F478503
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 740 | 467 | 1480 | 445 |
Family's Representative Sequence
| Representative Sequence | 3300002738|JGI25154J39366_1000846|JGI25154J39366_10008467 |
| Length | 455 |
| Sequence | MTTPVRDALSDDVPALTGDVLAIRGGRPLRGRVDVKGAKNLATKAMVASLLGETTSVLRDVPAISDVAVVRSLLEVHGVRVSEGDEPGSLVFDPSDVESAHFEEIDAHAGASRIPILFCGPLLHRLGQAFIPDLGGCRIGDRPIDFHLDALRKFGAIVEKLPSGIRLSTGGARLHGANIHLPYPSVGATEQVLLTAVRAEGITELRNAAIEPEIMDLIAVLQKMGAIISYEPNRVILIEGVEKLRGYDHRSIFDRNEAASWASAALATDGEIFVGGAKQQEMLTFLNVFRKAGGWFDIQEDGILFRRDGDIKPVVIETDVHPGFMTDWQQPLVVALTQAHGRSVVHETVYENRMGFTEALVKMGADIVVHPRGLQDGPRRVPRRDLEQAAVITGPTPLHGADIVVPDLRGGYSHVIAALTATGESKVSGVDILSRGYEKFLAKLDALGADFDVIR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 2 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 3 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 4 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003559 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_43 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 7 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 8 | 3300003735 | Avena fatua rhizosphere microbial communities - H4_Bulk_Litter_23 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 10 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 11 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 12 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 15 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 23 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 26 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 27 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 28 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 29 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 30 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 31 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 32 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 33 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 34 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 35 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 36 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 37 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 38 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 39 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 40 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 41 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 42 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 43 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 44 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 45 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 46 | 3300015688 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 | Metagenome | Rhizosphere |
| 47 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 48 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 49 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 50 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 51 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 52 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 53 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 54 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 55 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 56 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 57 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 58 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 59 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 60 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 61 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 62 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 63 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 64 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 65 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 66 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 67 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 68 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 82 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 83 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 85 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 86 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 87 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 88 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 89 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 90 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 91 | 3300031665 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 | Metagenome | Rhizosphere |
| 92 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 93 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 94 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 95 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 96 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 97 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 98 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 99 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 100 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 101 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 102 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 103 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 104 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 105 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 106 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 107 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 108 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 109 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 110 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 111 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 112 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 113 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 114 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 115 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 116 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 117 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 118 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 119 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 120 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 121 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 122 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 123 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 124 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 125 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 126 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 127 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 128 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 129 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 130 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 131 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 132 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 133 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 134 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 135 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 136 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 137 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 138 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 139 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 140 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 141 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 181 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 182 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 183 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 184 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 185 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 186 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 187 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 188 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 189 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 190 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 191 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 192 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 193 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 194 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 195 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 196 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 197 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 198 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 199 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 200 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 201 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 202 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 203 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 204 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 206 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 207 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 208 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 209 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 210 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 211 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 212 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 213 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 214 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 216 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 218 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 219 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 225 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 235 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 236 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 237 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 238 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 239 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 240 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 241 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 242 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 243 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 245 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 246 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 247 | 3300053143 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere | Metagenome | Endosphere |
| 248 | 3300053149 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere | Metagenome | Endosphere |
| 249 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 250 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 251 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 252 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 253 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 254 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 255 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 256 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 257 | 2537561592 | Arthrobacter crystallopoietes BAB-32 | Isolate | Rhizosphere |
| 258 | 2554235005 | Streptomyces violaceusniger SPC6 | Isolate | Rhizosphere |
| 259 | 2582581312 | Streptomyces atratus OK008 | Isolate | Rhizosphere |
| 260 | 2582581313 | Streptomyces mirabilis OV308 | Isolate | Rhizosphere |
| 261 | 2582581314 | Streptomyces mirabilis YR139 | Isolate | Rhizosphere |
| 262 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 263 | 2616644941 | Streptomyces atratus OK807 | Isolate | Rhizosphere |
| 264 | 2643221542 | Microbacterium sp. Root1433D1 | Isolate | Unclassified |
| 265 | 2643221546 | Microbacterium sp. Root53 | Isolate | Unclassified |
| 266 | 2643221548 | Streptomyces sp. Root55 | Isolate | Unclassified |
| 267 | 2643221549 | Agromyces sp. Root1464 | Isolate | Unclassified |
| 268 | 2643221553 | Microbacterium sp. Root553 | Isolate | Unclassified |
| 269 | 2643221566 | Microbacterium sp. Root166 | Isolate | Unclassified |
| 270 | 2643221572 | Leifsonia sp. Root60 | Isolate | Unclassified |
| 271 | 2643221575 | Microbacterium sp. Root61 | Isolate | Unclassified |
| 272 | 2643221578 | Streptomyces sp. Root63 | Isolate | Unclassified |
| 273 | 2643221587 | Streptomyces sp. Root66D1 | Isolate | Unclassified |
| 274 | 2643221597 | Microbacterium sp. Root180 | Isolate | Unclassified |
| 275 | 2643221613 | Oerskovia sp. Root22 | Isolate | Unclassified |
| 276 | 2643221616 | Leifsonia sp. Root227 | Isolate | Unclassified |
| 277 | 2643221619 | Agromyces sp. Root81 | Isolate | Unclassified |
| 278 | 2643221630 | Microbacterium sp. Root322 | Isolate | Unclassified |
| 279 | 2643221632 | Leifsonia sp. Root112D2 | Isolate | Unclassified |
| 280 | 2643221635 | Yonghaparkia sp. Root332 | Isolate | Unclassified |
| 281 | 2643221647 | Streptomyces sp. Root369 | Isolate | Unclassified |
| 282 | 2643221669 | Leifsonia sp. Root1293 | Isolate | Unclassified |
| 283 | 2643221670 | Streptomyces sp. Root431 | Isolate | Unclassified |
| 284 | 2643221673 | Streptomyces sp. Root1295 | Isolate | Unclassified |
| 285 | 2643221677 | Streptomyces sp. Root1304 | Isolate | Unclassified |
| 286 | 2643221678 | Streptomyces sp. Root1310 | Isolate | Unclassified |
| 287 | 2643221679 | Angustibacter sp. Root456 | Isolate | Unclassified |
| 288 | 2643221682 | Streptomyces sp. Root1319 | Isolate | Unclassified |
| 289 | 2643221690 | Cellulomonas sp. Root485 | Isolate | Unclassified |
| 290 | 2643221694 | Cellulomonas sp. Root137 | Isolate | Unclassified |
| 291 | 2643221714 | Streptomyces sp. Root264 | Isolate | Unclassified |
| 292 | 2643221721 | Oerskovia sp. Root918 | Isolate | Unclassified |
| 293 | 2643221722 | Cellulomonas sp. Root930 | Isolate | Unclassified |
| 294 | 2643221724 | Microbacterium sp. Root280D1 | Isolate | Unclassified |
| 295 | 2690315906 | Arthrobacter sp. OY3WO11 | Isolate | Unclassified |
| 296 | 2721755702 | Agromyces sp. AR33 | Isolate | Rhizosphere |
| 297 | 2728369380 | Microbacterium sp. 1.5R | Isolate | Rhizosphere |
| 298 | 2747842429 | Microbacterium sp. WCS2014-259 | Isolate | Unclassified |
| 299 | 2757320536 | Microbacterium sp. NFIX05 | Isolate | Unclassified |
| 300 | 2767802112 | Streptomyces avicenniae NRRL B-24776 | Isolate | Rhizosphere |
| 301 | 2773857758 | Microbacterium chocolatum 1320 | Isolate | Unclassified |
| 302 | 2773857763 | Microbacterium sp. SAI-030 | Isolate | Unclassified |
| 303 | 2775506735 | Arthrobacter sp. S95 1704 | Isolate | Unclassified |
| 304 | 2784132148 | Streptomyces sp. E5N91 SAI-083 | Isolate | Unclassified |
| 305 | 2784746763 | Streptomyces ossamyceticus SAI-001 | Isolate | Unclassified |
| 306 | 2784746768 | Streptomyces griseorubiginosus SAI-142 | Isolate | Unclassified |
| 307 | 2786546132 | Streptomyces sp. W SAI-097 | Isolate | Unclassified |
| 308 | 2791355406 | Streptomyces rhizosphaericus NRRL B-24304 | Isolate | Unclassified |
| 309 | 2808606306 | Microbacterium sp. SLBN-146 | Isolate | Unclassified |
| 310 | 2808606357 | Arthrobacter sp. SLBN-122 | Isolate | Unclassified |
| 311 | 2808606359 | Streptomyces sp. RJA2910 | Isolate | Unclassified |
| 312 | 2808606360 | Arthrobacter sp. SLBN-112 | Isolate | Unclassified |
| 313 | 2808606365 | Phycicoccus sp. SLBN-51 | Isolate | Unclassified |
| 314 | 2808606366 | Arthrobacter sp. SLBN-83 | Isolate | Unclassified |
| 315 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 316 | 2808606370 | Arthrobacter sp. SLBN-100 | Isolate | Unclassified |
| 317 | 2808606371 | Arthrobacter sp. SLBN-53 | Isolate | Unclassified |
| 318 | 2808606372 | Agromyces sp. 23-23 | Isolate | Unclassified |
| 319 | 2808606375 | Streptomyces sp. SLBN-31 | Isolate | Unclassified |
| 320 | 2808606447 | Microbacterium sp. HAR-UPW-R2A-48 | Isolate | Unclassified |
| 321 | 2808606448 | Streptomyces sp. 193411 | Isolate | Unclassified |
| 322 | 2808606700 | Arthrobacter agilis UMCV2 | Isolate | Rhizosphere |
| 323 | 2808606982 | Streptomyces sp. SLBN-118 | Isolate | Unclassified |
| 324 | 2811994871 | Arthrobacter sp. SLBN-179 | Isolate | Unclassified |
| 325 | 2811994872 | Microbacterium sp. MU4Y-5-1 | Isolate | Unclassified |
| 326 | 2811994879 | Streptomyces sp. 4-17 | Isolate | Unclassified |
| 327 | 2811994880 | Cellulomonas sp. SLBN-39 | Isolate | Unclassified |
| 328 | 2811994917 | Streptomyces sp. SLBN-134 | Isolate | Unclassified |
| 329 | 2818991463 | Streptomyces argenteolus 3259 | Isolate | Rhizosphere |
| 330 | 2821268502 | Microbacterium sp. YT0620BN | Isolate | Unclassified |
| 331 | 2833709550 | Microbacterium sp. 3290 | Isolate | Rhizosphere |
| 332 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 333 | 2839986021 | Cellulosimicrobium cellulans JZ5 | Isolate | Unclassified |
| 334 | 2844841374 | Leifsonia soli DSM 23871 | Isolate | Rhizosphere |
| 335 | 2848551377 | Brachybacterium saurashtrense DSM 23186 | Isolate | Unclassified |
| 336 | 2852632344 | Microbacterium sp. AK009 | Isolate | Rhizosphere |
| 337 | 2852635781 | Streptomyces sp. AK010 | Isolate | Rhizosphere |
| 338 | 2852646457 | Microbacterium sp. AK031 | Isolate | Rhizosphere |
| 339 | 2852663356 | Microbacterium sp. JAI119 | Isolate | Rhizosphere |
| 340 | 2852677369 | Pseudoclavibacter sp. JAI123 | Isolate | Rhizosphere |
| 341 | 2857479173 | Micrococcus sp. R-74225 | Isolate | Unclassified |
| 342 | 2857632687 | Micrococcus sp. R-73081 | Isolate | Unclassified |
| 343 | 2857710386 | Brevibacterium sp. R-73093 | Isolate | Unclassified |
| 344 | 2857720070 | Microbacterium sp. R-72113 | Isolate | Unclassified |
| 345 | 2857723135 | Microbacterium sp. R-72356 | Isolate | Unclassified |
| 346 | 2857729791 | Plantibacter sp. R-72288 | Isolate | Unclassified |
| 347 | 2862178590 | Streptomyces sp. SDr-06 | Isolate | Rhizosphere |
| 348 | 2862281513 | Streptomyces sp. Act143 | Isolate | Rhizosphere |
| 349 | 2862382967 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 350 | 2862574272 | Streptomyces sp. AcE210 | Isolate | Nodule |
| 351 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 352 | 2862993130 | Planctomonas deserti 13S1-3 v2 | Isolate | Rhizosphere |
| 353 | 2863404153 | Streptomyces scabiei SAI-025 (Annotation) (version 2) | Isolate | Unclassified |
| 354 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 355 | 2867369537 | Streptomyces sp. Z26 | Isolate | Unclassified |
| 356 | 2867428634 | Streptomyces sp. RP5T | Isolate | Unclassified |
| 357 | 2867475112 | Streptomyces sp. TM32 | Isolate | Unclassified |
| 358 | 2870628048 | Microbacterium thalassium DSM 12511 | Isolate | Rhizosphere |
| 359 | 2870801768 | Micrococcus endophyticus DSM 17945 | Isolate | Unclassified |
| 360 | 2870804320 | Micrococcus yunnanensis DSM 21948 | Isolate | Unclassified |
| 361 | 2873151551 | Streptomyces silaceus ACCC40021 | Isolate | Rhizosphere |
| 362 | 2875391855 | Streptomyces cavourensis 1AS2a | Isolate | Rhizosphere |
| 363 | 2877676314 | Streptomyces griseorubiginosus 3E-1 | Isolate | Unclassified |
| 364 | 2884763398 | Leifsonia sp. PS1209 | Isolate | Stem Tuber |
| 365 | 2884994152 | Cellulomonas sp. H30R-01 | Isolate | Rhizosphere |
| 366 | 2887443736 | Ruania rhizosphaerae LNNU 22110 | Isolate | Rhizosphere |
| 367 | 2895660088 | Leifsonia flava SYP-B2174 | Isolate | Rhizosphere |
| 368 | 2904430863 | Curtobacterium oceanosedimentum 1519 | Isolate | Rhizosphere |
| 369 | 2904509784 | Microbacterium sp. 1676 | Isolate | Rhizosphere |
| 370 | 2905926851 | Arthrobacter sedimenti MIC A30 | Isolate | Rhizosphere |
| 371 | 2906799679 | Microbacterium karelineae TRM80801 | Isolate | Unclassified |
| 372 | 2908678064 | Microbacterium sp. 1518 | Isolate | Rhizosphere |
| 373 | 2909074476 | Curtobacterium sp. 1310 | Isolate | Rhizosphere |
| 374 | 2912715099 | Streptomyces sp. Z423-1 | Isolate | Rhizosphere |
| 375 | 2912723979 | Streptomyces sp. NEAU-sy36 | Isolate | Rhizosphere |
| 376 | 2912757875 | Streptomyces sp. S4.7 | Isolate | Rhizosphere |
| 377 | 2918501144 | Streptomyces sp. PvR006 | Isolate | Rhizosphere |
| 378 | 2919039151 | Curtobacterium sp. 260 | Isolate | Rhizosphere |
| 379 | 2919055335 | Leifsonia sp. 1010 | Isolate | Rhizosphere |
| 380 | 2919069694 | Microbacterium sp. 1154 | Isolate | Unclassified |
| 381 | 2919391150 | Arthrobacter ipis 2973 | Isolate | Unclassified |
| 382 | 2919395869 | Microbacterium resistens 2980 | Isolate | Unclassified |
| 383 | 2919443155 | Agromyces sp. 3263 | Isolate | Rhizosphere |
| 384 | 2919446982 | Phycicoccus sp. 3266 | Isolate | Rhizosphere |
| 385 | 2919468124 | Streptomyces sp. 3330 | Isolate | Rhizosphere |
| 386 | 2919523602 | Leifsonia shinshuensis 3821 | Isolate | Unclassified |
| 387 | 2920879853 | Kocuria salina CV6 | Isolate | Unclassified |
| 388 | 2928090899 | Microbacterium sp. 1262 | Isolate | Rhizosphere |
| 389 | 2928121344 | Plantibacter flavus 1756 | Isolate | Rhizosphere |
| 390 | 2928153084 | Leifsonia sp. 563 | Isolate | Unclassified |
| 391 | 2932431166 | Cellulosimicrobium sp. 4261 | Isolate | Rhizosphere |
| 392 | 2935390628 | Streptomyces sp. PvR034 | Isolate | Rhizosphere |
| 393 | 2935409751 | Agromyces sp. PvR057 | Isolate | Rhizosphere |
| 394 | 2935890801 | Oerskovia enterophila 3230 | Isolate | Rhizosphere |
| 395 | 2939598168 | Arthrobacter sp. 754 | Isolate | Rhizosphere |
| 396 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 397 | 2945920336 | Pseudarthrobacter siccitolerans W1I3 | Isolate | Rhizosphere |
| 398 | 2945941187 | Arthrobacter pascens W1I14 | Isolate | Rhizosphere |
| 399 | 2945956166 | Arthrobacter globiformus W2I3 | Isolate | Rhizosphere |
| 400 | 2945968032 | Microbacterium murale W2I7 | Isolate | Rhizosphere |
| 401 | 2946003308 | Arthrobacter agilis W3I6 | Isolate | Rhizosphere |
| 402 | 2946037020 | Arthrobacter sp. W4I7 | Isolate | Rhizosphere |
| 403 | 2946041624 | Microbacterium natoriense W4I9-1 | Isolate | Rhizosphere |
| 404 | 2946045630 | Streptomyces sp. W4I9-2 | Isolate | Rhizosphere |
| 405 | 2946059875 | Arthrobacter sp. SLBN-112 | Isolate | Rhizosphere |
| 406 | 2946064051 | Streptomyces luteogriseus W4I19-1 | Isolate | Rhizosphere |
| 407 | 2946072368 | Streptomyces achromogenes W4I19-2 | Isolate | Rhizosphere |
| 408 | 2946080515 | Microbacterium sp. W4I20 | Isolate | Rhizosphere |
| 409 | 2947224130 | Streptomyces afghaniensis W1I20 | Isolate | Rhizosphere |
| 410 | 2953998280 | Pseudarthrobacter sp. W1I19 | Isolate | Rhizosphere |
| 411 | 2954002825 | Streptomyces turgidiscabies W2I16 | Isolate | Rhizosphere |
| 412 | 2954380949 | Streptomyces ciscaucasicus W1I15 | Isolate | Rhizosphere |
| 413 | 2954673503 | Streptomyces sp. SAI-119 | Isolate | Rhizosphere |
| 414 | 2954682443 | Streptomyces sp. SAI-149 | Isolate | Rhizosphere |
| 415 | 2954691527 | Streptomyces sp. SAI-127 | Isolate | Rhizosphere |
| 416 | 2954701450 | Streptomyces sp. SAI-144 | Isolate | Rhizosphere |
| 417 | 2954711539 | Streptomyces sp. SAI-090 | Isolate | Rhizosphere |
| 418 | 2954721474 | Streptomyces sp. SAI-117 | Isolate | Rhizosphere |
| 419 | 2954731030 | Streptomyces sp. SAI-133 | Isolate | Rhizosphere |
| 420 | 2954740390 | Streptomyces sp. SAI-041 | Isolate | Rhizosphere |
| 421 | 2954749733 | Streptomyces sp. SAI-135 | Isolate | Rhizosphere |
| 422 | 2954759201 | Streptomyces sp. SAI-208 | Isolate | Rhizosphere |
| 423 | 2964326757 | Planctomonas psychrotolerans J5903 | Isolate | Rhizosphere |
| 424 | 2966598605 | Kitasatospora papulosa SLBN-177 | Isolate | Rhizosphere |
| 425 | 2974294766 | Microbacterium proteolyticum SORGH_AS 209 | Isolate | Unclassified |
| 426 | 2974302888 | Pseudarthrobacter sp. SORGH_AS 212 | Isolate | Unclassified |
| 427 | 2974324384 | Microbacterium sp. SORGH_AS 344 | Isolate | Unclassified |
| 428 | 2977228692 | Microbacterium sp. SORGH_AS 421 | Isolate | Unclassified |
| 429 | 2977236895 | Microbacterium testaceum SORGH_AS 426 | Isolate | Unclassified |
| 430 | 2977264416 | Microbacterium testaceum SORGH_AS 594 | Isolate | Unclassified |
| 431 | 2984542743 | Microbacterium sp. SORGH_AS454 | Isolate | Aerial Root |
| 432 | 2984580707 | Microbacterium paludicola SORGH_AS919 | Isolate | Aerial Root |
| 433 | 2990044586 | Streptomyces sedi JCM 16909 | Isolate | Unclassified |
| 434 | 2990059506 | Streptomyces sp. CAP261 | Isolate | Unclassified |
| 435 | 2990088156 | Streptomyces albidus CAP 215 | Isolate | Unclassified |
| 436 | 2995726249 | Leucobacter zeae CC-MF41 | Isolate | Rhizosphere |
| 437 | 2997451912 | Streptomyces piniterrae jys28 | Isolate | Rhizosphere |
| 438 | 2997600082 | Streptomyces coffeae CA1R205 | Isolate | Unclassified |
| 439 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 440 | 3006393351 | Streptomyces sp. SID4985 | Isolate | Unclassified |
| 441 | 3006493962 | Streptomyces grisecoloratus TRM S81-3 | Isolate | Rhizosphere |
| 442 | 8002811521 | Leucobacter chinensis NC76-1 | Isolate | Rhizosphere |
| 443 | 8004025490 | Arthrobacter wenxiniae AETb3-4 | Isolate | Rhizosphere |
| 444 | 8004182704 | Microbacterium paraoxydans ku-mp | Isolate | Unclassified |
| 445 | 8004212874 | Microbacterium sp. NC79 | Isolate | Rhizosphere |
| 446 | 8008558824 | Streptomyces scabiei NRRL B-2795 | Isolate | Nodule |
| 447 | 8008574985 | Streptomyces sp. Jing01 | Isolate | Rhizosphere |
| 448 | 8016254467 | Microbacterium sp. SLBN-111 (version 3) | Isolate | Rhizosphere |
| 449 | 8023623736 | Streptomyces sp. 111WW2 | Isolate | Unclassified |
| 450 | 8025478263 | Streptomyces telluris AA8 | Isolate | Rhizosphere |
| 451 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 452 | 8025530807 | Streptomyces sp. 4R-3d | Isolate | Unclassified |
| 453 | 8033684223 | Streptomyces phytophilus PIP175 | Isolate | Unclassified |
| 454 | 8045830549 | Microbacterium yannicii DSM 23203 | Isolate | Unclassified |
| 455 | 8046352972 | Agromyces mangrovi NBRC 112812 | Isolate | Rhizosphere |
| 456 | 8047893842 | Streptomyces cangkringensis DSM 41769 | Isolate | Rhizosphere |
| 457 | 8048127548 | Streptomyces samsunensis DSM 42010 | Isolate | Rhizosphere |
| 458 | 8048356638 | Streptomyces rhizosphaericus DSM 41760 | Isolate | Rhizosphere |
| 459 | 8048369669 | Streptomyces indonesiensis DSM 41759 | Isolate | Rhizoplane |
| 460 | 8048379754 | Streptomyces asiaticus DSM 41761 | Isolate | Rhizosphere |
| 461 | 8048406513 | Streptomyces heilongjiangensis NEAU-W2 | Isolate | Unclassified |
| 462 | 8054107350 | Arthrobacter rhizosphaerae CCNWLXL 1-35 | Isolate | Rhizosphere |
| 463 | 8054160619 | Streptomyces rhizoryzae RS10V-4 | Isolate | Rhizosphere |
| 464 | 8055034563 | Leucobacter allii H21R-40 | Isolate | Rhizosphere |
| 465 | 8055037949 | Leucobacter rhizosphaerae H25R-14 | Isolate | Rhizosphere |
| 466 | 8056667051 | Streptomyces sichuanensis SCA3-4 | Isolate | Rhizosphere |
| 467 | 8056829672 | Streptomyces barringtoniae JA03 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 69.46 |
| Metatranscriptomes | 2.03 |
| Isolates | 28.51 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 7.43 |
| Nodule | 0.41 |
| Rhizoplane | 4.86 |
| Rhizosphere | 63.11 |
| Stem | 0 |
| Stem Tuber | 0.14 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25154J39366_1000846 | 3300002738 | Bacteria | 13272 |
| 2 | JGI24737J22298_10002831 | 3300001990 | Bacteria | 6148 |
| 3 | JGI24735J21928_10004528 | 3300002067 | Bacteria | 4674 |
| 4 | JGI24738J21930_10007855 | 3300002075 | Bacteria | 2444 |
| 5 | JGI25165J46597_1000002 | 3300003214 | Bacteria | 765387 |
| 6 | Ga0007427J51700_107271 | 3300003559 | Bacteria | 1924 |
| 7 | Ga0006562J51391_1032679 | 3300003578 | Bacteria | 11760 |
| 8 | Ga0006562J51391_1032682 | 3300003578 | Bacteria | 10200 |
| 9 | Ga0006562J51391_1034854 | 3300003578 | Bacteria | 4610 |
| 10 | Ga0006780_1011353 | 3300003735 | Bacteria | 3476 |
| 11 | Ga0055539_1000111 | 3300003752 | Bacteria | 90530 |
| 12 | Ga0055533_1000001 | 3300003756 | Bacteria | 1863437 |
| 13 | Ga0055525_1000317 | 3300003759 | Bacteria | 38691 |
| 14 | Ga0055527_1000012 | 3300003760 | Bacteria | 348744 |
| 15 | Ga0055542_1000017 | 3300003762 | Bacteria | 348744 |
| 16 | Ga0055529_1000023 | 3300003763 | Bacteria | 314383 |
| 17 | Ga0055541_1004852 | 3300003841 | Bacteria | 2402 |
| 18 | Ga0065714_10019108 | 3300005288 | Bacteria | 3076 |
| 19 | Ga0070658_10065597 | 3300005327 | Bacteria | 2963 |
| 20 | Ga0070683_100239998 | 3300005329 | Bacteria | 1724 |
| 21 | Ga0070666_10063792 | 3300005335 | Bacteria | 2498 |
| 22 | Ga0070669_100016507 | 3300005353 | Bacteria | 5269 |
| 23 | Ga0070675_100244363 | 3300005354 | Bacteria | 1569 |
| 24 | Ga0070679_100133727 | 3300005530 | Bacteria | 2461 |
| 25 | Ga0070696_100001852 | 3300005546 | Bacteria | 13884 |
| 26 | Ga0070665_100052203 | 3300005548 | Bacteria | 4102 |
| 27 | Ga0068852_100171729 | 3300005616 | Bacteria | 2033 |
| 28 | Ga0081455_10051034 | 3300005937 | Bacteria | 3551 |
| 29 | Ga0081540_1012227 | 3300005983 | Bacteria | 5674 |
| 30 | Ga0081539_10001159 | 3300005985 | Bacteria | 47725 |
| 31 | Ga0081539_10030524 | 3300005985 | Bacteria | 3344 |
| 32 | Ga0075365_10047812 | 3300006038 | Bacteria | 2813 |
| 33 | Ga0075368_10026380 | 3300006042 | Bacteria | 2235 |
| 34 | Ga0075364_10004420 | 3300006051 | Bacteria | 8085 |
| 35 | Ga0075364_10017035 | 3300006051 | Bacteria | 4531 |
| 36 | Ga0075364_10017496 | 3300006051 | Bacteria | 4478 |
| 37 | Ga0075364_10028991 | 3300006051 | Bacteria | 3547 |
| 38 | Ga0075367_10000349 | 3300006178 | Bacteria | 16510 |
| 39 | Ga0075369_10011511 | 3300006186 | Bacteria | 3482 |
| 40 | Ga0075369_10012427 | 3300006186 | Bacteria | 3364 |
| 41 | Ga0075370_10030256 | 3300006353 | Bacteria | 3020 |
| 42 | Ga0105251_10030179 | 3300009011 | Bacteria | 2725 |
| 43 | Ga0105243_10043093 | 3300009148 | Bacteria | 3536 |
| 44 | Ga0105246_10018229 | 3300011119 | Bacteria | 4473 |
| 45 | Ga0105246_10099641 | 3300011119 | Bacteria | 2112 |
| 46 | Ga0157371_10031269 | 3300013102 | Bacteria | 3834 |
| 47 | Ga0157369_10078764 | 3300013105 | Bacteria | 3530 |
| 48 | Ga0171462_1003 | 3300013250 | Bacteria | 853796 |
| 49 | Ga0157372_10059520 | 3300013307 | Bacteria | 4272 |
| 50 | Ga0157380_10006032 | 3300014326 | Bacteria | 8487 |
| 51 | Ga0182008_10004358 | 3300014497 | Bacteria | 8279 |
| 52 | Ga0182006_1017956 | 3300015261 | Bacteria | 2996 |
| 53 | Ga0182007_10001716 | 3300015262 | Bacteria | 11553 |
| 54 | Ga0183367_1006 | 3300015688 | Bacteria | 648044 |
| 55 | Ga0197907_10053258 | 3300020069 | Bacteria | 7119 |
| 56 | Ga0206349_1248741 | 3300020075 | Bacteria | 3259 |
| 57 | Ga0206355_1244303 | 3300020076 | Bacteria | 2746 |
| 58 | Ga0206354_10663781 | 3300020081 | Bacteria | 10305 |
| 59 | Ga0206353_11560231 | 3300020082 | Bacteria | 22870 |
| 60 | Ga0213875_10021319 | 3300021388 | Bacteria | 3105 |
| 61 | Ga0224712_10038306 | 3300022467 | Bacteria | 1790 |
| 62 | Ga0224712_10042375 | 3300022467 | Bacteria | 1724 |
| 63 | Ga0209566_100026 | 3300025225 | Bacteria | 367457 |
| 64 | Ga0209674_100001 | 3300025226 | Bacteria | 4013750 |
| 65 | Ga0209672_100003 | 3300025228 | Bacteria | 1560476 |
| 66 | Ga0209147_100633 | 3300025229 | Bacteria | 18857 |
| 67 | Ga0209563_100001 | 3300025230 | Bacteria | 4013775 |
| 68 | Ga0207427_100034 | 3300025231 | Bacteria | 320342 |
| 69 | Ga0209437_100486 | 3300025233 | Bacteria | 29316 |
| 70 | Ga0209258_101954 | 3300025242 | Bacteria | 6013 |
| 71 | Ga0209646_1000168 | 3300025246 | Bacteria | 86352 |
| 72 | Ga0209677_100001 | 3300025253 | Bacteria | 4013787 |
| 73 | Ga0209677_100321 | 3300025253 | Bacteria | 30989 |
| 74 | Ga0209148_1000004 | 3300025254 | Bacteria | 1844481 |
| 75 | Ga0209233_1000001 | 3300025261 | Bacteria | 2992747 |
| 76 | Ga0209455_1000022 | 3300025272 | Bacteria | 688910 |
| 77 | Ga0209455_1001078 | 3300025272 | Bacteria | 13442 |
| 78 | Ga0207426_1003169 | 3300025302 | Bacteria | 9298 |
| 79 | Ga0207426_1003328 | 3300025302 | Bacteria | 8871 |
| 80 | Ga0207697_10003823 | 3300025315 | Bacteria | 7349 |
| 81 | Ga0207655_1015461 | 3300025728 | Bacteria | 4239 |
| 82 | Ga0207655_1031119 | 3300025728 | Bacteria | 2466 |
| 83 | Ga0207680_10144677 | 3300025903 | Bacteria | 1579 |
| 84 | Ga0207647_10003003 | 3300025904 | Bacteria | 12690 |
| 85 | Ga0207647_10014486 | 3300025904 | Bacteria | 5435 |
| 86 | Ga0207647_10021739 | 3300025904 | Bacteria | 4275 |
| 87 | Ga0207705_10016193 | 3300025909 | Bacteria | 5348 |
| 88 | Ga0207705_10137037 | 3300025909 | Bacteria | 1825 |
| 89 | Ga0207707_10174844 | 3300025912 | Bacteria | 1876 |
| 90 | Ga0207657_10209689 | 3300025919 | Bacteria | 1564 |
| 91 | Ga0207659_10055425 | 3300025926 | Bacteria | 2835 |
| 92 | Ga0207690_10128839 | 3300025932 | Bacteria | 1849 |
| 93 | Ga0207709_10016230 | 3300025935 | Bacteria | 4138 |
| 94 | Ga0207709_10024063 | 3300025935 | Bacteria | 3474 |
| 95 | Ga0207691_10004165 | 3300025940 | Bacteria | 14053 |
| 96 | Ga0207639_10048159 | 3300026041 | Bacteria | 3225 |
| 97 | Ga0207674_10003834 | 3300026116 | Bacteria | 18322 |
| 98 | Ga0209813_10005047 | 3300027866 | Bacteria | 3190 |
| 99 | Ga0207428_10000930 | 3300027907 | Bacteria | 32598 |
| 100 | Ga0207428_10034774 | 3300027907 | Bacteria | 4126 |
| 101 | Ga0268266_10014428 | 3300028379 | Bacteria | 6793 |
| 102 | Ga0307517_10002661 | 3300028786 | Bacteria | 28533 |
| 103 | Ga0307515_10043521 | 3300028794 | Bacteria | 6976 |
| 104 | Ga0307512_10025890 | 3300030522 | Bacteria | 5188 |
| 105 | Ga0307513_10017644 | 3300031456 | Bacteria | 8553 |
| 106 | Ga0307513_10253479 | 3300031456 | Bacteria | 1555 |
| 107 | Ga0307408_100033573 | 3300031548 | Bacteria | 3586 |
| 108 | Ga0307408_100110295 | 3300031548 | Bacteria | 2112 |
| 109 | Ga0307508_10023476 | 3300031616 | Bacteria | 5598 |
| 110 | Ga0307514_10017872 | 3300031649 | Bacteria | 5827 |
| 111 | Ga0307514_10046967 | 3300031649 | Bacteria | 3372 |
| 112 | Ga0316575_10000020 | 3300031665 | Bacteria | 41761 |
| 113 | Ga0307516_10086151 | 3300031730 | Bacteria | 2978 |
| 114 | Ga0307516_10224380 | 3300031730 | Bacteria | 1586 |
| 115 | Ga0307405_10002212 | 3300031731 | Bacteria | 8494 |
| 116 | Ga0307405_10034996 | 3300031731 | Bacteria | 2995 |
| 117 | Ga0307405_10048808 | 3300031731 | Bacteria | 2613 |
| 118 | Ga0307405_10055697 | 3300031731 | Bacteria | 2476 |
| 119 | Ga0307405_10077513 | 3300031731 | Bacteria | 2160 |
| 120 | Ga0307405_10155550 | 3300031731 | Bacteria | 1613 |
| 121 | Ga0307405_10187543 | 3300031731 | Bacteria | 1490 |
| 122 | Ga0307413_10039323 | 3300031824 | Bacteria | 2750 |
| 123 | Ga0307413_10123346 | 3300031824 | Bacteria | 1759 |
| 124 | Ga0307410_10020465 | 3300031852 | Bacteria | 4047 |
| 125 | Ga0307410_10024749 | 3300031852 | Bacteria | 3756 |
| 126 | Ga0307410_10035774 | 3300031852 | Bacteria | 3229 |
| 127 | Ga0307410_10067611 | 3300031852 | Bacteria | 2465 |
| 128 | Ga0307410_10103357 | 3300031852 | Bacteria | 2046 |
| 129 | Ga0307406_10000217 | 3300031901 | Bacteria | 34729 |
| 130 | Ga0307406_10000795 | 3300031901 | Bacteria | 17683 |
| 131 | Ga0307406_10012650 | 3300031901 | Bacteria | 4812 |
| 132 | Ga0307406_10013566 | 3300031901 | Bacteria | 4671 |
| 133 | Ga0307407_10018907 | 3300031903 | Bacteria | 3497 |
| 134 | Ga0307407_10026812 | 3300031903 | Bacteria | 3056 |
| 135 | Ga0307407_10028089 | 3300031903 | Bacteria | 3003 |
| 136 | Ga0307407_10059330 | 3300031903 | Bacteria | 2228 |
| 137 | Ga0307407_10060796 | 3300031903 | Bacteria | 2206 |
| 138 | Ga0307407_10083323 | 3300031903 | Bacteria | 1940 |
| 139 | Ga0307412_10006909 | 3300031911 | Bacteria | 6438 |
| 140 | Ga0307412_10022049 | 3300031911 | Bacteria | 3898 |
| 141 | Ga0307412_10038443 | 3300031911 | Bacteria | 3082 |
| 142 | Ga0307412_10047139 | 3300031911 | Bacteria | 2829 |
| 143 | Ga0307412_10055007 | 3300031911 | Bacteria | 2645 |
| 144 | Ga0307412_10096688 | 3300031911 | Bacteria | 2079 |
| 145 | Ga0307412_10104466 | 3300031911 | Bacteria | 2010 |
| 146 | Ga0307409_100019274 | 3300031995 | Bacteria | 4614 |
| 147 | Ga0307409_100063104 | 3300031995 | Bacteria | 2904 |
| 148 | Ga0307409_100072330 | 3300031995 | Bacteria | 2745 |
| 149 | Ga0307409_100118713 | 3300031995 | Bacteria | 2234 |
| 150 | Ga0307409_100139219 | 3300031995 | Bacteria | 2088 |
| 151 | Ga0307409_100314688 | 3300031995 | Bacteria | 1462 |
| 152 | Ga0307416_100042927 | 3300032002 | Bacteria | 3535 |
| 153 | Ga0307416_100046082 | 3300032002 | Bacteria | 3438 |
| 154 | Ga0307416_100057842 | 3300032002 | Bacteria | 3139 |
| 155 | Ga0307416_100144085 | 3300032002 | Bacteria | 2171 |
| 156 | Ga0307416_100306265 | 3300032002 | Bacteria | 1582 |
| 157 | Ga0307414_10024948 | 3300032004 | Bacteria | 3821 |
| 158 | Ga0307414_10053480 | 3300032004 | Bacteria | 2816 |
| 159 | Ga0307411_10054680 | 3300032005 | Bacteria | 2622 |
| 160 | Ga0307411_10201850 | 3300032005 | Bacteria | 1528 |
| 161 | Ga0307510_10126949 | 3300033180 | Bacteria | 2237 |
| 162 | Ga0395899_0022477 | 3300037312 | Bacteria | 4782 |
| 163 | Ga0395899_0129821 | 3300037312 | Bacteria | 1800 |
| 164 | Ga0395900_0007672 | 3300037418 | Bacteria | 11131 |
| 165 | Ga0395900_0022895 | 3300037418 | Bacteria | 6393 |
| 166 | Ga0395900_0044495 | 3300037418 | Bacteria | 4574 |
| 167 | Ga0395900_0112045 | 3300037418 | Bacteria | 2802 |
| 168 | Ga0395900_0116189 | 3300037418 | Bacteria | 2745 |
| 169 | Ga0395900_0156815 | 3300037418 | Bacteria | 2325 |
| 170 | Ga0395898_0002083 | 3300037466 | Bacteria | 24880 |
| 171 | Ga0395898_0003163 | 3300037466 | Bacteria | 18566 |
| 172 | Ga0395898_0009247 | 3300037466 | Bacteria | 10366 |
| 173 | Ga0395898_0014659 | 3300037466 | Bacteria | 8049 |
| 174 | Ga0395898_0043966 | 3300037466 | Bacteria | 4400 |
| 175 | Ga0395898_0094782 | 3300037466 | Bacteria | 2868 |
| 176 | Ga0436364_1344107 | 3300037853 | Bacteria | 9638 |
| 177 | Ga0395901_0015426 | 3300038443 | Bacteria | 7780 |
| 178 | Ga0395901_0048733 | 3300038443 | Bacteria | 4400 |
| 179 | Ga0395901_0052609 | 3300038443 | Bacteria | 4232 |
| 180 | Ga0395901_0062250 | 3300038443 | Bacteria | 3883 |
| 181 | Ga0395901_0324873 | 3300038443 | Bacteria | 1591 |
| 182 | Ga0439436_0000502 | 3300041404 | Bacteria | 10200 |
| 183 | Ga0439466_0009647 | 3300041411 | Bacteria | 3607 |
| 184 | Ga0451793_0867888 | 3300041452 | Bacteria | 2830 |
| 185 | Ga0451853_0434821 | 3300041512 | Bacteria | 3963 |
| 186 | Ga0451853_2129295 | 3300041512 | Bacteria | 6836 |
| 187 | Ga0439433_0000454 | 3300041999 | Bacteria | 7545 |
| 188 | Ga0439442_000606 | 3300042002 | Bacteria | 7709 |
| 189 | Ga0439442_004446 | 3300042002 | Bacteria | 2784 |
| 190 | Ga0439448_0028505 | 3300042005 | Bacteria | 1764 |
| 191 | Ga0439449_0001965 | 3300042007 | Bacteria | 8075 |
| 192 | Ga0439449_0002526 | 3300042007 | Bacteria | 7149 |
| 193 | Ga0439457_007694 | 3300042014 | Bacteria | 2577 |
| 194 | Ga0439462_0003287 | 3300042015 | Bacteria | 3864 |
| 195 | Ga0450894_000266 | 3300042131 | Bacteria | 9384 |
| 196 | Ga0450898_000307 | 3300042134 | Bacteria | 5509 |
| 197 | Ga0450899_000210 | 3300042135 | Bacteria | 6073 |
| 198 | Ga0450903_000007 | 3300042138 | Bacteria | 38287 |
| 199 | Ga0450906_000632 | 3300042145 | Bacteria | 7538 |
| 200 | Ga0439458_0003549 | 3300042157 | Bacteria | 3638 |
| 201 | Ga0450908_007691 | 3300042184 | Bacteria | 2029 |
| 202 | Ga0466969_0008633 | 3300044656 | Bacteria | 5406 |
| 203 | Ga0466969_0012566 | 3300044656 | Bacteria | 4462 |
| 204 | Ga0466972_0007060 | 3300044658 | Bacteria | 5636 |
| 205 | Ga0466972_0039973 | 3300044658 | Bacteria | 2287 |
| 206 | Ga0466972_0041628 | 3300044658 | Bacteria | 2236 |
| 207 | Ga0466972_0095630 | 3300044658 | Bacteria | 1407 |
| 208 | Ga0466965_0001891 | 3300044683 | Bacteria | 8722 |
| 209 | Ga0466965_0003638 | 3300044683 | Bacteria | 6791 |
| 210 | Ga0466965_0007733 | 3300044683 | Bacteria | 4946 |
| 211 | Ga0466965_0016037 | 3300044683 | Bacteria | 3560 |
| 212 | Ga0466965_0024262 | 3300044683 | Bacteria | 2932 |
| 213 | Ga0466965_0030137 | 3300044683 | Bacteria | 2642 |
| 214 | Ga0466966_0001283 | 3300044684 | Bacteria | 16087 |
| 215 | Ga0466966_0046283 | 3300044684 | Bacteria | 2778 |
| 216 | Ga0466961_0001837 | 3300044693 | Bacteria | 13179 |
| 217 | Ga0466961_0003608 | 3300044693 | Bacteria | 9651 |
| 218 | Ga0466961_0023589 | 3300044693 | Bacteria | 3958 |
| 219 | Ga0466961_0049394 | 3300044693 | Bacteria | 2689 |
| 220 | Ga0466963_0000899 | 3300044694 | Bacteria | 15139 |
| 221 | Ga0466963_0048138 | 3300044694 | Bacteria | 2815 |
| 222 | Ga0466964_0001737 | 3300044706 | Bacteria | 7539 |
| 223 | Ga0466971_0000438 | 3300044719 | Bacteria | 16270 |
| 224 | Ga0466968_0049786 | 3300044735 | Bacteria | 1786 |
| 225 | Ga0466968_0075063 | 3300044735 | Bacteria | 1477 |
| 226 | Ga0466970_0000176 | 3300044765 | Bacteria | 30506 |
| 227 | Ga0466970_0002192 | 3300044765 | Bacteria | 9438 |
| 228 | Ga0466970_0008421 | 3300044765 | Bacteria | 5189 |
| 229 | Ga0466970_0024826 | 3300044765 | Bacteria | 3135 |
| 230 | Ga0466970_0027328 | 3300044765 | Bacteria | 2994 |
| 231 | Ga0466957_0007164 | 3300044842 | Bacteria | 6307 |
| 232 | Ga0466957_0017272 | 3300044842 | Bacteria | 4224 |
| 233 | Ga0466960_0000476 | 3300044901 | Bacteria | 13674 |
| 234 | Ga0466960_0009070 | 3300044901 | Bacteria | 4092 |
| 235 | Ga0466960_0035602 | 3300044901 | Bacteria | 2327 |
| 236 | Ga0466959_0000885 | 3300045049 | Bacteria | 17643 |
| 237 | Ga0466959_0022541 | 3300045049 | Bacteria | 4656 |
| 238 | Ga0466959_0122295 | 3300045049 | Bacteria | 1849 |
| 239 | Ga0466959_0133622 | 3300045049 | Bacteria | 1757 |
| 240 | Ga0466958_0002552 | 3300045836 | Bacteria | 9185 |
| 241 | Ga0466958_0038815 | 3300045836 | Bacteria | 2858 |
| 242 | Ga0466958_0072716 | 3300045836 | Bacteria | 2106 |
| 243 | Ga0466967_0001934 | 3300045976 | Bacteria | 12530 |
| 244 | Ga0466967_0160728 | 3300045976 | Bacteria | 2108 |
| 245 | Ga0466967_0172522 | 3300045976 | Bacteria | 2036 |
| 246 | Ga0495627_000401 | 3300046453 | Bacteria | 38376 |
| 247 | Ga0495603_0011409 | 3300046455 | Bacteria | 5379 |
| 248 | Ga0495603_0019356 | 3300046455 | Bacteria | 4120 |
| 249 | Ga0495603_0049457 | 3300046455 | Bacteria | 2503 |
| 250 | Ga0495629_0003337 | 3300046459 | Bacteria | 12131 |
| 251 | Ga0495629_0005059 | 3300046459 | Bacteria | 9866 |
| 252 | Ga0495638_0036113 | 3300046460 | Bacteria | 3149 |
| 253 | Ga0495651_0021660 | 3300046462 | Bacteria | 4997 |
| 254 | Ga0495582_0107629 | 3300046473 | Bacteria | 1565 |
| 255 | Ga0495664_0015086 | 3300046477 | Bacteria | 4390 |
| 256 | Ga0495584_0050492 | 3300046491 | Bacteria | 2095 |
| 257 | Ga0495594_0000183 | 3300046499 | Bacteria | 30417 |
| 258 | Ga0495594_0008626 | 3300046499 | Bacteria | 5252 |
| 259 | Ga0495618_0155023 | 3300046514 | Bacteria | 1462 |
| 260 | Ga0495628_0006731 | 3300046516 | Bacteria | 10015 |
| 261 | Ga0495630_0115200 | 3300046517 | Bacteria | 2037 |
| 262 | Ga0495632_0022270 | 3300046519 | Bacteria | 3398 |
| 263 | Ga0495643_0001934 | 3300046522 | Bacteria | 17437 |
| 264 | Ga0495652_0004275 | 3300046529 | Bacteria | 13709 |
| 265 | Ga0495665_0034504 | 3300046531 | Bacteria | 2705 |
| 266 | Ga0495640_0074470 | 3300046533 | Bacteria | 2270 |
| 267 | Ga0495586_0061367 | 3300046535 | Bacteria | 2046 |
| 268 | Ga0495586_0061915 | 3300046535 | Bacteria | 2036 |
| 269 | Ga0495587_0012474 | 3300046536 | Bacteria | 5347 |
| 270 | Ga0495645_0078862 | 3300046543 | Bacteria | 2366 |
| 271 | Ga0495622_0029690 | 3300046557 | Bacteria | 2554 |
| 272 | Ga0495667_0033339 | 3300046559 | Bacteria | 3447 |
| 273 | Ga0495611_0030131 | 3300046648 | Bacteria | 2384 |
| 274 | Ga0495625_0038469 | 3300046660 | Bacteria | 3502 |
| 275 | Ga0495588_0024620 | 3300046674 | Bacteria | 2991 |
| 276 | Ga0495657_0014574 | 3300046675 | Bacteria | 5768 |
| 277 | Ga0495613_0000823 | 3300046689 | Bacteria | 24027 |
| 278 | Ga0495624_0128817 | 3300046690 | Bacteria | 1552 |
| 279 | Ga0495671_0061764 | 3300046692 | Bacteria | 1848 |
| 280 | Ga0495649_0085434 | 3300046694 | Bacteria | 1684 |
| 281 | Ga0495660_0016149 | 3300046810 | Bacteria | 4306 |
| 282 | Ga0495581_0009365 | 3300047315 | Bacteria | 5667 |
| 283 | Ga0495581_0018154 | 3300047315 | Bacteria | 4086 |
| 284 | Ga0495604_0038259 | 3300047317 | Bacteria | 3774 |
| 285 | Ga0495676_0000425 | 3300047321 | Bacteria | 34173 |
| 286 | Ga0495676_0061686 | 3300047321 | Bacteria | 2931 |
| 287 | Ga0495676_0095245 | 3300047321 | Bacteria | 2215 |
| 288 | Ga0495683_0023477 | 3300047323 | Bacteria | 3170 |
| 289 | Ga0495683_0061214 | 3300047323 | Bacteria | 1864 |
| 290 | Ga0495675_0060955 | 3300047444 | Bacteria | 2390 |
| 291 | Ga0495685_000276 | 3300047447 | Bacteria | 17244 |
| 292 | Ga0495685_011251 | 3300047447 | Bacteria | 3015 |
| 293 | Ga0495681_0001135 | 3300047470 | Bacteria | 20239 |
| 294 | Ga0495681_0046436 | 3300047470 | Bacteria | 2071 |
| 295 | Ga0495614_0006629 | 3300048089 | Bacteria | 5184 |
| 296 | Ga0496101_0028213 | 3300048904 | Bacteria | 3917 |
| 297 | Ga0496101_0054290 | 3300048904 | Bacteria | 2892 |
| 298 | Ga0496102_0002409 | 3300048905 | Bacteria | 15971 |
| 299 | Ga0496102_0050650 | 3300048905 | Bacteria | 3782 |
| 300 | Ga0496102_0060141 | 3300048905 | Bacteria | 3476 |
| 301 | Ga0496103_0003299 | 3300048906 | Bacteria | 9877 |
| 302 | Ga0496103_0031142 | 3300048906 | Bacteria | 3249 |
| 303 | Ga0496103_0063610 | 3300048906 | Bacteria | 2298 |
| 304 | Ga0496104_0039361 | 3300048907 | Bacteria | 4427 |
| 305 | Ga0496104_0093039 | 3300048907 | Bacteria | 2883 |
| 306 | Ga0496105_0008276 | 3300048908 | Bacteria | 8088 |
| 307 | Ga0496105_0042831 | 3300048908 | Bacteria | 3732 |
| 308 | Ga0496105_0046971 | 3300048908 | Bacteria | 3563 |
| 309 | Ga0496105_0066479 | 3300048908 | Bacteria | 2976 |
| 310 | Ga0496106_0053327 | 3300048909 | Bacteria | 3054 |
| 311 | Ga0496109_0128851 | 3300048912 | Bacteria | 2361 |
| 312 | Ga0496109_0347243 | 3300048912 | Bacteria | 1401 |
| 313 | Ga0496110_0040573 | 3300048913 | Bacteria | 4057 |
| 314 | Ga0496111_0136553 | 3300048914 | Bacteria | 1816 |
| 315 | Ga0496111_0196818 | 3300048914 | Bacteria | 1498 |
| 316 | Ga0496112_0154763 | 3300048915 | Bacteria | 2260 |
| 317 | Ga0496113_0044504 | 3300048916 | Bacteria | 3289 |
| 318 | Ga0496113_0313642 | 3300048916 | Bacteria | 1257 |
| 319 | Ga0496114_0014522 | 3300048917 | Bacteria | 6326 |
| 320 | Ga0496114_0018358 | 3300048917 | Bacteria | 5655 |
| 321 | Ga0496114_0036186 | 3300048917 | Bacteria | 4080 |
| 322 | Ga0496114_0045186 | 3300048917 | Bacteria | 3658 |
| 323 | Ga0496114_0045508 | 3300048917 | Bacteria | 3646 |
| 324 | Ga0496114_0056148 | 3300048917 | Bacteria | 3285 |
| 325 | Ga0496115_0008804 | 3300048918 | Bacteria | 7480 |
| 326 | Ga0496115_0032784 | 3300048918 | Bacteria | 4100 |
| 327 | Ga0496115_0044181 | 3300048918 | Bacteria | 3553 |
| 328 | Ga0496115_0077461 | 3300048918 | Bacteria | 2703 |
| 329 | Ga0496115_0102969 | 3300048918 | Bacteria | 2341 |
| 330 | Ga0496116_0046538 | 3300048919 | Bacteria | 2927 |
| 331 | Ga0496117_0000053 | 3300048920 | Bacteria | 279396 |
| 332 | Ga0496117_0001098 | 3300048920 | Bacteria | 40887 |
| 333 | Ga0496117_0002166 | 3300048920 | Bacteria | 25599 |
| 334 | Ga0496117_0012242 | 3300048920 | Bacteria | 7586 |
| 335 | Ga0496117_0021611 | 3300048920 | Bacteria | 5198 |
| 336 | Ga0496117_0031847 | 3300048920 | Bacteria | 4019 |
| 337 | Ga0496118_0004656 | 3300048921 | Bacteria | 16093 |
| 338 | Ga0496118_0012368 | 3300048921 | Bacteria | 8202 |
| 339 | Ga0496118_0024300 | 3300048921 | Bacteria | 5236 |
| 340 | Ga0496118_0025277 | 3300048921 | Bacteria | 5098 |
| 341 | Ga0496118_0027693 | 3300048921 | Bacteria | 4789 |
| 342 | Ga0496118_0162412 | 3300048921 | Bacteria | 1379 |
| 343 | Ga0496119_0001888 | 3300048922 | Bacteria | 24099 |
| 344 | Ga0496119_0002138 | 3300048922 | Bacteria | 22248 |
| 345 | Ga0496119_0005568 | 3300048922 | Bacteria | 11985 |
| 346 | Ga0496119_0006144 | 3300048922 | Bacteria | 11241 |
| 347 | Ga0496119_0102418 | 3300048922 | Bacteria | 1605 |
| 348 | Ga0496119_0133690 | 3300048922 | Bacteria | 1348 |
| 349 | Ga0496120_0004461 | 3300048923 | Bacteria | 11730 |
| 350 | Ga0496120_0011223 | 3300048923 | Bacteria | 6178 |
| 351 | Ga0496120_0035721 | 3300048923 | Bacteria | 2965 |
| 352 | Ga0496121_0091924 | 3300048924 | Bacteria | 2367 |
| 353 | Ga0496122_0000031 | 3300048925 | Bacteria | 329726 |
| 354 | Ga0496122_0000194 | 3300048925 | Bacteria | 139191 |
| 355 | Ga0496122_0001160 | 3300048925 | Bacteria | 45119 |
| 356 | Ga0496122_0002890 | 3300048925 | Bacteria | 23494 |
| 357 | Ga0496122_0004113 | 3300048925 | Bacteria | 18414 |
| 358 | Ga0496122_0083405 | 3300048925 | Bacteria | 2216 |
| 359 | Ga0496123_0000013 | 3300048926 | Bacteria | 439694 |
| 360 | Ga0496123_0000350 | 3300048926 | Bacteria | 86569 |
| 361 | Ga0496123_0000405 | 3300048926 | Bacteria | 79019 |
| 362 | Ga0496123_0019951 | 3300048926 | Bacteria | 5262 |
| 363 | Ga0496124_0008009 | 3300048927 | Bacteria | 11120 |
| 364 | Ga0496124_0008422 | 3300048927 | Bacteria | 10785 |
| 365 | Ga0496124_0013529 | 3300048927 | Bacteria | 7958 |
| 366 | Ga0496124_0039796 | 3300048927 | Bacteria | 4071 |
| 367 | Ga0496124_0124997 | 3300048927 | Bacteria | 2050 |
| 368 | Ga0496125_0000077 | 3300048928 | Bacteria | 232629 |
| 369 | Ga0496125_0000214 | 3300048928 | Bacteria | 118625 |
| 370 | Ga0496125_0001794 | 3300048928 | Bacteria | 29677 |
| 371 | Ga0496125_0002783 | 3300048928 | Bacteria | 22123 |
| 372 | Ga0496125_0018219 | 3300048928 | Bacteria | 6673 |
| 373 | Ga0496125_0036927 | 3300048928 | Bacteria | 4256 |
| 374 | Ga0496125_0096634 | 3300048928 | Bacteria | 2192 |
| 375 | Ga0496125_0139859 | 3300048928 | Bacteria | 1685 |
| 376 | Ga0496126_0002423 | 3300048929 | Bacteria | 25250 |
| 377 | Ga0496126_0008871 | 3300048929 | Bacteria | 10775 |
| 378 | Ga0496126_0034141 | 3300048929 | Bacteria | 4781 |
| 379 | Ga0496126_0078199 | 3300048929 | Bacteria | 2932 |
| 380 | Ga0496126_0216034 | 3300048929 | Bacteria | 1613 |
| 381 | Ga0501325_001480 | 3300049541 | Bacteria | 1452 |
| 382 | Ga0501031_0002094 | 3300049568 | Bacteria | 12574 |
| 383 | Ga0501031_0019702 | 3300049568 | Bacteria | 4395 |
| 384 | Ga0501032_0005652 | 3300049569 | Bacteria | 9266 |
| 385 | Ga0501032_0006541 | 3300049569 | Bacteria | 8557 |
| 386 | Ga0501032_0031378 | 3300049569 | Bacteria | 3643 |
| 387 | Ga0501032_0073159 | 3300049569 | Bacteria | 2283 |
| 388 | Ga0501032_0076907 | 3300049569 | Bacteria | 2222 |
| 389 | Ga0501033_0000628 | 3300049570 | Bacteria | 32661 |
| 390 | Ga0501033_0009706 | 3300049570 | Bacteria | 7400 |
| 391 | Ga0501033_0033212 | 3300049570 | Bacteria | 3874 |
| 392 | Ga0501033_0072022 | 3300049570 | Bacteria | 2538 |
| 393 | Ga0501034_0000465 | 3300049571 | Bacteria | 67251 |
| 394 | Ga0501034_0002014 | 3300049571 | Bacteria | 25631 |
| 395 | Ga0501034_0007513 | 3300049571 | Bacteria | 11594 |
| 396 | Ga0501034_0009822 | 3300049571 | Bacteria | 10006 |
| 397 | Ga0501034_0017233 | 3300049571 | Bacteria | 7410 |
| 398 | Ga0501034_0019363 | 3300049571 | Bacteria | 6961 |
| 399 | Ga0501034_0024319 | 3300049571 | Bacteria | 6161 |
| 400 | Ga0501034_0037157 | 3300049571 | Bacteria | 4931 |
| 401 | Ga0501034_0039146 | 3300049571 | Bacteria | 4802 |
| 402 | Ga0501034_0041764 | 3300049571 | Bacteria | 4640 |
| 403 | Ga0501034_0046963 | 3300049571 | Bacteria | 4362 |
| 404 | Ga0501034_0056611 | 3300049571 | Bacteria | 3944 |
| 405 | Ga0501034_0084228 | 3300049571 | Bacteria | 3181 |
| 406 | Ga0501034_0128570 | 3300049571 | Bacteria | 2517 |
| 407 | Ga0501036_0001706 | 3300049572 | Bacteria | 17067 |
| 408 | Ga0501036_0004285 | 3300049572 | Bacteria | 11522 |
| 409 | Ga0501036_0008345 | 3300049572 | Bacteria | 8487 |
| 410 | Ga0501036_0012325 | 3300049572 | Bacteria | 7079 |
| 411 | Ga0501036_0014480 | 3300049572 | Bacteria | 6570 |
| 412 | Ga0501036_0027975 | 3300049572 | Bacteria | 4766 |
| 413 | Ga0501036_0040504 | 3300049572 | Bacteria | 3940 |
| 414 | Ga0501036_0140859 | 3300049572 | Bacteria | 2035 |
| 415 | Ga0501037_0000863 | 3300049573 | Bacteria | 22612 |
| 416 | Ga0501037_0002320 | 3300049573 | Bacteria | 13751 |
| 417 | Ga0501037_0002437 | 3300049573 | Bacteria | 13456 |
| 418 | Ga0501037_0019819 | 3300049573 | Bacteria | 4963 |
| 419 | Ga0501037_0105394 | 3300049573 | Bacteria | 2032 |
| 420 | Ga0501038_0001295 | 3300049574 | Bacteria | 22770 |
| 421 | Ga0501038_0006429 | 3300049574 | Bacteria | 10874 |
| 422 | Ga0501038_0011829 | 3300049574 | Bacteria | 7965 |
| 423 | Ga0501038_0014126 | 3300049574 | Bacteria | 7275 |
| 424 | Ga0501038_0014451 | 3300049574 | Bacteria | 7195 |
| 425 | Ga0501038_0022833 | 3300049574 | Bacteria | 5600 |
| 426 | Ga0501038_0055449 | 3300049574 | Bacteria | 3404 |
| 427 | Ga0501038_0113501 | 3300049574 | Bacteria | 2242 |
| 428 | Ga0501039_0006630 | 3300049575 | Bacteria | 8797 |
| 429 | Ga0501039_0008476 | 3300049575 | Bacteria | 7837 |
| 430 | Ga0501040_0001421 | 3300049576 | Bacteria | 15151 |
| 431 | Ga0501040_0005559 | 3300049576 | Bacteria | 8162 |
| 432 | Ga0501041_0001688 | 3300049577 | Bacteria | 12370 |
| 433 | Ga0501041_0002741 | 3300049577 | Bacteria | 10061 |
| 434 | Ga0501042_0008388 | 3300049578 | Bacteria | 6815 |
| 435 | Ga0501043_0001870 | 3300049579 | Bacteria | 18033 |
| 436 | Ga0501043_0005475 | 3300049579 | Bacteria | 10258 |
| 437 | Ga0501043_0025489 | 3300049579 | Bacteria | 4640 |
| 438 | Ga0501043_0057669 | 3300049579 | Bacteria | 3049 |
| 439 | Ga0501043_0065045 | 3300049579 | Bacteria | 2863 |
| 440 | Ga0501043_0103787 | 3300049579 | Bacteria | 2233 |
| 441 | Ga0501043_0108935 | 3300049579 | Bacteria | 2175 |
| 442 | Ga0501043_0163205 | 3300049579 | Bacteria | 1740 |
| 443 | Ga0501046_0004159 | 3300049580 | Bacteria | 13175 |
| 444 | Ga0501046_0004762 | 3300049580 | Bacteria | 12242 |
| 445 | Ga0501046_0005900 | 3300049580 | Bacteria | 10919 |
| 446 | Ga0501046_0025790 | 3300049580 | Bacteria | 4806 |
| 447 | Ga0501046_0032451 | 3300049580 | Bacteria | 4228 |
| 448 | Ga0501047_0004256 | 3300049581 | Bacteria | 13477 |
| 449 | Ga0501047_0006266 | 3300049581 | Bacteria | 11181 |
| 450 | Ga0501047_0015383 | 3300049581 | Bacteria | 7287 |
| 451 | Ga0501047_0033715 | 3300049581 | Bacteria | 4941 |
| 452 | Ga0501047_0089555 | 3300049581 | Bacteria | 2954 |
| 453 | Ga0501047_0111842 | 3300049581 | Bacteria | 2613 |
| 454 | Ga0501047_0176731 | 3300049581 | Bacteria | 2002 |
| 455 | Ga0501048_0003589 | 3300049582 | Bacteria | 11809 |
| 456 | Ga0501048_0006426 | 3300049582 | Bacteria | 8932 |
| 457 | Ga0501067_0004179 | 3300049583 | Bacteria | 7966 |
| 458 | Ga0501067_0089301 | 3300049583 | Bacteria | 1710 |
| 459 | Ga0501068_0000763 | 3300049584 | Bacteria | 16558 |
| 460 | Ga0501068_0010793 | 3300049584 | Bacteria | 5138 |
| 461 | Ga0501070_0000133 | 3300049586 | Bacteria | 67036 |
| 462 | Ga0501070_0007031 | 3300049586 | Bacteria | 9574 |
| 463 | Ga0501070_0007947 | 3300049586 | Bacteria | 8985 |
| 464 | Ga0501070_0011636 | 3300049586 | Bacteria | 7428 |
| 465 | Ga0501070_0021680 | 3300049586 | Bacteria | 5386 |
| 466 | Ga0501070_0027514 | 3300049586 | Bacteria | 4770 |
| 467 | Ga0501070_0177560 | 3300049586 | Bacteria | 1753 |
| 468 | Ga0501071_0000105 | 3300049587 | Bacteria | 32519 |
| 469 | Ga0501071_0049598 | 3300049587 | Bacteria | 3022 |
| 470 | Ga0501072_0002067 | 3300049588 | Bacteria | 14928 |
| 471 | Ga0501073_0019632 | 3300049589 | Bacteria | 4876 |
| 472 | Ga0501073_0025139 | 3300049589 | Bacteria | 4274 |
| 473 | Ga0501074_0004504 | 3300049590 | Bacteria | 9977 |
| 474 | Ga0501074_0005437 | 3300049590 | Bacteria | 9160 |
| 475 | Ga0501075_0000816 | 3300049591 | Bacteria | 19523 |
| 476 | Ga0501076_0002548 | 3300049592 | Bacteria | 12542 |
| 477 | Ga0501077_0009552 | 3300049593 | Bacteria | 6031 |
| 478 | Ga0501079_0009597 | 3300049741 | Bacteria | 7338 |
| 479 | Ga0501079_0009875 | 3300049741 | Bacteria | 7242 |
| 480 | Ga0501080_0012890 | 3300049742 | Bacteria | 7671 |
| 481 | Ga0501080_0161771 | 3300049742 | Bacteria | 2067 |
| 482 | Ga0501083_0003600 | 3300049744 | Bacteria | 10871 |
| 483 | Ga0501083_0086764 | 3300049744 | Bacteria | 2069 |
| 484 | Ga0501035_0003528 | 3300049822 | Bacteria | 14955 |
| 485 | Ga0501035_0016985 | 3300049822 | Bacteria | 6706 |
| 486 | Ga0501035_0020135 | 3300049822 | Bacteria | 6127 |
| 487 | Ga0501035_0035284 | 3300049822 | Bacteria | 4539 |
| 488 | Ga0501035_0040085 | 3300049822 | Bacteria | 4234 |
| 489 | Ga0501044_0005774 | 3300049823 | Bacteria | 13698 |
| 490 | Ga0501044_0011707 | 3300049823 | Bacteria | 9503 |
| 491 | Ga0501044_0013333 | 3300049823 | Bacteria | 8895 |
| 492 | Ga0501044_0032083 | 3300049823 | Bacteria | 5522 |
| 493 | Ga0501044_0060373 | 3300049823 | Bacteria | 3882 |
| 494 | Ga0501044_0061882 | 3300049823 | Bacteria | 3828 |
| 495 | Ga0501044_0111700 | 3300049823 | Bacteria | 2740 |
| 496 | Ga0501044_0131305 | 3300049823 | Bacteria | 2498 |
| 497 | Ga0501044_0386214 | 3300049823 | Bacteria | 1314 |
| 498 | Ga0501045_0004876 | 3300049824 | Bacteria | 9290 |
| 499 | Ga0501045_0007703 | 3300049824 | Bacteria | 7492 |
| 500 | nmdc:mga03n38_11297_c1 | 3300050490 | Bacteria | 3321 |
| 501 | nmdc:mga00v17_10925_c1 | 3300050491 | Bacteria | 4976 |
| 502 | nmdc:mga00v17_129928_c1 | 3300050491 | Bacteria | 1609 |
| 503 | nmdc:mga00v17_23769_c1 | 3300050491 | Bacteria | 3549 |
| 504 | nmdc:mga00v17_23924_c1 | 3300050491 | Bacteria | 3538 |
| 505 | nmdc:mga00v17_9487_c1 | 3300050491 | Bacteria | 5270 |
| 506 | nmdc:mga0yw44_31744_c1 | 3300050492 | Bacteria | 3074 |
| 507 | nmdc:mga06z11_886_c1 | 3300050494 | Bacteria | 10922 |
| 508 | nmdc:mga04h51_3550_c1 | 3300050495 | Bacteria | 3799 |
| 509 | nmdc:mga07m45_15975_c1 | 3300050496 | Bacteria | 4015 |
| 510 | Ga0500635_0000023 | 3300053080 | Bacteria | 108024 |
| 511 | Ga0495619_0024672 | 3300053085 | Bacteria | 3858 |
| 512 | Ga0500652_000684 | 3300053131 | Bacteria | 11506 |
| 513 | Ga0500559_0000183 | 3300053136 | Bacteria | 49768 |
| 514 | Ga0500573_0034169 | 3300053140 | Bacteria | 2933 |
| 515 | Ga0500579_058818 | 3300053143 | Bacteria | 2297 |
| 516 | Ga0500600_0119590 | 3300053149 | Bacteria | 1360 |
| 517 | Ga0500604_0033739 | 3300053151 | Bacteria | 1515 |
| 518 | Ga0500616_0000241 | 3300053153 | Bacteria | 86038 |
| 519 | Ga0500616_0002314 | 3300053153 | Bacteria | 16093 |
| 520 | Ga0500616_0009882 | 3300053153 | Bacteria | 5748 |
| 521 | Ga0501084_0003176 | 3300054114 | Bacteria | 13289 |
| 522 | Ga0501084_0004449 | 3300054114 | Bacteria | 11443 |
| 523 | Ga0501084_0066321 | 3300054114 | Bacteria | 3020 |
| 524 | Ga0587090_000021 | 3300059510 | Bacteria | 7644 |
| 525 | Ga0587072_001667 | 3300059643 | Bacteria | 2823 |
| 526 | Ga0501082_0073560 | 3300060353 | Bacteria | 2943 |
| 527 | Ga0501082_0102905 | 3300060353 | Bacteria | 2470 |
| 528 | Ga0466962_0000735 | 3300061719 | Bacteria | 14693 |
| 529 | Ga0530510_0002178 | 3300061734 | Bacteria | 13433 |
| 530 | 2537901164 | 2537561592 | Bacteria | 4348607 |
| 531 | 2554258278 | 2554235005 | Bacteria | 6457341 |
| 532 | 2585299010 | 2582581312 | Bacteria | 7308206 |
| 533 | 2585310024 | 2582581313 | Bacteria | 10042643 |
| 534 | 2585315691 | 2582581314 | Bacteria | 11452267 |
| 535 | 2588108933 | 2585428157 | Bacteria | 3018951 |
| 536 | 2616900439 | 2616644941 | Bacteria | 8510691 |
| 537 | 2643733892 | 2643221542 | Bacteria | 3563959 |
| 538 | 2643753283 | 2643221546 | Bacteria | 2910897 |
| 539 | 2643765474 | 2643221548 | Bacteria | 8053412 |
| 540 | 2643768048 | 2643221549 | Bacteria | 4042819 |
| 541 | 2643785516 | 2643221553 | Bacteria | 3544260 |
| 542 | 2643848615 | 2643221566 | Bacteria | 3460379 |
| 543 | 2643875633 | 2643221572 | Bacteria | 3614809 |
| 544 | 2643885694 | 2643221575 | Bacteria | 4022601 |
| 545 | 2643898256 | 2643221578 | Bacteria | 9213798 |
| 546 | 2643944370 | 2643221587 | Bacteria | 7586415 |
| 547 | 2643996113 | 2643221597 | Bacteria | 3347721 |
| 548 | 2644082077 | 2643221613 | Bacteria | 4622396 |
| 549 | 2644095698 | 2643221616 | Bacteria | 4066575 |
| 550 | 2644111434 | 2643221619 | Bacteria | 4158469 |
| 551 | 2644170473 | 2643221630 | Bacteria | 3601215 |
| 552 | 2644183014 | 2643221632 | Bacteria | 3406696 |
| 553 | 2644198717 | 2643221635 | Bacteria | 2632343 |
| 554 | 2644264497 | 2643221647 | Bacteria | 10741251 |
| 555 | 2644382688 | 2643221669 | Bacteria | 3611286 |
| 556 | 2644385710 | 2643221670 | Bacteria | 6497041 |
| 557 | 2644409401 | 2643221673 | Bacteria | 9196637 |
| 558 | 2644431268 | 2643221677 | Bacteria | 7584031 |
| 559 | 2644436745 | 2643221678 | Bacteria | 9540101 |
| 560 | 2644443971 | 2643221679 | Bacteria | 3839507 |
| 561 | 2644462455 | 2643221682 | Bacteria | 6743283 |
| 562 | 2644503255 | 2643221690 | Bacteria | 4654705 |
| 563 | 2644525567 | 2643221694 | Bacteria | 4392972 |
| 564 | 2644625457 | 2643221714 | Bacteria | 9015452 |
| 565 | 2644664940 | 2643221721 | Bacteria | 4486924 |
| 566 | 2644669645 | 2643221722 | Bacteria | 4247614 |
| 567 | 2644679930 | 2643221724 | Bacteria | 3593515 |
| 568 | 2691514386 | 2690315906 | Bacteria | 4517044 |
| 569 | 2723641725 | 2721755702 | Bacteria | 4373124 |
| 570 | 2730229404 | 2728369380 | Bacteria | 3620317 |
| 571 | 2747952419 | 2747842429 | Bacteria | 3914386 |
| 572 | 2758225853 | 2757320536 | Bacteria | 3629334 |
| 573 | 2768643292 | 2767802112 | Bacteria | 6465194 |
| 574 | 2774380158 | 2773857758 | Bacteria | 3592392 |
| 575 | 2774399277 | 2773857763 | Bacteria | 4180068 |
| 576 | 2775655286 | 2775506735 | Bacteria | 4556596 |
| 577 | 2784588220 | 2784132148 | Bacteria | 8627943 |
| 578 | 2785343839 | 2784746763 | Bacteria | 9783172 |
| 579 | 2785369023 | 2784746768 | Bacteria | 10036182 |
| 580 | 2786670172 | 2786546132 | Bacteria | 10419719 |
| 581 | 2793981253 | 2791355406 | Bacteria | 11364898 |
| 582 | 2808630977 | 2808606306 | Bacteria | 3608896 |
| 583 | 2808827470 | 2808606357 | Bacteria | 4466944 |
| 584 | 2808841643 | 2808606359 | Bacteria | 9866990 |
| 585 | 2808852836 | 2808606360 | Bacteria | 4404006 |
| 586 | 2808873397 | 2808606365 | Bacteria | 4301966 |
| 587 | 2808878715 | 2808606366 | Bacteria | 4415912 |
| 588 | 2808885831 | 2808606368 | Bacteria | 3174172 |
| 589 | 2808891705 | 2808606370 | Bacteria | 4942454 |
| 590 | 2808896835 | 2808606371 | Bacteria | 4251511 |
| 591 | 2808901717 | 2808606372 | Bacteria | 4649509 |
| 592 | 2808920178 | 2808606375 | Bacteria | 9466072 |
| 593 | 2809227618 | 2808606447 | Bacteria | 3572005 |
| 594 | 2809231832 | 2808606448 | Bacteria | 8656184 |
| 595 | 2810364019 | 2808606700 | Bacteria | 3482157 |
| 596 | 2811848595 | 2808606982 | Bacteria | 7791042 |
| 597 | 2812320745 | 2811994871 | Bacteria | 4497550 |
| 598 | 2812323427 | 2811994872 | Bacteria | 4121241 |
| 599 | 2812358609 | 2811994879 | Bacteria | 9313447 |
| 600 | 2812364726 | 2811994880 | Bacteria | 4147780 |
| 601 | 2812480933 | 2811994917 | Bacteria | 7761064 |
| 602 | 2819693327 | 2818991463 | Bacteria | 7948711 |
| 603 | 2821270220 | 2821268502 | Bacteria | 3750023 |
| 604 | 2833711178 | 2833709550 | Bacteria | 4008291 |
| 605 | 2835189088 | 2835188231 | Bacteria | 3476928 |
| 606 | 2839986043 | 2839986021 | Bacteria | 3685650 |
| 607 | 2844842079 | 2844841374 | Bacteria | 3917147 |
| 608 | 2848552724 | 2848551377 | Bacteria | 3720646 |
| 609 | 2852634382 | 2852632344 | Bacteria | 3463163 |
| 610 | 2852642335 | 2852635781 | Bacteria | 8251373 |
| 611 | 2852647122 | 2852646457 | Bacteria | 3408613 |
| 612 | 2852665046 | 2852663356 | Bacteria | 4090475 |
| 613 | 2852680094 | 2852677369 | Bacteria | 3768884 |
| 614 | 2857480713 | 2857479173 | Bacteria | 2469263 |
| 615 | 2857634202 | 2857632687 | Bacteria | 2448521 |
| 616 | 2857713174 | 2857710386 | Bacteria | 3186771 |
| 617 | 2857720111 | 2857720070 | Bacteria | 3189373 |
| 618 | 2857723568 | 2857723135 | Bacteria | 4217853 |
| 619 | 2857730181 | 2857729791 | Bacteria | 4040535 |
| 620 | 2862184580 | 2862178590 | Bacteria | 8583590 |
| 621 | 2862287746 | 2862281513 | Bacteria | 9621493 |
| 622 | 2862390216 | 2862382967 | Bacteria | 10317375 |
| 623 | 2862579636 | 2862574272 | Bacteria | 10567477 |
| 624 | 2862710288 | 2862705112 | Bacteria | 6563286 |
| 625 | 2862994996 | 2862993130 | Bacteria | 3860849 |
| 626 | 2863405135 | 2863404153 | Bacteria | 9672205 |
| 627 | 2867350037 | 2867346516 | Bacteria | 7608576 |
| 628 | 2867371519 | 2867369537 | Bacteria | 6501581 |
| 629 | 2867429128 | 2867428634 | Bacteria | 9590268 |
| 630 | 2867477313 | 2867475112 | Bacteria | 6909112 |
| 631 | 2870630566 | 2870628048 | Bacteria | 3696012 |
| 632 | 2870802778 | 2870801768 | Bacteria | 2710986 |
| 633 | 2870804852 | 2870804320 | Bacteria | 2552467 |
| 634 | 2873156177 | 2873151551 | Bacteria | 8625867 |
| 635 | 2875394141 | 2875391855 | Bacteria | 7600475 |
| 636 | 2877681533 | 2877676314 | Bacteria | 9512378 |
| 637 | 2884765066 | 2884763398 | Bacteria | 4091164 |
| 638 | 2884996065 | 2884994152 | Bacteria | 4492978 |
| 639 | 2887447646 | 2887443736 | Bacteria | 4426037 |
| 640 | 2895661691 | 2895660088 | Bacteria | 3782833 |
| 641 | 2904432922 | 2904430863 | Bacteria | 3486923 |
| 642 | 2904511777 | 2904509784 | Bacteria | 3520416 |
| 643 | 2905927359 | 2905926851 | Bacteria | 4423176 |
| 644 | 2906803089 | 2906799679 | Bacteria | 4031749 |
| 645 | 2908680703 | 2908678064 | Bacteria | 3482747 |
| 646 | 2909074504 | 2909074476 | Bacteria | 3436050 |
| 647 | 2912720483 | 2912715099 | Bacteria | 9460473 |
| 648 | 2912724681 | 2912723979 | Bacteria | 8557534 |
| 649 | 2912760267 | 2912757875 | Bacteria | 7940295 |
| 650 | 2918504141 | 2918501144 | Bacteria | 8668083 |
| 651 | 2919041484 | 2919039151 | Bacteria | 3391018 |
| 652 | 2919057721 | 2919055335 | Bacteria | 3875751 |
| 653 | 2919071746 | 2919069694 | Bacteria | 3622919 |
| 654 | 2919391198 | 2919391150 | Bacteria | 4884741 |
| 655 | 2919396410 | 2919395869 | Bacteria | 3704152 |
| 656 | 2919446528 | 2919443155 | Bacteria | 4072969 |
| 657 | 2919449672 | 2919446982 | Bacteria | 3994487 |
| 658 | 2919473365 | 2919468124 | Bacteria | 9133025 |
| 659 | 2919524122 | 2919523602 | Bacteria | 3788128 |
| 660 | 2920882044 | 2920879853 | Bacteria | 4216831 |
| 661 | 2928092058 | 2928090899 | Bacteria | 3158267 |
| 662 | 2928123404 | 2928121344 | Bacteria | 3972376 |
| 663 | 2928155708 | 2928153084 | Bacteria | 4020257 |
| 664 | 2932432865 | 2932431166 | Bacteria | 4215299 |
| 665 | 2935396281 | 2935390628 | Bacteria | 7043367 |
| 666 | 2935411134 | 2935409751 | Bacteria | 4179611 |
| 667 | 2935893347 | 2935890801 | Bacteria | 4593001 |
| 668 | 2939598439 | 2939598168 | Bacteria | 4687164 |
| 669 | 2945918505 | 2945916053 | Bacteria | 4555517 |
| 670 | 2945921212 | 2945920336 | Bacteria | 4501603 |
| 671 | 2945942627 | 2945941187 | Bacteria | 4682474 |
| 672 | 2945959613 | 2945956166 | Bacteria | 5110334 |
| 673 | 2945971575 | 2945968032 | Bacteria | 4111363 |
| 674 | 2946005061 | 2946003308 | Bacteria | 3857229 |
| 675 | 2946038545 | 2946037020 | Bacteria | 4900426 |
| 676 | 2946043952 | 2946041624 | Bacteria | 4191385 |
| 677 | 2946050466 | 2946045630 | Bacteria | 8527308 |
| 678 | 2946062363 | 2946059875 | Bacteria | 4386623 |
| 679 | 2946067268 | 2946064051 | Bacteria | 8957905 |
| 680 | 2946075542 | 2946072368 | Bacteria | 8999607 |
| 681 | 2946081175 | 2946080515 | Bacteria | 4310960 |
| 682 | 2947229976 | 2947224130 | Bacteria | 9938529 |
| 683 | 2953999818 | 2953998280 | Bacteria | 4812144 |
| 684 | 2954003183 | 2954002825 | Bacteria | 9173742 |
| 685 | 2954386662 | 2954380949 | Bacteria | 10050426 |
| 686 | 2954676509 | 2954673503 | Bacteria | 9685905 |
| 687 | 2954687658 | 2954682443 | Bacteria | 9862841 |
| 688 | 2954697474 | 2954691527 | Bacteria | 10720516 |
| 689 | 2954704760 | 2954701450 | Bacteria | 10834262 |
| 690 | 2954716636 | 2954711539 | Bacteria | 10867210 |
| 691 | 2954726584 | 2954721474 | Bacteria | 10456478 |
| 692 | 2954735212 | 2954731030 | Bacteria | 10243860 |
| 693 | 2954745506 | 2954740390 | Bacteria | 10229294 |
| 694 | 2954754082 | 2954749733 | Bacteria | 10366972 |
| 695 | 2954764480 | 2954759201 | Bacteria | 9358192 |
| 696 | 2964327239 | 2964326757 | Bacteria | 3290868 |
| 697 | 2966602940 | 2966598605 | Bacteria | 7676064 |
| 698 | 2974297371 | 2974294766 | Bacteria | 3767688 |
| 699 | 2974306536 | 2974302888 | Bacteria | 4369871 |
| 700 | 2974326391 | 2974324384 | Bacteria | 3750535 |
| 701 | 2977231626 | 2977228692 | Bacteria | 3450105 |
| 702 | 2977236981 | 2977236895 | Bacteria | 3569373 |
| 703 | 2977266849 | 2977264416 | Bacteria | 3750737 |
| 704 | 2984545226 | 2984542743 | Bacteria | 3569378 |
| 705 | 2984581176 | 2984580707 | Bacteria | 3351387 |
| 706 | 2990046701 | 2990044586 | Bacteria | 6603797 |
| 707 | 2990062813 | 2990059506 | Bacteria | 9321252 |
| 708 | 2990088689 | 2990088156 | Bacteria | 6657676 |
| 709 | 2995727803 | 2995726249 | Bacteria | 3470435 |
| 710 | 2997456845 | 2997451912 | Bacteria | 8492419 |
| 711 | 2997601641 | 2997600082 | Bacteria | 9896405 |
| 712 | 3006321616 | 3006321560 | Bacteria | 8247479 |
| 713 | 3006394131 | 3006393351 | Bacteria | 6615579 |
| 714 | 3006496511 | 3006493962 | Bacteria | 8825450 |
| 715 | 8002813953 | 8002811521 | Bacteria | 2942897 |
| 716 | 8004027678 | 8004025490 | Bacteria | 4327753 |
| 717 | 8004185369 | 8004182704 | Bacteria | 3391155 |
| 718 | 8004213899 | 8004212874 | Bacteria | 2861420 |
| 719 | 8008559937 | 8008558824 | Bacteria | 10610750 |
| 720 | 8008579231 | 8008574985 | Bacteria | 7815457 |
| 721 | 8016257337 | 8016254467 | Bacteria | 3797036 |
| 722 | 8023631850 | 8023623736 | Bacteria | 8593882 |
| 723 | 8025483383 | 8025478263 | Bacteria | 8209203 |
| 724 | 8025526445 | 8025524527 | Bacteria | 7197316 |
| 725 | 8025533736 | 8025530807 | Bacteria | 8495698 |
| 726 | 8033685695 | 8033684223 | Bacteria | 6906479 |
| 727 | 8045831799 | 8045830549 | Bacteria | 4444727 |
| 728 | 8046353171 | 8046352972 | Bacteria | 3613806 |
| 729 | 8047898490 | 8047893842 | Bacteria | 11723082 |
| 730 | 8048134914 | 8048127548 | Bacteria | 11053136 |
| 731 | 8048360420 | 8048356638 | Bacteria | 11044339 |
| 732 | 8048375452 | 8048369669 | Bacteria | 11666822 |
| 733 | 8048382753 | 8048379754 | Bacteria | 11877923 |
| 734 | 8048411129 | 8048406513 | Bacteria | 8936924 |
| 735 | 8054107887 | 8054107350 | Bacteria | 5022511 |
| 736 | 8054161027 | 8054160619 | Bacteria | 7783213 |
| 737 | 8055036238 | 8055034563 | Bacteria | 3562128 |
| 738 | 8055038290 | 8055037949 | Bacteria | 3337834 |
| 739 | 8056673238 | 8056667051 | Bacteria | 6953971 |
| 740 | 8056830409 | 8056829672 | Bacteria | 9045328 |
| 741 | JGI25154J39366_1000846 | |||
| 742 | JGI24737J22298_10002831 | |||
| 743 | JGI24735J21928_10004528 | |||
| 744 | JGI24738J21930_10007855 | |||
| 745 | JGI25165J46597_1000002 | |||
| 746 | Ga0007427J51700_107271 | |||
| 747 | Ga0006562J51391_1032679 | |||
| 748 | Ga0006562J51391_1032682 | |||
| 749 | Ga0006562J51391_1034854 | |||
| 750 | Ga0006780_1011353 | |||
| 751 | Ga0055539_1000111 | |||
| 752 | Ga0055533_1000001 | |||
| 753 | Ga0055525_1000317 | |||
| 754 | Ga0055527_1000012 | |||
| 755 | Ga0055542_1000017 | |||
| 756 | Ga0055529_1000023 | |||
| 757 | Ga0055541_1004852 | |||
| 758 | Ga0065714_10019108 | |||
| 759 | Ga0070658_10065597 | |||
| 760 | Ga0070683_100239998 | |||
| 761 | Ga0070666_10063792 | |||
| 762 | Ga0070669_100016507 | |||
| 763 | Ga0070675_100244363 | |||
| 764 | Ga0070679_100133727 | |||
| 765 | Ga0070696_100001852 | |||
| 766 | Ga0070665_100052203 | |||
| 767 | Ga0068852_100171729 | |||
| 768 | Ga0081455_10051034 | |||
| 769 | Ga0081540_1012227 | |||
| 770 | Ga0081539_10001159 | |||
| 771 | Ga0081539_10030524 | |||
| 772 | Ga0075365_10047812 | |||
| 773 | Ga0075368_10026380 | |||
| 774 | Ga0075364_10004420 | |||
| 775 | Ga0075364_10017035 | |||
| 776 | Ga0075364_10017496 | |||
| 777 | Ga0075364_10028991 | |||
| 778 | Ga0075367_10000349 | |||
| 779 | Ga0075369_10011511 | |||
| 780 | Ga0075369_10012427 | |||
| 781 | Ga0075370_10030256 | |||
| 782 | Ga0105251_10030179 | |||
| 783 | Ga0105243_10043093 | |||
| 784 | Ga0105246_10018229 | |||
| 785 | Ga0105246_10099641 | |||
| 786 | Ga0157371_10031269 | |||
| 787 | Ga0157369_10078764 | |||
| 788 | Ga0171462_1003 | |||
| 789 | Ga0157372_10059520 | |||
| 790 | Ga0157380_10006032 | |||
| 791 | Ga0182008_10004358 | |||
| 792 | Ga0182006_1017956 | |||
| 793 | Ga0182007_10001716 | |||
| 794 | Ga0183367_1006 | |||
| 795 | Ga0197907_10053258 | |||
| 796 | Ga0206349_1248741 | |||
| 797 | Ga0206355_1244303 | |||
| 798 | Ga0206354_10663781 | |||
| 799 | Ga0206353_11560231 | |||
| 800 | Ga0213875_10021319 | |||
| 801 | Ga0224712_10038306 | |||
| 802 | Ga0224712_10042375 | |||
| 803 | Ga0209566_100026 | |||
| 804 | Ga0209674_100001 | |||
| 805 | Ga0209672_100003 | |||
| 806 | Ga0209147_100633 | |||
| 807 | Ga0209563_100001 | |||
| 808 | Ga0207427_100034 | |||
| 809 | Ga0209437_100486 | |||
| 810 | Ga0209258_101954 | |||
| 811 | Ga0209646_1000168 | |||
| 812 | Ga0209677_100001 | |||
| 813 | Ga0209677_100321 | |||
| 814 | Ga0209148_1000004 | |||
| 815 | Ga0209233_1000001 | |||
| 816 | Ga0209455_1000022 | |||
| 817 | Ga0209455_1001078 | |||
| 818 | Ga0207426_1003169 | |||
| 819 | Ga0207426_1003328 | |||
| 820 | Ga0207697_10003823 | |||
| 821 | Ga0207655_1015461 | |||
| 822 | Ga0207655_1031119 | |||
| 823 | Ga0207680_10144677 | |||
| 824 | Ga0207647_10003003 | |||
| 825 | Ga0207647_10014486 | |||
| 826 | Ga0207647_10021739 | |||
| 827 | Ga0207705_10016193 | |||
| 828 | Ga0207705_10137037 | |||
| 829 | Ga0207707_10174844 | |||
| 830 | Ga0207657_10209689 | |||
| 831 | Ga0207659_10055425 | |||
| 832 | Ga0207690_10128839 | |||
| 833 | Ga0207709_10016230 | |||
| 834 | Ga0207709_10024063 | |||
| 835 | Ga0207691_10004165 | |||
| 836 | Ga0207639_10048159 | |||
| 837 | Ga0207674_10003834 | |||
| 838 | Ga0209813_10005047 | |||
| 839 | Ga0207428_10000930 | |||
| 840 | Ga0207428_10034774 | |||
| 841 | Ga0268266_10014428 | |||
| 842 | Ga0307517_10002661 | |||
| 843 | Ga0307515_10043521 | |||
| 844 | Ga0307512_10025890 | |||
| 845 | Ga0307513_10017644 | |||
| 846 | Ga0307513_10253479 | |||
| 847 | Ga0307408_100033573 | |||
| 848 | Ga0307408_100110295 | |||
| 849 | Ga0307508_10023476 | |||
| 850 | Ga0307514_10017872 | |||
| 851 | Ga0307514_10046967 | |||
| 852 | Ga0316575_10000020 | |||
| 853 | Ga0307516_10086151 | |||
| 854 | Ga0307516_10224380 | |||
| 855 | Ga0307405_10002212 | |||
| 856 | Ga0307405_10034996 | |||
| 857 | Ga0307405_10048808 | |||
| 858 | Ga0307405_10055697 | |||
| 859 | Ga0307405_10077513 | |||
| 860 | Ga0307405_10155550 | |||
| 861 | Ga0307405_10187543 | |||
| 862 | Ga0307413_10039323 | |||
| 863 | Ga0307413_10123346 | |||
| 864 | Ga0307410_10020465 | |||
| 865 | Ga0307410_10024749 | |||
| 866 | Ga0307410_10035774 | |||
| 867 | Ga0307410_10067611 | |||
| 868 | Ga0307410_10103357 | |||
| 869 | Ga0307406_10000217 | |||
| 870 | Ga0307406_10000795 | |||
| 871 | Ga0307406_10012650 | |||
| 872 | Ga0307406_10013566 | |||
| 873 | Ga0307407_10018907 | |||
| 874 | Ga0307407_10026812 | |||
| 875 | Ga0307407_10028089 | |||
| 876 | Ga0307407_10059330 | |||
| 877 | Ga0307407_10060796 | |||
| 878 | Ga0307407_10083323 | |||
| 879 | Ga0307412_10006909 | |||
| 880 | Ga0307412_10022049 | |||
| 881 | Ga0307412_10038443 | |||
| 882 | Ga0307412_10047139 | |||
| 883 | Ga0307412_10055007 | |||
| 884 | Ga0307412_10096688 | |||
| 885 | Ga0307412_10104466 | |||
| 886 | Ga0307409_100019274 | |||
| 887 | Ga0307409_100063104 | |||
| 888 | Ga0307409_100072330 | |||
| 889 | Ga0307409_100118713 | |||
| 890 | Ga0307409_100139219 | |||
| 891 | Ga0307409_100314688 | |||
| 892 | Ga0307416_100042927 | |||
| 893 | Ga0307416_100046082 | |||
| 894 | Ga0307416_100057842 | |||
| 895 | Ga0307416_100144085 | |||
| 896 | Ga0307416_100306265 | |||
| 897 | Ga0307414_10024948 | |||
| 898 | Ga0307414_10053480 | |||
| 899 | Ga0307411_10054680 | |||
| 900 | Ga0307411_10201850 | |||
| 901 | Ga0307510_10126949 | |||
| 902 | Ga0395899_0022477 | |||
| 903 | Ga0395899_0129821 | |||
| 904 | Ga0395900_0007672 | |||
| 905 | Ga0395900_0022895 | |||
| 906 | Ga0395900_0044495 | |||
| 907 | Ga0395900_0112045 | |||
| 908 | Ga0395900_0116189 | |||
| 909 | Ga0395900_0156815 | |||
| 910 | Ga0395898_0002083 | |||
| 911 | Ga0395898_0003163 | |||
| 912 | Ga0395898_0009247 | |||
| 913 | Ga0395898_0014659 | |||
| 914 | Ga0395898_0043966 | |||
| 915 | Ga0395898_0094782 | |||
| 916 | Ga0436364_1344107 | |||
| 917 | Ga0395901_0015426 | |||
| 918 | Ga0395901_0048733 | |||
| 919 | Ga0395901_0052609 | |||
| 920 | Ga0395901_0062250 | |||
| 921 | Ga0395901_0324873 | |||
| 922 | Ga0439436_0000502 | |||
| 923 | Ga0439466_0009647 | |||
| 924 | Ga0451793_0867888 | |||
| 925 | Ga0451853_0434821 | |||
| 926 | Ga0451853_2129295 | |||
| 927 | Ga0439433_0000454 | |||
| 928 | Ga0439442_000606 | |||
| 929 | Ga0439442_004446 | |||
| 930 | Ga0439448_0028505 | |||
| 931 | Ga0439449_0001965 | |||
| 932 | Ga0439449_0002526 | |||
| 933 | Ga0439457_007694 | |||
| 934 | Ga0439462_0003287 | |||
| 935 | Ga0450894_000266 | |||
| 936 | Ga0450898_000307 | |||
| 937 | Ga0450899_000210 | |||
| 938 | Ga0450903_000007 | |||
| 939 | Ga0450906_000632 | |||
| 940 | Ga0439458_0003549 | |||
| 941 | Ga0450908_007691 | |||
| 942 | Ga0466969_0008633 | |||
| 943 | Ga0466969_0012566 | |||
| 944 | Ga0466972_0007060 | |||
| 945 | Ga0466972_0039973 | |||
| 946 | Ga0466972_0041628 | |||
| 947 | Ga0466972_0095630 | |||
| 948 | Ga0466965_0001891 | |||
| 949 | Ga0466965_0003638 | |||
| 950 | Ga0466965_0007733 | |||
| 951 | Ga0466965_0016037 | |||
| 952 | Ga0466965_0024262 | |||
| 953 | Ga0466965_0030137 | |||
| 954 | Ga0466966_0001283 | |||
| 955 | Ga0466966_0046283 | |||
| 956 | Ga0466961_0001837 | |||
| 957 | Ga0466961_0003608 | |||
| 958 | Ga0466961_0023589 | |||
| 959 | Ga0466961_0049394 | |||
| 960 | Ga0466963_0000899 | |||
| 961 | Ga0466963_0048138 | |||
| 962 | Ga0466964_0001737 | |||
| 963 | Ga0466971_0000438 | |||
| 964 | Ga0466968_0049786 | |||
| 965 | Ga0466968_0075063 | |||
| 966 | Ga0466970_0000176 | |||
| 967 | Ga0466970_0002192 | |||
| 968 | Ga0466970_0008421 | |||
| 969 | Ga0466970_0024826 | |||
| 970 | Ga0466970_0027328 | |||
| 971 | Ga0466957_0007164 | |||
| 972 | Ga0466957_0017272 | |||
| 973 | Ga0466960_0000476 | |||
| 974 | Ga0466960_0009070 | |||
| 975 | Ga0466960_0035602 | |||
| 976 | Ga0466959_0000885 | |||
| 977 | Ga0466959_0022541 | |||
| 978 | Ga0466959_0122295 | |||
| 979 | Ga0466959_0133622 | |||
| 980 | Ga0466958_0002552 | |||
| 981 | Ga0466958_0038815 | |||
| 982 | Ga0466958_0072716 | |||
| 983 | Ga0466967_0001934 | |||
| 984 | Ga0466967_0160728 | |||
| 985 | Ga0466967_0172522 | |||
| 986 | Ga0495627_000401 | |||
| 987 | Ga0495603_0011409 | |||
| 988 | Ga0495603_0019356 | |||
| 989 | Ga0495603_0049457 | |||
| 990 | Ga0495629_0003337 | |||
| 991 | Ga0495629_0005059 | |||
| 992 | Ga0495638_0036113 | |||
| 993 | Ga0495651_0021660 | |||
| 994 | Ga0495582_0107629 | |||
| 995 | Ga0495664_0015086 | |||
| 996 | Ga0495584_0050492 | |||
| 997 | Ga0495594_0000183 | |||
| 998 | Ga0495594_0008626 | |||
| 999 | Ga0495618_0155023 | |||
| 1000 | Ga0495628_0006731 | |||
| 1001 | Ga0495630_0115200 | |||
| 1002 | Ga0495632_0022270 | |||
| 1003 | Ga0495643_0001934 | |||
| 1004 | Ga0495652_0004275 | |||
| 1005 | Ga0495665_0034504 | |||
| 1006 | Ga0495640_0074470 | |||
| 1007 | Ga0495586_0061367 | |||
| 1008 | Ga0495586_0061915 | |||
| 1009 | Ga0495587_0012474 | |||
| 1010 | Ga0495645_0078862 | |||
| 1011 | Ga0495622_0029690 | |||
| 1012 | Ga0495667_0033339 | |||
| 1013 | Ga0495611_0030131 | |||
| 1014 | Ga0495625_0038469 | |||
| 1015 | Ga0495588_0024620 | |||
| 1016 | Ga0495657_0014574 | |||
| 1017 | Ga0495613_0000823 | |||
| 1018 | Ga0495624_0128817 | |||
| 1019 | Ga0495671_0061764 | |||
| 1020 | Ga0495649_0085434 | |||
| 1021 | Ga0495660_0016149 | |||
| 1022 | Ga0495581_0009365 | |||
| 1023 | Ga0495581_0018154 | |||
| 1024 | Ga0495604_0038259 | |||
| 1025 | Ga0495676_0000425 | |||
| 1026 | Ga0495676_0061686 | |||
| 1027 | Ga0495676_0095245 | |||
| 1028 | Ga0495683_0023477 | |||
| 1029 | Ga0495683_0061214 | |||
| 1030 | Ga0495675_0060955 | |||
| 1031 | Ga0495685_000276 | |||
| 1032 | Ga0495685_011251 | |||
| 1033 | Ga0495681_0001135 | |||
| 1034 | Ga0495681_0046436 | |||
| 1035 | Ga0495614_0006629 | |||
| 1036 | Ga0496101_0028213 | |||
| 1037 | Ga0496101_0054290 | |||
| 1038 | Ga0496102_0002409 | |||
| 1039 | Ga0496102_0050650 | |||
| 1040 | Ga0496102_0060141 | |||
| 1041 | Ga0496103_0003299 | |||
| 1042 | Ga0496103_0031142 | |||
| 1043 | Ga0496103_0063610 | |||
| 1044 | Ga0496104_0039361 | |||
| 1045 | Ga0496104_0093039 | |||
| 1046 | Ga0496105_0008276 | |||
| 1047 | Ga0496105_0042831 | |||
| 1048 | Ga0496105_0046971 | |||
| 1049 | Ga0496105_0066479 | |||
| 1050 | Ga0496106_0053327 | |||
| 1051 | Ga0496109_0128851 | |||
| 1052 | Ga0496109_0347243 | |||
| 1053 | Ga0496110_0040573 | |||
| 1054 | Ga0496111_0136553 | |||
| 1055 | Ga0496111_0196818 | |||
| 1056 | Ga0496112_0154763 | |||
| 1057 | Ga0496113_0044504 | |||
| 1058 | Ga0496113_0313642 | |||
| 1059 | Ga0496114_0014522 | |||
| 1060 | Ga0496114_0018358 | |||
| 1061 | Ga0496114_0036186 | |||
| 1062 | Ga0496114_0045186 | |||
| 1063 | Ga0496114_0045508 | |||
| 1064 | Ga0496114_0056148 | |||
| 1065 | Ga0496115_0008804 | |||
| 1066 | Ga0496115_0032784 | |||
| 1067 | Ga0496115_0044181 | |||
| 1068 | Ga0496115_0077461 | |||
| 1069 | Ga0496115_0102969 | |||
| 1070 | Ga0496116_0046538 | |||
| 1071 | Ga0496117_0000053 | |||
| 1072 | Ga0496117_0001098 | |||
| 1073 | Ga0496117_0002166 | |||
| 1074 | Ga0496117_0012242 | |||
| 1075 | Ga0496117_0021611 | |||
| 1076 | Ga0496117_0031847 | |||
| 1077 | Ga0496118_0004656 | |||
| 1078 | Ga0496118_0012368 | |||
| 1079 | Ga0496118_0024300 | |||
| 1080 | Ga0496118_0025277 | |||
| 1081 | Ga0496118_0027693 | |||
| 1082 | Ga0496118_0162412 | |||
| 1083 | Ga0496119_0001888 | |||
| 1084 | Ga0496119_0002138 | |||
| 1085 | Ga0496119_0005568 | |||
| 1086 | Ga0496119_0006144 | |||
| 1087 | Ga0496119_0102418 | |||
| 1088 | Ga0496119_0133690 | |||
| 1089 | Ga0496120_0004461 | |||
| 1090 | Ga0496120_0011223 | |||
| 1091 | Ga0496120_0035721 | |||
| 1092 | Ga0496121_0091924 | |||
| 1093 | Ga0496122_0000031 | |||
| 1094 | Ga0496122_0000194 | |||
| 1095 | Ga0496122_0001160 | |||
| 1096 | Ga0496122_0002890 | |||
| 1097 | Ga0496122_0004113 | |||
| 1098 | Ga0496122_0083405 | |||
| 1099 | Ga0496123_0000013 | |||
| 1100 | Ga0496123_0000350 | |||
| 1101 | Ga0496123_0000405 | |||
| 1102 | Ga0496123_0019951 | |||
| 1103 | Ga0496124_0008009 | |||
| 1104 | Ga0496124_0008422 | |||
| 1105 | Ga0496124_0013529 | |||
| 1106 | Ga0496124_0039796 | |||
| 1107 | Ga0496124_0124997 | |||
| 1108 | Ga0496125_0000077 | |||
| 1109 | Ga0496125_0000214 | |||
| 1110 | Ga0496125_0001794 | |||
| 1111 | Ga0496125_0002783 | |||
| 1112 | Ga0496125_0018219 | |||
| 1113 | Ga0496125_0036927 | |||
| 1114 | Ga0496125_0096634 | |||
| 1115 | Ga0496125_0139859 | |||
| 1116 | Ga0496126_0002423 | |||
| 1117 | Ga0496126_0008871 | |||
| 1118 | Ga0496126_0034141 | |||
| 1119 | Ga0496126_0078199 | |||
| 1120 | Ga0496126_0216034 | |||
| 1121 | Ga0501325_001480 | |||
| 1122 | Ga0501031_0002094 | |||
| 1123 | Ga0501031_0019702 | |||
| 1124 | Ga0501032_0005652 | |||
| 1125 | Ga0501032_0006541 | |||
| 1126 | Ga0501032_0031378 | |||
| 1127 | Ga0501032_0073159 | |||
| 1128 | Ga0501032_0076907 | |||
| 1129 | Ga0501033_0000628 | |||
| 1130 | Ga0501033_0009706 | |||
| 1131 | Ga0501033_0033212 | |||
| 1132 | Ga0501033_0072022 | |||
| 1133 | Ga0501034_0000465 | |||
| 1134 | Ga0501034_0002014 | |||
| 1135 | Ga0501034_0007513 | |||
| 1136 | Ga0501034_0009822 | |||
| 1137 | Ga0501034_0017233 | |||
| 1138 | Ga0501034_0019363 | |||
| 1139 | Ga0501034_0024319 | |||
| 1140 | Ga0501034_0037157 | |||
| 1141 | Ga0501034_0039146 | |||
| 1142 | Ga0501034_0041764 | |||
| 1143 | Ga0501034_0046963 | |||
| 1144 | Ga0501034_0056611 | |||
| 1145 | Ga0501034_0084228 | |||
| 1146 | Ga0501034_0128570 | |||
| 1147 | Ga0501036_0001706 | |||
| 1148 | Ga0501036_0004285 | |||
| 1149 | Ga0501036_0008345 | |||
| 1150 | Ga0501036_0012325 | |||
| 1151 | Ga0501036_0014480 | |||
| 1152 | Ga0501036_0027975 | |||
| 1153 | Ga0501036_0040504 | |||
| 1154 | Ga0501036_0140859 | |||
| 1155 | Ga0501037_0000863 | |||
| 1156 | Ga0501037_0002320 | |||
| 1157 | Ga0501037_0002437 | |||
| 1158 | Ga0501037_0019819 | |||
| 1159 | Ga0501037_0105394 | |||
| 1160 | Ga0501038_0001295 | |||
| 1161 | Ga0501038_0006429 | |||
| 1162 | Ga0501038_0011829 | |||
| 1163 | Ga0501038_0014126 | |||
| 1164 | Ga0501038_0014451 | |||
| 1165 | Ga0501038_0022833 | |||
| 1166 | Ga0501038_0055449 | |||
| 1167 | Ga0501038_0113501 | |||
| 1168 | Ga0501039_0006630 | |||
| 1169 | Ga0501039_0008476 | |||
| 1170 | Ga0501040_0001421 | |||
| 1171 | Ga0501040_0005559 | |||
| 1172 | Ga0501041_0001688 | |||
| 1173 | Ga0501041_0002741 | |||
| 1174 | Ga0501042_0008388 | |||
| 1175 | Ga0501043_0001870 | |||
| 1176 | Ga0501043_0005475 | |||
| 1177 | Ga0501043_0025489 | |||
| 1178 | Ga0501043_0057669 | |||
| 1179 | Ga0501043_0065045 | |||
| 1180 | Ga0501043_0103787 | |||
| 1181 | Ga0501043_0108935 | |||
| 1182 | Ga0501043_0163205 | |||
| 1183 | Ga0501046_0004159 | |||
| 1184 | Ga0501046_0004762 | |||
| 1185 | Ga0501046_0005900 | |||
| 1186 | Ga0501046_0025790 | |||
| 1187 | Ga0501046_0032451 | |||
| 1188 | Ga0501047_0004256 | |||
| 1189 | Ga0501047_0006266 | |||
| 1190 | Ga0501047_0015383 | |||
| 1191 | Ga0501047_0033715 | |||
| 1192 | Ga0501047_0089555 | |||
| 1193 | Ga0501047_0111842 | |||
| 1194 | Ga0501047_0176731 | |||
| 1195 | Ga0501048_0003589 | |||
| 1196 | Ga0501048_0006426 | |||
| 1197 | Ga0501067_0004179 | |||
| 1198 | Ga0501067_0089301 | |||
| 1199 | Ga0501068_0000763 | |||
| 1200 | Ga0501068_0010793 | |||
| 1201 | Ga0501070_0000133 | |||
| 1202 | Ga0501070_0007031 | |||
| 1203 | Ga0501070_0007947 | |||
| 1204 | Ga0501070_0011636 | |||
| 1205 | Ga0501070_0021680 | |||
| 1206 | Ga0501070_0027514 | |||
| 1207 | Ga0501070_0177560 | |||
| 1208 | Ga0501071_0000105 | |||
| 1209 | Ga0501071_0049598 | |||
| 1210 | Ga0501072_0002067 | |||
| 1211 | Ga0501073_0019632 | |||
| 1212 | Ga0501073_0025139 | |||
| 1213 | Ga0501074_0004504 | |||
| 1214 | Ga0501074_0005437 | |||
| 1215 | Ga0501075_0000816 | |||
| 1216 | Ga0501076_0002548 | |||
| 1217 | Ga0501077_0009552 | |||
| 1218 | Ga0501079_0009597 | |||
| 1219 | Ga0501079_0009875 | |||
| 1220 | Ga0501080_0012890 | |||
| 1221 | Ga0501080_0161771 | |||
| 1222 | Ga0501083_0003600 | |||
| 1223 | Ga0501083_0086764 | |||
| 1224 | Ga0501035_0003528 | |||
| 1225 | Ga0501035_0016985 | |||
| 1226 | Ga0501035_0020135 | |||
| 1227 | Ga0501035_0035284 | |||
| 1228 | Ga0501035_0040085 | |||
| 1229 | Ga0501044_0005774 | |||
| 1230 | Ga0501044_0011707 | |||
| 1231 | Ga0501044_0013333 | |||
| 1232 | Ga0501044_0032083 | |||
| 1233 | Ga0501044_0060373 | |||
| 1234 | Ga0501044_0061882 | |||
| 1235 | Ga0501044_0111700 | |||
| 1236 | Ga0501044_0131305 | |||
| 1237 | Ga0501044_0386214 | |||
| 1238 | Ga0501045_0004876 | |||
| 1239 | Ga0501045_0007703 | |||
| 1240 | nmdc:mga03n38_11297_c1 | |||
| 1241 | nmdc:mga00v17_10925_c1 | |||
| 1242 | nmdc:mga00v17_129928_c1 | |||
| 1243 | nmdc:mga00v17_23769_c1 | |||
| 1244 | nmdc:mga00v17_23924_c1 | |||
| 1245 | nmdc:mga00v17_9487_c1 | |||
| 1246 | nmdc:mga0yw44_31744_c1 | |||
| 1247 | nmdc:mga06z11_886_c1 | |||
| 1248 | nmdc:mga04h51_3550_c1 | |||
| 1249 | nmdc:mga07m45_15975_c1 | |||
| 1250 | Ga0500635_0000023 | |||
| 1251 | Ga0495619_0024672 | |||
| 1252 | Ga0500652_000684 | |||
| 1253 | Ga0500559_0000183 | |||
| 1254 | Ga0500573_0034169 | |||
| 1255 | Ga0500579_058818 | |||
| 1256 | Ga0500600_0119590 | |||
| 1257 | Ga0500604_0033739 | |||
| 1258 | Ga0500616_0000241 | |||
| 1259 | Ga0500616_0002314 | |||
| 1260 | Ga0500616_0009882 | |||
| 1261 | Ga0501084_0003176 | |||
| 1262 | Ga0501084_0004449 | |||
| 1263 | Ga0501084_0066321 | |||
| 1264 | Ga0587090_000021 | |||
| 1265 | Ga0587072_001667 | |||
| 1266 | Ga0501082_0073560 | |||
| 1267 | Ga0501082_0102905 | |||
| 1268 | Ga0466962_0000735 | |||
| 1269 | Ga0530510_0002178 | |||
| 1270 | 2537901164 | |||
| 1271 | 2554258278 | |||
| 1272 | 2585299010 | |||
| 1273 | 2585310024 | |||
| 1274 | 2585315691 | |||
| 1275 | 2588108933 | |||
| 1276 | 2616900439 | |||
| 1277 | 2643733892 | |||
| 1278 | 2643753283 | |||
| 1279 | 2643765474 | |||
| 1280 | 2643768048 | |||
| 1281 | 2643785516 | |||
| 1282 | 2643848615 | |||
| 1283 | 2643875633 | |||
| 1284 | 2643885694 | |||
| 1285 | 2643898256 | |||
| 1286 | 2643944370 | |||
| 1287 | 2643996113 | |||
| 1288 | 2644082077 | |||
| 1289 | 2644095698 | |||
| 1290 | 2644111434 | |||
| 1291 | 2644170473 | |||
| 1292 | 2644183014 | |||
| 1293 | 2644198717 | |||
| 1294 | 2644264497 | |||
| 1295 | 2644382688 | |||
| 1296 | 2644385710 | |||
| 1297 | 2644409401 | |||
| 1298 | 2644431268 | |||
| 1299 | 2644436745 | |||
| 1300 | 2644443971 | |||
| 1301 | 2644462455 | |||
| 1302 | 2644503255 | |||
| 1303 | 2644525567 | |||
| 1304 | 2644625457 | |||
| 1305 | 2644664940 | |||
| 1306 | 2644669645 | |||
| 1307 | 2644679930 | |||
| 1308 | 2691514386 | |||
| 1309 | 2723641725 | |||
| 1310 | 2730229404 | |||
| 1311 | 2747952419 | |||
| 1312 | 2758225853 | |||
| 1313 | 2768643292 | |||
| 1314 | 2774380158 | |||
| 1315 | 2774399277 | |||
| 1316 | 2775655286 | |||
| 1317 | 2784588220 | |||
| 1318 | 2785343839 | |||
| 1319 | 2785369023 | |||
| 1320 | 2786670172 | |||
| 1321 | 2793981253 | |||
| 1322 | 2808630977 | |||
| 1323 | 2808827470 | |||
| 1324 | 2808841643 | |||
| 1325 | 2808852836 | |||
| 1326 | 2808873397 | |||
| 1327 | 2808878715 | |||
| 1328 | 2808885831 | |||
| 1329 | 2808891705 | |||
| 1330 | 2808896835 | |||
| 1331 | 2808901717 | |||
| 1332 | 2808920178 | |||
| 1333 | 2809227618 | |||
| 1334 | 2809231832 | |||
| 1335 | 2810364019 | |||
| 1336 | 2811848595 | |||
| 1337 | 2812320745 | |||
| 1338 | 2812323427 | |||
| 1339 | 2812358609 | |||
| 1340 | 2812364726 | |||
| 1341 | 2812480933 | |||
| 1342 | 2819693327 | |||
| 1343 | 2821270220 | |||
| 1344 | 2833711178 | |||
| 1345 | 2835189088 | |||
| 1346 | 2839986043 | |||
| 1347 | 2844842079 | |||
| 1348 | 2848552724 | |||
| 1349 | 2852634382 | |||
| 1350 | 2852642335 | |||
| 1351 | 2852647122 | |||
| 1352 | 2852665046 | |||
| 1353 | 2852680094 | |||
| 1354 | 2857480713 | |||
| 1355 | 2857634202 | |||
| 1356 | 2857713174 | |||
| 1357 | 2857720111 | |||
| 1358 | 2857723568 | |||
| 1359 | 2857730181 | |||
| 1360 | 2862184580 | |||
| 1361 | 2862287746 | |||
| 1362 | 2862390216 | |||
| 1363 | 2862579636 | |||
| 1364 | 2862710288 | |||
| 1365 | 2862994996 | |||
| 1366 | 2863405135 | |||
| 1367 | 2867350037 | |||
| 1368 | 2867371519 | |||
| 1369 | 2867429128 | |||
| 1370 | 2867477313 | |||
| 1371 | 2870630566 | |||
| 1372 | 2870802778 | |||
| 1373 | 2870804852 | |||
| 1374 | 2873156177 | |||
| 1375 | 2875394141 | |||
| 1376 | 2877681533 | |||
| 1377 | 2884765066 | |||
| 1378 | 2884996065 | |||
| 1379 | 2887447646 | |||
| 1380 | 2895661691 | |||
| 1381 | 2904432922 | |||
| 1382 | 2904511777 | |||
| 1383 | 2905927359 | |||
| 1384 | 2906803089 | |||
| 1385 | 2908680703 | |||
| 1386 | 2909074504 | |||
| 1387 | 2912720483 | |||
| 1388 | 2912724681 | |||
| 1389 | 2912760267 | |||
| 1390 | 2918504141 | |||
| 1391 | 2919041484 | |||
| 1392 | 2919057721 | |||
| 1393 | 2919071746 | |||
| 1394 | 2919391198 | |||
| 1395 | 2919396410 | |||
| 1396 | 2919446528 | |||
| 1397 | 2919449672 | |||
| 1398 | 2919473365 | |||
| 1399 | 2919524122 | |||
| 1400 | 2920882044 | |||
| 1401 | 2928092058 | |||
| 1402 | 2928123404 | |||
| 1403 | 2928155708 | |||
| 1404 | 2932432865 | |||
| 1405 | 2935396281 | |||
| 1406 | 2935411134 | |||
| 1407 | 2935893347 | |||
| 1408 | 2939598439 | |||
| 1409 | 2945918505 | |||
| 1410 | 2945921212 | |||
| 1411 | 2945942627 | |||
| 1412 | 2945959613 | |||
| 1413 | 2945971575 | |||
| 1414 | 2946005061 | |||
| 1415 | 2946038545 | |||
| 1416 | 2946043952 | |||
| 1417 | 2946050466 | |||
| 1418 | 2946062363 | |||
| 1419 | 2946067268 | |||
| 1420 | 2946075542 | |||
| 1421 | 2946081175 | |||
| 1422 | 2947229976 | |||
| 1423 | 2953999818 | |||
| 1424 | 2954003183 | |||
| 1425 | 2954386662 | |||
| 1426 | 2954676509 | |||
| 1427 | 2954687658 | |||
| 1428 | 2954697474 | |||
| 1429 | 2954704760 | |||
| 1430 | 2954716636 | |||
| 1431 | 2954726584 | |||
| 1432 | 2954735212 | |||
| 1433 | 2954745506 | |||
| 1434 | 2954754082 | |||
| 1435 | 2954764480 | |||
| 1436 | 2964327239 | |||
| 1437 | 2966602940 | |||
| 1438 | 2974297371 | |||
| 1439 | 2974306536 | |||
| 1440 | 2974326391 | |||
| 1441 | 2977231626 | |||
| 1442 | 2977236981 | |||
| 1443 | 2977266849 | |||
| 1444 | 2984545226 | |||
| 1445 | 2984581176 | |||
| 1446 | 2990046701 | |||
| 1447 | 2990062813 | |||
| 1448 | 2990088689 | |||
| 1449 | 2995727803 | |||
| 1450 | 2997456845 | |||
| 1451 | 2997601641 | |||
| 1452 | 3006321616 | |||
| 1453 | 3006394131 | |||
| 1454 | 3006496511 | |||
| 1455 | 8002813953 | |||
| 1456 | 8004027678 | |||
| 1457 | 8004185369 | |||
| 1458 | 8004213899 | |||
| 1459 | 8008559937 | |||
| 1460 | 8008579231 | |||
| 1461 | 8016257337 | |||
| 1462 | 8023631850 | |||
| 1463 | 8025483383 | |||
| 1464 | 8025526445 | |||
| 1465 | 8025533736 | |||
| 1466 | 8033685695 | |||
| 1467 | 8045831799 | |||
| 1468 | 8046353171 | |||
| 1469 | 8047898490 | |||
| 1470 | 8048134914 | |||
| 1471 | 8048360420 | |||
| 1472 | 8048375452 | |||
| 1473 | 8048382753 | |||
| 1474 | 8048411129 | |||
| 1475 | 8054107887 | |||
| 1476 | 8054161027 | |||
| 1477 | 8055036238 | |||
| 1478 | 8055038290 | |||
| 1479 | 8056673238 | |||
| 1480 | 8056830409 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3swg-assembly1.cif.gz_A | aquifex aeolicus mura in complex with udp-n-acetylmuramic acid and covalent adduct of pep with cys124 | 0.9318 | 7 | 439 |
| 1a2n-assembly1.cif.gz_A | structure of the c115a mutant of mura complexed with the fluorinated analog of the reaction tetrahedral intermediate | 0.9307 | 7 | 442 |
| 3zh4-assembly1.cif.gz_A | crystal structure of s. pneumoniae hungary 19a mura1 in complex with citrate | 0.93 | 7 | 442 |
| 3kr6-assembly1.cif.gz_A | mura dead-end complex with fosfomycin | 0.927 | 7 | 439 |
| 5u4h-assembly1.cif.gz_B | 1.05 angstrom resolution crystal structure of udp-n-acetylglucosamine 1-carboxyvinyltransferase from acinetobacter baumannii in covalently bound complex with (2r)-2-(phosphonooxy)propanoic acid. | 0.9257 | 5 | 439 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A749_226_417_3.40.50.1370 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Aspartate/ornithine carbamoyltransferase | 0.9339 | 235 | 436 | 3.40.50.1370 |
| af_Q2FWD4_231_413_3.65.10.10 | Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain | 0.9337 | 240 | 437 | 3.65.10.10 |
| 3zh4A01 | Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain | 0.93 | 240 | 442 | 3.65.10.10 |
| 5bq2A01 | Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain | 0.9287 | 240 | 439 | 3.65.10.10 |
| af_P9WJM1_237_415_3.65.10.10 | Alpha Beta;Alpha-beta prism;UDP-n-acetylglucosamine1-carboxyvinyl-transferase; Chain;Enolpyruvate transferase domain | 0.926 | 246 | 437 | 3.65.10.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A849HE14-F1-model_v4 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7) (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase) (EPT) | 0.98 | 5 | 441 |
GO:0005737
GO:0008360 GO:0008760 GO:0009252 GO:0019277 GO:0051301 GO:0071555 |
| AF-A0A7V9LU61-F1-model_v4 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7) (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase) (EPT) | 0.9792 | 5 | 441 |
GO:0005737
GO:0008360 GO:0008760 GO:0009252 GO:0019277 GO:0051301 GO:0071555 |
| AF-A0A6B3I9T0-F1-model_v4 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase | 0.9787 | 22 | 112 |
GO:0016765
|
| AF-A0A132MXW6-F1-model_v4 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7) (Enoylpyruvate transferase) (UDP-N-acetylglucosamine enolpyruvyl transferase) (EPT) | 0.9784 | 4 | 441 |
GO:0005737
GO:0008360 GO:0008760 GO:0009252 GO:0019277 GO:0051301 GO:0071555 |
| AF-V6JVD7-F1-model_v4 | deleted | 0.9779 | 9 | 442 |
|