F478503

General Info

Members Datasets Scaffolds Average Seq Length
740 467 1480 445

Family's Representative Sequence

Representative Sequence 3300002738|JGI25154J39366_1000846|JGI25154J39366_10008467
Length 455
Sequence MTTPVRDALSDDVPALTGDVLAIRGGRPLRGRVDVKGAKNLATKAMVASLLGETTSVLRDVPAISDVAVVRSLLEVHGVRVSEGDEPGSLVFDPSDVESAHFEEIDAHAGASRIPILFCGPLLHRLGQAFIPDLGGCRIGDRPIDFHLDALRKFGAIVEKLPSGIRLSTGGARLHGANIHLPYPSVGATEQVLLTAVRAEGITELRNAAIEPEIMDLIAVLQKMGAIISYEPNRVILIEGVEKLRGYDHRSIFDRNEAASWASAALATDGEIFVGGAKQQEMLTFLNVFRKAGGWFDIQEDGILFRRDGDIKPVVIETDVHPGFMTDWQQPLVVALTQAHGRSVVHETVYENRMGFTEALVKMGADIVVHPRGLQDGPRRVPRRDLEQAAVITGPTPLHGADIVVPDLRGGYSHVIAALTATGESKVSGVDILSRGYEKFLAKLDALGADFDVIR

Samples

Sample ID Description Type Environment
1 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003559 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
7 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
8 3300003735 Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
10 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
11 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
12 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
13 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
14 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
15 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
26 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
27 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
28 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
29 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
30 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
31 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
32 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
33 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
34 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
35 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
36 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
37 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
38 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
39 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
40 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
41 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
42 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
43 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
44 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
45 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
46 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
47 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
48 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
49 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
55 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
56 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
57 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
58 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
59 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
60 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
61 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
62 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
63 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
65 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
66 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
68 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
82 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
83 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
85 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
86 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
87 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
88 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
89 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
90 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
91 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
92 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
93 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
94 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
95 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
96 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
97 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
98 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
99 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
100 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
101 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
102 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
103 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
104 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
105 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
106 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
107 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
108 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
109 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
110 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
111 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
112 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
113 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
114 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
117 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
118 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
119 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
120 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
121 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
122 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
123 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
124 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
125 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
126 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
127 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
128 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
129 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
130 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
131 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
132 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
133 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
134 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
135 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
136 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
137 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
140 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
141 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
142 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
143 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
144 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
145 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
146 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
147 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
148 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
149 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
150 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
151 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
152 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
153 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
154 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
155 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
156 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
157 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
158 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
159 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
160 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
161 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
162 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
163 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
164 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
178 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
179 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
194 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
195 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
196 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
197 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
198 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
199 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
200 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
201 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
204 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
208 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
209 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
212 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
216 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
218 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
219 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
221 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
222 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
223 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
224 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
225 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
226 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
227 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
228 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
229 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
235 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
236 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
237 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
238 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
239 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
240 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
241 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
242 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
243 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
244 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
245 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
246 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
247 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
248 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
249 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
250 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
251 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
252 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
253 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
254 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
255 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
256 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
257 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
258 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
259 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
260 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
261 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
262 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
263 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
264 2643221542 Microbacterium sp. Root1433D1 Isolate Unclassified
265 2643221546 Microbacterium sp. Root53 Isolate Unclassified
266 2643221548 Streptomyces sp. Root55 Isolate Unclassified
267 2643221549 Agromyces sp. Root1464 Isolate Unclassified
268 2643221553 Microbacterium sp. Root553 Isolate Unclassified
269 2643221566 Microbacterium sp. Root166 Isolate Unclassified
270 2643221572 Leifsonia sp. Root60 Isolate Unclassified
271 2643221575 Microbacterium sp. Root61 Isolate Unclassified
272 2643221578 Streptomyces sp. Root63 Isolate Unclassified
273 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
274 2643221597 Microbacterium sp. Root180 Isolate Unclassified
275 2643221613 Oerskovia sp. Root22 Isolate Unclassified
276 2643221616 Leifsonia sp. Root227 Isolate Unclassified
277 2643221619 Agromyces sp. Root81 Isolate Unclassified
278 2643221630 Microbacterium sp. Root322 Isolate Unclassified
279 2643221632 Leifsonia sp. Root112D2 Isolate Unclassified
280 2643221635 Yonghaparkia sp. Root332 Isolate Unclassified
281 2643221647 Streptomyces sp. Root369 Isolate Unclassified
282 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
283 2643221670 Streptomyces sp. Root431 Isolate Unclassified
284 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
285 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
286 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
287 2643221679 Angustibacter sp. Root456 Isolate Unclassified
288 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
289 2643221690 Cellulomonas sp. Root485 Isolate Unclassified
290 2643221694 Cellulomonas sp. Root137 Isolate Unclassified
291 2643221714 Streptomyces sp. Root264 Isolate Unclassified
292 2643221721 Oerskovia sp. Root918 Isolate Unclassified
293 2643221722 Cellulomonas sp. Root930 Isolate Unclassified
294 2643221724 Microbacterium sp. Root280D1 Isolate Unclassified
295 2690315906 Arthrobacter sp. OY3WO11 Isolate Unclassified
296 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
297 2728369380 Microbacterium sp. 1.5R Isolate Rhizosphere
298 2747842429 Microbacterium sp. WCS2014-259 Isolate Unclassified
299 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
300 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
301 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
302 2773857763 Microbacterium sp. SAI-030 Isolate Unclassified
303 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
304 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
305 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
306 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
307 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
308 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
309 2808606306 Microbacterium sp. SLBN-146 Isolate Unclassified
310 2808606357 Arthrobacter sp. SLBN-122 Isolate Unclassified
311 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
312 2808606360 Arthrobacter sp. SLBN-112 Isolate Unclassified
313 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
314 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
315 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
316 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
317 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
318 2808606372 Agromyces sp. 23-23 Isolate Unclassified
319 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
320 2808606447 Microbacterium sp. HAR-UPW-R2A-48 Isolate Unclassified
321 2808606448 Streptomyces sp. 193411 Isolate Unclassified
322 2808606700 Arthrobacter agilis UMCV2 Isolate Rhizosphere
323 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
324 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
325 2811994872 Microbacterium sp. MU4Y-5-1 Isolate Unclassified
326 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
327 2811994880 Cellulomonas sp. SLBN-39 Isolate Unclassified
328 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
329 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
330 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
331 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
332 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
333 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
334 2844841374 Leifsonia soli DSM 23871 Isolate Rhizosphere
335 2848551377 Brachybacterium saurashtrense DSM 23186 Isolate Unclassified
336 2852632344 Microbacterium sp. AK009 Isolate Rhizosphere
337 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
338 2852646457 Microbacterium sp. AK031 Isolate Rhizosphere
339 2852663356 Microbacterium sp. JAI119 Isolate Rhizosphere
340 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
341 2857479173 Micrococcus sp. R-74225 Isolate Unclassified
342 2857632687 Micrococcus sp. R-73081 Isolate Unclassified
343 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
344 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
345 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
346 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
347 2862178590 Streptomyces sp. SDr-06 Isolate Rhizosphere
348 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
349 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
350 2862574272 Streptomyces sp. AcE210 Isolate Nodule
351 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
352 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
353 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
354 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
355 2867369537 Streptomyces sp. Z26 Isolate Unclassified
356 2867428634 Streptomyces sp. RP5T Isolate Unclassified
357 2867475112 Streptomyces sp. TM32 Isolate Unclassified
358 2870628048 Microbacterium thalassium DSM 12511 Isolate Rhizosphere
359 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
360 2870804320 Micrococcus yunnanensis DSM 21948 Isolate Unclassified
361 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
362 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
363 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
364 2884763398 Leifsonia sp. PS1209 Isolate Stem Tuber
365 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
366 2887443736 Ruania rhizosphaerae LNNU 22110 Isolate Rhizosphere
367 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
368 2904430863 Curtobacterium oceanosedimentum 1519 Isolate Rhizosphere
369 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
370 2905926851 Arthrobacter sedimenti MIC A30 Isolate Rhizosphere
371 2906799679 Microbacterium karelineae TRM80801 Isolate Unclassified
372 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
373 2909074476 Curtobacterium sp. 1310 Isolate Rhizosphere
374 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
375 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
376 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
377 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
378 2919039151 Curtobacterium sp. 260 Isolate Rhizosphere
379 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
380 2919069694 Microbacterium sp. 1154 Isolate Unclassified
381 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
382 2919395869 Microbacterium resistens 2980 Isolate Unclassified
383 2919443155 Agromyces sp. 3263 Isolate Rhizosphere
384 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
385 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
386 2919523602 Leifsonia shinshuensis 3821 Isolate Unclassified
387 2920879853 Kocuria salina CV6 Isolate Unclassified
388 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
389 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
390 2928153084 Leifsonia sp. 563 Isolate Unclassified
391 2932431166 Cellulosimicrobium sp. 4261 Isolate Rhizosphere
392 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
393 2935409751 Agromyces sp. PvR057 Isolate Rhizosphere
394 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
395 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
396 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
397 2945920336 Pseudarthrobacter siccitolerans W1I3 Isolate Rhizosphere
398 2945941187 Arthrobacter pascens W1I14 Isolate Rhizosphere
399 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
400 2945968032 Microbacterium murale W2I7 Isolate Rhizosphere
401 2946003308 Arthrobacter agilis W3I6 Isolate Rhizosphere
402 2946037020 Arthrobacter sp. W4I7 Isolate Rhizosphere
403 2946041624 Microbacterium natoriense W4I9-1 Isolate Rhizosphere
404 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
405 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
406 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
407 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
408 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
409 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
410 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
411 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
412 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
413 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
414 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
415 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
416 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
417 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
418 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
419 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
420 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
421 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
422 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
423 2964326757 Planctomonas psychrotolerans J5903 Isolate Rhizosphere
424 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
425 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
426 2974302888 Pseudarthrobacter sp. SORGH_AS 212 Isolate Unclassified
427 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
428 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
429 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
430 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
431 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
432 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
433 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
434 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
435 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
436 2995726249 Leucobacter zeae CC-MF41 Isolate Rhizosphere
437 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
438 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
439 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
440 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
441 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
442 8002811521 Leucobacter chinensis NC76-1 Isolate Rhizosphere
443 8004025490 Arthrobacter wenxiniae AETb3-4 Isolate Rhizosphere
444 8004182704 Microbacterium paraoxydans ku-mp Isolate Unclassified
445 8004212874 Microbacterium sp. NC79 Isolate Rhizosphere
446 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
447 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
448 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
449 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
450 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
451 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
452 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
453 8033684223 Streptomyces phytophilus PIP175 Isolate Unclassified
454 8045830549 Microbacterium yannicii DSM 23203 Isolate Unclassified
455 8046352972 Agromyces mangrovi NBRC 112812 Isolate Rhizosphere
456 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
457 8048127548 Streptomyces samsunensis DSM 42010 Isolate Rhizosphere
458 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
459 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
460 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
461 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
462 8054107350 Arthrobacter rhizosphaerae CCNWLXL 1-35 Isolate Rhizosphere
463 8054160619 Streptomyces rhizoryzae RS10V-4 Isolate Rhizosphere
464 8055034563 Leucobacter allii H21R-40 Isolate Rhizosphere
465 8055037949 Leucobacter rhizosphaerae H25R-14 Isolate Rhizosphere
466 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
467 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 69.46
Metatranscriptomes 2.03
Isolates 28.51

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 7.43
Nodule 0.41
Rhizoplane 4.86
Rhizosphere 63.11
Stem 0
Stem Tuber 0.14
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25154J39366_1000846 3300002738 Bacteria 13272
2 JGI24737J22298_10002831 3300001990 Bacteria 6148
3 JGI24735J21928_10004528 3300002067 Bacteria 4674
4 JGI24738J21930_10007855 3300002075 Bacteria 2444
5 JGI25165J46597_1000002 3300003214 Bacteria 765387
6 Ga0007427J51700_107271 3300003559 Bacteria 1924
7 Ga0006562J51391_1032679 3300003578 Bacteria 11760
8 Ga0006562J51391_1032682 3300003578 Bacteria 10200
9 Ga0006562J51391_1034854 3300003578 Bacteria 4610
10 Ga0006780_1011353 3300003735 Bacteria 3476
11 Ga0055539_1000111 3300003752 Bacteria 90530
12 Ga0055533_1000001 3300003756 Bacteria 1863437
13 Ga0055525_1000317 3300003759 Bacteria 38691
14 Ga0055527_1000012 3300003760 Bacteria 348744
15 Ga0055542_1000017 3300003762 Bacteria 348744
16 Ga0055529_1000023 3300003763 Bacteria 314383
17 Ga0055541_1004852 3300003841 Bacteria 2402
18 Ga0065714_10019108 3300005288 Bacteria 3076
19 Ga0070658_10065597 3300005327 Bacteria 2963
20 Ga0070683_100239998 3300005329 Bacteria 1724
21 Ga0070666_10063792 3300005335 Bacteria 2498
22 Ga0070669_100016507 3300005353 Bacteria 5269
23 Ga0070675_100244363 3300005354 Bacteria 1569
24 Ga0070679_100133727 3300005530 Bacteria 2461
25 Ga0070696_100001852 3300005546 Bacteria 13884
26 Ga0070665_100052203 3300005548 Bacteria 4102
27 Ga0068852_100171729 3300005616 Bacteria 2033
28 Ga0081455_10051034 3300005937 Bacteria 3551
29 Ga0081540_1012227 3300005983 Bacteria 5674
30 Ga0081539_10001159 3300005985 Bacteria 47725
31 Ga0081539_10030524 3300005985 Bacteria 3344
32 Ga0075365_10047812 3300006038 Bacteria 2813
33 Ga0075368_10026380 3300006042 Bacteria 2235
34 Ga0075364_10004420 3300006051 Bacteria 8085
35 Ga0075364_10017035 3300006051 Bacteria 4531
36 Ga0075364_10017496 3300006051 Bacteria 4478
37 Ga0075364_10028991 3300006051 Bacteria 3547
38 Ga0075367_10000349 3300006178 Bacteria 16510
39 Ga0075369_10011511 3300006186 Bacteria 3482
40 Ga0075369_10012427 3300006186 Bacteria 3364
41 Ga0075370_10030256 3300006353 Bacteria 3020
42 Ga0105251_10030179 3300009011 Bacteria 2725
43 Ga0105243_10043093 3300009148 Bacteria 3536
44 Ga0105246_10018229 3300011119 Bacteria 4473
45 Ga0105246_10099641 3300011119 Bacteria 2112
46 Ga0157371_10031269 3300013102 Bacteria 3834
47 Ga0157369_10078764 3300013105 Bacteria 3530
48 Ga0171462_1003 3300013250 Bacteria 853796
49 Ga0157372_10059520 3300013307 Bacteria 4272
50 Ga0157380_10006032 3300014326 Bacteria 8487
51 Ga0182008_10004358 3300014497 Bacteria 8279
52 Ga0182006_1017956 3300015261 Bacteria 2996
53 Ga0182007_10001716 3300015262 Bacteria 11553
54 Ga0183367_1006 3300015688 Bacteria 648044
55 Ga0197907_10053258 3300020069 Bacteria 7119
56 Ga0206349_1248741 3300020075 Bacteria 3259
57 Ga0206355_1244303 3300020076 Bacteria 2746
58 Ga0206354_10663781 3300020081 Bacteria 10305
59 Ga0206353_11560231 3300020082 Bacteria 22870
60 Ga0213875_10021319 3300021388 Bacteria 3105
61 Ga0224712_10038306 3300022467 Bacteria 1790
62 Ga0224712_10042375 3300022467 Bacteria 1724
63 Ga0209566_100026 3300025225 Bacteria 367457
64 Ga0209674_100001 3300025226 Bacteria 4013750
65 Ga0209672_100003 3300025228 Bacteria 1560476
66 Ga0209147_100633 3300025229 Bacteria 18857
67 Ga0209563_100001 3300025230 Bacteria 4013775
68 Ga0207427_100034 3300025231 Bacteria 320342
69 Ga0209437_100486 3300025233 Bacteria 29316
70 Ga0209258_101954 3300025242 Bacteria 6013
71 Ga0209646_1000168 3300025246 Bacteria 86352
72 Ga0209677_100001 3300025253 Bacteria 4013787
73 Ga0209677_100321 3300025253 Bacteria 30989
74 Ga0209148_1000004 3300025254 Bacteria 1844481
75 Ga0209233_1000001 3300025261 Bacteria 2992747
76 Ga0209455_1000022 3300025272 Bacteria 688910
77 Ga0209455_1001078 3300025272 Bacteria 13442
78 Ga0207426_1003169 3300025302 Bacteria 9298
79 Ga0207426_1003328 3300025302 Bacteria 8871
80 Ga0207697_10003823 3300025315 Bacteria 7349
81 Ga0207655_1015461 3300025728 Bacteria 4239
82 Ga0207655_1031119 3300025728 Bacteria 2466
83 Ga0207680_10144677 3300025903 Bacteria 1579
84 Ga0207647_10003003 3300025904 Bacteria 12690
85 Ga0207647_10014486 3300025904 Bacteria 5435
86 Ga0207647_10021739 3300025904 Bacteria 4275
87 Ga0207705_10016193 3300025909 Bacteria 5348
88 Ga0207705_10137037 3300025909 Bacteria 1825
89 Ga0207707_10174844 3300025912 Bacteria 1876
90 Ga0207657_10209689 3300025919 Bacteria 1564
91 Ga0207659_10055425 3300025926 Bacteria 2835
92 Ga0207690_10128839 3300025932 Bacteria 1849
93 Ga0207709_10016230 3300025935 Bacteria 4138
94 Ga0207709_10024063 3300025935 Bacteria 3474
95 Ga0207691_10004165 3300025940 Bacteria 14053
96 Ga0207639_10048159 3300026041 Bacteria 3225
97 Ga0207674_10003834 3300026116 Bacteria 18322
98 Ga0209813_10005047 3300027866 Bacteria 3190
99 Ga0207428_10000930 3300027907 Bacteria 32598
100 Ga0207428_10034774 3300027907 Bacteria 4126
101 Ga0268266_10014428 3300028379 Bacteria 6793
102 Ga0307517_10002661 3300028786 Bacteria 28533
103 Ga0307515_10043521 3300028794 Bacteria 6976
104 Ga0307512_10025890 3300030522 Bacteria 5188
105 Ga0307513_10017644 3300031456 Bacteria 8553
106 Ga0307513_10253479 3300031456 Bacteria 1555
107 Ga0307408_100033573 3300031548 Bacteria 3586
108 Ga0307408_100110295 3300031548 Bacteria 2112
109 Ga0307508_10023476 3300031616 Bacteria 5598
110 Ga0307514_10017872 3300031649 Bacteria 5827
111 Ga0307514_10046967 3300031649 Bacteria 3372
112 Ga0316575_10000020 3300031665 Bacteria 41761
113 Ga0307516_10086151 3300031730 Bacteria 2978
114 Ga0307516_10224380 3300031730 Bacteria 1586
115 Ga0307405_10002212 3300031731 Bacteria 8494
116 Ga0307405_10034996 3300031731 Bacteria 2995
117 Ga0307405_10048808 3300031731 Bacteria 2613
118 Ga0307405_10055697 3300031731 Bacteria 2476
119 Ga0307405_10077513 3300031731 Bacteria 2160
120 Ga0307405_10155550 3300031731 Bacteria 1613
121 Ga0307405_10187543 3300031731 Bacteria 1490
122 Ga0307413_10039323 3300031824 Bacteria 2750
123 Ga0307413_10123346 3300031824 Bacteria 1759
124 Ga0307410_10020465 3300031852 Bacteria 4047
125 Ga0307410_10024749 3300031852 Bacteria 3756
126 Ga0307410_10035774 3300031852 Bacteria 3229
127 Ga0307410_10067611 3300031852 Bacteria 2465
128 Ga0307410_10103357 3300031852 Bacteria 2046
129 Ga0307406_10000217 3300031901 Bacteria 34729
130 Ga0307406_10000795 3300031901 Bacteria 17683
131 Ga0307406_10012650 3300031901 Bacteria 4812
132 Ga0307406_10013566 3300031901 Bacteria 4671
133 Ga0307407_10018907 3300031903 Bacteria 3497
134 Ga0307407_10026812 3300031903 Bacteria 3056
135 Ga0307407_10028089 3300031903 Bacteria 3003
136 Ga0307407_10059330 3300031903 Bacteria 2228
137 Ga0307407_10060796 3300031903 Bacteria 2206
138 Ga0307407_10083323 3300031903 Bacteria 1940
139 Ga0307412_10006909 3300031911 Bacteria 6438
140 Ga0307412_10022049 3300031911 Bacteria 3898
141 Ga0307412_10038443 3300031911 Bacteria 3082
142 Ga0307412_10047139 3300031911 Bacteria 2829
143 Ga0307412_10055007 3300031911 Bacteria 2645
144 Ga0307412_10096688 3300031911 Bacteria 2079
145 Ga0307412_10104466 3300031911 Bacteria 2010
146 Ga0307409_100019274 3300031995 Bacteria 4614
147 Ga0307409_100063104 3300031995 Bacteria 2904
148 Ga0307409_100072330 3300031995 Bacteria 2745
149 Ga0307409_100118713 3300031995 Bacteria 2234
150 Ga0307409_100139219 3300031995 Bacteria 2088
151 Ga0307409_100314688 3300031995 Bacteria 1462
152 Ga0307416_100042927 3300032002 Bacteria 3535
153 Ga0307416_100046082 3300032002 Bacteria 3438
154 Ga0307416_100057842 3300032002 Bacteria 3139
155 Ga0307416_100144085 3300032002 Bacteria 2171
156 Ga0307416_100306265 3300032002 Bacteria 1582
157 Ga0307414_10024948 3300032004 Bacteria 3821
158 Ga0307414_10053480 3300032004 Bacteria 2816
159 Ga0307411_10054680 3300032005 Bacteria 2622
160 Ga0307411_10201850 3300032005 Bacteria 1528
161 Ga0307510_10126949 3300033180 Bacteria 2237
162 Ga0395899_0022477 3300037312 Bacteria 4782
163 Ga0395899_0129821 3300037312 Bacteria 1800
164 Ga0395900_0007672 3300037418 Bacteria 11131
165 Ga0395900_0022895 3300037418 Bacteria 6393
166 Ga0395900_0044495 3300037418 Bacteria 4574
167 Ga0395900_0112045 3300037418 Bacteria 2802
168 Ga0395900_0116189 3300037418 Bacteria 2745
169 Ga0395900_0156815 3300037418 Bacteria 2325
170 Ga0395898_0002083 3300037466 Bacteria 24880
171 Ga0395898_0003163 3300037466 Bacteria 18566
172 Ga0395898_0009247 3300037466 Bacteria 10366
173 Ga0395898_0014659 3300037466 Bacteria 8049
174 Ga0395898_0043966 3300037466 Bacteria 4400
175 Ga0395898_0094782 3300037466 Bacteria 2868
176 Ga0436364_1344107 3300037853 Bacteria 9638
177 Ga0395901_0015426 3300038443 Bacteria 7780
178 Ga0395901_0048733 3300038443 Bacteria 4400
179 Ga0395901_0052609 3300038443 Bacteria 4232
180 Ga0395901_0062250 3300038443 Bacteria 3883
181 Ga0395901_0324873 3300038443 Bacteria 1591
182 Ga0439436_0000502 3300041404 Bacteria 10200
183 Ga0439466_0009647 3300041411 Bacteria 3607
184 Ga0451793_0867888 3300041452 Bacteria 2830
185 Ga0451853_0434821 3300041512 Bacteria 3963
186 Ga0451853_2129295 3300041512 Bacteria 6836
187 Ga0439433_0000454 3300041999 Bacteria 7545
188 Ga0439442_000606 3300042002 Bacteria 7709
189 Ga0439442_004446 3300042002 Bacteria 2784
190 Ga0439448_0028505 3300042005 Bacteria 1764
191 Ga0439449_0001965 3300042007 Bacteria 8075
192 Ga0439449_0002526 3300042007 Bacteria 7149
193 Ga0439457_007694 3300042014 Bacteria 2577
194 Ga0439462_0003287 3300042015 Bacteria 3864
195 Ga0450894_000266 3300042131 Bacteria 9384
196 Ga0450898_000307 3300042134 Bacteria 5509
197 Ga0450899_000210 3300042135 Bacteria 6073
198 Ga0450903_000007 3300042138 Bacteria 38287
199 Ga0450906_000632 3300042145 Bacteria 7538
200 Ga0439458_0003549 3300042157 Bacteria 3638
201 Ga0450908_007691 3300042184 Bacteria 2029
202 Ga0466969_0008633 3300044656 Bacteria 5406
203 Ga0466969_0012566 3300044656 Bacteria 4462
204 Ga0466972_0007060 3300044658 Bacteria 5636
205 Ga0466972_0039973 3300044658 Bacteria 2287
206 Ga0466972_0041628 3300044658 Bacteria 2236
207 Ga0466972_0095630 3300044658 Bacteria 1407
208 Ga0466965_0001891 3300044683 Bacteria 8722
209 Ga0466965_0003638 3300044683 Bacteria 6791
210 Ga0466965_0007733 3300044683 Bacteria 4946
211 Ga0466965_0016037 3300044683 Bacteria 3560
212 Ga0466965_0024262 3300044683 Bacteria 2932
213 Ga0466965_0030137 3300044683 Bacteria 2642
214 Ga0466966_0001283 3300044684 Bacteria 16087
215 Ga0466966_0046283 3300044684 Bacteria 2778
216 Ga0466961_0001837 3300044693 Bacteria 13179
217 Ga0466961_0003608 3300044693 Bacteria 9651
218 Ga0466961_0023589 3300044693 Bacteria 3958
219 Ga0466961_0049394 3300044693 Bacteria 2689
220 Ga0466963_0000899 3300044694 Bacteria 15139
221 Ga0466963_0048138 3300044694 Bacteria 2815
222 Ga0466964_0001737 3300044706 Bacteria 7539
223 Ga0466971_0000438 3300044719 Bacteria 16270
224 Ga0466968_0049786 3300044735 Bacteria 1786
225 Ga0466968_0075063 3300044735 Bacteria 1477
226 Ga0466970_0000176 3300044765 Bacteria 30506
227 Ga0466970_0002192 3300044765 Bacteria 9438
228 Ga0466970_0008421 3300044765 Bacteria 5189
229 Ga0466970_0024826 3300044765 Bacteria 3135
230 Ga0466970_0027328 3300044765 Bacteria 2994
231 Ga0466957_0007164 3300044842 Bacteria 6307
232 Ga0466957_0017272 3300044842 Bacteria 4224
233 Ga0466960_0000476 3300044901 Bacteria 13674
234 Ga0466960_0009070 3300044901 Bacteria 4092
235 Ga0466960_0035602 3300044901 Bacteria 2327
236 Ga0466959_0000885 3300045049 Bacteria 17643
237 Ga0466959_0022541 3300045049 Bacteria 4656
238 Ga0466959_0122295 3300045049 Bacteria 1849
239 Ga0466959_0133622 3300045049 Bacteria 1757
240 Ga0466958_0002552 3300045836 Bacteria 9185
241 Ga0466958_0038815 3300045836 Bacteria 2858
242 Ga0466958_0072716 3300045836 Bacteria 2106
243 Ga0466967_0001934 3300045976 Bacteria 12530
244 Ga0466967_0160728 3300045976 Bacteria 2108
245 Ga0466967_0172522 3300045976 Bacteria 2036
246 Ga0495627_000401 3300046453 Bacteria 38376
247 Ga0495603_0011409 3300046455 Bacteria 5379
248 Ga0495603_0019356 3300046455 Bacteria 4120
249 Ga0495603_0049457 3300046455 Bacteria 2503
250 Ga0495629_0003337 3300046459 Bacteria 12131
251 Ga0495629_0005059 3300046459 Bacteria 9866
252 Ga0495638_0036113 3300046460 Bacteria 3149
253 Ga0495651_0021660 3300046462 Bacteria 4997
254 Ga0495582_0107629 3300046473 Bacteria 1565
255 Ga0495664_0015086 3300046477 Bacteria 4390
256 Ga0495584_0050492 3300046491 Bacteria 2095
257 Ga0495594_0000183 3300046499 Bacteria 30417
258 Ga0495594_0008626 3300046499 Bacteria 5252
259 Ga0495618_0155023 3300046514 Bacteria 1462
260 Ga0495628_0006731 3300046516 Bacteria 10015
261 Ga0495630_0115200 3300046517 Bacteria 2037
262 Ga0495632_0022270 3300046519 Bacteria 3398
263 Ga0495643_0001934 3300046522 Bacteria 17437
264 Ga0495652_0004275 3300046529 Bacteria 13709
265 Ga0495665_0034504 3300046531 Bacteria 2705
266 Ga0495640_0074470 3300046533 Bacteria 2270
267 Ga0495586_0061367 3300046535 Bacteria 2046
268 Ga0495586_0061915 3300046535 Bacteria 2036
269 Ga0495587_0012474 3300046536 Bacteria 5347
270 Ga0495645_0078862 3300046543 Bacteria 2366
271 Ga0495622_0029690 3300046557 Bacteria 2554
272 Ga0495667_0033339 3300046559 Bacteria 3447
273 Ga0495611_0030131 3300046648 Bacteria 2384
274 Ga0495625_0038469 3300046660 Bacteria 3502
275 Ga0495588_0024620 3300046674 Bacteria 2991
276 Ga0495657_0014574 3300046675 Bacteria 5768
277 Ga0495613_0000823 3300046689 Bacteria 24027
278 Ga0495624_0128817 3300046690 Bacteria 1552
279 Ga0495671_0061764 3300046692 Bacteria 1848
280 Ga0495649_0085434 3300046694 Bacteria 1684
281 Ga0495660_0016149 3300046810 Bacteria 4306
282 Ga0495581_0009365 3300047315 Bacteria 5667
283 Ga0495581_0018154 3300047315 Bacteria 4086
284 Ga0495604_0038259 3300047317 Bacteria 3774
285 Ga0495676_0000425 3300047321 Bacteria 34173
286 Ga0495676_0061686 3300047321 Bacteria 2931
287 Ga0495676_0095245 3300047321 Bacteria 2215
288 Ga0495683_0023477 3300047323 Bacteria 3170
289 Ga0495683_0061214 3300047323 Bacteria 1864
290 Ga0495675_0060955 3300047444 Bacteria 2390
291 Ga0495685_000276 3300047447 Bacteria 17244
292 Ga0495685_011251 3300047447 Bacteria 3015
293 Ga0495681_0001135 3300047470 Bacteria 20239
294 Ga0495681_0046436 3300047470 Bacteria 2071
295 Ga0495614_0006629 3300048089 Bacteria 5184
296 Ga0496101_0028213 3300048904 Bacteria 3917
297 Ga0496101_0054290 3300048904 Bacteria 2892
298 Ga0496102_0002409 3300048905 Bacteria 15971
299 Ga0496102_0050650 3300048905 Bacteria 3782
300 Ga0496102_0060141 3300048905 Bacteria 3476
301 Ga0496103_0003299 3300048906 Bacteria 9877
302 Ga0496103_0031142 3300048906 Bacteria 3249
303 Ga0496103_0063610 3300048906 Bacteria 2298
304 Ga0496104_0039361 3300048907 Bacteria 4427
305 Ga0496104_0093039 3300048907 Bacteria 2883
306 Ga0496105_0008276 3300048908 Bacteria 8088
307 Ga0496105_0042831 3300048908 Bacteria 3732
308 Ga0496105_0046971 3300048908 Bacteria 3563
309 Ga0496105_0066479 3300048908 Bacteria 2976
310 Ga0496106_0053327 3300048909 Bacteria 3054
311 Ga0496109_0128851 3300048912 Bacteria 2361
312 Ga0496109_0347243 3300048912 Bacteria 1401
313 Ga0496110_0040573 3300048913 Bacteria 4057
314 Ga0496111_0136553 3300048914 Bacteria 1816
315 Ga0496111_0196818 3300048914 Bacteria 1498
316 Ga0496112_0154763 3300048915 Bacteria 2260
317 Ga0496113_0044504 3300048916 Bacteria 3289
318 Ga0496113_0313642 3300048916 Bacteria 1257
319 Ga0496114_0014522 3300048917 Bacteria 6326
320 Ga0496114_0018358 3300048917 Bacteria 5655
321 Ga0496114_0036186 3300048917 Bacteria 4080
322 Ga0496114_0045186 3300048917 Bacteria 3658
323 Ga0496114_0045508 3300048917 Bacteria 3646
324 Ga0496114_0056148 3300048917 Bacteria 3285
325 Ga0496115_0008804 3300048918 Bacteria 7480
326 Ga0496115_0032784 3300048918 Bacteria 4100
327 Ga0496115_0044181 3300048918 Bacteria 3553
328 Ga0496115_0077461 3300048918 Bacteria 2703
329 Ga0496115_0102969 3300048918 Bacteria 2341
330 Ga0496116_0046538 3300048919 Bacteria 2927
331 Ga0496117_0000053 3300048920 Bacteria 279396
332 Ga0496117_0001098 3300048920 Bacteria 40887
333 Ga0496117_0002166 3300048920 Bacteria 25599
334 Ga0496117_0012242 3300048920 Bacteria 7586
335 Ga0496117_0021611 3300048920 Bacteria 5198
336 Ga0496117_0031847 3300048920 Bacteria 4019
337 Ga0496118_0004656 3300048921 Bacteria 16093
338 Ga0496118_0012368 3300048921 Bacteria 8202
339 Ga0496118_0024300 3300048921 Bacteria 5236
340 Ga0496118_0025277 3300048921 Bacteria 5098
341 Ga0496118_0027693 3300048921 Bacteria 4789
342 Ga0496118_0162412 3300048921 Bacteria 1379
343 Ga0496119_0001888 3300048922 Bacteria 24099
344 Ga0496119_0002138 3300048922 Bacteria 22248
345 Ga0496119_0005568 3300048922 Bacteria 11985
346 Ga0496119_0006144 3300048922 Bacteria 11241
347 Ga0496119_0102418 3300048922 Bacteria 1605
348 Ga0496119_0133690 3300048922 Bacteria 1348
349 Ga0496120_0004461 3300048923 Bacteria 11730
350 Ga0496120_0011223 3300048923 Bacteria 6178
351 Ga0496120_0035721 3300048923 Bacteria 2965
352 Ga0496121_0091924 3300048924 Bacteria 2367
353 Ga0496122_0000031 3300048925 Bacteria 329726
354 Ga0496122_0000194 3300048925 Bacteria 139191
355 Ga0496122_0001160 3300048925 Bacteria 45119
356 Ga0496122_0002890 3300048925 Bacteria 23494
357 Ga0496122_0004113 3300048925 Bacteria 18414
358 Ga0496122_0083405 3300048925 Bacteria 2216
359 Ga0496123_0000013 3300048926 Bacteria 439694
360 Ga0496123_0000350 3300048926 Bacteria 86569
361 Ga0496123_0000405 3300048926 Bacteria 79019
362 Ga0496123_0019951 3300048926 Bacteria 5262
363 Ga0496124_0008009 3300048927 Bacteria 11120
364 Ga0496124_0008422 3300048927 Bacteria 10785
365 Ga0496124_0013529 3300048927 Bacteria 7958
366 Ga0496124_0039796 3300048927 Bacteria 4071
367 Ga0496124_0124997 3300048927 Bacteria 2050
368 Ga0496125_0000077 3300048928 Bacteria 232629
369 Ga0496125_0000214 3300048928 Bacteria 118625
370 Ga0496125_0001794 3300048928 Bacteria 29677
371 Ga0496125_0002783 3300048928 Bacteria 22123
372 Ga0496125_0018219 3300048928 Bacteria 6673
373 Ga0496125_0036927 3300048928 Bacteria 4256
374 Ga0496125_0096634 3300048928 Bacteria 2192
375 Ga0496125_0139859 3300048928 Bacteria 1685
376 Ga0496126_0002423 3300048929 Bacteria 25250
377 Ga0496126_0008871 3300048929 Bacteria 10775
378 Ga0496126_0034141 3300048929 Bacteria 4781
379 Ga0496126_0078199 3300048929 Bacteria 2932
380 Ga0496126_0216034 3300048929 Bacteria 1613
381 Ga0501325_001480 3300049541 Bacteria 1452
382 Ga0501031_0002094 3300049568 Bacteria 12574
383 Ga0501031_0019702 3300049568 Bacteria 4395
384 Ga0501032_0005652 3300049569 Bacteria 9266
385 Ga0501032_0006541 3300049569 Bacteria 8557
386 Ga0501032_0031378 3300049569 Bacteria 3643
387 Ga0501032_0073159 3300049569 Bacteria 2283
388 Ga0501032_0076907 3300049569 Bacteria 2222
389 Ga0501033_0000628 3300049570 Bacteria 32661
390 Ga0501033_0009706 3300049570 Bacteria 7400
391 Ga0501033_0033212 3300049570 Bacteria 3874
392 Ga0501033_0072022 3300049570 Bacteria 2538
393 Ga0501034_0000465 3300049571 Bacteria 67251
394 Ga0501034_0002014 3300049571 Bacteria 25631
395 Ga0501034_0007513 3300049571 Bacteria 11594
396 Ga0501034_0009822 3300049571 Bacteria 10006
397 Ga0501034_0017233 3300049571 Bacteria 7410
398 Ga0501034_0019363 3300049571 Bacteria 6961
399 Ga0501034_0024319 3300049571 Bacteria 6161
400 Ga0501034_0037157 3300049571 Bacteria 4931
401 Ga0501034_0039146 3300049571 Bacteria 4802
402 Ga0501034_0041764 3300049571 Bacteria 4640
403 Ga0501034_0046963 3300049571 Bacteria 4362
404 Ga0501034_0056611 3300049571 Bacteria 3944
405 Ga0501034_0084228 3300049571 Bacteria 3181
406 Ga0501034_0128570 3300049571 Bacteria 2517
407 Ga0501036_0001706 3300049572 Bacteria 17067
408 Ga0501036_0004285 3300049572 Bacteria 11522
409 Ga0501036_0008345 3300049572 Bacteria 8487
410 Ga0501036_0012325 3300049572 Bacteria 7079
411 Ga0501036_0014480 3300049572 Bacteria 6570
412 Ga0501036_0027975 3300049572 Bacteria 4766
413 Ga0501036_0040504 3300049572 Bacteria 3940
414 Ga0501036_0140859 3300049572 Bacteria 2035
415 Ga0501037_0000863 3300049573 Bacteria 22612
416 Ga0501037_0002320 3300049573 Bacteria 13751
417 Ga0501037_0002437 3300049573 Bacteria 13456
418 Ga0501037_0019819 3300049573 Bacteria 4963
419 Ga0501037_0105394 3300049573 Bacteria 2032
420 Ga0501038_0001295 3300049574 Bacteria 22770
421 Ga0501038_0006429 3300049574 Bacteria 10874
422 Ga0501038_0011829 3300049574 Bacteria 7965
423 Ga0501038_0014126 3300049574 Bacteria 7275
424 Ga0501038_0014451 3300049574 Bacteria 7195
425 Ga0501038_0022833 3300049574 Bacteria 5600
426 Ga0501038_0055449 3300049574 Bacteria 3404
427 Ga0501038_0113501 3300049574 Bacteria 2242
428 Ga0501039_0006630 3300049575 Bacteria 8797
429 Ga0501039_0008476 3300049575 Bacteria 7837
430 Ga0501040_0001421 3300049576 Bacteria 15151
431 Ga0501040_0005559 3300049576 Bacteria 8162
432 Ga0501041_0001688 3300049577 Bacteria 12370
433 Ga0501041_0002741 3300049577 Bacteria 10061
434 Ga0501042_0008388 3300049578 Bacteria 6815
435 Ga0501043_0001870 3300049579 Bacteria 18033
436 Ga0501043_0005475 3300049579 Bacteria 10258
437 Ga0501043_0025489 3300049579 Bacteria 4640
438 Ga0501043_0057669 3300049579 Bacteria 3049
439 Ga0501043_0065045 3300049579 Bacteria 2863
440 Ga0501043_0103787 3300049579 Bacteria 2233
441 Ga0501043_0108935 3300049579 Bacteria 2175
442 Ga0501043_0163205 3300049579 Bacteria 1740
443 Ga0501046_0004159 3300049580 Bacteria 13175
444 Ga0501046_0004762 3300049580 Bacteria 12242
445 Ga0501046_0005900 3300049580 Bacteria 10919
446 Ga0501046_0025790 3300049580 Bacteria 4806
447 Ga0501046_0032451 3300049580 Bacteria 4228
448 Ga0501047_0004256 3300049581 Bacteria 13477
449 Ga0501047_0006266 3300049581 Bacteria 11181
450 Ga0501047_0015383 3300049581 Bacteria 7287
451 Ga0501047_0033715 3300049581 Bacteria 4941
452 Ga0501047_0089555 3300049581 Bacteria 2954
453 Ga0501047_0111842 3300049581 Bacteria 2613
454 Ga0501047_0176731 3300049581 Bacteria 2002
455 Ga0501048_0003589 3300049582 Bacteria 11809
456 Ga0501048_0006426 3300049582 Bacteria 8932
457 Ga0501067_0004179 3300049583 Bacteria 7966
458 Ga0501067_0089301 3300049583 Bacteria 1710
459 Ga0501068_0000763 3300049584 Bacteria 16558
460 Ga0501068_0010793 3300049584 Bacteria 5138
461 Ga0501070_0000133 3300049586 Bacteria 67036
462 Ga0501070_0007031 3300049586 Bacteria 9574
463 Ga0501070_0007947 3300049586 Bacteria 8985
464 Ga0501070_0011636 3300049586 Bacteria 7428
465 Ga0501070_0021680 3300049586 Bacteria 5386
466 Ga0501070_0027514 3300049586 Bacteria 4770
467 Ga0501070_0177560 3300049586 Bacteria 1753
468 Ga0501071_0000105 3300049587 Bacteria 32519
469 Ga0501071_0049598 3300049587 Bacteria 3022
470 Ga0501072_0002067 3300049588 Bacteria 14928
471 Ga0501073_0019632 3300049589 Bacteria 4876
472 Ga0501073_0025139 3300049589 Bacteria 4274
473 Ga0501074_0004504 3300049590 Bacteria 9977
474 Ga0501074_0005437 3300049590 Bacteria 9160
475 Ga0501075_0000816 3300049591 Bacteria 19523
476 Ga0501076_0002548 3300049592 Bacteria 12542
477 Ga0501077_0009552 3300049593 Bacteria 6031
478 Ga0501079_0009597 3300049741 Bacteria 7338
479 Ga0501079_0009875 3300049741 Bacteria 7242
480 Ga0501080_0012890 3300049742 Bacteria 7671
481 Ga0501080_0161771 3300049742 Bacteria 2067
482 Ga0501083_0003600 3300049744 Bacteria 10871
483 Ga0501083_0086764 3300049744 Bacteria 2069
484 Ga0501035_0003528 3300049822 Bacteria 14955
485 Ga0501035_0016985 3300049822 Bacteria 6706
486 Ga0501035_0020135 3300049822 Bacteria 6127
487 Ga0501035_0035284 3300049822 Bacteria 4539
488 Ga0501035_0040085 3300049822 Bacteria 4234
489 Ga0501044_0005774 3300049823 Bacteria 13698
490 Ga0501044_0011707 3300049823 Bacteria 9503
491 Ga0501044_0013333 3300049823 Bacteria 8895
492 Ga0501044_0032083 3300049823 Bacteria 5522
493 Ga0501044_0060373 3300049823 Bacteria 3882
494 Ga0501044_0061882 3300049823 Bacteria 3828
495 Ga0501044_0111700 3300049823 Bacteria 2740
496 Ga0501044_0131305 3300049823 Bacteria 2498
497 Ga0501044_0386214 3300049823 Bacteria 1314
498 Ga0501045_0004876 3300049824 Bacteria 9290
499 Ga0501045_0007703 3300049824 Bacteria 7492
500 nmdc:mga03n38_11297_c1 3300050490 Bacteria 3321
501 nmdc:mga00v17_10925_c1 3300050491 Bacteria 4976
502 nmdc:mga00v17_129928_c1 3300050491 Bacteria 1609
503 nmdc:mga00v17_23769_c1 3300050491 Bacteria 3549
504 nmdc:mga00v17_23924_c1 3300050491 Bacteria 3538
505 nmdc:mga00v17_9487_c1 3300050491 Bacteria 5270
506 nmdc:mga0yw44_31744_c1 3300050492 Bacteria 3074
507 nmdc:mga06z11_886_c1 3300050494 Bacteria 10922
508 nmdc:mga04h51_3550_c1 3300050495 Bacteria 3799
509 nmdc:mga07m45_15975_c1 3300050496 Bacteria 4015
510 Ga0500635_0000023 3300053080 Bacteria 108024
511 Ga0495619_0024672 3300053085 Bacteria 3858
512 Ga0500652_000684 3300053131 Bacteria 11506
513 Ga0500559_0000183 3300053136 Bacteria 49768
514 Ga0500573_0034169 3300053140 Bacteria 2933
515 Ga0500579_058818 3300053143 Bacteria 2297
516 Ga0500600_0119590 3300053149 Bacteria 1360
517 Ga0500604_0033739 3300053151 Bacteria 1515
518 Ga0500616_0000241 3300053153 Bacteria 86038
519 Ga0500616_0002314 3300053153 Bacteria 16093
520 Ga0500616_0009882 3300053153 Bacteria 5748
521 Ga0501084_0003176 3300054114 Bacteria 13289
522 Ga0501084_0004449 3300054114 Bacteria 11443
523 Ga0501084_0066321 3300054114 Bacteria 3020
524 Ga0587090_000021 3300059510 Bacteria 7644
525 Ga0587072_001667 3300059643 Bacteria 2823
526 Ga0501082_0073560 3300060353 Bacteria 2943
527 Ga0501082_0102905 3300060353 Bacteria 2470
528 Ga0466962_0000735 3300061719 Bacteria 14693
529 Ga0530510_0002178 3300061734 Bacteria 13433
530 2537901164 2537561592 Bacteria 4348607
531 2554258278 2554235005 Bacteria 6457341
532 2585299010 2582581312 Bacteria 7308206
533 2585310024 2582581313 Bacteria 10042643
534 2585315691 2582581314 Bacteria 11452267
535 2588108933 2585428157 Bacteria 3018951
536 2616900439 2616644941 Bacteria 8510691
537 2643733892 2643221542 Bacteria 3563959
538 2643753283 2643221546 Bacteria 2910897
539 2643765474 2643221548 Bacteria 8053412
540 2643768048 2643221549 Bacteria 4042819
541 2643785516 2643221553 Bacteria 3544260
542 2643848615 2643221566 Bacteria 3460379
543 2643875633 2643221572 Bacteria 3614809
544 2643885694 2643221575 Bacteria 4022601
545 2643898256 2643221578 Bacteria 9213798
546 2643944370 2643221587 Bacteria 7586415
547 2643996113 2643221597 Bacteria 3347721
548 2644082077 2643221613 Bacteria 4622396
549 2644095698 2643221616 Bacteria 4066575
550 2644111434 2643221619 Bacteria 4158469
551 2644170473 2643221630 Bacteria 3601215
552 2644183014 2643221632 Bacteria 3406696
553 2644198717 2643221635 Bacteria 2632343
554 2644264497 2643221647 Bacteria 10741251
555 2644382688 2643221669 Bacteria 3611286
556 2644385710 2643221670 Bacteria 6497041
557 2644409401 2643221673 Bacteria 9196637
558 2644431268 2643221677 Bacteria 7584031
559 2644436745 2643221678 Bacteria 9540101
560 2644443971 2643221679 Bacteria 3839507
561 2644462455 2643221682 Bacteria 6743283
562 2644503255 2643221690 Bacteria 4654705
563 2644525567 2643221694 Bacteria 4392972
564 2644625457 2643221714 Bacteria 9015452
565 2644664940 2643221721 Bacteria 4486924
566 2644669645 2643221722 Bacteria 4247614
567 2644679930 2643221724 Bacteria 3593515
568 2691514386 2690315906 Bacteria 4517044
569 2723641725 2721755702 Bacteria 4373124
570 2730229404 2728369380 Bacteria 3620317
571 2747952419 2747842429 Bacteria 3914386
572 2758225853 2757320536 Bacteria 3629334
573 2768643292 2767802112 Bacteria 6465194
574 2774380158 2773857758 Bacteria 3592392
575 2774399277 2773857763 Bacteria 4180068
576 2775655286 2775506735 Bacteria 4556596
577 2784588220 2784132148 Bacteria 8627943
578 2785343839 2784746763 Bacteria 9783172
579 2785369023 2784746768 Bacteria 10036182
580 2786670172 2786546132 Bacteria 10419719
581 2793981253 2791355406 Bacteria 11364898
582 2808630977 2808606306 Bacteria 3608896
583 2808827470 2808606357 Bacteria 4466944
584 2808841643 2808606359 Bacteria 9866990
585 2808852836 2808606360 Bacteria 4404006
586 2808873397 2808606365 Bacteria 4301966
587 2808878715 2808606366 Bacteria 4415912
588 2808885831 2808606368 Bacteria 3174172
589 2808891705 2808606370 Bacteria 4942454
590 2808896835 2808606371 Bacteria 4251511
591 2808901717 2808606372 Bacteria 4649509
592 2808920178 2808606375 Bacteria 9466072
593 2809227618 2808606447 Bacteria 3572005
594 2809231832 2808606448 Bacteria 8656184
595 2810364019 2808606700 Bacteria 3482157
596 2811848595 2808606982 Bacteria 7791042
597 2812320745 2811994871 Bacteria 4497550
598 2812323427 2811994872 Bacteria 4121241
599 2812358609 2811994879 Bacteria 9313447
600 2812364726 2811994880 Bacteria 4147780
601 2812480933 2811994917 Bacteria 7761064
602 2819693327 2818991463 Bacteria 7948711
603 2821270220 2821268502 Bacteria 3750023
604 2833711178 2833709550 Bacteria 4008291
605 2835189088 2835188231 Bacteria 3476928
606 2839986043 2839986021 Bacteria 3685650
607 2844842079 2844841374 Bacteria 3917147
608 2848552724 2848551377 Bacteria 3720646
609 2852634382 2852632344 Bacteria 3463163
610 2852642335 2852635781 Bacteria 8251373
611 2852647122 2852646457 Bacteria 3408613
612 2852665046 2852663356 Bacteria 4090475
613 2852680094 2852677369 Bacteria 3768884
614 2857480713 2857479173 Bacteria 2469263
615 2857634202 2857632687 Bacteria 2448521
616 2857713174 2857710386 Bacteria 3186771
617 2857720111 2857720070 Bacteria 3189373
618 2857723568 2857723135 Bacteria 4217853
619 2857730181 2857729791 Bacteria 4040535
620 2862184580 2862178590 Bacteria 8583590
621 2862287746 2862281513 Bacteria 9621493
622 2862390216 2862382967 Bacteria 10317375
623 2862579636 2862574272 Bacteria 10567477
624 2862710288 2862705112 Bacteria 6563286
625 2862994996 2862993130 Bacteria 3860849
626 2863405135 2863404153 Bacteria 9672205
627 2867350037 2867346516 Bacteria 7608576
628 2867371519 2867369537 Bacteria 6501581
629 2867429128 2867428634 Bacteria 9590268
630 2867477313 2867475112 Bacteria 6909112
631 2870630566 2870628048 Bacteria 3696012
632 2870802778 2870801768 Bacteria 2710986
633 2870804852 2870804320 Bacteria 2552467
634 2873156177 2873151551 Bacteria 8625867
635 2875394141 2875391855 Bacteria 7600475
636 2877681533 2877676314 Bacteria 9512378
637 2884765066 2884763398 Bacteria 4091164
638 2884996065 2884994152 Bacteria 4492978
639 2887447646 2887443736 Bacteria 4426037
640 2895661691 2895660088 Bacteria 3782833
641 2904432922 2904430863 Bacteria 3486923
642 2904511777 2904509784 Bacteria 3520416
643 2905927359 2905926851 Bacteria 4423176
644 2906803089 2906799679 Bacteria 4031749
645 2908680703 2908678064 Bacteria 3482747
646 2909074504 2909074476 Bacteria 3436050
647 2912720483 2912715099 Bacteria 9460473
648 2912724681 2912723979 Bacteria 8557534
649 2912760267 2912757875 Bacteria 7940295
650 2918504141 2918501144 Bacteria 8668083
651 2919041484 2919039151 Bacteria 3391018
652 2919057721 2919055335 Bacteria 3875751
653 2919071746 2919069694 Bacteria 3622919
654 2919391198 2919391150 Bacteria 4884741
655 2919396410 2919395869 Bacteria 3704152
656 2919446528 2919443155 Bacteria 4072969
657 2919449672 2919446982 Bacteria 3994487
658 2919473365 2919468124 Bacteria 9133025
659 2919524122 2919523602 Bacteria 3788128
660 2920882044 2920879853 Bacteria 4216831
661 2928092058 2928090899 Bacteria 3158267
662 2928123404 2928121344 Bacteria 3972376
663 2928155708 2928153084 Bacteria 4020257
664 2932432865 2932431166 Bacteria 4215299
665 2935396281 2935390628 Bacteria 7043367
666 2935411134 2935409751 Bacteria 4179611
667 2935893347 2935890801 Bacteria 4593001
668 2939598439 2939598168 Bacteria 4687164
669 2945918505 2945916053 Bacteria 4555517
670 2945921212 2945920336 Bacteria 4501603
671 2945942627 2945941187 Bacteria 4682474
672 2945959613 2945956166 Bacteria 5110334
673 2945971575 2945968032 Bacteria 4111363
674 2946005061 2946003308 Bacteria 3857229
675 2946038545 2946037020 Bacteria 4900426
676 2946043952 2946041624 Bacteria 4191385
677 2946050466 2946045630 Bacteria 8527308
678 2946062363 2946059875 Bacteria 4386623
679 2946067268 2946064051 Bacteria 8957905
680 2946075542 2946072368 Bacteria 8999607
681 2946081175 2946080515 Bacteria 4310960
682 2947229976 2947224130 Bacteria 9938529
683 2953999818 2953998280 Bacteria 4812144
684 2954003183 2954002825 Bacteria 9173742
685 2954386662 2954380949 Bacteria 10050426
686 2954676509 2954673503 Bacteria 9685905
687 2954687658 2954682443 Bacteria 9862841
688 2954697474 2954691527 Bacteria 10720516
689 2954704760 2954701450 Bacteria 10834262
690 2954716636 2954711539 Bacteria 10867210
691 2954726584 2954721474 Bacteria 10456478
692 2954735212 2954731030 Bacteria 10243860
693 2954745506 2954740390 Bacteria 10229294
694 2954754082 2954749733 Bacteria 10366972
695 2954764480 2954759201 Bacteria 9358192
696 2964327239 2964326757 Bacteria 3290868
697 2966602940 2966598605 Bacteria 7676064
698 2974297371 2974294766 Bacteria 3767688
699 2974306536 2974302888 Bacteria 4369871
700 2974326391 2974324384 Bacteria 3750535
701 2977231626 2977228692 Bacteria 3450105
702 2977236981 2977236895 Bacteria 3569373
703 2977266849 2977264416 Bacteria 3750737
704 2984545226 2984542743 Bacteria 3569378
705 2984581176 2984580707 Bacteria 3351387
706 2990046701 2990044586 Bacteria 6603797
707 2990062813 2990059506 Bacteria 9321252
708 2990088689 2990088156 Bacteria 6657676
709 2995727803 2995726249 Bacteria 3470435
710 2997456845 2997451912 Bacteria 8492419
711 2997601641 2997600082 Bacteria 9896405
712 3006321616 3006321560 Bacteria 8247479
713 3006394131 3006393351 Bacteria 6615579
714 3006496511 3006493962 Bacteria 8825450
715 8002813953 8002811521 Bacteria 2942897
716 8004027678 8004025490 Bacteria 4327753
717 8004185369 8004182704 Bacteria 3391155
718 8004213899 8004212874 Bacteria 2861420
719 8008559937 8008558824 Bacteria 10610750
720 8008579231 8008574985 Bacteria 7815457
721 8016257337 8016254467 Bacteria 3797036
722 8023631850 8023623736 Bacteria 8593882
723 8025483383 8025478263 Bacteria 8209203
724 8025526445 8025524527 Bacteria 7197316
725 8025533736 8025530807 Bacteria 8495698
726 8033685695 8033684223 Bacteria 6906479
727 8045831799 8045830549 Bacteria 4444727
728 8046353171 8046352972 Bacteria 3613806
729 8047898490 8047893842 Bacteria 11723082
730 8048134914 8048127548 Bacteria 11053136
731 8048360420 8048356638 Bacteria 11044339
732 8048375452 8048369669 Bacteria 11666822
733 8048382753 8048379754 Bacteria 11877923
734 8048411129 8048406513 Bacteria 8936924
735 8054107887 8054107350 Bacteria 5022511
736 8054161027 8054160619 Bacteria 7783213
737 8055036238 8055034563 Bacteria 3562128
738 8055038290 8055037949 Bacteria 3337834
739 8056673238 8056667051 Bacteria 6953971
740 8056830409 8056829672 Bacteria 9045328
741 JGI25154J39366_1000846
742 JGI24737J22298_10002831
743 JGI24735J21928_10004528
744 JGI24738J21930_10007855
745 JGI25165J46597_1000002
746 Ga0007427J51700_107271
747 Ga0006562J51391_1032679
748 Ga0006562J51391_1032682
749 Ga0006562J51391_1034854
750 Ga0006780_1011353
751 Ga0055539_1000111
752 Ga0055533_1000001
753 Ga0055525_1000317
754 Ga0055527_1000012
755 Ga0055542_1000017
756 Ga0055529_1000023
757 Ga0055541_1004852
758 Ga0065714_10019108
759 Ga0070658_10065597
760 Ga0070683_100239998
761 Ga0070666_10063792
762 Ga0070669_100016507
763 Ga0070675_100244363
764 Ga0070679_100133727
765 Ga0070696_100001852
766 Ga0070665_100052203
767 Ga0068852_100171729
768 Ga0081455_10051034
769 Ga0081540_1012227
770 Ga0081539_10001159
771 Ga0081539_10030524
772 Ga0075365_10047812
773 Ga0075368_10026380
774 Ga0075364_10004420
775 Ga0075364_10017035
776 Ga0075364_10017496
777 Ga0075364_10028991
778 Ga0075367_10000349
779 Ga0075369_10011511
780 Ga0075369_10012427
781 Ga0075370_10030256
782 Ga0105251_10030179
783 Ga0105243_10043093
784 Ga0105246_10018229
785 Ga0105246_10099641
786 Ga0157371_10031269
787 Ga0157369_10078764
788 Ga0171462_1003
789 Ga0157372_10059520
790 Ga0157380_10006032
791 Ga0182008_10004358
792 Ga0182006_1017956
793 Ga0182007_10001716
794 Ga0183367_1006
795 Ga0197907_10053258
796 Ga0206349_1248741
797 Ga0206355_1244303
798 Ga0206354_10663781
799 Ga0206353_11560231
800 Ga0213875_10021319
801 Ga0224712_10038306
802 Ga0224712_10042375
803 Ga0209566_100026
804 Ga0209674_100001
805 Ga0209672_100003
806 Ga0209147_100633
807 Ga0209563_100001
808 Ga0207427_100034
809 Ga0209437_100486
810 Ga0209258_101954
811 Ga0209646_1000168
812 Ga0209677_100001
813 Ga0209677_100321
814 Ga0209148_1000004
815 Ga0209233_1000001
816 Ga0209455_1000022
817 Ga0209455_1001078
818 Ga0207426_1003169
819 Ga0207426_1003328
820 Ga0207697_10003823
821 Ga0207655_1015461
822 Ga0207655_1031119
823 Ga0207680_10144677
824 Ga0207647_10003003
825 Ga0207647_10014486
826 Ga0207647_10021739
827 Ga0207705_10016193
828 Ga0207705_10137037
829 Ga0207707_10174844
830 Ga0207657_10209689
831 Ga0207659_10055425
832 Ga0207690_10128839
833 Ga0207709_10016230
834 Ga0207709_10024063
835 Ga0207691_10004165
836 Ga0207639_10048159
837 Ga0207674_10003834
838 Ga0209813_10005047
839 Ga0207428_10000930
840 Ga0207428_10034774
841 Ga0268266_10014428
842 Ga0307517_10002661
843 Ga0307515_10043521
844 Ga0307512_10025890
845 Ga0307513_10017644
846 Ga0307513_10253479
847 Ga0307408_100033573
848 Ga0307408_100110295
849 Ga0307508_10023476
850 Ga0307514_10017872
851 Ga0307514_10046967
852 Ga0316575_10000020
853 Ga0307516_10086151
854 Ga0307516_10224380
855 Ga0307405_10002212
856 Ga0307405_10034996
857 Ga0307405_10048808
858 Ga0307405_10055697
859 Ga0307405_10077513
860 Ga0307405_10155550
861 Ga0307405_10187543
862 Ga0307413_10039323
863 Ga0307413_10123346
864 Ga0307410_10020465
865 Ga0307410_10024749
866 Ga0307410_10035774
867 Ga0307410_10067611
868 Ga0307410_10103357
869 Ga0307406_10000217
870 Ga0307406_10000795
871 Ga0307406_10012650
872 Ga0307406_10013566
873 Ga0307407_10018907
874 Ga0307407_10026812
875 Ga0307407_10028089
876 Ga0307407_10059330
877 Ga0307407_10060796
878 Ga0307407_10083323
879 Ga0307412_10006909
880 Ga0307412_10022049
881 Ga0307412_10038443
882 Ga0307412_10047139
883 Ga0307412_10055007
884 Ga0307412_10096688
885 Ga0307412_10104466
886 Ga0307409_100019274
887 Ga0307409_100063104
888 Ga0307409_100072330
889 Ga0307409_100118713
890 Ga0307409_100139219
891 Ga0307409_100314688
892 Ga0307416_100042927
893 Ga0307416_100046082
894 Ga0307416_100057842
895 Ga0307416_100144085
896 Ga0307416_100306265
897 Ga0307414_10024948
898 Ga0307414_10053480
899 Ga0307411_10054680
900 Ga0307411_10201850
901 Ga0307510_10126949
902 Ga0395899_0022477
903 Ga0395899_0129821
904 Ga0395900_0007672
905 Ga0395900_0022895
906 Ga0395900_0044495
907 Ga0395900_0112045
908 Ga0395900_0116189
909 Ga0395900_0156815
910 Ga0395898_0002083
911 Ga0395898_0003163
912 Ga0395898_0009247
913 Ga0395898_0014659
914 Ga0395898_0043966
915 Ga0395898_0094782
916 Ga0436364_1344107
917 Ga0395901_0015426
918 Ga0395901_0048733
919 Ga0395901_0052609
920 Ga0395901_0062250
921 Ga0395901_0324873
922 Ga0439436_0000502
923 Ga0439466_0009647
924 Ga0451793_0867888
925 Ga0451853_0434821
926 Ga0451853_2129295
927 Ga0439433_0000454
928 Ga0439442_000606
929 Ga0439442_004446
930 Ga0439448_0028505
931 Ga0439449_0001965
932 Ga0439449_0002526
933 Ga0439457_007694
934 Ga0439462_0003287
935 Ga0450894_000266
936 Ga0450898_000307
937 Ga0450899_000210
938 Ga0450903_000007
939 Ga0450906_000632
940 Ga0439458_0003549
941 Ga0450908_007691
942 Ga0466969_0008633
943 Ga0466969_0012566
944 Ga0466972_0007060
945 Ga0466972_0039973
946 Ga0466972_0041628
947 Ga0466972_0095630
948 Ga0466965_0001891
949 Ga0466965_0003638
950 Ga0466965_0007733
951 Ga0466965_0016037
952 Ga0466965_0024262
953 Ga0466965_0030137
954 Ga0466966_0001283
955 Ga0466966_0046283
956 Ga0466961_0001837
957 Ga0466961_0003608
958 Ga0466961_0023589
959 Ga0466961_0049394
960 Ga0466963_0000899
961 Ga0466963_0048138
962 Ga0466964_0001737
963 Ga0466971_0000438
964 Ga0466968_0049786
965 Ga0466968_0075063
966 Ga0466970_0000176
967 Ga0466970_0002192
968 Ga0466970_0008421
969 Ga0466970_0024826
970 Ga0466970_0027328
971 Ga0466957_0007164
972 Ga0466957_0017272
973 Ga0466960_0000476
974 Ga0466960_0009070
975 Ga0466960_0035602
976 Ga0466959_0000885
977 Ga0466959_0022541
978 Ga0466959_0122295
979 Ga0466959_0133622
980 Ga0466958_0002552
981 Ga0466958_0038815
982 Ga0466958_0072716
983 Ga0466967_0001934
984 Ga0466967_0160728
985 Ga0466967_0172522
986 Ga0495627_000401
987 Ga0495603_0011409
988 Ga0495603_0019356
989 Ga0495603_0049457
990 Ga0495629_0003337
991 Ga0495629_0005059
992 Ga0495638_0036113
993 Ga0495651_0021660
994 Ga0495582_0107629
995 Ga0495664_0015086
996 Ga0495584_0050492
997 Ga0495594_0000183
998 Ga0495594_0008626
999 Ga0495618_0155023
1000 Ga0495628_0006731
1001 Ga0495630_0115200
1002 Ga0495632_0022270
1003 Ga0495643_0001934
1004 Ga0495652_0004275
1005 Ga0495665_0034504
1006 Ga0495640_0074470
1007 Ga0495586_0061367
1008 Ga0495586_0061915
1009 Ga0495587_0012474
1010 Ga0495645_0078862
1011 Ga0495622_0029690
1012 Ga0495667_0033339
1013 Ga0495611_0030131
1014 Ga0495625_0038469
1015 Ga0495588_0024620
1016 Ga0495657_0014574
1017 Ga0495613_0000823
1018 Ga0495624_0128817
1019 Ga0495671_0061764
1020 Ga0495649_0085434
1021 Ga0495660_0016149
1022 Ga0495581_0009365
1023 Ga0495581_0018154
1024 Ga0495604_0038259
1025 Ga0495676_0000425
1026 Ga0495676_0061686
1027 Ga0495676_0095245
1028 Ga0495683_0023477
1029 Ga0495683_0061214
1030 Ga0495675_0060955
1031 Ga0495685_000276
1032 Ga0495685_011251
1033 Ga0495681_0001135
1034 Ga0495681_0046436
1035 Ga0495614_0006629
1036 Ga0496101_0028213
1037 Ga0496101_0054290
1038 Ga0496102_0002409
1039 Ga0496102_0050650
1040 Ga0496102_0060141
1041 Ga0496103_0003299
1042 Ga0496103_0031142
1043 Ga0496103_0063610
1044 Ga0496104_0039361
1045 Ga0496104_0093039
1046 Ga0496105_0008276
1047 Ga0496105_0042831
1048 Ga0496105_0046971
1049 Ga0496105_0066479
1050 Ga0496106_0053327
1051 Ga0496109_0128851
1052 Ga0496109_0347243
1053 Ga0496110_0040573
1054 Ga0496111_0136553
1055 Ga0496111_0196818
1056 Ga0496112_0154763
1057 Ga0496113_0044504
1058 Ga0496113_0313642
1059 Ga0496114_0014522
1060 Ga0496114_0018358
1061 Ga0496114_0036186
1062 Ga0496114_0045186
1063 Ga0496114_0045508
1064 Ga0496114_0056148
1065 Ga0496115_0008804
1066 Ga0496115_0032784
1067 Ga0496115_0044181
1068 Ga0496115_0077461
1069 Ga0496115_0102969
1070 Ga0496116_0046538
1071 Ga0496117_0000053
1072 Ga0496117_0001098
1073 Ga0496117_0002166
1074 Ga0496117_0012242
1075 Ga0496117_0021611
1076 Ga0496117_0031847
1077 Ga0496118_0004656
1078 Ga0496118_0012368
1079 Ga0496118_0024300
1080 Ga0496118_0025277
1081 Ga0496118_0027693
1082 Ga0496118_0162412
1083 Ga0496119_0001888
1084 Ga0496119_0002138
1085 Ga0496119_0005568
1086 Ga0496119_0006144
1087 Ga0496119_0102418
1088 Ga0496119_0133690
1089 Ga0496120_0004461
1090 Ga0496120_0011223
1091 Ga0496120_0035721
1092 Ga0496121_0091924
1093 Ga0496122_0000031
1094 Ga0496122_0000194
1095 Ga0496122_0001160
1096 Ga0496122_0002890
1097 Ga0496122_0004113
1098 Ga0496122_0083405
1099 Ga0496123_0000013
1100 Ga0496123_0000350
1101 Ga0496123_0000405
1102 Ga0496123_0019951
1103 Ga0496124_0008009
1104 Ga0496124_0008422
1105 Ga0496124_0013529
1106 Ga0496124_0039796
1107 Ga0496124_0124997
1108 Ga0496125_0000077
1109 Ga0496125_0000214
1110 Ga0496125_0001794
1111 Ga0496125_0002783
1112 Ga0496125_0018219
1113 Ga0496125_0036927
1114 Ga0496125_0096634
1115 Ga0496125_0139859
1116 Ga0496126_0002423
1117 Ga0496126_0008871
1118 Ga0496126_0034141
1119 Ga0496126_0078199
1120 Ga0496126_0216034
1121 Ga0501325_001480
1122 Ga0501031_0002094
1123 Ga0501031_0019702
1124 Ga0501032_0005652
1125 Ga0501032_0006541
1126 Ga0501032_0031378
1127 Ga0501032_0073159
1128 Ga0501032_0076907
1129 Ga0501033_0000628
1130 Ga0501033_0009706
1131 Ga0501033_0033212
1132 Ga0501033_0072022
1133 Ga0501034_0000465
1134 Ga0501034_0002014
1135 Ga0501034_0007513
1136 Ga0501034_0009822
1137 Ga0501034_0017233
1138 Ga0501034_0019363
1139 Ga0501034_0024319
1140 Ga0501034_0037157
1141 Ga0501034_0039146
1142 Ga0501034_0041764
1143 Ga0501034_0046963
1144 Ga0501034_0056611
1145 Ga0501034_0084228
1146 Ga0501034_0128570
1147 Ga0501036_0001706
1148 Ga0501036_0004285
1149 Ga0501036_0008345
1150 Ga0501036_0012325
1151 Ga0501036_0014480
1152 Ga0501036_0027975
1153 Ga0501036_0040504
1154 Ga0501036_0140859
1155 Ga0501037_0000863
1156 Ga0501037_0002320
1157 Ga0501037_0002437
1158 Ga0501037_0019819
1159 Ga0501037_0105394
1160 Ga0501038_0001295
1161 Ga0501038_0006429
1162 Ga0501038_0011829
1163 Ga0501038_0014126
1164 Ga0501038_0014451
1165 Ga0501038_0022833
1166 Ga0501038_0055449
1167 Ga0501038_0113501
1168 Ga0501039_0006630
1169 Ga0501039_0008476
1170 Ga0501040_0001421
1171 Ga0501040_0005559
1172 Ga0501041_0001688
1173 Ga0501041_0002741
1174 Ga0501042_0008388
1175 Ga0501043_0001870
1176 Ga0501043_0005475
1177 Ga0501043_0025489
1178 Ga0501043_0057669
1179 Ga0501043_0065045
1180 Ga0501043_0103787
1181 Ga0501043_0108935
1182 Ga0501043_0163205
1183 Ga0501046_0004159
1184 Ga0501046_0004762
1185 Ga0501046_0005900
1186 Ga0501046_0025790
1187 Ga0501046_0032451
1188 Ga0501047_0004256
1189 Ga0501047_0006266
1190 Ga0501047_0015383
1191 Ga0501047_0033715
1192 Ga0501047_0089555
1193 Ga0501047_0111842
1194 Ga0501047_0176731
1195 Ga0501048_0003589
1196 Ga0501048_0006426
1197 Ga0501067_0004179
1198 Ga0501067_0089301
1199 Ga0501068_0000763
1200 Ga0501068_0010793
1201 Ga0501070_0000133
1202 Ga0501070_0007031
1203 Ga0501070_0007947
1204 Ga0501070_0011636
1205 Ga0501070_0021680
1206 Ga0501070_0027514
1207 Ga0501070_0177560
1208 Ga0501071_0000105
1209 Ga0501071_0049598
1210 Ga0501072_0002067
1211 Ga0501073_0019632
1212 Ga0501073_0025139
1213 Ga0501074_0004504
1214 Ga0501074_0005437
1215 Ga0501075_0000816
1216 Ga0501076_0002548
1217 Ga0501077_0009552
1218 Ga0501079_0009597
1219 Ga0501079_0009875
1220 Ga0501080_0012890
1221 Ga0501080_0161771
1222 Ga0501083_0003600
1223 Ga0501083_0086764
1224 Ga0501035_0003528
1225 Ga0501035_0016985
1226 Ga0501035_0020135
1227 Ga0501035_0035284
1228 Ga0501035_0040085
1229 Ga0501044_0005774
1230 Ga0501044_0011707
1231 Ga0501044_0013333
1232 Ga0501044_0032083
1233 Ga0501044_0060373
1234 Ga0501044_0061882
1235 Ga0501044_0111700
1236 Ga0501044_0131305
1237 Ga0501044_0386214
1238 Ga0501045_0004876
1239 Ga0501045_0007703
1240 nmdc:mga03n38_11297_c1
1241 nmdc:mga00v17_10925_c1
1242 nmdc:mga00v17_129928_c1
1243 nmdc:mga00v17_23769_c1
1244 nmdc:mga00v17_23924_c1
1245 nmdc:mga00v17_9487_c1
1246 nmdc:mga0yw44_31744_c1
1247 nmdc:mga06z11_886_c1
1248 nmdc:mga04h51_3550_c1
1249 nmdc:mga07m45_15975_c1
1250 Ga0500635_0000023
1251 Ga0495619_0024672
1252 Ga0500652_000684
1253 Ga0500559_0000183
1254 Ga0500573_0034169
1255 Ga0500579_058818
1256 Ga0500600_0119590
1257 Ga0500604_0033739
1258 Ga0500616_0000241
1259 Ga0500616_0002314
1260 Ga0500616_0009882
1261 Ga0501084_0003176
1262 Ga0501084_0004449
1263 Ga0501084_0066321
1264 Ga0587090_000021
1265 Ga0587072_001667
1266 Ga0501082_0073560
1267 Ga0501082_0102905
1268 Ga0466962_0000735
1269 Ga0530510_0002178
1270 2537901164
1271 2554258278
1272 2585299010
1273 2585310024
1274 2585315691
1275 2588108933
1276 2616900439
1277 2643733892
1278 2643753283
1279 2643765474
1280 2643768048
1281 2643785516
1282 2643848615
1283 2643875633
1284 2643885694
1285 2643898256
1286 2643944370
1287 2643996113
1288 2644082077
1289 2644095698
1290 2644111434
1291 2644170473
1292 2644183014
1293 2644198717
1294 2644264497
1295 2644382688
1296 2644385710
1297 2644409401
1298 2644431268
1299 2644436745
1300 2644443971
1301 2644462455
1302 2644503255
1303 2644525567
1304 2644625457
1305 2644664940
1306 2644669645
1307 2644679930
1308 2691514386
1309 2723641725
1310 2730229404
1311 2747952419
1312 2758225853
1313 2768643292
1314 2774380158
1315 2774399277
1316 2775655286
1317 2784588220
1318 2785343839
1319 2785369023
1320 2786670172
1321 2793981253
1322 2808630977
1323 2808827470
1324 2808841643
1325 2808852836
1326 2808873397
1327 2808878715
1328 2808885831
1329 2808891705
1330 2808896835
1331 2808901717
1332 2808920178
1333 2809227618
1334 2809231832
1335 2810364019
1336 2811848595
1337 2812320745
1338 2812323427
1339 2812358609
1340 2812364726
1341 2812480933
1342 2819693327
1343 2821270220
1344 2833711178
1345 2835189088
1346 2839986043
1347 2844842079
1348 2848552724
1349 2852634382
1350 2852642335
1351 2852647122
1352 2852665046
1353 2852680094
1354 2857480713
1355 2857634202
1356 2857713174
1357 2857720111
1358 2857723568
1359 2857730181
1360 2862184580
1361 2862287746
1362 2862390216
1363 2862579636
1364 2862710288
1365 2862994996
1366 2863405135
1367 2867350037
1368 2867371519
1369 2867429128
1370 2867477313
1371 2870630566
1372 2870802778
1373 2870804852
1374 2873156177
1375 2875394141
1376 2877681533
1377 2884765066
1378 2884996065
1379 2887447646
1380 2895661691
1381 2904432922
1382 2904511777
1383 2905927359
1384 2906803089
1385 2908680703
1386 2909074504
1387 2912720483
1388 2912724681
1389 2912760267
1390 2918504141
1391 2919041484
1392 2919057721
1393 2919071746
1394 2919391198
1395 2919396410
1396 2919446528
1397 2919449672
1398 2919473365
1399 2919524122
1400 2920882044
1401 2928092058
1402 2928123404
1403 2928155708
1404 2932432865
1405 2935396281
1406 2935411134
1407 2935893347
1408 2939598439
1409 2945918505
1410 2945921212
1411 2945942627
1412 2945959613
1413 2945971575
1414 2946005061
1415 2946038545
1416 2946043952
1417 2946050466
1418 2946062363
1419 2946067268
1420 2946075542
1421 2946081175
1422 2947229976
1423 2953999818
1424 2954003183
1425 2954386662
1426 2954676509
1427 2954687658
1428 2954697474
1429 2954704760
1430 2954716636
1431 2954726584
1432 2954735212
1433 2954745506
1434 2954754082
1435 2954764480
1436 2964327239
1437 2966602940
1438 2974297371
1439 2974306536
1440 2974326391
1441 2977231626
1442 2977236981
1443 2977266849
1444 2984545226
1445 2984581176
1446 2990046701
1447 2990062813
1448 2990088689
1449 2995727803
1450 2997456845
1451 2997601641
1452 3006321616
1453 3006394131
1454 3006496511
1455 8002813953
1456 8004027678
1457 8004185369
1458 8004213899
1459 8008559937
1460 8008579231
1461 8016257337
1462 8023631850
1463 8025483383
1464 8025526445
1465 8025533736
1466 8033685695
1467 8045831799
1468 8046353171
1469 8047898490
1470 8048134914
1471 8048360420
1472 8048375452
1473 8048382753
1474 8048411129
1475 8054107887
1476 8054161027
1477 8055036238
1478 8055038290
1479 8056673238
1480 8056830409

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00275

EPSP_synthase

EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase)

23

444

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
3swg-assembly1.cif.gz_A aquifex aeolicus mura in complex with udp-n-acetylmuramic acid and covalent adduct of pep with cys124 0.9318 7 439
1a2n-assembly1.cif.gz_A structure of the c115a mutant of mura complexed with the fluorinated analog of the reaction tetrahedral intermediate 0.9307 7 442
3zh4-assembly1.cif.gz_A crystal structure of s. pneumoniae hungary 19a mura1 in complex with citrate 0.93 7 442
3kr6-assembly1.cif.gz_A mura dead-end complex with fosfomycin 0.927 7 439
5u4h-assembly1.cif.gz_B 1.05 angstrom resolution crystal structure of udp-n-acetylglucosamine 1-carboxyvinyltransferase from acinetobacter baumannii in covalently bound complex with (2r)-2-(phosphonooxy)propanoic acid. 0.9257 5 439
ID Description Score Start End Superfamily
af_P0A749_226_417_3.40.50.1370 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase 0.9339 235 436 3.40.50.1370
af_Q2FWD4_231_413_3.65.10.10 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9337 240 437 3.65.10.10
3zh4A01 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.93 240 442 3.65.10.10
5bq2A01 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.9287 240 439 3.65.10.10
af_P9WJM1_237_415_3.65.10.10 Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain 0.926 246 437 3.65.10.10
ID Description Score Start End GO Terms
AF-A0A849HE14-F1-model_v4 UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7) (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase) (EPT) 0.98 5 441 GO:0005737
GO:0008360
GO:0008760
GO:0009252
GO:0019277
GO:0051301
GO:0071555
AF-A0A7V9LU61-F1-model_v4 UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7) (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase) (EPT) 0.9792 5 441 GO:0005737
GO:0008360
GO:0008760
GO:0009252
GO:0019277
GO:0051301
GO:0071555
AF-A0A6B3I9T0-F1-model_v4 UDP-N-acetylglucosamine 1-carboxyvinyltransferase 0.9787 22 112 GO:0016765
AF-A0A132MXW6-F1-model_v4 UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7) (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase) (EPT) 0.9784 4 441 GO:0005737
GO:0008360
GO:0008760
GO:0009252
GO:0019277
GO:0051301
GO:0071555
AF-V6JVD7-F1-model_v4 deleted 0.9779 9 442

Map