F478516

General Info

Members Datasets Scaffolds Average Seq Length
740 473 1480 155

Family's Representative Sequence

Representative Sequence 3300005983|Ga0081540_1003782|Ga0081540_10037827
Length 160
Sequence MSKPEFVYVTYIETTPEKMWEALTDSEFARRYWFGTEVRSDWKVGSPFALVSDGKTTDTGEILEADRPRRLSYTFKHELYETMREPATKVAFTIEPYGNLVKLTVTHEGFVEGSKLLGAVSTGWPAILSGLKSMLETGKPLAIPRAALGKEELAKEELDR

Samples

Sample ID Description Type Environment
1 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
7 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
8 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
9 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
10 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
11 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
35 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
58 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
59 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
60 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
61 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
62 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
85 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
93 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
94 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
95 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
96 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
123 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
127 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
129 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
130 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
190 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
191 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
192 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
193 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
195 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
198 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
199 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
202 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
203 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
204 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
205 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
206 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
207 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
210 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
211 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
219 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
220 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
221 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
222 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
224 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
225 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
226 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
227 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
228 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
229 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
230 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
231 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
232 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
233 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
234 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
235 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
236 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
237 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
238 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
239 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
240 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
246 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
247 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
255 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
256 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
257 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
260 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
261 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
262 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
263 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
264 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
265 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
266 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
267 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
268 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
269 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
270 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
271 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
272 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
273 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
274 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
275 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
282 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
283 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
284 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
285 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
286 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
287 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
288 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
289 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
290 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
293 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
294 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
298 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
299 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
300 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
301 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
302 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
303 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
304 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
305 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
308 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
309 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
310 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
314 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
315 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
316 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
317 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
318 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
319 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
320 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
321 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
322 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
323 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
324 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
325 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
326 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
327 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
328 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
329 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
330 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
331 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
332 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
333 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
334 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
335 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
336 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
337 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
338 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
339 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
340 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
341 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
342 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
343 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
344 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
345 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
346 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
347 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
348 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
349 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
350 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
351 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
352 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
353 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
354 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
355 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
356 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
357 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
358 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
359 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
360 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
361 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
362 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
363 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
364 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
365 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
366 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
367 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
368 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
369 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
370 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
371 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
372 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
373 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
374 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
375 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
376 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
377 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
378 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
379 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
380 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
381 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
382 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
383 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
384 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
385 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
386 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
387 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
388 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
389 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
390 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
391 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
392 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
393 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
394 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
395 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
396 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
397 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
398 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
399 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
400 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
401 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
402 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
403 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
404 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
405 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
406 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
407 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
408 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
409 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
410 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
411 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
412 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
413 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
414 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
415 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
416 2904699407
417 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
418 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
419 2906610324
420 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
421 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
422 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
423 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
424 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
425 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
426 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
427 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
428 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
429 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
430 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
431 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
432 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
433 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
434 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
435 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
436 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
437 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
438 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
439 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
440 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
441 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
442 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
443 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
444 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
445 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
446 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
447 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
448 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
449 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
450 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
451 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
452 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
453 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
454 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
455 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
456 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
457 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
458 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
459 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
460 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
461 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
462 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
463 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
464 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
465 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
466 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
467 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
468 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
469 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
470 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
471 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
472 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
473 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 85.64
Metatranscriptomes 0
Isolates 14.36

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.89
Nodule 11.76
Rhizoplane 6.62
Rhizosphere 60.54
Stem 0
Stem Tuber 0
Unclassified 0.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081540_1003782 3300005983 Bacteria 11839
2 JGI24739J22299_10255793 3300001989 Bacteria 513
3 JGI25165J46597_1012306 3300003214 Bacteria 1199
4 JGI25153J46596_10027530 3300003215 Bacteria 1989
5 JGI25160J50197_1027724 3300003354 Bacteria 1535
6 JGI25161J50226_1016812 3300003374 Bacteria 777
7 JGI25404J52841_10002913 3300003659 Bacteria 3315
8 JGI25404J52841_10037809 3300003659 Bacteria 1026
9 Ga0055542_1001822 3300003762 Bacteria 8723
10 Ga0055529_1022046 3300003763 Bacteria 790
11 Ga0055543_1002520 3300004625 Bacteria 5988
12 Ga0065165_1001425 3300005262 Bacteria 25961
13 Ga0065165_1001827 3300005262 Bacteria 20819
14 Ga0065715_10457851 3300005293 Bacteria 819
15 Ga0065707_10618365 3300005295 Bacteria 680
16 Ga0070658_11240907 3300005327 Bacteria 648
17 Ga0070676_10152168 3300005328 Bacteria 1482
18 Ga0070683_100043990 3300005329 Bacteria 4117
19 Ga0070690_100188154 3300005330 Bacteria 1430
20 Ga0070690_100796797 3300005330 Bacteria 732
21 Ga0070670_100369149 3300005331 Bacteria 1263
22 Ga0070680_100150865 3300005336 Bacteria 1951
23 Ga0070680_100534929 3300005336 Bacteria 1004
24 Ga0070682_100073277 3300005337 Bacteria 2196
25 Ga0070691_10237344 3300005341 Bacteria 973
26 Ga0070661_100155093 3300005344 Bacteria 1732
27 Ga0070692_10082899 3300005345 Bacteria 1730
28 Ga0070668_100035749 3300005347 Bacteria 3789
29 Ga0070669_100178346 3300005353 Bacteria 1660
30 Ga0070675_100431536 3300005354 Bacteria 1179
31 Ga0070671_100029123 3300005355 Bacteria 4552
32 Ga0070671_100314747 3300005355 Bacteria 1333
33 Ga0070671_100722234 3300005355 Bacteria 865
34 Ga0070659_100504523 3300005366 Bacteria 1031
35 Ga0070667_100242113 3300005367 Bacteria 1611
36 Ga0070667_101521175 3300005367 Bacteria 629
37 Ga0070709_10513655 3300005434 Bacteria 912
38 Ga0070714_100077856 3300005435 Bacteria 2881
39 Ga0070714_100317187 3300005435 Bacteria 1457
40 Ga0070714_100568532 3300005435 Bacteria 1087
41 Ga0070713_100050840 3300005436 Bacteria 3426
42 Ga0070710_10048568 3300005437 Bacteria 2371
43 Ga0070710_10892247 3300005437 Bacteria 641
44 Ga0070711_100122874 3300005439 Bacteria 1923
45 Ga0070694_100072864 3300005444 Bacteria 2370
46 Ga0070678_100037898 3300005456 Bacteria 3389
47 Ga0070662_100192294 3300005457 Bacteria 1615
48 Ga0070681_10180180 3300005458 Bacteria 2034
49 Ga0070681_10634681 3300005458 Bacteria 983
50 Ga0068867_100194625 3300005459 Bacteria 1620
51 Ga0070706_101556186 3300005467 Bacteria 604
52 Ga0070698_100083484 3300005471 Bacteria 3183
53 Ga0070679_100282072 3300005530 Bacteria 1614
54 Ga0070684_100045735 3300005535 Bacteria 3790
55 Ga0070697_100500310 3300005536 Bacteria 1063
56 Ga0068853_100037492 3300005539 Bacteria 4124
57 Ga0068853_100515760 3300005539 Bacteria 1130
58 Ga0070672_100614409 3300005543 Bacteria 947
59 Ga0070672_100716317 3300005543 Bacteria 877
60 Ga0070686_100096006 3300005544 Bacteria 1993
61 Ga0070686_100193609 3300005544 Bacteria 1453
62 Ga0070695_100232036 3300005545 Bacteria 1334
63 Ga0070696_100102890 3300005546 Bacteria 2049
64 Ga0070693_100774190 3300005547 Bacteria 709
65 Ga0070693_100792643 3300005547 Bacteria 702
66 Ga0070665_100150594 3300005548 Bacteria 2329
67 Ga0070665_100199952 3300005548 Bacteria 1999
68 Ga0070704_100172948 3300005549 Bacteria 1720
69 Ga0068855_100026149 3300005563 Bacteria 6982
70 Ga0070664_100639108 3300005564 Bacteria 988
71 Ga0068857_100136160 3300005577 Bacteria 2217
72 Ga0068854_100068550 3300005578 Bacteria 2587
73 Ga0068854_100350676 3300005578 Bacteria 1208
74 Ga0068856_100023428 3300005614 Bacteria 6002
75 Ga0068856_100984568 3300005614 Bacteria 862
76 Ga0070702_100032768 3300005615 Bacteria 2853
77 Ga0070702_101185101 3300005615 Bacteria 615
78 Ga0068852_100010196 3300005616 Bacteria 7005
79 Ga0068852_100737572 3300005616 Bacteria 997
80 Ga0068852_101216374 3300005616 Bacteria 774
81 Ga0068859_100060634 3300005617 Bacteria 3812
82 Ga0068864_100172836 3300005618 Bacteria 1971
83 Ga0068864_100342636 3300005618 Bacteria 1409
84 Ga0068866_10126576 3300005718 Bacteria 1447
85 Ga0068861_100492507 3300005719 Bacteria 1106
86 Ga0068851_10059840 3300005834 Bacteria 1949
87 Ga0068851_10172939 3300005834 Bacteria 1193
88 Ga0068870_10021787 3300005840 Bacteria 3140
89 Ga0068863_100126079 3300005841 Bacteria 2442
90 Ga0068863_100552856 3300005841 Bacteria 1137
91 Ga0068858_100123528 3300005842 Bacteria 2422
92 Ga0068860_100150834 3300005843 Bacteria 2238
93 Ga0068860_100742938 3300005843 Bacteria 992
94 Ga0068862_100463296 3300005844 Bacteria 1197
95 Ga0081455_10004342 3300005937 Bacteria 15952
96 Ga0081538_10056238 3300005981 Bacteria 2306
97 Ga0081540_1001023 3300005983 Bacteria 25059
98 Ga0081540_1009882 3300005983 Bacteria 6519
99 Ga0070717_10708318 3300006028 Bacteria 915
100 Ga0075365_10059349 3300006038 Bacteria 2549
101 Ga0075365_10136967 3300006038 Bacteria 1697
102 Ga0075365_10168469 3300006038 Bacteria 1528
103 Ga0075365_10356944 3300006038 Bacteria 1030
104 Ga0075368_10023629 3300006042 Bacteria 2350
105 Ga0075368_10071988 3300006042 Bacteria 1397
106 Ga0075364_10038869 3300006051 Bacteria 3084
107 Ga0075364_10076059 3300006051 Bacteria 2215
108 Ga0075364_10109275 3300006051 Bacteria 1844
109 Ga0075364_10423659 3300006051 Bacteria 909
110 Ga0075364_10784946 3300006051 Bacteria 649
111 Ga0070715_10111121 3300006163 Bacteria 1293
112 Ga0070716_100085363 3300006173 Bacteria 1896
113 Ga0070712_100160485 3300006175 Bacteria 1736
114 Ga0070712_100230463 3300006175 Bacteria 1471
115 Ga0075362_10058622 3300006177 Bacteria 1737
116 Ga0075367_10027494 3300006178 Bacteria 3237
117 Ga0075367_10052789 3300006178 Bacteria 2407
118 Ga0075367_10092408 3300006178 Bacteria 1842
119 Ga0075367_10166575 3300006178 Bacteria 1372
120 Ga0075367_10227601 3300006178 Bacteria 1168
121 Ga0075367_10572369 3300006178 Bacteria 718
122 Ga0075369_10044450 3300006186 Bacteria 1908
123 Ga0075369_10105875 3300006186 Bacteria 1265
124 Ga0075366_10127232 3300006195 Bacteria 1537
125 Ga0097621_100435026 3300006237 Bacteria 1179
126 Ga0097621_101351369 3300006237 Bacteria 674
127 Ga0075370_10024706 3300006353 Bacteria 3321
128 Ga0075370_10163164 3300006353 Bacteria 1308
129 Ga0075370_10398283 3300006353 Bacteria 826
130 Ga0068871_100319131 3300006358 Bacteria 1367
131 Ga0075428_100179316 3300006844 Bacteria 2293
132 Ga0075430_101203073 3300006846 Bacteria 624
133 Ga0075433_10383363 3300006852 Bacteria 1241
134 Ga0075433_11443397 3300006852 Bacteria 595
135 Ga0075434_100053726 3300006871 Bacteria 4002
136 Ga0068865_100196703 3300006881 Bacteria 1563
137 Ga0097620_100060640 3300006931 Bacteria 3812
138 Ga0099825_1035219 3300006941 Bacteria 1804
139 Ga0099824_1006625 3300006942 Bacteria 15796
140 Ga0099822_1003046 3300006943 Bacteria 21323
141 Ga0099823_1032609 3300006944 Bacteria 4230
142 Ga0075435_100249441 3300007076 Bacteria 1511
143 Ga0099795_10182422 3300007788 Bacteria 877
144 Ga0105250_10093077 3300009092 Bacteria 1227
145 Ga0105250_10104947 3300009092 Bacteria 1155
146 Ga0105240_10007824 3300009093 Bacteria 15430
147 Ga0105240_10533996 3300009093 Bacteria 1300
148 Ga0105240_10574755 3300009093 Bacteria 1244
149 Ga0105240_11157263 3300009093 Bacteria 821
150 Ga0111539_12630987 3300009094 Bacteria 583
151 Ga0105245_10018572 3300009098 Bacteria 6081
152 Ga0105245_10050191 3300009098 Bacteria 3738
153 Ga0105245_10152444 3300009098 Bacteria 2186
154 Ga0105247_10022617 3300009101 Bacteria 3786
155 Ga0105247_10058711 3300009101 Bacteria 2381
156 Ga0105241_10016719 3300009174 Bacteria 5383
157 Ga0105241_10105146 3300009174 Bacteria 2251
158 Ga0105241_10190218 3300009174 Bacteria 1708
159 Ga0105241_10207439 3300009174 Bacteria 1640
160 Ga0105242_10041047 3300009176 Bacteria 3730
161 Ga0105242_11174129 3300009176 Bacteria 785
162 Ga0105248_10014395 3300009177 Bacteria 8707
163 Ga0105248_10184530 3300009177 Bacteria 2351
164 Ga0105237_10006994 3300009545 Bacteria 12431
165 Ga0105237_10014182 3300009545 Bacteria 8344
166 Ga0105237_10051786 3300009545 Bacteria 4123
167 Ga0105238_10017485 3300009551 Bacteria 7290
168 Ga0105238_10167303 3300009551 Bacteria 2174
169 Ga0105238_10487148 3300009551 Bacteria 1233
170 Ga0105238_10507575 3300009551 Bacteria 1207
171 Ga0105249_10709161 3300009553 Bacteria 1067
172 Ga0105249_10817340 3300009553 Bacteria 996
173 Ga0105249_11761062 3300009553 Bacteria 692
174 Ga0105249_12329793 3300009553 Bacteria 608
175 Ga0099796_10013574 3300010159 Bacteria 2330
176 Ga0099796_10021176 3300010159 Bacteria 1999
177 Ga0105239_10033687 3300010375 Bacteria 5624
178 Ga0105239_10036816 3300010375 Bacteria 5368
179 Ga0105239_10039087 3300010375 Bacteria 5198
180 Ga0105239_10080967 3300010375 Bacteria 3573
181 Ga0105239_10232880 3300010375 Bacteria 2067
182 Ga0105239_10392339 3300010375 Bacteria 1570
183 Ga0105239_10565564 3300010375 Bacteria 1295
184 Ga0105239_11493420 3300010375 Bacteria 781
185 Ga0105239_11596504 3300010375 Bacteria 754
186 Ga0105246_10059294 3300011119 Bacteria 2655
187 Ga0105246_10075663 3300011119 Bacteria 2384
188 Ga0105246_10501125 3300011119 Bacteria 1031
189 Ga0105246_10513206 3300011119 Bacteria 1020
190 Ga0157371_10505736 3300013102 Bacteria 892
191 Ga0157370_10292323 3300013104 Bacteria 1505
192 Ga0157370_10337781 3300013104 Bacteria 1389
193 Ga0157374_10016963 3300013296 Bacteria 6410
194 Ga0157374_10086155 3300013296 Bacteria 2988
195 Ga0157378_10105960 3300013297 Bacteria 2571
196 Ga0163162_10648196 3300013306 Bacteria 1180
197 Ga0163162_10992031 3300013306 Bacteria 949
198 Ga0163162_11311363 3300013306 Bacteria 823
199 Ga0157375_10026462 3300013308 Bacteria 5407
200 Ga0157375_10091258 3300013308 Bacteria 3107
201 Ga0157375_10621775 3300013308 Bacteria 1238
202 Ga0163163_10116866 3300014325 Bacteria 2699
203 Ga0163163_10502685 3300014325 Bacteria 1274
204 Ga0163163_10977946 3300014325 Bacteria 910
205 Ga0163163_11722211 3300014325 Bacteria 687
206 Ga0157379_10016160 3300014968 Bacteria 6565
207 Ga0157379_10272934 3300014968 Bacteria 1538
208 Ga0157379_11187925 3300014968 Bacteria 733
209 Ga0157376_10168012 3300014969 Bacteria 1995
210 Ga0157376_10224466 3300014969 Bacteria 1742
211 Ga0157376_11463930 3300014969 Bacteria 715
212 Ga0163161_10598690 3300017792 Bacteria 909
213 Ga0213876_10665601 3300021384 Bacteria 554
214 Ga0209563_101608 3300025230 Bacteria 5843
215 Ga0209677_105532 3300025253 Bacteria 3269
216 Ga0209148_1000333 3300025254 Bacteria 64490
217 Ga0209233_1002558 3300025261 Bacteria 6631
218 Ga0209233_1014185 3300025261 Bacteria 2253
219 Ga0209233_1016510 3300025261 Bacteria 2032
220 Ga0209455_1004271 3300025272 Bacteria 4744
221 Ga0209455_1006362 3300025272 Bacteria 3497
222 Ga0209455_1023133 3300025272 Bacteria 1171
223 Ga0209758_1008100 3300025297 Bacteria 6924
224 Ga0209758_1084937 3300025297 Bacteria 945
225 Ga0207426_1002293 3300025302 Bacteria 12619
226 Ga0207426_1012030 3300025302 Bacteria 3269
227 Ga0207426_1040946 3300025302 Bacteria 1440
228 Ga0209257_1093642 3300025304 Bacteria 745
229 Ga0207697_10129446 3300025315 Bacteria 1090
230 Ga0207656_10067441 3300025321 Bacteria 1584
231 Ga0207696_1015201 3300025711 Bacteria 2614
232 Ga0207653_10177712 3300025885 Bacteria 795
233 Ga0207692_10078545 3300025898 Bacteria 1759
234 Ga0207642_10095555 3300025899 Bacteria 1479
235 Ga0207642_10487898 3300025899 Bacteria 752
236 Ga0207710_10052982 3300025900 Bacteria 1825
237 Ga0207710_10297562 3300025900 Bacteria 815
238 Ga0207688_10021119 3300025901 Bacteria 3555
239 Ga0207680_11096586 3300025903 Bacteria 569
240 Ga0207647_10120087 3300025904 Bacteria 1550
241 Ga0207647_10140190 3300025904 Bacteria 1417
242 Ga0207647_10161051 3300025904 Bacteria 1309
243 Ga0207685_10306781 3300025905 Bacteria 787
244 Ga0207699_10019652 3300025906 Bacteria 3607
245 Ga0207699_10031280 3300025906 Bacteria 2987
246 Ga0207645_10086892 3300025907 Bacteria 2009
247 Ga0207643_10213374 3300025908 Bacteria 1179
248 Ga0207654_10004645 3300025911 Bacteria 6939
249 Ga0207654_10043627 3300025911 Bacteria 2543
250 Ga0207707_10076306 3300025912 Bacteria 2925
251 Ga0207695_10000378 3300025913 Bacteria 101352
252 Ga0207695_10194549 3300025913 Bacteria 1944
253 Ga0207695_10320231 3300025913 Bacteria 1440
254 Ga0207671_10003481 3300025914 Bacteria 15659
255 Ga0207671_10069229 3300025914 Bacteria 2631
256 Ga0207693_10057837 3300025915 Bacteria 3038
257 Ga0207660_10105534 3300025917 Bacteria 2111
258 Ga0207660_10373710 3300025917 Bacteria 1145
259 Ga0207649_10109449 3300025920 Bacteria 1843
260 Ga0207652_10032578 3300025921 Bacteria 4383
261 Ga0207694_10073412 3300025924 Bacteria 2676
262 Ga0207694_10182390 3300025924 Bacteria 1703
263 Ga0207694_10804470 3300025924 Bacteria 794
264 Ga0207650_10154616 3300025925 Bacteria 1813
265 Ga0207650_10193039 3300025925 Bacteria 1628
266 Ga0207659_11249477 3300025926 Bacteria 638
267 Ga0207687_10452632 3300025927 Bacteria 1065
268 Ga0207700_10037982 3300025928 Bacteria 3492
269 Ga0207664_10275230 3300025929 Bacteria 1476
270 Ga0207664_10576673 3300025929 Bacteria 1010
271 Ga0207664_10692947 3300025929 Bacteria 916
272 Ga0207644_10311024 3300025931 Bacteria 1272
273 Ga0207644_10473930 3300025931 Bacteria 1030
274 Ga0207690_10078689 3300025932 Bacteria 2295
275 Ga0207690_11404376 3300025932 Bacteria 584
276 Ga0207706_10203439 3300025933 Bacteria 1736
277 Ga0207686_11153679 3300025934 Bacteria 633
278 Ga0207709_10365266 3300025935 Bacteria 1094
279 Ga0207670_10820819 3300025936 Bacteria 776
280 Ga0207669_10027657 3300025937 Bacteria 3109
281 Ga0207704_11058090 3300025938 Bacteria 688
282 Ga0207665_10943387 3300025939 Bacteria 685
283 Ga0207691_10414684 3300025940 Bacteria 1148
284 Ga0207691_10807130 3300025940 Bacteria 788
285 Ga0207711_10238460 3300025941 Bacteria 1667
286 Ga0207689_10015283 3300025942 Bacteria 6497
287 Ga0207689_10027575 3300025942 Bacteria 4752
288 Ga0207661_10002756 3300025944 Bacteria 12095
289 Ga0207667_10334331 3300025949 Bacteria 1546
290 Ga0207667_10859980 3300025949 Bacteria 901
291 Ga0207712_10162613 3300025961 Bacteria 1737
292 Ga0207668_10032823 3300025972 Bacteria 3435
293 Ga0207668_10744041 3300025972 Bacteria 864
294 Ga0207640_10023769 3300025981 Bacteria 3688
295 Ga0207640_10275754 3300025981 Bacteria 1318
296 Ga0207640_10906734 3300025981 Bacteria 770
297 Ga0207658_10137222 3300025986 Bacteria 1974
298 Ga0207658_10567358 3300025986 Bacteria 1017
299 Ga0207658_10763919 3300025986 Bacteria 876
300 Ga0207658_10938785 3300025986 Bacteria 788
301 Ga0207703_10113670 3300026035 Bacteria 2314
302 Ga0207639_10066676 3300026041 Bacteria 2799
303 Ga0207678_10014899 3300026067 Bacteria 6838
304 Ga0207708_10234254 3300026075 Bacteria 1475
305 Ga0207702_11073317 3300026078 Bacteria 799
306 Ga0207641_10370707 3300026088 Bacteria 1369
307 Ga0207648_10411499 3300026089 Bacteria 1227
308 Ga0207676_10174073 3300026095 Bacteria 1878
309 Ga0207676_10295286 3300026095 Bacteria 1477
310 Ga0207674_10024494 3300026116 Bacteria 6449
311 Ga0207675_100041289 3300026118 Bacteria 4308
312 Ga0207675_100055763 3300026118 Bacteria 3687
313 Ga0207683_10010327 3300026121 Bacteria 7963
314 Ga0207683_10039433 3300026121 Bacteria 4121
315 Ga0207698_10181013 3300026142 Bacteria 1867
316 Ga0209389_1000019 3300027296 Bacteria 172067
317 Ga0209589_1000007 3300027357 Bacteria 425699
318 Ga0209489_100008 3300027361 Bacteria 425699
319 Ga0209489_100033 3300027361 Bacteria 172166
320 Ga0209700_100009 3300027363 Bacteria 425699
321 Ga0209700_100012 3300027363 Bacteria 357892
322 Ga0209179_1041756 3300027512 Bacteria 967
323 Ga0209813_10145054 3300027866 Bacteria 846
324 Ga0268266_10594555 3300028379 Bacteria 1063
325 Ga0268266_10864595 3300028379 Bacteria 874
326 Ga0268265_10390283 3300028380 Bacteria 1283
327 Ga0307512_10270981 3300030522 Bacteria 822
328 Ga0307513_10084532 3300031456 Bacteria 3259
329 Ga0307509_10068899 3300031507 Bacteria 3700
330 Ga0307516_10165589 3300031730 Bacteria 1956
331 Ga0307507_10277768 3300033179 Bacteria 1051
332 Ga0307510_10022577 3300033180 Bacteria 7305
333 Ga0307510_10240282 3300033180 Bacteria 1306
334 Ga0315911_1000012 3300033442 Bacteria 248988
335 Ga0373930_0019693 3300034816 Bacteria 1308
336 Ga0373926_0101149 3300035083 Bacteria 1078
337 Ga0373934_0185251 3300035086 Bacteria 856
338 Ga0373944_0036097 3300035089 Bacteria 1509
339 Ga0373923_0057651 3300035111 Bacteria 1643
340 Ga0373923_0067969 3300035111 Bacteria 1525
341 Ga0373932_0226397 3300035112 Bacteria 674
342 Ga0373945_0007911 3300035116 Bacteria 3451
343 Ga0373945_0298064 3300035116 Bacteria 690
344 Ga0373953_0037801 3300035117 Bacteria 1907
345 Ga0373954_0040360 3300035118 Bacteria 2174
346 Ga0373956_0052951 3300035119 Bacteria 1826
347 Ga0373943_0001976 3300035170 Bacteria 9276
348 Ga0373943_0031820 3300035170 Bacteria 2505
349 Ga0373946_0015298 3300035171 Bacteria 2907
350 Ga0373955_0026967 3300035172 Bacteria 2965
351 Ga0373935_0010925 3300035692 Bacteria 5452
352 Ga0373935_0477695 3300035692 Bacteria 903
353 Ga0373927_0076635 3300035695 Bacteria 2165
354 Ga0373927_0077552 3300035695 Bacteria 2152
355 Ga0373927_0087521 3300035695 Bacteria 2022
356 Ga0373927_0293693 3300035695 Bacteria 1069
357 Ga0373933_0060867 3300035724 Bacteria 2277
358 Ga0373933_0314488 3300035724 Bacteria 1015
359 Ga0373947_0014281 3300035725 Bacteria 4555
360 Ga0373947_0023710 3300035725 Bacteria 3572
361 Ga0373947_0137916 3300035725 Bacteria 1562
362 Ga0373937_0701606 3300036401 Bacteria 958
363 Ga0373925_0009031 3300037068 Bacteria 7256
364 Ga0373925_0023599 3300037068 Bacteria 4488
365 Ga0373925_0357947 3300037068 Bacteria 1186
366 Ga0373925_0796800 3300037068 Bacteria 779
367 Ga0395898_0290341 3300037466 Bacteria 1560
368 Ga0395905_0014770 3300037471 Bacteria 7445
369 Ga0395905_0095485 3300037471 Bacteria 2790
370 Ga0395905_0292335 3300037471 Bacteria 1516
371 Ga0395901_0103718 3300038443 Bacteria 2984
372 Ga0395901_0763441 3300038443 Bacteria 959
373 Ga0436365_0174183 3300039437 Bacteria 721
374 Ga0436363_1048974 3300039450 Bacteria 963
375 Ga0451804_1148948 3300041463 Bacteria 676
376 Ga0451853_3757683 3300041512 Bacteria 799
377 Ga0466969_0036637 3300044656 Bacteria 2477
378 Ga0466972_0377642 3300044658 Bacteria 664
379 Ga0466966_0000632 3300044684 Bacteria 22387
380 Ga0466966_0640803 3300044684 Unclassified 640
381 Ga0466961_0000897 3300044693 Bacteria 18504
382 Ga0466963_0234494 3300044694 Bacteria 1286
383 Ga0466968_0016262 3300044735 Bacteria 2960
384 Ga0466957_0018547 3300044842 Bacteria 4087
385 Ga0466960_0071671 3300044901 Bacteria 1726
386 Ga0466959_0004435 3300045049 Bacteria 9399
387 Ga0466967_0055810 3300045976 Bacteria 3480
388 Ga0466967_0095059 3300045976 Bacteria 2715
389 Ga0466967_0394449 3300045976 Bacteria 1346
390 Ga0495617_108033 3300046452 Bacteria 901
391 Ga0495592_0151571 3300046454 Bacteria 1603
392 Ga0495592_0251944 3300046454 Bacteria 1166
393 Ga0495603_0112175 3300046455 Bacteria 1590
394 Ga0495603_0149362 3300046455 Bacteria 1358
395 Ga0495603_0317096 3300046455 Bacteria 895
396 Ga0495590_0124839 3300046457 Bacteria 923
397 Ga0495629_0015463 3300046459 Bacteria 5480
398 Ga0495629_0094122 3300046459 Bacteria 2091
399 Ga0495629_0812797 3300046459 Bacteria 616
400 Ga0495641_0028703 3300046461 Bacteria 2689
401 Ga0495651_0046976 3300046462 Bacteria 3340
402 Ga0495650_0119189 3300046471 Bacteria 973
403 Ga0495580_0035726 3300046472 Bacteria 3572
404 Ga0495582_0001981 3300046473 Bacteria 11486
405 Ga0495582_0006519 3300046473 Bacteria 6478
406 Ga0495582_0044026 3300046473 Bacteria 2458
407 Ga0495605_0217458 3300046474 Bacteria 827
408 Ga0495639_0001516 3300046475 Bacteria 10355
409 Ga0495639_0295086 3300046475 Bacteria 808
410 Ga0495662_0064711 3300046476 Bacteria 1767
411 Ga0495664_0003288 3300046477 Bacteria 8792
412 Ga0495664_0010823 3300046477 Bacteria 5128
413 Ga0495664_0232243 3300046477 Bacteria 1116
414 Ga0495584_0144960 3300046491 Bacteria 1206
415 Ga0495584_0267457 3300046491 Bacteria 869
416 Ga0495585_0055134 3300046492 Bacteria 2197
417 Ga0495594_0001191 3300046499 Bacteria 13605
418 Ga0495594_0051177 3300046499 Bacteria 2273
419 Ga0495596_0142445 3300046500 Bacteria 931
420 Ga0495606_0206922 3300046507 Bacteria 1114
421 Ga0495608_0027531 3300046511 Bacteria 3868
422 Ga0495608_0497030 3300046511 Bacteria 739
423 Ga0495610_0030089 3300046512 Bacteria 2850
424 Ga0495616_0077636 3300046513 Bacteria 1594
425 Ga0495616_0393605 3300046513 Bacteria 570
426 Ga0495618_0118037 3300046514 Bacteria 1699
427 Ga0495618_0237685 3300046514 Bacteria 1146
428 Ga0495628_0016128 3300046516 Bacteria 6234
429 Ga0495628_0026661 3300046516 Bacteria 4708
430 Ga0495628_0082016 3300046516 Bacteria 2505
431 Ga0495628_0277731 3300046516 Bacteria 1245
432 Ga0495628_0673116 3300046516 Bacteria 733
433 Ga0495630_0008198 3300046517 Bacteria 7502
434 Ga0495632_0062891 3300046519 Bacteria 1798
435 Ga0495637_0107307 3300046520 Bacteria 1086
436 Ga0495643_0259117 3300046522 Bacteria 808
437 Ga0495642_0056652 3300046528 Bacteria 1619
438 Ga0495652_0014451 3300046529 Bacteria 7086
439 Ga0495652_0032544 3300046529 Bacteria 4559
440 Ga0495652_0172339 3300046529 Bacteria 1669
441 Ga0495652_0179703 3300046529 Bacteria 1625
442 Ga0495652_0568529 3300046529 Bacteria 777
443 Ga0495665_0000574 3300046531 Bacteria 18692
444 Ga0495665_0295423 3300046531 Bacteria 830
445 Ga0495640_0029121 3300046533 Bacteria 3969
446 Ga0495640_0120909 3300046533 Bacteria 1702
447 Ga0495587_0275312 3300046536 Bacteria 944
448 Ga0495597_0182471 3300046542 Bacteria 848
449 Ga0495645_0228443 3300046543 Bacteria 1248
450 Ga0495622_0004364 3300046557 Bacteria 6585
451 Ga0495622_0043358 3300046557 Bacteria 2091
452 Ga0495622_0076485 3300046557 Bacteria 1542
453 Ga0495622_0182817 3300046557 Bacteria 940
454 Ga0495667_0087745 3300046559 Bacteria 2017
455 Ga0495667_0325448 3300046559 Bacteria 972
456 Ga0495656_0246001 3300046615 Bacteria 902
457 Ga0495668_0011860 3300046616 Bacteria 5195
458 Ga0495634_0003485 3300046642 Bacteria 12608
459 Ga0495634_0011719 3300046642 Bacteria 6375
460 Ga0495634_0116792 3300046642 Bacteria 1711
461 Ga0495625_0072248 3300046660 Bacteria 2420
462 Ga0495625_0396719 3300046660 Bacteria 863
463 Ga0495635_0016363 3300046663 Bacteria 5178
464 Ga0495635_0030796 3300046663 Bacteria 3727
465 Ga0495635_0506564 3300046663 Bacteria 794
466 Ga0495661_0229565 3300046665 Bacteria 958
467 Ga0495588_0098374 3300046674 Bacteria 1536
468 Ga0495588_0368420 3300046674 Bacteria 755
469 Ga0495657_0035840 3300046675 Bacteria 3435
470 Ga0495657_0049630 3300046675 Bacteria 2825
471 Ga0495599_0028675 3300046678 Bacteria 3488
472 Ga0495623_0058377 3300046679 Bacteria 2426
473 Ga0495646_0046096 3300046680 Bacteria 2660
474 Ga0495646_0316556 3300046680 Bacteria 823
475 Ga0495658_0003379 3300046683 Bacteria 7908
476 Ga0495658_0006988 3300046683 Bacteria 5568
477 Ga0495669_0078077 3300046684 Bacteria 1517
478 Ga0495669_0150283 3300046684 Bacteria 1102
479 Ga0495669_0294687 3300046684 Bacteria 781
480 Ga0495613_0007863 3300046689 Bacteria 7929
481 Ga0495624_0029342 3300046690 Bacteria 3589
482 Ga0495624_0243840 3300046690 Bacteria 1087
483 Ga0495649_0091977 3300046694 Bacteria 1616
484 Ga0495589_0152101 3300046794 Bacteria 1105
485 Ga0495600_0007070 3300046809 Bacteria 6857
486 Ga0495600_0022089 3300046809 Bacteria 4083
487 Ga0495581_0007281 3300047315 Bacteria 6400
488 Ga0495581_0009697 3300047315 Bacteria 5574
489 Ga0495581_0072971 3300047315 Bacteria 1986
490 Ga0495581_0122587 3300047315 Bacteria 1513
491 Ga0495604_0030745 3300047317 Bacteria 4262
492 Ga0495604_0069358 3300047317 Bacteria 2672
493 Ga0495674_0006663 3300047319 Bacteria 11066
494 Ga0495674_0014462 3300047319 Bacteria 7386
495 Ga0495674_0019168 3300047319 Bacteria 6355
496 Ga0495674_0116318 3300047319 Bacteria 2262
497 Ga0495672_0154739 3300047320 Bacteria 1185
498 Ga0495676_0022272 3300047321 Bacteria 5516
499 Ga0495676_0028615 3300047321 Bacteria 4755
500 Ga0495676_0059215 3300047321 Bacteria 3009
501 Ga0495676_0115441 3300047321 Bacteria 1963
502 Ga0495680_0001058 3300047322 Bacteria 30479
503 Ga0495675_0036037 3300047444 Bacteria 3157
504 Ga0495679_143139 3300047446 Bacteria 645
505 Ga0495673_0188048 3300047469 Bacteria 778
506 Ga0495684_0056700 3300047471 Bacteria 2986
507 Ga0495684_0065325 3300047471 Bacteria 2766
508 Ga0495686_0105726 3300047472 Bacteria 1693
509 Ga0495593_0002074 3300047673 Bacteria 11971
510 Ga0496100_0050500 3300048903 Bacteria 2695
511 Ga0496100_0178255 3300048903 Bacteria 1535
512 Ga0496101_0031151 3300048904 Bacteria 3746
513 Ga0496101_0081607 3300048904 Bacteria 2392
514 Ga0496101_0275937 3300048904 Bacteria 1313
515 Ga0496101_0474136 3300048904 Bacteria 988
516 Ga0496102_0163089 3300048905 Bacteria 2097
517 Ga0496102_0227118 3300048905 Bacteria 1760
518 Ga0496102_0417826 3300048905 Bacteria 1260
519 Ga0496102_0685879 3300048905 Bacteria 947
520 Ga0496103_0224083 3300048906 Bacteria 1209
521 Ga0496103_0365741 3300048906 Bacteria 927
522 Ga0496103_0405239 3300048906 Bacteria 876
523 Ga0496104_0001403 3300048907 Bacteria 20868
524 Ga0496104_0046472 3300048907 Bacteria 4089
525 Ga0496104_0296133 3300048907 Bacteria 1530
526 Ga0496104_0371610 3300048907 Bacteria 1342
527 Ga0496105_0003256 3300048908 Bacteria 11964
528 Ga0496105_0003429 3300048908 Bacteria 11732
529 Ga0496105_0016752 3300048908 Bacteria 5857
530 Ga0496105_0120773 3300048908 Bacteria 2161
531 Ga0496106_0036824 3300048909 Bacteria 3660
532 Ga0496106_0065254 3300048909 Bacteria 2772
533 Ga0496106_0065821 3300048909 Bacteria 2759
534 Ga0496106_0361103 3300048909 Bacteria 1167
535 Ga0496107_0057187 3300048910 Bacteria 2819
536 Ga0496107_0060935 3300048910 Bacteria 2731
537 Ga0496107_0513500 3300048910 Bacteria 888
538 Ga0496108_0095003 3300048911 Bacteria 2538
539 Ga0496108_1707542 3300048911 Bacteria 518
540 Ga0496109_0257979 3300048912 Bacteria 1642
541 Ga0496110_0078604 3300048913 Bacteria 2937
542 Ga0496110_0124657 3300048913 Bacteria 2323
543 Ga0496111_0026704 3300048914 Bacteria 4078
544 Ga0496111_0651790 3300048914 Bacteria 768
545 Ga0496112_0186050 3300048915 Bacteria 2040
546 Ga0496112_0653929 3300048915 Bacteria 981
547 Ga0496112_0742057 3300048915 Bacteria 908
548 Ga0496113_0052825 3300048916 Bacteria 3036
549 Ga0496113_0096716 3300048916 Bacteria 2283
550 Ga0496113_0479725 3300048916 Bacteria 999
551 Ga0496113_0672002 3300048916 Bacteria 828
552 Ga0496114_0067248 3300048917 Bacteria 3006
553 Ga0496115_0115679 3300048918 Bacteria 2205
554 Ga0496115_0393112 3300048918 Bacteria 1126
555 Ga0496115_0561322 3300048918 Bacteria 911
556 Ga0496115_0565626 3300048918 Bacteria 907
557 Ga0496117_0068177 3300048920 Bacteria 2403
558 Ga0496117_0257027 3300048920 Bacteria 949
559 Ga0496118_0093540 3300048921 Bacteria 2059
560 Ga0496118_0248275 3300048921 Bacteria 1013
561 Ga0496119_0032305 3300048922 Bacteria 3490
562 Ga0496119_0304616 3300048922 Bacteria 784
563 Ga0496120_0002168 3300048923 Bacteria 20847
564 Ga0496121_0022709 3300048924 Bacteria 6072
565 Ga0496121_0044328 3300048924 Bacteria 3838
566 Ga0496121_0104779 3300048924 Bacteria 2172
567 Ga0496121_0164094 3300048924 Bacteria 1621
568 Ga0496121_0199501 3300048924 Bacteria 1427
569 Ga0496121_0228701 3300048924 Bacteria 1304
570 Ga0496121_0258872 3300048924 Bacteria 1202
571 Ga0496123_0131176 3300048926 Bacteria 1388
572 Ga0496123_0244532 3300048926 Bacteria 889
573 Ga0496124_0221230 3300048927 Bacteria 1424
574 Ga0496125_0241720 3300048928 Bacteria 1146
575 Ga0496126_0052295 3300048929 Bacteria 3713
576 Ga0496126_0084595 3300048929 Bacteria 2797
577 Ga0496126_0088380 3300048929 Bacteria 2729
578 Ga0496126_0168413 3300048929 Bacteria 1868
579 Ga0496126_0215012 3300048929 Bacteria 1617
580 Ga0496126_0263071 3300048929 Bacteria 1434
581 Ga0496126_0573434 3300048929 Bacteria 892
582 Ga0496126_0741285 3300048929 Bacteria 759
583 nmdc:mga03683_209384_c1 3300050489 Bacteria 897
584 nmdc:mga00v17_121643_c1 3300050491 Bacteria 1662
585 nmdc:mga00v17_259591_c1 3300050491 Bacteria 1127
586 nmdc:mga00v17_57092_c1 3300050491 Bacteria 2387
587 nmdc:mga0yw44_117563_c1 3300050492 Bacteria 1355
588 nmdc:mga0yw44_209937_c1 3300050492 Bacteria 1288
589 nmdc:mga0yw44_26598_c1 3300050492 Bacteria 3307
590 nmdc:mga06z11_105598_c1 3300050494 Bacteria 1552
591 nmdc:mga06z11_106290_c1 3300050494 Bacteria 1547
592 nmdc:mga06z11_219037_c1 3300050494 Bacteria 1112
593 nmdc:mga06z11_237629_c1 3300050494 Bacteria 1069
594 nmdc:mga06z11_525404_c1 3300050494 Bacteria 718
595 nmdc:mga06z11_79887_c1 3300050494 Bacteria 1752
596 nmdc:mga04h51_218085_c1 3300050495 Bacteria 755
597 nmdc:mga04h51_282680_c1 3300050495 Bacteria 672
598 nmdc:mga07m45_29166_c1 3300050496 Bacteria 3049
599 nmdc:mga0n895_63276_c1 3300050512 Bacteria 3658
600 nmdc:mga0rr50_781845_c1 3300050513 Bacteria 815
601 nmdc:mga08x19_382640_c1 3300050514 Bacteria 985
602 nmdc:mga0a205_204030_c1 3300050515 Bacteria 1866
603 nmdc:mga0sz30_412925_c1 3300050516 Bacteria 605
604 nmdc:mga0sz30_49188_c1 3300050516 Bacteria 1786
605 Ga0495601_0088421 3300053077 Bacteria 1992
606 Ga0495601_0115219 3300053077 Bacteria 1743
607 Ga0495612_0095074 3300053078 Bacteria 1265
608 Ga0495655_0048071 3300053083 Bacteria 1119
609 Ga0495595_0231888 3300053084 Bacteria 922
610 Ga0495619_0003483 3300053085 Bacteria 10158
611 Ga0495619_0147612 3300053085 Bacteria 1621
612 Ga0500651_0319360 3300053093 Bacteria 887
613 Ga0500566_0000192 3300053094 Bacteria 31868
614 Ga0500640_051554 3300053095 Bacteria 1799
615 Ga0500569_106686 3300053109 Bacteria 923
616 Ga0500572_000343 3300053111 Bacteria 16647
617 Ga0500595_021147 3300053119 Bacteria 2327
618 Ga0500595_044347 3300053119 Bacteria 1410
619 Ga0500614_077032 3300053123 Bacteria 926
620 Ga0500618_124908 3300053125 Bacteria 583
621 Ga0500559_0000552 3300053136 Bacteria 25939
622 Ga0500559_0118509 3300053136 Bacteria 1230
623 Ga0500577_0231544 3300053142 Bacteria 801
624 Ga0500590_140953 3300053148 Bacteria 1102
625 Ga0500603_015780 3300053150 Bacteria 1783
626 Ga0500622_0026971 3300053156 Bacteria 3030
627 Ga0500638_087756 3300053162 Bacteria 1469
628 Ga0500639_019826 3300053163 Bacteria 3546
629 Ga0500636_0015319 3300053177 Bacteria 4518
630 Ga0500637_0040579 3300053178 Bacteria 2630
631 Ga0500609_004988 3300053731 Bacteria 1819
632 Ga0500596_000906 3300053735 Bacteria 5925
633 2509147935 2508501128 Bacteria 8613869
634 2513626774 2513237092 Bacteria 8341956
635 2513643352 2513237094 Bacteria 8789602
636 2513655698 2513237096 Bacteria 8722461
637 2513673425 2513237098 Bacteria 9902361
638 2513862745 2513237137 Bacteria 9558895
639 2513875242 2513237139 Bacteria 8737671
640 2513916224 2513237145 Bacteria 8979722
641 2514014349 2513237161 Bacteria 8871253
642 2517890166 2517572143 Bacteria 9484767
643 2524464740 2524023210 Bacteria 9029266
644 2524538290 2524023228 Bacteria 10118060
645 2617349573 2617270735 Bacteria 9163226
646 2671121625 2667528175 Bacteria 7532676
647 2793067851 2791355197 Bacteria 8420563
648 2805919610 2802429603 Bacteria 8777136
649 2824663531 2824661429 Bacteria 9877870
650 2824678653 2824671348 Bacteria 8369588
651 2824695319 2824687955 Bacteria 8360029
652 2824700056 2824696289 Bacteria 8335049
653 2824707673 2824704595 Bacteria 9667483
654 2824757410 2824753945 Bacteria 9787441
655 2824768023 2824763712 Bacteria 9792355
656 2824780196 2824773399 Bacteria 8360218
657 2838130497 2838122688 Bacteria 8803140
658 2841942196 2841941048 Bacteria 8688029
659 2841955344 2841949485 Bacteria 8680857
660 2841971281 2841966195 Bacteria 8673214
661 2841981573 2841974524 Bacteria 8931498
662 2841987119 2841983080 Bacteria 8395090
663 2842042056 2842038055 Bacteria 8002051
664 2842050099 2842045827 Bacteria 8006841
665 2844321032 2844315083 Bacteria 8138177
666 2847932351 2847930680 Bacteria 9342022
667 2847943599 2847939898 Bacteria 8606328
668 2849077322 2849076700 Bacteria 7039503
669 2874614093 2874612657 Bacteria 8252029
670 2874624909 2874620515 Bacteria 8290088
671 2876765939 2876761206 Bacteria 10111113
672 2876766488 2876761206 Bacteria 10111113
673 2879091484 2879083081 Bacteria 8587928
674 2879102670 2879099564 Bacteria 10442239
675 2881371189 2881364244 Bacteria 7710352
676 2885382318 2885374607 Bacteria 8927485
677 2885388637 2885383462 Bacteria 9473874
678 2888391876 2888388044 Bacteria 7304136
679 2903728470 2903727486 Bacteria 8281579
680 2903776676 2903768456 Bacteria 9749579
681 2904669116 2904666416 Bacteria 8226587
682 2904692996 2904690495 Bacteria 9412302
683 2904706663
684 2904715571 2904711408 Bacteria 9771557
685 2906605319 2906602504 Bacteria 8295279
686 2906612062
687 2906640288 2906635258 Bacteria 8601019
688 2906645422 2906643746 Bacteria 8722424
689 2906663616 2906660503 Bacteria 8595048
690 2908757980 2908756301 Bacteria 8864324
691 2922363553 2922361189 Bacteria 7436256
692 2929620192 2929615660 Bacteria 9193770
693 2929629505 2929624759 Bacteria 9339455
694 2932791550 2932784394 Bacteria 9704911
695 2932799326 2932794094 Bacteria 7915132
696 2932816812 2932809354 Bacteria 9135765
697 2932824011 2932818245 Bacteria 9955613
698 2933582109 2933577622 Bacteria 9116884
699 2935621195 2935616580 Bacteria 9032984
700 2935643485 2935638405 Bacteria 10015038
701 2935671192 2935665750 Bacteria 9571747
702 2935681205 2935675223 Bacteria 9928132
703 2935689456 2935684952 Bacteria 9590419
704 2935700029 2935694250 Bacteria 9291695
705 2935710761 2935703347 Bacteria 10242284
706 2935720707 2935713505 Bacteria 9608509
707 2935727982 2935722832 Bacteria 9608746
708 2935737422 2935732158 Bacteria 9706831
709 2935746517 2935741537 Bacteria 9707219
710 2935757484 2935750917 Bacteria 9590372
711 2935763861 2935760218 Bacteria 9817913
712 2935807839 2935801545 Bacteria 9301974
713 2935818256 2935810662 Bacteria 9401221
714 2935833002 2935827899 Bacteria 10038562
715 2935844326 2935837841 Bacteria 9454360
716 2935859612 2935855204 Bacteria 9035059
717 2935871323 2935864058 Bacteria 9784707
718 2935879066 2935873716 Bacteria 9632195
719 2935996709 2935992306 Bacteria 9802711
720 2936008585 2936002035 Bacteria 9362176
721 2936044926 2936037263 Bacteria 9446081
722 2940563692 2940556831 Bacteria 9590747
723 2941537063 2941531003 Bacteria 7653939
724 2941542658 2941538514 Bacteria 9402094
725 3005476409 3005474847 Bacteria 9259049
726 3005490143 3005483717 Bacteria 7877331
727 3005591408 3005587118 Bacteria 7794411
728 3005601374 3005594810 Bacteria 8716512
729 3005716814 3005710791 Bacteria 7622528
730 3005724067 3005718088 Bacteria 8283608
731 8006937753 8006933436 Bacteria 10410654
732 8006977784 8006973647 Bacteria 10679141
733 8019578680 8019576017 Bacteria 10049540
734 8019596717 8019586578 Bacteria 10212056
735 8019604972 8019597564 Bacteria 10041141
736 8019613561 8019608314 Bacteria 10042931
737 8055750055 8055742211 Bacteria 9226248
738 8056684677 8056681323 Bacteria 8472857
739 8056695491 8056689827 Bacteria 6712655
740 8056975830 8056967851 Bacteria 9038162
741 Ga0081540_1003782
742 JGI24739J22299_10255793
743 JGI25165J46597_1012306
744 JGI25153J46596_10027530
745 JGI25160J50197_1027724
746 JGI25161J50226_1016812
747 JGI25404J52841_10002913
748 JGI25404J52841_10037809
749 Ga0055542_1001822
750 Ga0055529_1022046
751 Ga0055543_1002520
752 Ga0065165_1001425
753 Ga0065165_1001827
754 Ga0065715_10457851
755 Ga0065707_10618365
756 Ga0070658_11240907
757 Ga0070676_10152168
758 Ga0070683_100043990
759 Ga0070690_100188154
760 Ga0070690_100796797
761 Ga0070670_100369149
762 Ga0070680_100150865
763 Ga0070680_100534929
764 Ga0070682_100073277
765 Ga0070691_10237344
766 Ga0070661_100155093
767 Ga0070692_10082899
768 Ga0070668_100035749
769 Ga0070669_100178346
770 Ga0070675_100431536
771 Ga0070671_100029123
772 Ga0070671_100314747
773 Ga0070671_100722234
774 Ga0070659_100504523
775 Ga0070667_100242113
776 Ga0070667_101521175
777 Ga0070709_10513655
778 Ga0070714_100077856
779 Ga0070714_100317187
780 Ga0070714_100568532
781 Ga0070713_100050840
782 Ga0070710_10048568
783 Ga0070710_10892247
784 Ga0070711_100122874
785 Ga0070694_100072864
786 Ga0070678_100037898
787 Ga0070662_100192294
788 Ga0070681_10180180
789 Ga0070681_10634681
790 Ga0068867_100194625
791 Ga0070706_101556186
792 Ga0070698_100083484
793 Ga0070679_100282072
794 Ga0070684_100045735
795 Ga0070697_100500310
796 Ga0068853_100037492
797 Ga0068853_100515760
798 Ga0070672_100614409
799 Ga0070672_100716317
800 Ga0070686_100096006
801 Ga0070686_100193609
802 Ga0070695_100232036
803 Ga0070696_100102890
804 Ga0070693_100774190
805 Ga0070693_100792643
806 Ga0070665_100150594
807 Ga0070665_100199952
808 Ga0070704_100172948
809 Ga0068855_100026149
810 Ga0070664_100639108
811 Ga0068857_100136160
812 Ga0068854_100068550
813 Ga0068854_100350676
814 Ga0068856_100023428
815 Ga0068856_100984568
816 Ga0070702_100032768
817 Ga0070702_101185101
818 Ga0068852_100010196
819 Ga0068852_100737572
820 Ga0068852_101216374
821 Ga0068859_100060634
822 Ga0068864_100172836
823 Ga0068864_100342636
824 Ga0068866_10126576
825 Ga0068861_100492507
826 Ga0068851_10059840
827 Ga0068851_10172939
828 Ga0068870_10021787
829 Ga0068863_100126079
830 Ga0068863_100552856
831 Ga0068858_100123528
832 Ga0068860_100150834
833 Ga0068860_100742938
834 Ga0068862_100463296
835 Ga0081455_10004342
836 Ga0081538_10056238
837 Ga0081540_1001023
838 Ga0081540_1009882
839 Ga0070717_10708318
840 Ga0075365_10059349
841 Ga0075365_10136967
842 Ga0075365_10168469
843 Ga0075365_10356944
844 Ga0075368_10023629
845 Ga0075368_10071988
846 Ga0075364_10038869
847 Ga0075364_10076059
848 Ga0075364_10109275
849 Ga0075364_10423659
850 Ga0075364_10784946
851 Ga0070715_10111121
852 Ga0070716_100085363
853 Ga0070712_100160485
854 Ga0070712_100230463
855 Ga0075362_10058622
856 Ga0075367_10027494
857 Ga0075367_10052789
858 Ga0075367_10092408
859 Ga0075367_10166575
860 Ga0075367_10227601
861 Ga0075367_10572369
862 Ga0075369_10044450
863 Ga0075369_10105875
864 Ga0075366_10127232
865 Ga0097621_100435026
866 Ga0097621_101351369
867 Ga0075370_10024706
868 Ga0075370_10163164
869 Ga0075370_10398283
870 Ga0068871_100319131
871 Ga0075428_100179316
872 Ga0075430_101203073
873 Ga0075433_10383363
874 Ga0075433_11443397
875 Ga0075434_100053726
876 Ga0068865_100196703
877 Ga0097620_100060640
878 Ga0099825_1035219
879 Ga0099824_1006625
880 Ga0099822_1003046
881 Ga0099823_1032609
882 Ga0075435_100249441
883 Ga0099795_10182422
884 Ga0105250_10093077
885 Ga0105250_10104947
886 Ga0105240_10007824
887 Ga0105240_10533996
888 Ga0105240_10574755
889 Ga0105240_11157263
890 Ga0111539_12630987
891 Ga0105245_10018572
892 Ga0105245_10050191
893 Ga0105245_10152444
894 Ga0105247_10022617
895 Ga0105247_10058711
896 Ga0105241_10016719
897 Ga0105241_10105146
898 Ga0105241_10190218
899 Ga0105241_10207439
900 Ga0105242_10041047
901 Ga0105242_11174129
902 Ga0105248_10014395
903 Ga0105248_10184530
904 Ga0105237_10006994
905 Ga0105237_10014182
906 Ga0105237_10051786
907 Ga0105238_10017485
908 Ga0105238_10167303
909 Ga0105238_10487148
910 Ga0105238_10507575
911 Ga0105249_10709161
912 Ga0105249_10817340
913 Ga0105249_11761062
914 Ga0105249_12329793
915 Ga0099796_10013574
916 Ga0099796_10021176
917 Ga0105239_10033687
918 Ga0105239_10036816
919 Ga0105239_10039087
920 Ga0105239_10080967
921 Ga0105239_10232880
922 Ga0105239_10392339
923 Ga0105239_10565564
924 Ga0105239_11493420
925 Ga0105239_11596504
926 Ga0105246_10059294
927 Ga0105246_10075663
928 Ga0105246_10501125
929 Ga0105246_10513206
930 Ga0157371_10505736
931 Ga0157370_10292323
932 Ga0157370_10337781
933 Ga0157374_10016963
934 Ga0157374_10086155
935 Ga0157378_10105960
936 Ga0163162_10648196
937 Ga0163162_10992031
938 Ga0163162_11311363
939 Ga0157375_10026462
940 Ga0157375_10091258
941 Ga0157375_10621775
942 Ga0163163_10116866
943 Ga0163163_10502685
944 Ga0163163_10977946
945 Ga0163163_11722211
946 Ga0157379_10016160
947 Ga0157379_10272934
948 Ga0157379_11187925
949 Ga0157376_10168012
950 Ga0157376_10224466
951 Ga0157376_11463930
952 Ga0163161_10598690
953 Ga0213876_10665601
954 Ga0209563_101608
955 Ga0209677_105532
956 Ga0209148_1000333
957 Ga0209233_1002558
958 Ga0209233_1014185
959 Ga0209233_1016510
960 Ga0209455_1004271
961 Ga0209455_1006362
962 Ga0209455_1023133
963 Ga0209758_1008100
964 Ga0209758_1084937
965 Ga0207426_1002293
966 Ga0207426_1012030
967 Ga0207426_1040946
968 Ga0209257_1093642
969 Ga0207697_10129446
970 Ga0207656_10067441
971 Ga0207696_1015201
972 Ga0207653_10177712
973 Ga0207692_10078545
974 Ga0207642_10095555
975 Ga0207642_10487898
976 Ga0207710_10052982
977 Ga0207710_10297562
978 Ga0207688_10021119
979 Ga0207680_11096586
980 Ga0207647_10120087
981 Ga0207647_10140190
982 Ga0207647_10161051
983 Ga0207685_10306781
984 Ga0207699_10019652
985 Ga0207699_10031280
986 Ga0207645_10086892
987 Ga0207643_10213374
988 Ga0207654_10004645
989 Ga0207654_10043627
990 Ga0207707_10076306
991 Ga0207695_10000378
992 Ga0207695_10194549
993 Ga0207695_10320231
994 Ga0207671_10003481
995 Ga0207671_10069229
996 Ga0207693_10057837
997 Ga0207660_10105534
998 Ga0207660_10373710
999 Ga0207649_10109449
1000 Ga0207652_10032578
1001 Ga0207694_10073412
1002 Ga0207694_10182390
1003 Ga0207694_10804470
1004 Ga0207650_10154616
1005 Ga0207650_10193039
1006 Ga0207659_11249477
1007 Ga0207687_10452632
1008 Ga0207700_10037982
1009 Ga0207664_10275230
1010 Ga0207664_10576673
1011 Ga0207664_10692947
1012 Ga0207644_10311024
1013 Ga0207644_10473930
1014 Ga0207690_10078689
1015 Ga0207690_11404376
1016 Ga0207706_10203439
1017 Ga0207686_11153679
1018 Ga0207709_10365266
1019 Ga0207670_10820819
1020 Ga0207669_10027657
1021 Ga0207704_11058090
1022 Ga0207665_10943387
1023 Ga0207691_10414684
1024 Ga0207691_10807130
1025 Ga0207711_10238460
1026 Ga0207689_10015283
1027 Ga0207689_10027575
1028 Ga0207661_10002756
1029 Ga0207667_10334331
1030 Ga0207667_10859980
1031 Ga0207712_10162613
1032 Ga0207668_10032823
1033 Ga0207668_10744041
1034 Ga0207640_10023769
1035 Ga0207640_10275754
1036 Ga0207640_10906734
1037 Ga0207658_10137222
1038 Ga0207658_10567358
1039 Ga0207658_10763919
1040 Ga0207658_10938785
1041 Ga0207703_10113670
1042 Ga0207639_10066676
1043 Ga0207678_10014899
1044 Ga0207708_10234254
1045 Ga0207702_11073317
1046 Ga0207641_10370707
1047 Ga0207648_10411499
1048 Ga0207676_10174073
1049 Ga0207676_10295286
1050 Ga0207674_10024494
1051 Ga0207675_100041289
1052 Ga0207675_100055763
1053 Ga0207683_10010327
1054 Ga0207683_10039433
1055 Ga0207698_10181013
1056 Ga0209389_1000019
1057 Ga0209589_1000007
1058 Ga0209489_100008
1059 Ga0209489_100033
1060 Ga0209700_100009
1061 Ga0209700_100012
1062 Ga0209179_1041756
1063 Ga0209813_10145054
1064 Ga0268266_10594555
1065 Ga0268266_10864595
1066 Ga0268265_10390283
1067 Ga0307512_10270981
1068 Ga0307513_10084532
1069 Ga0307509_10068899
1070 Ga0307516_10165589
1071 Ga0307507_10277768
1072 Ga0307510_10022577
1073 Ga0307510_10240282
1074 Ga0315911_1000012
1075 Ga0373930_0019693
1076 Ga0373926_0101149
1077 Ga0373934_0185251
1078 Ga0373944_0036097
1079 Ga0373923_0057651
1080 Ga0373923_0067969
1081 Ga0373932_0226397
1082 Ga0373945_0007911
1083 Ga0373945_0298064
1084 Ga0373953_0037801
1085 Ga0373954_0040360
1086 Ga0373956_0052951
1087 Ga0373943_0001976
1088 Ga0373943_0031820
1089 Ga0373946_0015298
1090 Ga0373955_0026967
1091 Ga0373935_0010925
1092 Ga0373935_0477695
1093 Ga0373927_0076635
1094 Ga0373927_0077552
1095 Ga0373927_0087521
1096 Ga0373927_0293693
1097 Ga0373933_0060867
1098 Ga0373933_0314488
1099 Ga0373947_0014281
1100 Ga0373947_0023710
1101 Ga0373947_0137916
1102 Ga0373937_0701606
1103 Ga0373925_0009031
1104 Ga0373925_0023599
1105 Ga0373925_0357947
1106 Ga0373925_0796800
1107 Ga0395898_0290341
1108 Ga0395905_0014770
1109 Ga0395905_0095485
1110 Ga0395905_0292335
1111 Ga0395901_0103718
1112 Ga0395901_0763441
1113 Ga0436365_0174183
1114 Ga0436363_1048974
1115 Ga0451804_1148948
1116 Ga0451853_3757683
1117 Ga0466969_0036637
1118 Ga0466972_0377642
1119 Ga0466966_0000632
1120 Ga0466966_0640803
1121 Ga0466961_0000897
1122 Ga0466963_0234494
1123 Ga0466968_0016262
1124 Ga0466957_0018547
1125 Ga0466960_0071671
1126 Ga0466959_0004435
1127 Ga0466967_0055810
1128 Ga0466967_0095059
1129 Ga0466967_0394449
1130 Ga0495617_108033
1131 Ga0495592_0151571
1132 Ga0495592_0251944
1133 Ga0495603_0112175
1134 Ga0495603_0149362
1135 Ga0495603_0317096
1136 Ga0495590_0124839
1137 Ga0495629_0015463
1138 Ga0495629_0094122
1139 Ga0495629_0812797
1140 Ga0495641_0028703
1141 Ga0495651_0046976
1142 Ga0495650_0119189
1143 Ga0495580_0035726
1144 Ga0495582_0001981
1145 Ga0495582_0006519
1146 Ga0495582_0044026
1147 Ga0495605_0217458
1148 Ga0495639_0001516
1149 Ga0495639_0295086
1150 Ga0495662_0064711
1151 Ga0495664_0003288
1152 Ga0495664_0010823
1153 Ga0495664_0232243
1154 Ga0495584_0144960
1155 Ga0495584_0267457
1156 Ga0495585_0055134
1157 Ga0495594_0001191
1158 Ga0495594_0051177
1159 Ga0495596_0142445
1160 Ga0495606_0206922
1161 Ga0495608_0027531
1162 Ga0495608_0497030
1163 Ga0495610_0030089
1164 Ga0495616_0077636
1165 Ga0495616_0393605
1166 Ga0495618_0118037
1167 Ga0495618_0237685
1168 Ga0495628_0016128
1169 Ga0495628_0026661
1170 Ga0495628_0082016
1171 Ga0495628_0277731
1172 Ga0495628_0673116
1173 Ga0495630_0008198
1174 Ga0495632_0062891
1175 Ga0495637_0107307
1176 Ga0495643_0259117
1177 Ga0495642_0056652
1178 Ga0495652_0014451
1179 Ga0495652_0032544
1180 Ga0495652_0172339
1181 Ga0495652_0179703
1182 Ga0495652_0568529
1183 Ga0495665_0000574
1184 Ga0495665_0295423
1185 Ga0495640_0029121
1186 Ga0495640_0120909
1187 Ga0495587_0275312
1188 Ga0495597_0182471
1189 Ga0495645_0228443
1190 Ga0495622_0004364
1191 Ga0495622_0043358
1192 Ga0495622_0076485
1193 Ga0495622_0182817
1194 Ga0495667_0087745
1195 Ga0495667_0325448
1196 Ga0495656_0246001
1197 Ga0495668_0011860
1198 Ga0495634_0003485
1199 Ga0495634_0011719
1200 Ga0495634_0116792
1201 Ga0495625_0072248
1202 Ga0495625_0396719
1203 Ga0495635_0016363
1204 Ga0495635_0030796
1205 Ga0495635_0506564
1206 Ga0495661_0229565
1207 Ga0495588_0098374
1208 Ga0495588_0368420
1209 Ga0495657_0035840
1210 Ga0495657_0049630
1211 Ga0495599_0028675
1212 Ga0495623_0058377
1213 Ga0495646_0046096
1214 Ga0495646_0316556
1215 Ga0495658_0003379
1216 Ga0495658_0006988
1217 Ga0495669_0078077
1218 Ga0495669_0150283
1219 Ga0495669_0294687
1220 Ga0495613_0007863
1221 Ga0495624_0029342
1222 Ga0495624_0243840
1223 Ga0495649_0091977
1224 Ga0495589_0152101
1225 Ga0495600_0007070
1226 Ga0495600_0022089
1227 Ga0495581_0007281
1228 Ga0495581_0009697
1229 Ga0495581_0072971
1230 Ga0495581_0122587
1231 Ga0495604_0030745
1232 Ga0495604_0069358
1233 Ga0495674_0006663
1234 Ga0495674_0014462
1235 Ga0495674_0019168
1236 Ga0495674_0116318
1237 Ga0495672_0154739
1238 Ga0495676_0022272
1239 Ga0495676_0028615
1240 Ga0495676_0059215
1241 Ga0495676_0115441
1242 Ga0495680_0001058
1243 Ga0495675_0036037
1244 Ga0495679_143139
1245 Ga0495673_0188048
1246 Ga0495684_0056700
1247 Ga0495684_0065325
1248 Ga0495686_0105726
1249 Ga0495593_0002074
1250 Ga0496100_0050500
1251 Ga0496100_0178255
1252 Ga0496101_0031151
1253 Ga0496101_0081607
1254 Ga0496101_0275937
1255 Ga0496101_0474136
1256 Ga0496102_0163089
1257 Ga0496102_0227118
1258 Ga0496102_0417826
1259 Ga0496102_0685879
1260 Ga0496103_0224083
1261 Ga0496103_0365741
1262 Ga0496103_0405239
1263 Ga0496104_0001403
1264 Ga0496104_0046472
1265 Ga0496104_0296133
1266 Ga0496104_0371610
1267 Ga0496105_0003256
1268 Ga0496105_0003429
1269 Ga0496105_0016752
1270 Ga0496105_0120773
1271 Ga0496106_0036824
1272 Ga0496106_0065254
1273 Ga0496106_0065821
1274 Ga0496106_0361103
1275 Ga0496107_0057187
1276 Ga0496107_0060935
1277 Ga0496107_0513500
1278 Ga0496108_0095003
1279 Ga0496108_1707542
1280 Ga0496109_0257979
1281 Ga0496110_0078604
1282 Ga0496110_0124657
1283 Ga0496111_0026704
1284 Ga0496111_0651790
1285 Ga0496112_0186050
1286 Ga0496112_0653929
1287 Ga0496112_0742057
1288 Ga0496113_0052825
1289 Ga0496113_0096716
1290 Ga0496113_0479725
1291 Ga0496113_0672002
1292 Ga0496114_0067248
1293 Ga0496115_0115679
1294 Ga0496115_0393112
1295 Ga0496115_0561322
1296 Ga0496115_0565626
1297 Ga0496117_0068177
1298 Ga0496117_0257027
1299 Ga0496118_0093540
1300 Ga0496118_0248275
1301 Ga0496119_0032305
1302 Ga0496119_0304616
1303 Ga0496120_0002168
1304 Ga0496121_0022709
1305 Ga0496121_0044328
1306 Ga0496121_0104779
1307 Ga0496121_0164094
1308 Ga0496121_0199501
1309 Ga0496121_0228701
1310 Ga0496121_0258872
1311 Ga0496123_0131176
1312 Ga0496123_0244532
1313 Ga0496124_0221230
1314 Ga0496125_0241720
1315 Ga0496126_0052295
1316 Ga0496126_0084595
1317 Ga0496126_0088380
1318 Ga0496126_0168413
1319 Ga0496126_0215012
1320 Ga0496126_0263071
1321 Ga0496126_0573434
1322 Ga0496126_0741285
1323 nmdc:mga03683_209384_c1
1324 nmdc:mga00v17_121643_c1
1325 nmdc:mga00v17_259591_c1
1326 nmdc:mga00v17_57092_c1
1327 nmdc:mga0yw44_117563_c1
1328 nmdc:mga0yw44_209937_c1
1329 nmdc:mga0yw44_26598_c1
1330 nmdc:mga06z11_105598_c1
1331 nmdc:mga06z11_106290_c1
1332 nmdc:mga06z11_219037_c1
1333 nmdc:mga06z11_237629_c1
1334 nmdc:mga06z11_525404_c1
1335 nmdc:mga06z11_79887_c1
1336 nmdc:mga04h51_218085_c1
1337 nmdc:mga04h51_282680_c1
1338 nmdc:mga07m45_29166_c1
1339 nmdc:mga0n895_63276_c1
1340 nmdc:mga0rr50_781845_c1
1341 nmdc:mga08x19_382640_c1
1342 nmdc:mga0a205_204030_c1
1343 nmdc:mga0sz30_412925_c1
1344 nmdc:mga0sz30_49188_c1
1345 Ga0495601_0088421
1346 Ga0495601_0115219
1347 Ga0495612_0095074
1348 Ga0495655_0048071
1349 Ga0495595_0231888
1350 Ga0495619_0003483
1351 Ga0495619_0147612
1352 Ga0500651_0319360
1353 Ga0500566_0000192
1354 Ga0500640_051554
1355 Ga0500569_106686
1356 Ga0500572_000343
1357 Ga0500595_021147
1358 Ga0500595_044347
1359 Ga0500614_077032
1360 Ga0500618_124908
1361 Ga0500559_0000552
1362 Ga0500559_0118509
1363 Ga0500577_0231544
1364 Ga0500590_140953
1365 Ga0500603_015780
1366 Ga0500622_0026971
1367 Ga0500638_087756
1368 Ga0500639_019826
1369 Ga0500636_0015319
1370 Ga0500637_0040579
1371 Ga0500609_004988
1372 Ga0500596_000906
1373 2509147935
1374 2513626774
1375 2513643352
1376 2513655698
1377 2513673425
1378 2513862745
1379 2513875242
1380 2513916224
1381 2514014349
1382 2517890166
1383 2524464740
1384 2524538290
1385 2617349573
1386 2671121625
1387 2793067851
1388 2805919610
1389 2824663531
1390 2824678653
1391 2824695319
1392 2824700056
1393 2824707673
1394 2824757410
1395 2824768023
1396 2824780196
1397 2838130497
1398 2841942196
1399 2841955344
1400 2841971281
1401 2841981573
1402 2841987119
1403 2842042056
1404 2842050099
1405 2844321032
1406 2847932351
1407 2847943599
1408 2849077322
1409 2874614093
1410 2874624909
1411 2876765939
1412 2876766488
1413 2879091484
1414 2879102670
1415 2881371189
1416 2885382318
1417 2885388637
1418 2888391876
1419 2903728470
1420 2903776676
1421 2904669116
1422 2904692996
1423 2904706663
1424 2904715571
1425 2906605319
1426 2906612062
1427 2906640288
1428 2906645422
1429 2906663616
1430 2908757980
1431 2922363553
1432 2929620192
1433 2929629505
1434 2932791550
1435 2932799326
1436 2932816812
1437 2932824011
1438 2933582109
1439 2935621195
1440 2935643485
1441 2935671192
1442 2935681205
1443 2935689456
1444 2935700029
1445 2935710761
1446 2935720707
1447 2935727982
1448 2935737422
1449 2935746517
1450 2935757484
1451 2935763861
1452 2935807839
1453 2935818256
1454 2935833002
1455 2935844326
1456 2935859612
1457 2935871323
1458 2935879066
1459 2935996709
1460 2936008585
1461 2936044926
1462 2940563692
1463 2941537063
1464 2941542658
1465 3005476409
1466 3005490143
1467 3005591408
1468 3005601374
1469 3005716814
1470 3005724067
1471 8006937753
1472 8006977784
1473 8019578680
1474 8019596717
1475 8019604972
1476 8019613561
1477 8055750055
1478 8056684677
1479 8056695491
1480 8056975830

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08327

AHSA1

Activator of Hsp90 ATPase homolog 1-like protein

13

136

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fpw-assembly3.cif.gz_B crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.894 5 150
4fpw-assembly3.cif.gz_A crystal structure of calu16 from micromonospora echinospora. northeast structural genomics consortium target mir12. 0.8901 5 139
2luz-assembly1.cif.gz_A solution nmr structure of calu16 from micromonospora echinospora, northeast structural genomics consortium (nesg) target mir12 0.8716 3 145
3q63-assembly2.cif.gz_D x-ray crystal structure of protein mll2253 from mesorhizobium loti, northeast structural genomics consortium target mlr404. 0.858 4 136
2m89-assembly1.cif.gz_B solution structure of the aha1 dimer from colwellia psychrerythraea 0.8436 4 139
ID Description Score Start End Superfamily
2luzA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8716 3 145 3.30.530.20
af_O53773_104_241_3.30.530.20 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8594 6 140 3.30.530.20
4fpwA00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8577 5 150 3.30.530.20
2m89B00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8436 4 139 3.30.530.20
3q63F00 Alpha Beta;2-Layer Sandwich;Alpha-D-Glucose-1,6-Bisphosphate; Chain A, domain 4;START domain 0.8385 1 136 3.30.530.20
ID Description Score Start End GO Terms
AF-A0A1W9IDC2-F1-model_v4 ATPase 0.9873 6 143
AF-A0A0S8FK83-F1-model_v4 Activator of Hsp90 ATPase homologue 1/2-like C-terminal domain-containing protein 0.9829 1 144
AF-A0A2T0NY80-F1-model_v4 deleted 0.9811 1 154
AF-A0A4V1L1T6-F1-model_v4 ATPase 0.9752 1 154
AF-A0A328XLI8-F1-model_v4 deleted 0.975 5 143

Map