10012225 Ga0157369_100122255 287
419 3300013306 Ga0163162_10025666 Ga0163162_100256663 287
420 3300013306 Ga0163162_10266504 Ga0163162_102665042 287
421 3300013307 Ga0157372_10012060 Ga0157372_100120605 287
422 3300013307 Ga0157372_10130235 Ga0157372_101302353 287
423 3300013307 Ga0157372_10182711 Ga0157372_101827113 287
424 3300015261 Ga0182006_1006250 Ga0182006_10062505 287
425 3300017792 Ga0163161_10000050 Ga0163161_1000005072 287
426 3300017792 Ga0163161_10035907 Ga0163161_100359073 287
427 3300021388 Ga0213875_10000536 Ga0213875_1000053627 287
428 3300025207 Ga0209760_100044 Ga0209760_10004438 287
429 3300025224 Ga0209784_100001 Ga0209784_100001422 287
430 3300025225 Ga0209566_100001 Ga0209566_100001422 287
431 3300025226 Ga0209674_100002 Ga0209674_100002422 287
432 3300025230 Ga0209563_100008 Ga0209563_100008425 287
433 3300025231 Ga0207427_100002 Ga0207427_100002855 287
434 3300025233 Ga0209437_100046 Ga0209437_100046227 287
435 3300025233 Ga0209437_100063 Ga0209437_100063242 287
436 3300025253 Ga0209677_100004 Ga0209677_100004425 287
437 3300025261 Ga0209233_1001000 Ga0209233_10010009 287
438 3300025711 Ga0207696_1000014 Ga0207696_100001450 287
439 3300025711 Ga0207696_1000027 Ga0207696_1000027102 287
440 3300025711 Ga0207696_1000598 Ga0207696_100059824 287
441 3300025711 Ga0207696_1001272 Ga0207696_10012727 287
442 3300025728 Ga0207655_1000056 Ga0207655_100005645 287
443 3300025728 Ga0207655_1000223 Ga0207655_100022386 287
444 3300025728 Ga0207655_1005240 Ga0207655_10052402 287
445 3300025728 Ga0207655_1006410 Ga0207655_10064103 287
446 3300025728 Ga0207655_1021860 Ga0207655_10218602 287
447 3300025728 Ga0207655_1081662 Ga0207655_10816622 287
448 3300025735 Ga0207713_1000007 Ga0207713_100000767 287
449 3300025735 Ga0207713_1000057 Ga0207713_100005789 287
450 3300025735 Ga0207713_1000362 Ga0207713_100036232 287
451 3300025735 Ga0207713_1000420 Ga0207713_10004204 287
452 3300025735 Ga0207713_1024793 Ga0207713_10247933 287
453 3300025900 Ga0207710_10000007 Ga0207710_10000007387 287
454 3300025911 Ga0207654_10000008 Ga0207654_10000008313 287
455 3300025972 Ga0207668_10076015 Ga0207668_100760153 287
456 3300027111 Ga0209281_1000260 Ga0209281_100026047 287
457 3300027312 Ga0209371_1000276 Ga0209371_100027612 287
458 3300027312 Ga0209371_1001319 Ga0209371_100131914 287
459 3300027312 Ga0209371_1004348 Ga0209371_10043484 287
460 3300027312 Ga0209371_1008943 Ga0209371_10089433 287
461 3300028379 Ga0268266_10062117 Ga0268266_100621173 287
462 3300030500 Ga0268256_1000230 Ga0268256_100023012 287
463 3300030500 Ga0268256_1004026 Ga0268256_10040265 287
464 3300030500 Ga0268256_1010421 Ga0268256_10104212 287
465 3300037853 Ga0436364_0741160 Ga0436364_0741160_30806_31678 287
466 3300039438 Ga0436360_0305121 Ga0436360_0305121_930_1802 287
467 3300041411 Ga0439466_0000107 Ga0439466_0000107_4520_5425 287
468 3300041512 Ga0451853_1620505 Ga0451853_1620505_439_1323 287
469 3300042006 Ga0439432_013400 Ga0439432_013400_963_1874 287
470 3300042006 Ga0439432_015476 Ga0439432_015476_605_1492 287
471 3300042006 Ga0439432_018585 Ga0439432_018585_187_1092 287
472 3300042010 Ga0439452_000004 Ga0439452_000004_691663_692550 287
473 3300042010 Ga0439452_004058 Ga0439452_004058_79_984 287
474 3300042013 Ga0439456_021223 Ga0439456_021223_304_1179 287
475 3300042016 Ga0439463_005527 Ga0439463_005527_1157_2062 287
476 3300042146 Ga0450907_000034 Ga0450907_000034_11757_12662 287
477 3300042439 Ga0439464_0003743 Ga0439464_0003743_2326_3231 287
478 3300045836 Ga0466958_0137584 Ga0466958_0137584_553_1425 287
479 3300046453 Ga0495627_000266 Ga0495627_000266_2707_3618 287
480 3300046471 Ga0495650_0000004 Ga0495650_0000004_488692_489567 287
481 3300046492 Ga0495585_0011226 Ga0495585_0011226_56_961 287
482 3300046500 Ga0495596_0069970 Ga0495596_0069970_477_1340 287
483 3300046522 Ga0495643_0024885 Ga0495643_0024885_920_1825 287
484 3300046524 Ga0495648_0006699 Ga0495648_0006699_7964_8869 287
485 3300046530 Ga0495654_0000546 Ga0495654_0000546_2335_3246 287
486 3300046794 Ga0495589_0000028 Ga0495589_0000028_124627_125538 287
487 3300046810 Ga0495660_0000013 Ga0495660_0000013_130539_131414 287
488 3300046810 Ga0495660_0008020 Ga0495660_0008020_537_1442 287
489 3300047320 Ga0495672_0000054 Ga0495672_0000054_157271_158176 287
490 3300047446 Ga0495679_000606 Ga0495679_000606_473_1378 287
491 3300048905 Ga0496102_0014967 Ga0496102_0014967_647_1537 287
492 3300048905 Ga0496102_0145276 Ga0496102_0145276_1126_2031 287
493 3300048906 Ga0496103_0035083 Ga0496103_0035083_2000_2890 287
494 3300048907 Ga0496104_0011029 Ga0496104_0011029_694_1569 287
495 3300048908 Ga0496105_0002003 Ga0496105_0002003_10926_11831 287
496 3300048909 Ga0496106_0059225 Ga0496106_0059225_1636_2526 287
497 3300048919 Ga0496116_0000009 Ga0496116_0000009_251618_252529 287
498 3300048919 Ga0496116_0000016 Ga0496116_0000016_359988_360863 287
499 3300048919 Ga0496116_0000368 Ga0496116_0000368_19361_20248 287
500 3300048919 Ga0496116_0015068 Ga0496116_0015068_4904_5794 287
501 3300048920 Ga0496117_0000350 Ga0496117_0000350_8254_9144 287
502 3300048920 Ga0496117_0000772 Ga0496117_0000772_17029_17916 287
503 3300048920 Ga0496117_0003500 Ga0496117_0003500_5147_6058 287
504 3300048920 Ga0496117_0007185 Ga0496117_0007185_9696_10601 287
505 3300048920 Ga0496117_0019017 Ga0496117_0019017_4326_5201 287
506 3300048921 Ga0496118_0000821 Ga0496118_0000821_8254_9144 287
507 3300048921 Ga0496118_0001525 Ga0496118_0001525_16544_17431 287
508 3300048921 Ga0496118_0002391 Ga0496118_0002391_14631_15506 287
509 3300048921 Ga0496118_0003425 Ga0496118_0003425_18561_19472 287
510 3300048921 Ga0496118_0017152 Ga0496118_0017152_460_1335 287
511 3300048922 Ga0496119_0000226 Ga0496119_0000226_42701_43591 287
512 3300048922 Ga0496119_0002114 Ga0496119_0002114_11223_12128 287
513 3300048922 Ga0496119_0004720 Ga0496119_0004720_4819_5682 287
514 3300048922 Ga0496119_0005631 Ga0496119_0005631_3897_4760 287
515 3300048922 Ga0496119_0101112 Ga0496119_0101112_460_1335 287
516 3300048922 Ga0496119_0136414 Ga0496119_0136414_40_951 287
517 3300048923 Ga0496120_0000330 Ga0496120_0000330_35385_36275 287
518 3300048923 Ga0496120_0002452 Ga0496120_0002452_3897_4760 287
519 3300048923 Ga0496120_0002661 Ga0496120_0002661_10254_11159 287
520 3300048923 Ga0496120_0002723 Ga0496120_0002723_2997_3860 287
521 3300048923 Ga0496120_0010797 Ga0496120_0010797_1128_2003 287
522 3300048924 Ga0496121_0000336 Ga0496121_0000336_69964_70869 287
523 3300048925 Ga0496122_0000481 Ga0496122_0000481_41932_42807 287
524 3300048926 Ga0496123_0000385 Ga0496123_0000385_40084_40959 287
525 3300048926 Ga0496123_0001855 Ga0496123_0001855_22176_23066 287
526 3300048927 Ga0496124_0000096 Ga0496124_0000096_132038_132901 287
527 3300048927 Ga0496124_0000305 Ga0496124_0000305_82514_83389 287
528 3300048927 Ga0496124_0019237 Ga0496124_0019237_2392_3279 287
529 3300048927 Ga0496124_0035850 Ga0496124_0035850_488_1393 287
530 3300048927 Ga0496124_0094226 Ga0496124_0094226_576_1466 287
531 3300048928 Ga0496125_0000943 Ga0496125_0000943_37801_38676 287
532 3300048928 Ga0496125_0007084 Ga0496125_0007084_8971_9876 287
533 3300048929 Ga0496126_0005699 Ga0496126_0005699_6545_7420 287
534 3300049460 Ga0495682_0049768 Ga0495682_0049768_18_929 287
535 3300049822 Ga0501035_0249113 Ga0501035_0249113_463_1326 287
536 3300049823 Ga0501044_0000112 Ga0501044_0000112_60618_61481 287
537 iso_pu_bacteria 2506520007 2506580305 287
538 iso_pu_bacteria 2506520008 2506585444 287
539 iso_pu_bacteria 2585427591 2585827875 287
540 iso_pu_bacteria 2585427592 2585830888 287
541 iso_pu_bacteria 2667528173 2671106389 287
542 iso_pu_bacteria 2687453601 2689446836 287
543 iso_pu_bacteria 2904474040 2904474466 287
544 iso_pu_bacteria 2904504865 2904506966 287
545 iso_pu_bacteria 2919150387 2919150812 287
546 iso_pu_bacteria 2927143783 2927145686 287
547 3300006946 Ga0079104_1000238 Ga0079104_100023850 288
548 3300009036 Ga0105244_10013293 Ga0105244_100132935 288
549 3300021384 Ga0213876_10000026 Ga0213876_10000026133 288
550 3300027111 Ga0209281_1000058 Ga0209281_1000058202 288
551 3300027312 Ga0209371_1003617 Ga0209371_10036174 288
552 3300027312 Ga0209371_1010252 Ga0209371_10102523 288
553 3300030500 Ga0268256_1003295 Ga0268256_10032954 288
554 3300030500 Ga0268256_1010999 Ga0268256_10109992 288
555 3300039437 Ga0436365_0084998 Ga0436365_0084998_75457_76323 288
556 3300039447 Ga0436361_0167940 Ga0436361_0167940_2650_3525 288
557 3300048925 Ga0496122_0018182 Ga0496122_0018182_3206_4072 288
558 3300048925 Ga0496122_0043391 Ga0496122_0043391_2398_3285 288
559 3300048926 Ga0496123_0000467 Ga0496123_0000467_14762_15628 288
560 3300048926 Ga0496123_0015833 Ga0496123_0015833_2290_3177 288
561 3300048929 Ga0496126_0496716 Ga0496126_0496716_22_888 288
562 2162886007 SwRhRL2b_contig_3631014 SwRhRL2b_0695.00006980 289
563 2162886007 SwRhRL2b_contig_541451 SwRhRL2b_0733.00005140 289
564 3300003856 Ga0058692_1000183 Ga0058692_100018332 289
565 3300003856 Ga0058692_1003144 Ga0058692_10031445 289
566 3300003856 Ga0058692_1005138 Ga0058692_10051384 289
567 3300003856 Ga0058692_1008820 Ga0058692_10088203 289
568 3300003856 Ga0058692_1008822 Ga0058692_10088223 289
569 3300005289 Ga0065704_10001780 Ga0065704_100017804 289
570 3300005289 Ga0065704_10004251 Ga0065704_100042515 289
571 3300005456 Ga0070678_100028534 Ga0070678_1000285345 289
572 3300005548 Ga0070665_100009321 Ga0070665_1000093217 289
573 3300005577 Ga0068857_100000004 Ga0068857_10000000481 289
574 3300006051 Ga0075364_10002478 Ga0075364_100024782 289
575 3300006051 Ga0075364_10002674 Ga0075364_100026745 289
576 3300006195 Ga0075366_10074589 Ga0075366_100745892 289
577 3300006946 Ga0079104_1001044 Ga0079104_100104412 289
578 3300006946 Ga0079104_1001079 Ga0079104_100107918 289
579 3300006946 Ga0079104_1005238 Ga0079104_10052384 289
580 3300006946 Ga0079104_1005520 Ga0079104_10055204 289
581 3300006946 Ga0079104_1006147 Ga0079104_10061473 289
582 3300006946 Ga0079104_1011898 Ga0079104_10118984 289
583 3300006946 Ga0079104_1012465 Ga0079104_10124653 289
584 3300009011 Ga0105251_10002260 Ga0105251_1000226010 289
585 3300009011 Ga0105251_10035432 Ga0105251_100354322 289
586 3300009011 Ga0105251_10049628 Ga0105251_100496283 289
587 3300009011 Ga0105251_10107428 Ga0105251_101074281 289
588 3300009036 Ga0105244_10000256 Ga0105244_1000025639 289
589 3300009036 Ga0105244_10010532 Ga0105244_100105324 289
590 3300009036 Ga0105244_10025204 Ga0105244_100252042 289
591 3300009036 Ga0105244_10044987 Ga0105244_100449873 289
592 3300009036 Ga0105244_10058404 Ga0105244_100584042 289
593 3300009092 Ga0105250_10000378 Ga0105250_1000037820 289
594 3300009092 Ga0105250_10004843 Ga0105250_100048434 289
595 3300009092 Ga0105250_10005593 Ga0105250_100055932 289
596 3300009093 Ga0105240_10423701 Ga0105240_104237012 289
597 3300009148 Ga0105243_10002183 Ga0105243_100021834 289
598 3300011119 Ga0105246_10027407 Ga0105246_100274073 289
599 3300013100 Ga0157373_10065768 Ga0157373_100657683 289
600 3300013100 Ga0157373_10185192 Ga0157373_101851922 289
601 3300013102 Ga0157371_10005708 Ga0157371_100057084 289
602 3300013102 Ga0157371_10115385 Ga0157371_101153853 289
603 3300013296 Ga0157374_10606852 Ga0157374_106068521 289
604 3300013307 Ga0157372_10097925 Ga0157372_100979251 289
605 3300014325 Ga0163163_10027306 Ga0163163_100273064 289
606 3300015679 Ga0183366_1003 Ga0183366_100382 289
607 3300015680 Ga0183370_1003 Ga0183370_1003338 289
608 3300015685 Ga0183369_1005 Ga0183369_1005338 289
609 3300015687 Ga0183368_1006 Ga0183368_100681 289
610 3300017792 Ga0163161_10110402 Ga0163161_101104022 289
611 3300025711 Ga0207696_1000066 Ga0207696_1000066119 289
612 3300025711 Ga0207696_1003590 Ga0207696_10035905 289
613 3300025711 Ga0207696_1027228 Ga0207696_10272282 289
614 3300025728 Ga0207655_1000017 Ga0207655_1000017423 289
615 3300025728 Ga0207655_1000026 Ga0207655_1000026414 289
616 3300025728 Ga0207655_1000436 Ga0207655_100043639 289
617 3300025728 Ga0207655_1001219 Ga0207655_10012194 289
618 3300025728 Ga0207655_1003013 Ga0207655_100301310 289
619 3300025728 Ga0207655_1044688 Ga0207655_10446882 289
620 3300025735 Ga0207713_1000048 Ga0207713_100004889 289
621 3300025735 Ga0207713_1000164 Ga0207713_100016479 289
622 3300025735 Ga0207713_1037599 Ga0207713_10375991 289
623 3300025935 Ga0207709_10001680 Ga0207709_100016803 289
624 3300025935 Ga0207709_10022920 Ga0207709_100229202 289
625 3300026116 Ga0207674_10000009 Ga0207674_10000009105 289
626 3300026121 Ga0207683_10048655 Ga0207683_100486555 289
627 3300027111 Ga0209281_1000137 Ga0209281_100013795 289
628 3300027111 Ga0209281_1000146 Ga0209281_100014687 289
629 3300027111 Ga0209281_1000298 Ga0209281_100029812 289
630 3300027111 Ga0209281_1000891 Ga0209281_100089111 289
631 3300027111 Ga0209281_1001324 Ga0209281_100132410 289
632 3300027111 Ga0209281_1003504 Ga0209281_10035043 289
633 3300027111 Ga0209281_1003533 Ga0209281_10035334 289
634 3300027312 Ga0209371_1000030 Ga0209371_100003017 289
635 3300027312 Ga0209371_1000053 Ga0209371_100005364 289
636 3300027312 Ga0209371_1000096 Ga0209371_100009664 289
637 3300027312 Ga0209371_1000435 Ga0209371_10004354 289
638 3300027312 Ga0209371_1000612 Ga0209371_100061231 289
639 3300027312 Ga0209371_1001468 Ga0209371_100146813 289
640 3300027312 Ga0209371_1003846 Ga0209371_10038467 289
641 3300028379 Ga0268266_10000307 Ga0268266_1000030726 289
642 3300028379 Ga0268266_10108839 Ga0268266_101088392 289
643 3300030500 Ga0268256_1000025 Ga0268256_100002570 289
644 3300030500 Ga0268256_1000053 Ga0268256_1000053171 289
645 3300030500 Ga0268256_1000086 Ga0268256_100008664 289
646 3300030500 Ga0268256_1001251 Ga0268256_10012514 289
647 3300030500 Ga0268256_1001533 Ga0268256_10015338 289
648 3300030500 Ga0268256_1002281 Ga0268256_10022815 289
649 3300035111 Ga0373923_0089620 Ga0373923_0089620_294_1175 289
650 3300035113 Ga0373936_0090420 Ga0373936_0090420_146_1027 289
651 3300035170 Ga0373943_0128516 Ga0373943_0128516_165_1046 289
652 3300035725 Ga0373947_0026694 Ga0373947_0026694_2352_3233 289
653 3300036401 Ga0373937_0068801 Ga0373937_0068801_847_1728 289
654 3300037068 Ga0373925_0113983 Ga0373925_0113983_1145_2026 289
655 3300041405 Ga0439438_003055 Ga0439438_003055_2854_3732 289
656 3300041505 Ga0451849_0294755 Ga0451849_0294755_128_997 289
657 3300042010 Ga0439452_000074 Ga0439452_000074_11543_12412 289
658 3300042439 Ga0439464_0003850 Ga0439464_0003850_2760_3629 289
659 3300044669 Ga0466981_0000042 Ga0466981_0000042_26259_27128 289
660 3300046453 Ga0495627_051127 Ga0495627_051127_120_1007 289
661 3300046458 Ga0495591_000047 Ga0495591_000047_76101_76970 289
662 3300046458 Ga0495591_007463 Ga0495591_007463_2368_3255 289
663 3300046458 Ga0495591_013879 Ga0495591_013879_106_975 289
664 3300046460 Ga0495638_0076348 Ga0495638_0076348_973_1860 289
665 3300046471 Ga0495650_0000028 Ga0495650_0000028_56043_56912 289
666 3300046471 Ga0495650_0000377 Ga0495650_0000377_75847_76716 289
667 3300046474 Ga0495605_0143931 Ga0495605_0143931_152_1021 289
668 3300046491 Ga0495584_0021408 Ga0495584_0021408_1590_2459 289
669 3300046501 Ga0495607_0022330 Ga0495607_0022330_2438_3307 289
670 3300046507 Ga0495606_0000954 Ga0495606_0000954_20646_21515 289
671 3300046522 Ga0495643_0164251 Ga0495643_0164251_23_910 289
672 3300046524 Ga0495648_0010621 Ga0495648_0010621_3806_4675 289
673 3300046530 Ga0495654_0001218 Ga0495654_0001218_13296_14165 289
674 3300046692 Ga0495671_0002990 Ga0495671_0002990_1902_2771 289
675 3300046694 Ga0495649_0012306 Ga0495649_0012306_394_1281 289
676 3300046694 Ga0495649_0030599 Ga0495649_0030599_1783_2652 289
677 3300046694 Ga0495649_0031182 Ga0495649_0031182_1380_2267 289
678 3300046810 Ga0495660_0000516 Ga0495660_0000516_28214_29083 289
679 3300047320 Ga0495672_0000029 Ga0495672_0000029_228508_229377 289
680 3300047323 Ga0495683_0001353 Ga0495683_0001353_2249_3118 289
681 3300047469 Ga0495673_0000092 Ga0495673_0000092_75973_76842 289
682 3300048907 Ga0496104_0001075 Ga0496104_0001075_21173_22042 289
683 3300048907 Ga0496104_0155030 Ga0496104_0155030_893_1762 289
684 3300048908 Ga0496105_0067341 Ga0496105_0067341_187_1056 289
685 3300048919 Ga0496116_0020768 Ga0496116_0020768_2889_3758 289
686 3300048919 Ga0496116_0025582 Ga0496116_0025582_785_1678 289
687 3300048919 Ga0496116_0026248 Ga0496116_0026248_1051_1944 289
688 3300048919 Ga0496116_0030687 Ga0496116_0030687_2594_3463 289
689 3300048920 Ga0496117_0000753 Ga0496117_0000753_43434_44303 289
690 3300048920 Ga0496117_0021006 Ga0496117_0021006_16_885 289
691 3300048920 Ga0496117_0021419 Ga0496117_0021419_1672_2541 289
692 3300048920 Ga0496117_0029129 Ga0496117_0029129_2855_3724 289
693 3300048921 Ga0496118_0001665 Ga0496118_0001665_29977_30846 289
694 3300048921 Ga0496118_0035218 Ga0496118_0035218_286_1155 289
695 3300048921 Ga0496118_0041118 Ga0496118_0041118_184_1053 289
696 3300048921 Ga0496118_0218761 Ga0496118_0218761_156_1025 289
697 3300048922 Ga0496119_0007240 Ga0496119_0007240_5772_6641 289
698 3300048922 Ga0496119_0008294 Ga0496119_0008294_869_1738 289
699 3300048922 Ga0496119_0009873 Ga0496119_0009873_61_954 289
700 3300048922 Ga0496119_0010529 Ga0496119_0010529_3838_4707 289
701 3300048923 Ga0496120_0003940 Ga0496120_0003940_2836_3705 289
702 3300048923 Ga0496120_0006300 Ga0496120_0006300_4529_5398 289
703 3300048923 Ga0496120_0044727 Ga0496120_0044727_1599_2468 289
704 3300048923 Ga0496120_0121416 Ga0496120_0121416_227_1096 289
705 3300048924 Ga0496121_0018475 Ga0496121_0018475_1218_2087 289
706 3300048924 Ga0496121_0023839 Ga0496121_0023839_4155_5024 289
707 3300048924 Ga0496121_0030318 Ga0496121_0030318_2570_3463 289
708 3300048924 Ga0496121_0093404 Ga0496121_0093404_165_1034 289
709 3300048924 Ga0496121_0366545 Ga0496121_0366545_24_893 289
710 3300048925 Ga0496122_0000419 Ga0496122_0000419_12996_13865 289
711 3300048925 Ga0496122_0006694 Ga0496122_0006694_24_893 289
712 3300048925 Ga0496122_0039415 Ga0496122_0039415_338_1207 289
713 3300048925 Ga0496122_0155714 Ga0496122_0155714_431_1324 289
714 3300048925 Ga0496122_0250544 Ga0496122_0250544_98_967 289
715 3300048925 Ga0496122_0250545 Ga0496122_0250545_24_893 289
716 3300048925 Ga0496122_0261333 Ga0496122_0261333_12_881 289
717 3300048925 Ga0496122_0268072 Ga0496122_0268072_12_881 289
718 3300048926 Ga0496123_0000746 Ga0496123_0000746_7864_8733 289
719 3300048926 Ga0496123_0001433 Ga0496123_0001433_21370_22239 289
720 3300048926 Ga0496123_0027778 Ga0496123_0027778_449_1318 289
721 3300048926 Ga0496123_0193575 Ga0496123_0193575_69_938 289
722 3300048926 Ga0496123_0215389 Ga0496123_0215389_24_893 289
723 3300048926 Ga0496123_0219285 Ga0496123_0219285_80_949 289
724 3300048927 Ga0496124_0002318 Ga0496124_0002318_21239_22126 289
725 3300048927 Ga0496124_0009520 Ga0496124_0009520_8969_9838 289
726 3300048927 Ga0496124_0022697 Ga0496124_0022697_1219_2088 289
727 3300048927 Ga0496124_0052610 Ga0496124_0052610_2435_3328 289
728 3300048927 Ga0496124_0089566 Ga0496124_0089566_1409_2278 289
729 3300048927 Ga0496124_0219650 Ga0496124_0219650_235_1104 289
730 3300048928 Ga0496125_0002656 Ga0496125_0002656_18525_19394 289
731 3300048928 Ga0496125_0018353 Ga0496125_0018353_2112_2981 289
732 3300048928 Ga0496125_0027825 Ga0496125_0027825_2740_3609 289
733 3300048929 Ga0496126_0002156 Ga0496126_0002156_22788_23657 289
734 3300048929 Ga0496126_0002622 Ga0496126_0002622_3745_4614 289
735 3300048929 Ga0496126_0117545 Ga0496126_0117545_1195_2064 289
736 3300049459 Ga0495678_001668 Ga0495678_001668_691_1560 289
737 3300049460 Ga0495682_0000003 Ga0495682_0000003_75847_76716 289
738 3300050491 nmdc:mga00v17_59361_c1 nmdc:mga00v17_59361_c1_1236_2105 289
739 3300050493 nmdc:mga0k408_79317_c1 nmdc:mga0k408_79317_c1_900_1769 289
740 3300053126 Ga0500621_000006 Ga0500621_000006_75848_76717 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01564

Spermine_synth

Spermine/spermidine synthase domain

80

266

0.98

PF17284

Spermine_synt_N

Spermidine synthase tetramerisation domain

26

77

0.98

PF08241

Methyltransf_11

Methyltransferase domain

102

210

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3o4f-assembly1.cif.gz_B crystal structure of spermidine synthase from e. coli 0.9928 5 283
3o4f-assembly4.cif.gz_H crystal structure of spermidine synthase from e. coli 0.9917 5 283
3o4f-assembly2.cif.gz_D crystal structure of spermidine synthase from e. coli 0.9891 5 283
3o4f-assembly4.cif.gz_H crystal structure of spermidine synthase from e. coli 0.988 5 283
3o4f-assembly3.cif.gz_F crystal structure of spermidine synthase from e. coli 0.9866 5 284
ID Description Score Start End Superfamily
3adnF01 Mainly Beta;Roll;Spermidine Synthase; Chain: A, domain 2;Spermidine synthase, tetramerisation domain 0.9842 7 54 2.30.140.10
3adnA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9738 55 283 3.40.50.150
af_B4E3X6_90_272_3.40.50.150 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9588 59 241 3.40.50.150
3adnA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.956 55 283 3.40.50.150
1jq3D01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Vaccinia Virus protein VP39 0.9552 55 239 3.40.50.150
ID Description Score Start End GO Terms
AF-A0A3S4KI33-F1-model_v4 Spermidine synthase (EC 2.5.1.16) 0.9965 91 284 GO:0004766
GO:0005829
GO:0008295
AF-A0A2D0IRL3-F1-model_v4 Polyamine aminopropyltransferase (Putrescine aminopropyltransferase) (PAPT) (Spermidine synthase) (SPDS) (SPDSY) (EC 2.5.1.16) 0.9961 5 233 GO:0004766
GO:0005829
GO:0008295
AF-A0A2G0Q491-F1-model_v4 Polyamine aminopropyltransferase (Putrescine aminopropyltransferase) (PAPT) (Spermidine synthase) (SPDS) (SPDSY) (EC 2.5.1.16) 0.9945 1 144 GO:0004766
GO:0005829
GO:0008295
AF-A0A6N8K8B4-F1-model_v4 deleted 0.9925 50 192
AF-A0A6P2BGR2-F1-model_v4 Polyamine aminopropyltransferase (EC 2.5.1.16) 0.987 72 284 GO:0004766
GO:0005829
GO:0008295

Feature Viewer

pLDDT pTM Quality
92.67 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map