F478420

General Info

Members Datasets Scaffolds Average Seq Length
738 306 738 167

Family's Representative Sequence

Representative Sequence 3300050510|nmdc:mga06r32_698988_c1|nmdc:mga06r32_698988_c1_192_785
Length 197
Sequence VLDGARAAGSLRGFRGPFFTLHREAHLMAKSPKIAPCLWFDDQAEEAARFYTGIFRKAKILTITRYGAAGFEVHHRPAGSVMTVEFELDGQRFTALNGGPEFKFNEAISFQVYCESQEEIDYYWSKLGEGGDPSAQQCGWLKDRYGVSWQVVPQGMEELFKDENSPAAQRTMEAMLKMKKLDLAELKRAHDGELANV

Samples

Sample ID Description Type Environment
1 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
2 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
51 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
52 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
53 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
54 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
55 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
62 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
63 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
70 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
76 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
77 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
104 3300012478 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 Metagenome Rhizosphere
105 3300012487 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 Metagenome Rhizosphere
106 3300012510 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 Metagenome Rhizosphere
107 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
108 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
109 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
110 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
111 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
112 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
113 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
114 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
115 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
116 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
119 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
122 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
123 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
127 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
128 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
129 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
192 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
193 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
194 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
195 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
196 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
197 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
198 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
199 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
200 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
201 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
202 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
203 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
204 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
205 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
206 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
207 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
208 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
209 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
210 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
211 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
212 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
213 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
214 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
215 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
216 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
217 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
218 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
219 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
220 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
221 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
224 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
225 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
226 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
227 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
228 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
229 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
230 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
231 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
232 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
233 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
234 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
235 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
236 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
237 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
238 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
239 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
240 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
243 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
244 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
245 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
246 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
247 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
248 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
249 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
250 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
251 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
252 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
253 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
254 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
255 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
256 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
257 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
258 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
259 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
262 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
263 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
264 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
265 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
270 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
271 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
272 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
273 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
274 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
277 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
278 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
279 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
280 3300049659 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control Metagenome Rhizosphere
281 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
282 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
283 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
289 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
293 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
294 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
295 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
296 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
297 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
298 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
299 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
300 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
301 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
302 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
305 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
306 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.92
Metatranscriptomes 1.08
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.3
Nodule 0
Rhizoplane 3.79
Rhizosphere 92.55
Stem 0
Stem Tuber 0
Unclassified 1.36

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1000011 3300002773 Bacteria 130992
2 JGI25150J39212_1000192 3300002774 Bacteria 34489
3 JGI25153J46596_10008784 3300003215 Bacteria 4782
4 rootH2_10120259 3300003320 Bacteria 3099
5 rootL2_10058686 3300003322 Bacteria 6147
6 Ga0055524_1000795 3300003775 Bacteria 20983
7 Ga0058862_12052405 3300004803 Bacteria 700
8 Ga0065715_10119334 3300005293 Bacteria 2289
9 Ga0065715_10193406 3300005293 Bacteria 1402
10 Ga0065715_10940291 3300005293 Bacteria 562
11 Ga0065707_10093493 3300005295 Bacteria 3622
12 Ga0070658_10737086 3300005327 Bacteria 856
13 Ga0070658_10756199 3300005327 Bacteria 844
14 Ga0070676_10182569 3300005328 Bacteria 1365
15 Ga0070676_10304891 3300005328 Bacteria 1081
16 Ga0070676_10980852 3300005328 Bacteria 633
17 Ga0070683_100033350 3300005329 Bacteria 4695
18 Ga0070683_100065908 3300005329 Bacteria 3373
19 Ga0070683_100110269 3300005329 Bacteria 2596
20 Ga0070670_100031186 3300005331 Bacteria 4591
21 Ga0070670_100042393 3300005331 Bacteria 3912
22 Ga0070670_100082100 3300005331 Bacteria 2770
23 Ga0070677_10001919 3300005333 Bacteria 6581
24 Ga0068869_100016143 3300005334 Bacteria 5029
25 Ga0068869_100119397 3300005334 Bacteria 2015
26 Ga0068869_100248006 3300005334 Bacteria 1421
27 Ga0068869_100282571 3300005334 Bacteria 1335
28 Ga0068869_100536813 3300005334 Bacteria 981
29 Ga0068869_100714118 3300005334 Bacteria 856
30 Ga0070680_100120994 3300005336 Bacteria 2185
31 Ga0070680_100415512 3300005336 Bacteria 1147
32 Ga0070682_100009256 3300005337 Bacteria 5574
33 Ga0070660_101457688 3300005339 Bacteria 582
34 Ga0070689_100119399 3300005340 Bacteria 2105
35 Ga0070689_100230900 3300005340 Bacteria 1521
36 Ga0070691_10360555 3300005341 Bacteria 810
37 Ga0070661_100031934 3300005344 Bacteria 3809
38 Ga0070661_100167693 3300005344 Bacteria 1666
39 Ga0070661_100298197 3300005344 Bacteria 1254
40 Ga0070692_10691517 3300005345 Bacteria 685
41 Ga0070692_10807599 3300005345 Bacteria 641
42 Ga0070668_100087591 3300005347 Bacteria 2450
43 Ga0070668_100358947 3300005347 Bacteria 1235
44 Ga0070669_100317159 3300005353 Bacteria 1258
45 Ga0070669_100729996 3300005353 Bacteria 838
46 Ga0070675_100002529 3300005354 Bacteria 13684
47 Ga0070675_100014873 3300005354 Bacteria 6143
48 Ga0070675_100403557 3300005354 Bacteria 1220
49 Ga0070675_100527867 3300005354 Bacteria 1066
50 Ga0070675_100754570 3300005354 Bacteria 888
51 Ga0070675_100790667 3300005354 Bacteria 867
52 Ga0070675_101307027 3300005354 Bacteria 668
53 Ga0070671_100030633 3300005355 Bacteria 4440
54 Ga0070671_100152731 3300005355 Bacteria 1950
55 Ga0070671_100281642 3300005355 Bacteria 1414
56 Ga0070674_100018210 3300005356 Bacteria 4436
57 Ga0070674_100083924 3300005356 Bacteria 2283
58 Ga0070674_100298360 3300005356 Bacteria 1284
59 Ga0070674_100473995 3300005356 Bacteria 1038
60 Ga0070674_100703632 3300005356 Bacteria 864
61 Ga0070674_100766179 3300005356 Bacteria 830
62 Ga0070673_100015314 3300005364 Bacteria 5381
63 Ga0070673_100048831 3300005364 Bacteria 3301
64 Ga0070673_100458440 3300005364 Bacteria 1148
65 Ga0070688_100207811 3300005365 Bacteria 1373
66 Ga0070688_100729718 3300005365 Bacteria 770
67 Ga0070659_100879991 3300005366 Bacteria 782
68 Ga0070667_100035679 3300005367 Bacteria 4167
69 Ga0070667_100116943 3300005367 Bacteria 2316
70 Ga0070714_100037634 3300005435 Bacteria 4066
71 Ga0070713_100002093 3300005436 Bacteria 12895
72 Ga0070701_10014341 3300005438 Bacteria 3630
73 Ga0070701_10185750 3300005438 Unclassified 1220
74 Ga0070701_10406858 3300005438 Bacteria 863
75 Ga0070711_100030774 3300005439 Bacteria 3557
76 Ga0070711_100161473 3300005439 Bacteria 1699
77 Ga0070711_100421622 3300005439 Bacteria 1087
78 Ga0070705_100057663 3300005440 Bacteria 2292
79 Ga0070705_100116584 3300005440 Bacteria 1717
80 Ga0070700_100073767 3300005441 Bacteria 2185
81 Ga0070700_101167386 3300005441 Bacteria 641
82 Ga0070694_100013925 3300005444 Bacteria 5030
83 Ga0070708_100039835 3300005445 Bacteria 4113
84 Ga0070663_100336736 3300005455 Bacteria 1218
85 Ga0070663_101475071 3300005455 Bacteria 604
86 Ga0070678_100030884 3300005456 Bacteria 3688
87 Ga0070678_100188766 3300005456 Bacteria 1693
88 Ga0070678_101173206 3300005456 Bacteria 711
89 Ga0070681_10167376 3300005458 Bacteria 2120
90 Ga0068867_100018494 3300005459 Bacteria 4953
91 Ga0068867_100200125 3300005459 Bacteria 1599
92 Ga0068867_100202031 3300005459 Bacteria 1591
93 Ga0068867_100331777 3300005459 Bacteria 1264
94 Ga0068867_100442480 3300005459 Bacteria 1105
95 Ga0068867_100508773 3300005459 Bacteria 1036
96 Ga0068867_100629845 3300005459 Bacteria 939
97 Ga0070685_10010519 3300005466 Bacteria 4810
98 Ga0070685_10103790 3300005466 Bacteria 1740
99 Ga0070685_10238155 3300005466 Bacteria 1200
100 Ga0070685_10426688 3300005466 Bacteria 924
101 Ga0070707_100219459 3300005468 Bacteria 1852
102 Ga0070698_100031386 3300005471 Bacteria 5509
103 Ga0070698_100884261 3300005471 Bacteria 839
104 Ga0070699_100067735 3300005518 Bacteria 3100
105 Ga0070699_100164156 3300005518 Archaea 1967
106 Ga0070699_100316473 3300005518 Bacteria 1402
107 Ga0070699_101101123 3300005518 Bacteria 729
108 Ga0070699_101301841 3300005518 Bacteria 667
109 Ga0070679_100094887 3300005530 Bacteria 2971
110 Ga0070679_100323167 3300005530 Bacteria 1492
111 Ga0070684_100080666 3300005535 Bacteria 2878
112 Ga0070684_100183447 3300005535 Bacteria 1903
113 Ga0070684_100333151 3300005535 Bacteria 1395
114 Ga0070684_100428813 3300005535 Bacteria 1221
115 Ga0070697_100171295 3300005536 Bacteria 1838
116 Ga0070697_100415699 3300005536 Bacteria 1168
117 Ga0068853_100194027 3300005539 Bacteria 1846
118 Ga0068853_100962404 3300005539 Bacteria 821
119 Ga0068853_101616134 3300005539 Bacteria 628
120 Ga0070672_100003495 3300005543 Bacteria 10182
121 Ga0070672_100005464 3300005543 Bacteria 8426
122 Ga0070672_100032723 3300005543 Bacteria 3928
123 Ga0070686_100014728 3300005544 Bacteria 4513
124 Ga0070686_100786308 3300005544 Bacteria 766
125 Ga0070695_100491387 3300005545 Bacteria 947
126 Ga0070696_100094040 3300005546 Bacteria 2138
127 Ga0070696_100474032 3300005546 Bacteria 991
128 Ga0070696_100848020 3300005546 Bacteria 755
129 Ga0070665_100013512 3300005548 Bacteria 8213
130 Ga0070665_100418224 3300005548 Bacteria 1349
131 Ga0070665_101557080 3300005548 Bacteria 669
132 Ga0070704_100022238 3300005549 Bacteria 4124
133 Ga0070704_100988525 3300005549 Bacteria 761
134 Ga0068855_100127119 3300005563 Bacteria 2913
135 Ga0068855_100480758 3300005563 Bacteria 1352
136 Ga0068855_100636349 3300005563 Bacteria 1147
137 Ga0070664_100190205 3300005564 Bacteria 1828
138 Ga0070664_100215796 3300005564 Bacteria 1715
139 Ga0070664_100282472 3300005564 Bacteria 1497
140 Ga0070664_100410022 3300005564 Bacteria 1240
141 Ga0070664_101010890 3300005564 Bacteria 782
142 Ga0068857_100422668 3300005577 Bacteria 1243
143 Ga0068857_100557042 3300005577 Bacteria 1080
144 Ga0068854_100056259 3300005578 Bacteria 2834
145 Ga0068854_100082366 3300005578 Bacteria 2378
146 Ga0068854_100727676 3300005578 Bacteria 859
147 Ga0068854_101024594 3300005578 Bacteria 732
148 Ga0068856_100232508 3300005614 Bacteria 1859
149 Ga0068856_100378288 3300005614 Bacteria 1435
150 Ga0070702_100075076 3300005615 Bacteria 2008
151 Ga0070702_100653983 3300005615 Bacteria 795
152 Ga0068852_100000396 3300005616 Bacteria 29216
153 Ga0068852_100347911 3300005616 Bacteria 1446
154 Ga0068852_100807824 3300005616 Bacteria 952
155 Ga0068852_101869087 3300005616 Bacteria 623
156 Ga0068859_100199022 3300005617 Bacteria 2088
157 Ga0068859_100215382 3300005617 Bacteria 2008
158 Ga0068859_100465542 3300005617 Bacteria 1360
159 Ga0068859_100999209 3300005617 Bacteria 919
160 Ga0068864_100117902 3300005618 Bacteria 2370
161 Ga0068864_100141094 3300005618 Bacteria 2173
162 Ga0068864_100518743 3300005618 Bacteria 1148
163 Ga0068866_10041977 3300005718 Bacteria 2273
164 Ga0068861_100042324 3300005719 Bacteria 3413
165 Ga0068861_100082176 3300005719 Bacteria 2524
166 Ga0068861_101384939 3300005719 Bacteria 686
167 Ga0068870_10006540 3300005840 Bacteria 5141
168 Ga0068870_10123930 3300005840 Bacteria 1492
169 Ga0068863_100234098 3300005841 Bacteria 1772
170 Ga0068863_100255791 3300005841 Bacteria 1692
171 Ga0068863_100747581 3300005841 Bacteria 974
172 Ga0068860_100022880 3300005843 Bacteria 6044
173 Ga0068860_100189878 3300005843 Bacteria 1988
174 Ga0068860_100235990 3300005843 Bacteria 1778
175 Ga0068862_100333529 3300005844 Bacteria 1403
176 Ga0068862_100705211 3300005844 Bacteria 978
177 Ga0081455_10011370 3300005937 Bacteria 8946
178 Ga0075365_10220724 3300006038 Bacteria 1330
179 Ga0075432_10226391 3300006058 Bacteria 750
180 Ga0075432_10294029 3300006058 Bacteria 672
181 Ga0070716_100582695 3300006173 Bacteria 839
182 Ga0070712_100101302 3300006175 Bacteria 2130
183 Ga0070712_100107804 3300006175 Bacteria 2073
184 Ga0070712_100382950 3300006175 Bacteria 1158
185 Ga0075366_10010031 3300006195 Bacteria 5308
186 Ga0075366_10072120 3300006195 Bacteria 2057
187 Ga0097621_100043520 3300006237 Bacteria 3620
188 Ga0097621_100082575 3300006237 Bacteria 2676
189 Ga0097621_100259061 3300006237 Bacteria 1525
190 Ga0097621_100531790 3300006237 Bacteria 1068
191 Ga0097621_100534832 3300006237 Bacteria 1065
192 Ga0068871_100054380 3300006358 Bacteria 3248
193 Ga0068871_100059349 3300006358 Bacteria 3117
194 Ga0068871_100139445 3300006358 Bacteria 2061
195 Ga0068871_100402502 3300006358 Bacteria 1219
196 Ga0068871_100475057 3300006358 Bacteria 1124
197 Ga0068871_101080116 3300006358 Bacteria 750
198 Ga0068871_101249092 3300006358 Bacteria 698
199 Ga0068871_101420296 3300006358 Bacteria 654
200 Ga0075428_100011452 3300006844 Bacteria 9866
201 Ga0075428_100091957 3300006844 Bacteria 3308
202 Ga0075428_100743009 3300006844 Bacteria 1044
203 Ga0075430_100005840 3300006846 Bacteria 10387
204 Ga0075430_100026577 3300006846 Bacteria 4922
205 Ga0075430_100060510 3300006846 Bacteria 3183
206 Ga0075430_100491307 3300006846 Bacteria 1013
207 Ga0075431_100017186 3300006847 Bacteria 7351
208 Ga0075431_100112418 3300006847 Bacteria 2811
209 Ga0075431_100153043 3300006847 Bacteria 2374
210 Ga0075431_100216254 3300006847 Bacteria 1956
211 Ga0075431_100248436 3300006847 Bacteria 1808
212 Ga0075431_100333904 3300006847 Archaea 1526
213 Ga0075431_100547166 3300006847 Bacteria 1145
214 Ga0075431_101000440 3300006847 Bacteria 803
215 Ga0075433_10034948 3300006852 Bacteria 4320
216 Ga0075433_10035427 3300006852 Bacteria 4292
217 Ga0075433_10072810 3300006852 Bacteria 3022
218 Ga0075433_10299674 3300006852 Bacteria 1423
219 Ga0075434_100111577 3300006871 Bacteria 2745
220 Ga0075434_100278673 3300006871 Bacteria 1692
221 Ga0075434_100586146 3300006871 Bacteria 1134
222 Ga0075434_101146363 3300006871 Bacteria 790
223 Ga0075429_100125808 3300006880 Bacteria 2241
224 Ga0068865_100007298 3300006881 Bacteria 6792
225 Ga0068865_100113367 3300006881 Bacteria 2004
226 Ga0068865_100222952 3300006881 Bacteria 1475
227 Ga0068865_100415415 3300006881 Bacteria 1105
228 Ga0075436_100064270 3300006914 Bacteria 2536
229 Ga0075436_100243767 3300006914 Bacteria 1279
230 Ga0075436_100541691 3300006914 Unclassified 854
231 Ga0097620_100199007 3300006931 Bacteria 2088
232 Ga0097620_100215390 3300006931 Bacteria 2008
233 Ga0097620_100465519 3300006931 Bacteria 1360
234 Ga0097620_100999204 3300006931 Bacteria 919
235 Ga0075435_100061172 3300007076 Bacteria 3055
236 Ga0075435_100185703 3300007076 Bacteria 1758
237 Ga0075435_101496074 3300007076 Bacteria 592
238 Ga0105240_10036346 3300009093 Bacteria 6338
239 Ga0105240_10326116 3300009093 Bacteria 1749
240 Ga0111539_10140806 3300009094 Bacteria 2824
241 Ga0111539_10220381 3300009094 Bacteria 2210
242 Ga0111539_10225301 3300009094 Archaea 2184
243 Ga0111539_10346936 3300009094 Bacteria 1728
244 Ga0111539_10445984 3300009094 Bacteria 1507
245 Ga0111539_10684231 3300009094 Bacteria 1194
246 Ga0111539_10724161 3300009094 Bacteria 1158
247 Ga0111539_10768691 3300009094 Bacteria 1121
248 Ga0111539_10827994 3300009094 Bacteria 1077
249 Ga0114129_10025699 3300009147 Bacteria 8342
250 Ga0114129_10193744 3300009147 Bacteria 2758
251 Ga0114129_10206847 3300009147 Bacteria 2655
252 Ga0114129_10713892 3300009147 Bacteria 1287
253 Ga0114129_11163833 3300009147 Bacteria 962
254 Ga0105243_10033429 3300009148 Bacteria 3977
255 Ga0105243_12001656 3300009148 Bacteria 614
256 Ga0105241_10508205 3300009174 Bacteria 1076
257 Ga0105241_11434347 3300009174 Bacteria 662
258 Ga0105242_10054832 3300009176 Bacteria 3260
259 Ga0105242_10086811 3300009176 Bacteria 2626
260 Ga0105248_10175949 3300009177 Bacteria 2412
261 Ga0105248_10504300 3300009177 Bacteria 1364
262 Ga0105248_10924245 3300009177 Bacteria 985
263 Ga0105248_10942549 3300009177 Bacteria 975
264 Ga0105237_10004247 3300009545 Bacteria 16672
265 Ga0105237_10369657 3300009545 Bacteria 1439
266 Ga0105237_11781317 3300009545 Bacteria 623
267 Ga0105238_10002845 3300009551 Bacteria 17273
268 Ga0105238_10089714 3300009551 Bacteria 3061
269 Ga0105238_10210223 3300009551 Bacteria 1922
270 Ga0105249_11750639 3300009553 Bacteria 694
271 Ga0105239_10004502 3300010375 Bacteria 16626
272 Ga0105239_10549664 3300010375 Bacteria 1315
273 Ga0105239_11426096 3300010375 Bacteria 800
274 Ga0105246_10143229 3300011119 Bacteria 1800
275 Ga0105246_10621704 3300011119 Bacteria 936
276 Ga0157336_1000062 3300012477 Archaea 4154
277 Ga0157328_1007160 3300012478 Bacteria 699
278 Ga0157321_1013075 3300012487 Bacteria 671
279 Ga0157316_1011411 3300012510 Bacteria 834
280 Ga0157373_10029707 3300013100 Bacteria 3935
281 Ga0157373_10186697 3300013100 Bacteria 1460
282 Ga0157371_10000830 3300013102 Bacteria 35437
283 Ga0157371_10003303 3300013102 Bacteria 14760
284 Ga0157370_10025403 3300013104 Bacteria 5863
285 Ga0157370_10051040 3300013104 Bacteria 3952
286 Ga0157370_10074572 3300013104 Bacteria 3200
287 Ga0157370_10391008 3300013104 Bacteria 1280
288 Ga0157370_10449123 3300013104 Unclassified 1185
289 Ga0157369_10356063 3300013105 Bacteria 1520
290 Ga0157369_10584756 3300013105 Bacteria 1153
291 Ga0157374_11382513 3300013296 Bacteria 727
292 Ga0157378_10074037 3300013297 Bacteria 3064
293 Ga0157378_10625089 3300013297 Bacteria 1090
294 Ga0163162_10050057 3300013306 Bacteria 4189
295 Ga0163162_10073872 3300013306 Bacteria 3467
296 Ga0157372_10033879 3300013307 Bacteria 5613
297 Ga0157372_10166495 3300013307 Bacteria 2549
298 Ga0157372_10688128 3300013307 Bacteria 1190
299 Ga0157372_10776969 3300013307 Bacteria 1113
300 Ga0157372_10888001 3300013307 Bacteria 1034
301 Ga0157375_10004605 3300013308 Bacteria 11987
302 Ga0157375_10100869 3300013308 Bacteria 2968
303 Ga0157375_10621796 3300013308 Bacteria 1238
304 Ga0157375_10991118 3300013308 Bacteria 980
305 Ga0157375_12250297 3300013308 Bacteria 650
306 Ga0163163_10036870 3300014325 Bacteria 4752
307 Ga0163163_10110680 3300014325 Bacteria 2775
308 Ga0163163_10149169 3300014325 Bacteria 2383
309 Ga0163163_10196396 3300014325 Bacteria 2066
310 Ga0163163_10256092 3300014325 Bacteria 1801
311 Ga0163163_11073988 3300014325 Bacteria 868
312 Ga0157380_10050326 3300014326 Bacteria 3290
313 Ga0157380_10083794 3300014326 Bacteria 2613
314 Ga0157380_10497769 3300014326 Bacteria 1183
315 Ga0157380_11115431 3300014326 Bacteria 828
316 Ga0157380_11167570 3300014326 Bacteria 812
317 Ga0157380_11546732 3300014326 Bacteria 718
318 Ga0157380_11995517 3300014326 Bacteria 642
319 Ga0157376_10015473 3300014969 Bacteria 5764
320 Ga0157376_10138078 3300014969 Bacteria 2183
321 Ga0157376_10143521 3300014969 Bacteria 2145
322 Ga0157376_10296161 3300014969 Bacteria 1530
323 Ga0157376_10772862 3300014969 Bacteria 971
324 Ga0163161_10218456 3300017792 Bacteria 1475
325 Ga0163161_10404384 3300017792 Bacteria 1095
326 Ga0206356_10923714 3300020070 Unclassified 2177
327 Ga0206355_1352774 3300020076 Bacteria 979
328 Ga0206352_10264359 3300020078 Bacteria 703
329 Ga0206350_11660287 3300020080 Bacteria 957
330 Ga0206353_10852945 3300020082 Bacteria 1448
331 Ga0224712_10089302 3300022467 Bacteria 1288
332 Ga0224712_10318442 3300022467 Bacteria 730
333 Ga0207425_1000001 3300025245 Bacteria 2525432
334 Ga0209129_1000001 3300025258 Bacteria 1452436
335 Ga0209565_1012991 3300025263 Bacteria 1965
336 Ga0209130_1037776 3300025284 Bacteria 951
337 Ga0209758_1000073 3300025297 Bacteria 276262
338 Ga0209256_1000116 3300025299 Bacteria 169876
339 Ga0207697_10068723 3300025315 Bacteria 1482
340 Ga0207682_10003132 3300025893 Bacteria 7246
341 Ga0207682_10144957 3300025893 Bacteria 1068
342 Ga0207642_10040912 3300025899 Bacteria 2026
343 Ga0207645_10530371 3300025907 Bacteria 798
344 Ga0207645_10657177 3300025907 Bacteria 712
345 Ga0207643_10009683 3300025908 Bacteria 5171
346 Ga0207643_10123817 3300025908 Bacteria 1533
347 Ga0207643_10354455 3300025908 Bacteria 921
348 Ga0207643_10403801 3300025908 Bacteria 864
349 Ga0207705_10190455 3300025909 Bacteria 1551
350 Ga0207684_10044118 3300025910 Bacteria 3780
351 Ga0207684_10466335 3300025910 Bacteria 1084
352 Ga0207654_10416751 3300025911 Bacteria 936
353 Ga0207654_10547159 3300025911 Bacteria 822
354 Ga0207707_10305746 3300025912 Bacteria 1374
355 Ga0207707_10692286 3300025912 Bacteria 856
356 Ga0207707_10923754 3300025912 Bacteria 720
357 Ga0207695_10033025 3300025913 Bacteria 5654
358 Ga0207695_10039302 3300025913 Bacteria 5087
359 Ga0207695_10047165 3300025913 Unclassified 4562
360 Ga0207695_10074603 3300025913 Bacteria 3454
361 Ga0207671_10003331 3300025914 Bacteria 16145
362 Ga0207671_10279308 3300025914 Bacteria 1317
363 Ga0207671_10742842 3300025914 Bacteria 780
364 Ga0207693_10105812 3300025915 Bacteria 2206
365 Ga0207693_10112576 3300025915 Bacteria 2135
366 Ga0207693_10650889 3300025915 Bacteria 818
367 Ga0207663_10205347 3300025916 Bacteria 1424
368 Ga0207660_10323375 3300025917 Bacteria 1232
369 Ga0207649_10015896 3300025920 Bacteria 4233
370 Ga0207649_10137520 3300025920 Bacteria 1668
371 Ga0207649_10247391 3300025920 Bacteria 1283
372 Ga0207649_10292041 3300025920 Bacteria 1189
373 Ga0207649_10448090 3300025920 Bacteria 974
374 Ga0207649_10471698 3300025920 Unclassified 950
375 Ga0207652_10084265 3300025921 Bacteria 2784
376 Ga0207652_10163064 3300025921 Bacteria 1998
377 Ga0207646_10772738 3300025922 Bacteria 856
378 Ga0207646_10790545 3300025922 Bacteria 845
379 Ga0207681_10012328 3300025923 Bacteria 5274
380 Ga0207681_10151119 3300025923 Bacteria 1740
381 Ga0207694_10102993 3300025924 Bacteria 2263
382 Ga0207650_10022091 3300025925 Bacteria 4503
383 Ga0207650_10026596 3300025925 Bacteria 4129
384 Ga0207659_10015813 3300025926 Bacteria 4900
385 Ga0207659_10018902 3300025926 Bacteria 4525
386 Ga0207659_10344937 3300025926 Bacteria 1234
387 Ga0207659_10394097 3300025926 Bacteria 1157
388 Ga0207687_11559023 3300025927 Bacteria 567
389 Ga0207700_11201193 3300025928 Bacteria 677
390 Ga0207664_10064557 3300025929 Bacteria 2929
391 Ga0207644_10591383 3300025931 Bacteria 921
392 Ga0207706_10023819 3300025933 Bacteria 5492
393 Ga0207706_10263413 3300025933 Bacteria 1505
394 Ga0207706_10332343 3300025933 Bacteria 1322
395 Ga0207686_10014515 3300025934 Bacteria 4387
396 Ga0207686_10036022 3300025934 Bacteria 2975
397 Ga0207670_10158096 3300025936 Bacteria 1689
398 Ga0207670_10216643 3300025936 Bacteria 1463
399 Ga0207670_10221074 3300025936 Bacteria 1450
400 Ga0207670_10905268 3300025936 Bacteria 739
401 Ga0207669_10004353 3300025937 Bacteria 6220
402 Ga0207669_10138393 3300025937 Unclassified 1686
403 Ga0207669_10876497 3300025937 Bacteria 748
404 Ga0207704_10012153 3300025938 Bacteria 4265
405 Ga0207704_10055717 3300025938 Bacteria 2418
406 Ga0207704_10056966 3300025938 Bacteria 2398
407 Ga0207704_10119811 3300025938 Bacteria 1798
408 Ga0207704_10712385 3300025938 Bacteria 832
409 Ga0207691_10007022 3300025940 Bacteria 10862
410 Ga0207691_10007763 3300025940 Bacteria 10333
411 Ga0207691_10028018 3300025940 Bacteria 5278
412 Ga0207691_10059504 3300025940 Bacteria 3473
413 Ga0207711_10299314 3300025941 Bacteria 1483
414 Ga0207689_10004736 3300025942 Bacteria 12267
415 Ga0207689_10059539 3300025942 Bacteria 3141
416 Ga0207689_10109033 3300025942 Bacteria 2275
417 Ga0207689_10322324 3300025942 Bacteria 1282
418 Ga0207689_10390238 3300025942 Bacteria 1160
419 Ga0207661_10060287 3300025944 Bacteria 3061
420 Ga0207661_10145490 3300025944 Bacteria 2044
421 Ga0207679_10050528 3300025945 Bacteria 3039
422 Ga0207679_10115154 3300025945 Bacteria 2129
423 Ga0207667_10216745 3300025949 Bacteria 1961
424 Ga0207667_10478557 3300025949 Bacteria 1264
425 Ga0207651_10056014 3300025960 Bacteria 2711
426 Ga0207651_10163583 3300025960 Bacteria 1747
427 Ga0207712_10074160 3300025961 Bacteria 2456
428 Ga0207668_10241766 3300025972 Bacteria 1461
429 Ga0207668_10257967 3300025972 Bacteria 1419
430 Ga0207640_10085407 3300025981 Bacteria 2170
431 Ga0207640_10536904 3300025981 Bacteria 980
432 Ga0207640_11038540 3300025981 Bacteria 722
433 Ga0207640_11769984 3300025981 Bacteria 558
434 Ga0207658_10194895 3300025986 Bacteria 1687
435 Ga0207658_10293652 3300025986 Bacteria 1398
436 Ga0207658_10604108 3300025986 Bacteria 986
437 Ga0207677_10313924 3300026023 Bacteria 1300
438 Ga0207677_11097683 3300026023 Bacteria 725
439 Ga0207703_10966142 3300026035 Bacteria 817
440 Ga0207639_11387781 3300026041 Bacteria 659
441 Ga0207708_10077192 3300026075 Bacteria 2556
442 Ga0207708_10248896 3300026075 Bacteria 1431
443 Ga0207708_10258486 3300026075 Bacteria 1405
444 Ga0207708_10449492 3300026075 Bacteria 1073
445 Ga0207702_10145458 3300026078 Bacteria 2150
446 Ga0207641_10031738 3300026088 Bacteria 4383
447 Ga0207641_10107336 3300026088 Bacteria 2469
448 Ga0207641_10264573 3300026088 Bacteria 1611
449 Ga0207641_10541206 3300026088 Bacteria 1135
450 Ga0207648_10001800 3300026089 Bacteria 23485
451 Ga0207648_10009283 3300026089 Bacteria 9435
452 Ga0207648_10020948 3300026089 Bacteria 5886
453 Ga0207648_10062126 3300026089 Bacteria 3257
454 Ga0207648_10151364 3300026089 Bacteria 2047
455 Ga0207648_10259260 3300026089 Bacteria 1551
456 Ga0207648_10288602 3300026089 Bacteria 1469
457 Ga0207648_10575804 3300026089 Bacteria 1036
458 Ga0207648_10995275 3300026089 Bacteria 785
459 Ga0207648_11111823 3300026089 Bacteria 741
460 Ga0207676_10132857 3300026095 Bacteria 2119
461 Ga0207676_10180260 3300026095 Bacteria 1849
462 Ga0207676_10511386 3300026095 Archaea 1142
463 Ga0207676_11713335 3300026095 Bacteria 627
464 Ga0207674_10014406 3300026116 Bacteria 8734
465 Ga0207674_10394831 3300026116 Bacteria 1337
466 Ga0207675_100226538 3300026118 Bacteria 1802
467 Ga0207675_100503365 3300026118 Bacteria 1206
468 Ga0207675_100864074 3300026118 Bacteria 920
469 Ga0207683_10042246 3300026121 Bacteria 3982
470 Ga0207683_10341566 3300026121 Bacteria 1373
471 Ga0207683_10370101 3300026121 Bacteria 1316
472 Ga0207698_10207311 3300026142 Bacteria 1761
473 Ga0207698_11344855 3300026142 Bacteria 729
474 Ga0209982_1003561 3300027552 Bacteria 2214
475 Ga0209974_10104416 3300027876 Bacteria 992
476 Ga0207428_10106267 3300027907 Bacteria 2164
477 Ga0207428_10130719 3300027907 Bacteria 1921
478 Ga0207428_10263468 3300027907 Archaea 1283
479 Ga0207428_10352052 3300027907 Bacteria 1083
480 Ga0207428_10696316 3300027907 Bacteria 727
481 Ga0268266_10044966 3300028379 Bacteria 3775
482 Ga0268266_10165015 3300028379 Bacteria 2006
483 Ga0268266_10664971 3300028379 Bacteria 1003
484 Ga0268266_11059496 3300028379 Unclassified 785
485 Ga0268265_10206360 3300028380 Bacteria 1709
486 Ga0268265_10823681 3300028380 Bacteria 906
487 Ga0268265_10935066 3300028380 Bacteria 853
488 Ga0268265_11384946 3300028380 Bacteria 705
489 Ga0268265_11563257 3300028380 Bacteria 664
490 Ga0268264_10037603 3300028381 Bacteria 3991
491 Ga0268264_10180315 3300028381 Bacteria 1917
492 Ga0268264_10196304 3300028381 Bacteria 1843
493 Ga0307513_10027758 3300031456 Bacteria 6489
494 Ga0307513_10142449 3300031456 Bacteria 2321
495 Ga0307513_10145467 3300031456 Bacteria 2289
496 Ga0307509_10009146 3300031507 Bacteria 12455
497 Ga0307509_10171419 3300031507 Bacteria 2049
498 Ga0307509_10348300 3300031507 Bacteria 1205
499 Ga0307408_100000035 3300031548 Bacteria 205352
500 Ga0307408_100059995 3300031548 Unclassified 2771
501 Ga0307408_100079616 3300031548 Bacteria 2445
502 Ga0307408_100215788 3300031548 Bacteria 1562
503 Ga0307408_100290091 3300031548 Bacteria 1366
504 Ga0307408_100753528 3300031548 Bacteria 880
505 Ga0307408_101981692 3300031548 Bacteria 560
506 Ga0307405_10119361 3300031731 Bacteria 1802
507 Ga0307405_10150105 3300031731 Bacteria 1637
508 Ga0307405_10485541 3300031731 Bacteria 987
509 Ga0307413_10018554 3300031824 Bacteria 3654
510 Ga0307413_10043498 3300031824 Unclassified 2647
511 Ga0307413_10063789 3300031824 Bacteria 2286
512 Ga0307410_10001136 3300031852 Bacteria 11682
513 Ga0307410_10055113 3300031852 Bacteria 2698
514 Ga0307410_10132425 3300031852 Bacteria 1833
515 Ga0307410_10746347 3300031852 Bacteria 828
516 Ga0307410_11180150 3300031852 Bacteria 666
517 Ga0307406_10161069 3300031901 Bacteria 1613
518 Ga0307406_10396634 3300031901 Bacteria 1092
519 Ga0307406_10416911 3300031901 Bacteria 1069
520 Ga0307406_10753971 3300031901 Bacteria 817
521 Ga0307407_10000211 3300031903 Bacteria 17579
522 Ga0307407_10020319 3300031903 Bacteria 3400
523 Ga0307407_10124590 3300031903 Bacteria 1639
524 Ga0307407_10241127 3300031903 Bacteria 1233
525 Ga0307407_10590083 3300031903 Bacteria 826
526 Ga0307412_10417974 3300031911 Bacteria 1096
527 Ga0307412_10637084 3300031911 Bacteria 907
528 Ga0307412_10946643 3300031911 Bacteria 758
529 Ga0307409_100082827 3300031995 Bacteria 2599
530 Ga0307409_100099345 3300031995 Bacteria 2410
531 Ga0307409_100120220 3300031995 Bacteria 2223
532 Ga0307409_100165842 3300031995 Bacteria 1938
533 Ga0307409_100276992 3300031995 Bacteria 1548
534 Ga0307409_100367517 3300031995 Bacteria 1363
535 Ga0307409_101402152 3300031995 Bacteria 725
536 Ga0307416_100002534 3300032002 Bacteria 10514
537 Ga0307416_100061013 3300032002 Bacteria 3075
538 Ga0307416_100122064 3300032002 Unclassified 2324
539 Ga0307416_101949099 3300032002 Bacteria 690
540 Ga0307414_10060255 3300032004 Unclassified 2683
541 Ga0307414_10093881 3300032004 Bacteria 2238
542 Ga0307411_10012291 3300032005 Bacteria 4664
543 Ga0307411_10032163 3300032005 Bacteria 3238
544 Ga0307411_10111617 3300032005 Bacteria 1958
545 Ga0307411_10345411 3300032005 Bacteria 1211
546 Ga0307411_10579313 3300032005 Bacteria 962
547 Ga0307411_11366423 3300032005 Bacteria 647
548 Ga0307411_11785108 3300032005 Bacteria 571
549 Ga0307415_100122991 3300032126 Bacteria 1949
550 Ga0307415_100338024 3300032126 Bacteria 1262
551 Ga0373961_0199491 3300035241 Bacteria 705
552 Ga0373931_0850481 3300035691 Bacteria 611
553 Ga0395905_0037531 3300037471 Bacteria 4548
554 Ga0395905_0068251 3300037471 Bacteria 3331
555 Ga0395905_0162438 3300037471 Bacteria 2099
556 Ga0395905_0335818 3300037471 Bacteria 1402
557 Ga0395905_0420721 3300037471 Bacteria 1232
558 Ga0395901_0061333 3300038443 Bacteria 3913
559 Ga0451789_1231417 3300041443 Bacteria 964
560 Ga0451791_0550808 3300041451 Bacteria 1744
561 Ga0451793_0639628 3300041452 Bacteria 1189
562 Ga0451795_1615507 3300041456 Bacteria 1139
563 Ga0451798_0003318 3300041458 Bacteria 1593
564 Ga0451800_0601781 3300041459 Bacteria 1415
565 Ga0451800_1495159 3300041459 Bacteria 859
566 Ga0451802_0233296 3300041460 Bacteria 1157
567 Ga0451802_0842791 3300041460 Bacteria 1958
568 Ga0451807_0061546 3300041486 Bacteria 8117
569 Ga0451807_0112940 3300041486 Bacteria 2804
570 Ga0451843_1694280 3300041509 Bacteria 556
571 Ga0451853_2552288 3300041512 Bacteria 674
572 Ga0439448_0037577 3300042005 Bacteria 1556
573 Ga0439450_081997 3300042008 Bacteria 803
574 Ga0439455_0101163 3300042012 Archaea 797
575 Ga0439455_0111968 3300042012 Bacteria 760
576 Ga0439434_0070809 3300042435 Archaea 1098
577 Ga0439444_0120909 3300042437 Bacteria 611
578 Ga0439459_0028048 3300042438 Bacteria 1127
579 Ga0451577_0494948 3300042876 Unclassified 1110
580 Ga0439440_0039545 3300042993 Bacteria 1145
581 Ga0439440_0118163 3300042993 Archaea 736
582 Ga0453683_0233109 3300044673 Bacteria 1172
583 Ga0451576_0005304 3300045051 Bacteria 16202
584 Ga0451576_0668619 3300045051 Bacteria 1091
585 Ga0495590_0140175 3300046457 Bacteria 872
586 Ga0495638_0005416 3300046460 Bacteria 9498
587 Ga0495584_0014170 3300046491 Bacteria 4063
588 Ga0495585_0080608 3300046492 Bacteria 1764
589 Ga0495632_0036558 3300046519 Bacteria 2497
590 Ga0495637_0117879 3300046520 Bacteria 1024
591 Ga0495643_0000187 3300046522 Bacteria 99364
592 Ga0495644_0186699 3300046523 Bacteria 798
593 Ga0495648_0085742 3300046524 Bacteria 1778
594 Ga0495663_0037513 3300046525 Bacteria 1462
595 Ga0495622_0199713 3300046557 Bacteria 891
596 Ga0495611_0192930 3300046648 Archaea 951
597 Ga0495625_0013132 3300046660 Bacteria 6674
598 Ga0495625_0047730 3300046660 Bacteria 3087
599 Ga0495670_0031366 3300046691 Bacteria 2641
600 Ga0495649_0003550 3300046694 Bacteria 10477
601 Ga0495649_0218427 3300046694 Bacteria 986
602 Ga0495636_0065204 3300047318 Bacteria 1547
603 Ga0495626_0117424 3300048091 Bacteria 1147
604 Ga0496100_0071424 3300048903 Bacteria 2318
605 Ga0496101_0107204 3300048904 Bacteria 2099
606 Ga0496101_0496720 3300048904 Bacteria 964
607 Ga0496101_0724207 3300048904 Bacteria 785
608 Ga0496102_0010277 3300048905 Bacteria 8047
609 Ga0496103_0256254 3300048906 Bacteria 1126
610 Ga0496106_0606410 3300048909 Bacteria 877
611 Ga0496106_1011285 3300048909 Bacteria 653
612 Ga0496107_0348334 3300048910 Bacteria 1102
613 Ga0496108_0350096 3300048911 Bacteria 1289
614 Ga0496109_0063212 3300048912 Bacteria 3386
615 Ga0496109_0607344 3300048912 Bacteria 1030
616 Ga0496110_0219863 3300048913 Bacteria 1727
617 Ga0496111_0435953 3300048914 Bacteria 967
618 Ga0496112_0219229 3300048915 Bacteria 1859
619 Ga0496112_0590566 3300048915 Bacteria 1043
620 Ga0496114_0375359 3300048917 Bacteria 1259
621 Ga0501292_011320 3300049515 Archaea 1349
622 Ga0501031_0832740 3300049568 Archaea 591
623 Ga0501033_0021211 3300049570 Bacteria 4901
624 Ga0501036_0062762 3300049572 Bacteria 3147
625 Ga0501036_0285103 3300049572 Bacteria 1382
626 Ga0501036_0998356 3300049572 Archaea 685
627 Ga0501036_1409461 3300049572 Bacteria 565
628 Ga0501037_0088973 3300049573 Bacteria 2235
629 Ga0501038_0074323 3300049574 Bacteria 2876
630 Ga0501038_0470097 3300049574 Archaea 965
631 Ga0501039_0078025 3300049575 Bacteria 2576
632 Ga0501039_0348830 3300049575 Archaea 1163
633 Ga0501039_0778489 3300049575 Unclassified 747
634 Ga0501040_0010704 3300049576 Bacteria 5998
635 Ga0501040_0112227 3300049576 Bacteria 1907
636 Ga0501040_0204314 3300049576 Bacteria 1403
637 Ga0501040_0266514 3300049576 Bacteria 1223
638 Ga0501042_0081006 3300049578 Bacteria 2326
639 Ga0501042_0332486 3300049578 Archaea 1098
640 Ga0501042_0425190 3300049578 Bacteria 963
641 Ga0501042_0426552 3300049578 Archaea 961
642 Ga0501043_0107682 3300049579 Bacteria 2189
643 Ga0501048_0006223 3300049582 Bacteria 9079
644 Ga0501048_1127038 3300049582 Bacteria 564
645 Ga0501067_0010818 3300049583 Bacteria 5048
646 Ga0501067_0051170 3300049583 Bacteria 2290
647 Ga0501068_0001138 3300049584 Bacteria 14094
648 Ga0501068_0043293 3300049584 Bacteria 2708
649 Ga0501070_0039090 3300049586 Bacteria 3958
650 Ga0501071_0137500 3300049587 Bacteria 1818
651 Ga0501071_0234659 3300049587 Bacteria 1382
652 Ga0501071_0256423 3300049587 Bacteria 1321
653 Ga0501071_0498111 3300049587 Bacteria 934
654 Ga0501071_1133262 3300049587 Unclassified 604
655 Ga0501072_0089424 3300049588 Bacteria 2444
656 Ga0501072_0886331 3300049588 Bacteria 697
657 Ga0501072_0922408 3300049588 Bacteria 682
658 Ga0501073_0013731 3300049589 Bacteria 5891
659 Ga0501074_0000872 3300049590 Bacteria 19243
660 Ga0501074_0066817 3300049590 Bacteria 2586
661 Ga0501075_0008080 3300049591 Bacteria 7317
662 Ga0501076_0004790 3300049592 Bacteria 9654
663 Ga0501076_0030444 3300049592 Bacteria 4204
664 Ga0501076_0035121 3300049592 Bacteria 3922
665 Ga0501077_0009972 3300049593 Bacteria 5912
666 Ga0501077_0025001 3300049593 Bacteria 3792
667 Ga0501209_090615 3300049656 Bacteria 889
668 Ga0501214_013363 3300049659 Archaea 951
669 Ga0501233_088704 3300049668 Archaea 805
670 Ga0501225_0041800 3300049705 Archaea 1265
671 Ga0501245_007318 3300049708 Archaea 1559
672 Ga0501079_0000867 3300049741 Bacteria 20732
673 Ga0501079_0070186 3300049741 Bacteria 2705
674 Ga0501080_0009692 3300049742 Bacteria 8795
675 Ga0501080_0298670 3300049742 Bacteria 1461
676 Ga0501081_0033632 3300049743 Bacteria 3484
677 Ga0501081_0262526 3300049743 Bacteria 1262
678 Ga0501083_0004795 3300049744 Bacteria 9555
679 Ga0501279_047025 3300049775 Archaea 676
680 Ga0501035_0000029 3300049822 Bacteria 179018
681 Ga0501035_0061005 3300049822 Bacteria 3357
682 Ga0501045_0008524 3300049824 Bacteria 7145
683 Ga0501045_0101449 3300049824 Bacteria 2131
684 nmdc:mga0yw44_64592_c1 3300050492 Bacteria 2253
685 nmdc:mga0k408_1948_c1 3300050493 Bacteria 11061
686 nmdc:mga0k408_77471_c1 3300050493 Bacteria 1944
687 nmdc:mga05p37_1106957_c1 3300050507 Bacteria 829
688 nmdc:mga05p37_176990_c1 3300050507 Bacteria 2598
689 nmdc:mga05p37_177134_c1 3300050507 Bacteria 2597
690 nmdc:mga05p37_27545_c1 3300050507 Bacteria 6919
691 nmdc:mga05p37_56259_c1 3300050507 Archaea 1343
692 nmdc:mga05p37_57535_c1 3300050507 Bacteria 4789
693 nmdc:mga05p37_754021_c1 3300050507 Bacteria 1072
694 nmdc:mga09592_149217_c1 3300050508 Archaea 2017
695 nmdc:mga09592_150457_c1 3300050508 Bacteria 2008
696 nmdc:mga09592_39370_c1 3300050508 Bacteria 3971
697 nmdc:mga0qj67_19842_c1 3300050509 Bacteria 5141
698 nmdc:mga0qj67_467598_c1 3300050509 Bacteria 1015
699 nmdc:mga0qj67_61657_c1 3300050509 Bacteria 2978
700 nmdc:mga06r32_1014931_c1 3300050510 Bacteria 782
701 nmdc:mga06r32_101994_c1 3300050510 Bacteria 2816
702 nmdc:mga06r32_102749_c1 3300050510 Bacteria 2806
703 nmdc:mga06r32_1179849_c1 3300050510 Bacteria 712
704 nmdc:mga06r32_254850_c1 3300050510 Bacteria 1742
705 nmdc:mga06r32_445579_c1 3300050510 Bacteria 1275
706 nmdc:mga06r32_61988_c1 3300050510 Archaea 3602
707 nmdc:mga06r32_670708_c1 3300050510 Bacteria 1004
708 nmdc:mga06r32_698988_c1 3300050510 Bacteria 980
709 nmdc:mga06r32_749856_c1 3300050510 Bacteria 939
710 nmdc:mga06r32_98773_c2 3300050510 Bacteria 1145
711 nmdc:mga08y16_119395_c1 3300050511 Bacteria 2744
712 nmdc:mga08y16_146165_c1 3300050511 Archaea 2458
713 nmdc:mga08y16_626458_c1 3300050511 Bacteria 1082
714 nmdc:mga08y16_649414_c1 3300050511 Bacteria 1059
715 nmdc:mga08y16_703796_c1 3300050511 Bacteria 1010
716 nmdc:mga08y16_913115_c1 3300050511 Bacteria 863
717 nmdc:mga08y16_94777_c1 3300050511 Bacteria 3109
718 nmdc:mga0n895_1611240_c1 3300050512 Bacteria 613
719 nmdc:mga0n895_8124_c1 3300050512 Bacteria 9066
720 nmdc:mga0n895_81665_c1 3300050512 Unclassified 3221
721 nmdc:mga0rr50_283341_c1 3300050513 Bacteria 1383
722 nmdc:mga08x19_333648_c1 3300050514 Bacteria 1057
723 nmdc:mga08x19_64853_c1 3300050514 Bacteria 1475
724 nmdc:mga08x19_69996_c1 3300050514 Bacteria 2285
725 nmdc:mga0a205_29717_c2 3300050515 Bacteria 3178
726 nmdc:mga0a205_31427_c1 3300050515 Bacteria 5086
727 nmdc:mga0a205_34488_c1 3300050515 Bacteria 4854
728 Ga0500650_0360617 3300053098 Bacteria 634
729 Ga0501084_0015268 3300054114 Bacteria 6368
730 Ga0501084_0025479 3300054114 Bacteria 4935
731 Ga0501084_0256999 3300054114 Bacteria 1475
732 Ga0590077_018589 3300059426 Bacteria 1468
733 Ga0501082_0022789 3300060353 Bacteria 5394
734 Ga0501082_0040727 3300060353 Bacteria 4006
735 Ga0501082_0741802 3300060353 Bacteria 859
736 Ga0530510_0008234 3300061734 Bacteria 7269
737 Ga0530510_0077575 3300061734 Bacteria 2414
738 Ga0530510_0976918 3300061734 Bacteria 648

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025927 Ga0207687_11559023 Ga0207687_115590231 155
2 3300025933 Ga0207706_10263413 Ga0207706_102634133 155
3 3300025936 Ga0207670_10905268 Ga0207670_109052681 155
4 3300025938 Ga0207704_10012153 Ga0207704_100121532 155
5 3300025940 Ga0207691_10028018 Ga0207691_100280183 155
6 3300025961 Ga0207712_10074160 Ga0207712_100741602 155
7 3300025986 Ga0207658_10194895 Ga0207658_101948952 155
8 3300026023 Ga0207677_10313924 Ga0207677_103139243 155
9 3300026088 Ga0207641_10264573 Ga0207641_102645733 155
10 3300026089 Ga0207648_10001800 Ga0207648_100018009 155
11 3300026095 Ga0207676_10132857 Ga0207676_101328572 155
12 3300028379 Ga0268266_10664971 Ga0268266_106649712 155
13 3300028380 Ga0268265_11563257 Ga0268265_115632571 155
14 3300028381 Ga0268264_10180315 Ga0268264_101803152 155
15 3300050510 nmdc:mga06r32_102749_c1 nmdc:mga06r32_102749_c1_2282_2767 155
16 3300050510 nmdc:mga06r32_254850_c1 nmdc:mga06r32_254850_c1_11_499 155
17 3300042876 Ga0451577_0494948 Ga0451577_0494948_21_497 156
18 3300025981 Ga0207640_11038540 Ga0207640_110385401 157
19 3300005295 Ga0065707_10093493 Ga0065707_100934934 158
20 3300013100 Ga0157373_10186697 Ga0157373_101866973 158
21 3300013102 Ga0157371_10000830 Ga0157371_1000083026 158
22 3300013102 Ga0157371_10003303 Ga0157371_1000330311 158
23 3300013104 Ga0157370_10051040 Ga0157370_100510404 158
24 3300013104 Ga0157370_10449123 Ga0157370_104491232 158
25 3300031548 Ga0307408_101981692 Ga0307408_1019816921 158
26 3300042437 Ga0439444_0120909 Ga0439444_0120909_53_538 158
27 3300049668 Ga0501233_088704 Ga0501233_088704_224_703 158
28 3300049705 Ga0501225_0041800 Ga0501225_0041800_565_1044 158
29 3300049708 Ga0501245_007318 Ga0501245_007318_105_584 158
30 3300037471 Ga0395905_0420721 Ga0395905_0420721_553_1041 159
31 3300046523 Ga0495644_0186699 Ga0495644_0186699_169_651 159
32 3300049572 Ga0501036_0998356 Ga0501036_0998356_120_647 159
33 3300049574 Ga0501038_0470097 Ga0501038_0470097_317_844 159
34 3300049575 Ga0501039_0348830 Ga0501039_0348830_305_832 159
35 3300049578 Ga0501042_0332486 Ga0501042_0332486_155_682 159
36 3300050510 nmdc:mga06r32_749856_c1 nmdc:mga06r32_749856_c1_348_836 159
37 3300005328 Ga0070676_10980852 Ga0070676_109808521 160
38 3300005334 Ga0068869_100714118 Ga0068869_1007141181 160
39 3300005339 Ga0070660_101457688 Ga0070660_1014576881 160
40 3300005341 Ga0070691_10360555 Ga0070691_103605552 160
41 3300005345 Ga0070692_10807599 Ga0070692_108075991 160
42 3300005347 Ga0070668_100358947 Ga0070668_1003589472 160
43 3300005354 Ga0070675_100754570 Ga0070675_1007545702 160
44 3300005354 Ga0070675_100790667 Ga0070675_1007906671 160
45 3300005355 Ga0070671_100281642 Ga0070671_1002816421 160
46 3300005356 Ga0070674_100083924 Ga0070674_1000839242 160
47 3300005444 Ga0070694_100013925 Ga0070694_1000139252 160
48 3300005455 Ga0070663_101475071 Ga0070663_1014750711 160
49 3300005530 Ga0070679_100323167 Ga0070679_1003231671 160
50 3300005549 Ga0070704_100022238 Ga0070704_1000222382 160
51 3300005563 Ga0068855_100480758 Ga0068855_1004807582 160
52 3300005578 Ga0068854_100056259 Ga0068854_1000562591 160
53 3300005614 Ga0068856_100378288 Ga0068856_1003782882 160
54 3300005616 Ga0068852_100807824 Ga0068852_1008078242 160
55 3300005617 Ga0068859_100215382 Ga0068859_1002153823 160
56 3300005719 Ga0068861_100042324 Ga0068861_1000423242 160
57 3300005843 Ga0068860_100235990 Ga0068860_1002359903 160
58 3300006175 Ga0070712_100382950 Ga0070712_1003829502 160
59 3300006847 Ga0075431_100547166 Ga0075431_1005471662 160
60 3300006852 Ga0075433_10072810 Ga0075433_100728104 160
61 3300006871 Ga0075434_100278673 Ga0075434_1002786734 160
62 3300006881 Ga0068865_100415415 Ga0068865_1004154152 160
63 3300006931 Ga0097620_100215390 Ga0097620_1002153903 160
64 3300009094 Ga0111539_10220381 Ga0111539_102203812 160
65 3300009094 Ga0111539_10724161 Ga0111539_107241612 160
66 3300009094 Ga0111539_10827994 Ga0111539_108279942 160
67 3300009147 Ga0114129_10206847 Ga0114129_102068474 160
68 3300010375 Ga0105239_11426096 Ga0105239_114260962 160
69 3300011119 Ga0105246_10621704 Ga0105246_106217042 160
70 3300012487 Ga0157321_1013075 Ga0157321_10130751 160
71 3300012510 Ga0157316_1011411 Ga0157316_10114112 160
72 3300013297 Ga0157378_10074037 Ga0157378_100740373 160
73 3300013306 Ga0163162_10073872 Ga0163162_100738723 160
74 3300013307 Ga0157372_10888001 Ga0157372_108880012 160
75 3300013308 Ga0157375_10621796 Ga0157375_106217962 160
76 3300014326 Ga0157380_11995517 Ga0157380_119955171 160
77 3300014969 Ga0157376_10772862 Ga0157376_107728622 160
78 3300025936 Ga0207670_10216643 Ga0207670_102166433 160
79 3300025942 Ga0207689_10390238 Ga0207689_103902382 160
80 3300025972 Ga0207668_10257967 Ga0207668_102579672 160
81 3300025981 Ga0207640_10085407 Ga0207640_100854074 160
82 3300025986 Ga0207658_10604108 Ga0207658_106041081 160
83 3300026023 Ga0207677_11097683 Ga0207677_110976831 160
84 3300026075 Ga0207708_10449492 Ga0207708_104494922 160
85 3300026121 Ga0207683_10341566 Ga0207683_103415662 160
86 3300027552 Ga0209982_1003561 Ga0209982_10035612 160
87 3300027907 Ga0207428_10352052 Ga0207428_103520522 160
88 3300027907 Ga0207428_10696316 Ga0207428_106963161 160
89 3300028380 Ga0268265_10823681 Ga0268265_108236812 160
90 3300031903 Ga0307407_10590083 Ga0307407_105900832 160
91 3300032005 Ga0307411_10345411 Ga0307411_103454112 160
92 3300035241 Ga0373961_0199491 Ga0373961_0199491_188_691 160
93 3300035691 Ga0373931_0850481 Ga0373931_0850481_61_564 160
94 3300037471 Ga0395905_0162438 Ga0395905_0162438_1427_1918 160
95 3300038443 Ga0395901_0061333 Ga0395901_0061333_1595_2086 160
96 3300046491 Ga0495584_0014170 Ga0495584_0014170_329_841 160
97 3300046492 Ga0495585_0080608 Ga0495585_0080608_465_977 160
98 3300046525 Ga0495663_0037513 Ga0495663_0037513_454_966 160
99 3300046660 Ga0495625_0013132 Ga0495625_0013132_947_1441 160
100 3300046691 Ga0495670_0031366 Ga0495670_0031366_1506_2018 160
101 3300047318 Ga0495636_0065204 Ga0495636_0065204_272_784 160
102 3300048904 Ga0496101_0496720 Ga0496101_0496720_180_677 160
103 3300048904 Ga0496101_0724207 Ga0496101_0724207_257_760 160
104 3300048905 Ga0496102_0010277 Ga0496102_0010277_6390_6893 160
105 3300048906 Ga0496103_0256254 Ga0496103_0256254_424_927 160
106 3300048909 Ga0496106_1011285 Ga0496106_1011285_22_525 160
107 3300048910 Ga0496107_0348334 Ga0496107_0348334_530_1033 160
108 3300048911 Ga0496108_0350096 Ga0496108_0350096_383_886 160
109 3300048912 Ga0496109_0607344 Ga0496109_0607344_64_567 160
110 3300048913 Ga0496110_0219863 Ga0496110_0219863_512_1015 160
111 3300048914 Ga0496111_0435953 Ga0496111_0435953_146_649 160
112 3300048915 Ga0496112_0219229 Ga0496112_0219229_256_759 160
113 3300049570 Ga0501033_0021211 Ga0501033_0021211_1042_1545 160
114 3300049572 Ga0501036_0062762 Ga0501036_0062762_516_1019 160
115 3300049574 Ga0501038_0074323 Ga0501038_0074323_729_1232 160
116 3300049575 Ga0501039_0078025 Ga0501039_0078025_1714_2217 160
117 3300049576 Ga0501040_0010704 Ga0501040_0010704_993_1496 160
118 3300049578 Ga0501042_0081006 Ga0501042_0081006_184_687 160
119 3300049579 Ga0501043_0107682 Ga0501043_0107682_216_719 160
120 3300049582 Ga0501048_0006223 Ga0501048_0006223_4587_5090 160
121 3300049584 Ga0501068_0043293 Ga0501068_0043293_822_1325 160
122 3300049587 Ga0501071_0137500 Ga0501071_0137500_163_666 160
123 3300049587 Ga0501071_0498111 Ga0501071_0498111_254_772 160
124 3300049588 Ga0501072_0089424 Ga0501072_0089424_1082_1585 160
125 3300049588 Ga0501072_0922408 Ga0501072_0922408_11_496 160
126 3300049590 Ga0501074_0066817 Ga0501074_0066817_10_513 160
127 3300049591 Ga0501075_0008080 Ga0501075_0008080_4958_5461 160
128 3300049592 Ga0501076_0004790 Ga0501076_0004790_5790_6293 160
129 3300049593 Ga0501077_0009972 Ga0501077_0009972_3730_4233 160
130 3300049593 Ga0501077_0025001 Ga0501077_0025001_2743_3246 160
131 3300049743 Ga0501081_0033632 Ga0501081_0033632_993_1496 160
132 3300049822 Ga0501035_0061005 Ga0501035_0061005_519_1022 160
133 3300049824 Ga0501045_0008524 Ga0501045_0008524_2751_3254 160
134 3300050507 nmdc:mga05p37_1106957_c1 nmdc:mga05p37_1106957_c1_86_589 160
135 3300050507 nmdc:mga05p37_176990_c1 nmdc:mga05p37_176990_c1_234_737 160
136 3300050510 nmdc:mga06r32_98773_c2 nmdc:mga06r32_98773_c2_167_670 160
137 3300050511 nmdc:mga08y16_119395_c1 nmdc:mga08y16_119395_c1_385_888 160
138 3300050511 nmdc:mga08y16_626458_c1 nmdc:mga08y16_626458_c1_233_745 160
139 3300050511 nmdc:mga08y16_649414_c1 nmdc:mga08y16_649414_c1_161_664 160
140 3300050515 nmdc:mga0a205_29717_c2 nmdc:mga0a205_29717_c2_1944_2447 160
141 3300054114 Ga0501084_0025479 Ga0501084_0025479_688_1191 160
142 3300060353 Ga0501082_0022789 Ga0501082_0022789_4677_5180 160
143 3300061734 Ga0530510_0077575 Ga0530510_0077575_46_549 160
144 3300061734 Ga0530510_0976918 Ga0530510_0976918_37_522 160
145 3300003322 rootL2_10058686 rootL2_100586866 161
146 3300005328 Ga0070676_10182569 Ga0070676_101825692 161
147 3300005331 Ga0070670_100082100 Ga0070670_1000821004 161
148 3300005333 Ga0070677_10001919 Ga0070677_100019193 161
149 3300005334 Ga0068869_100016143 Ga0068869_1000161434 161
150 3300005334 Ga0068869_100119397 Ga0068869_1001193973 161
151 3300005334 Ga0068869_100248006 Ga0068869_1002480062 161
152 3300005334 Ga0068869_100282571 Ga0068869_1002825712 161
153 3300005334 Ga0068869_100536813 Ga0068869_1005368131 161
154 3300005337 Ga0070682_100009256 Ga0070682_1000092564 161
155 3300005340 Ga0070689_100119399 Ga0070689_1001193993 161
156 3300005340 Ga0070689_100230900 Ga0070689_1002309002 161
157 3300005353 Ga0070669_100729996 Ga0070669_1007299962 161
158 3300005354 Ga0070675_100002529 Ga0070675_1000025298 161
159 3300005354 Ga0070675_100527867 Ga0070675_1005278672 161
160 3300005356 Ga0070674_100018210 Ga0070674_1000182104 161
161 3300005356 Ga0070674_100473995 Ga0070674_1004739953 161
162 3300005356 Ga0070674_100703632 Ga0070674_1007036322 161
163 3300005356 Ga0070674_100766179 Ga0070674_1007661792 161
164 3300005364 Ga0070673_100015314 Ga0070673_1000153145 161
165 3300005364 Ga0070673_100048831 Ga0070673_1000488313 161
166 3300005365 Ga0070688_100729718 Ga0070688_1007297181 161
167 3300005366 Ga0070659_100879991 Ga0070659_1008799912 161
168 3300005367 Ga0070667_100035679 Ga0070667_1000356794 161
169 3300005438 Ga0070701_10014341 Ga0070701_100143414 161
170 3300005438 Ga0070701_10406858 Ga0070701_104068582 161
171 3300005439 Ga0070711_100161473 Ga0070711_1001614732 161
172 3300005441 Ga0070700_100073767 Ga0070700_1000737672 161
173 3300005441 Ga0070700_101167386 Ga0070700_1011673861 161
174 3300005455 Ga0070663_100336736 Ga0070663_1003367363 161
175 3300005456 Ga0070678_100030884 Ga0070678_1000308844 161
176 3300005456 Ga0070678_101173206 Ga0070678_1011732061 161
177 3300005459 Ga0068867_100018494 Ga0068867_1000184941 161
178 3300005459 Ga0068867_100331777 Ga0068867_1003317772 161
179 3300005459 Ga0068867_100508773 Ga0068867_1005087731 161
180 3300005466 Ga0070685_10010519 Ga0070685_100105195 161
181 3300005466 Ga0070685_10103790 Ga0070685_101037902 161
182 3300005466 Ga0070685_10426688 Ga0070685_104266882 161
183 3300005471 Ga0070698_100884261 Ga0070698_1008842611 161
184 3300005518 Ga0070699_101101123 Ga0070699_1011011231 161
185 3300005536 Ga0070697_100415699 Ga0070697_1004156993 161
186 3300005539 Ga0068853_101616134 Ga0068853_1016161341 161
187 3300005543 Ga0070672_100003495 Ga0070672_1000034952 161
188 3300005543 Ga0070672_100005464 Ga0070672_1000054649 161
189 3300005544 Ga0070686_100014728 Ga0070686_1000147285 161
190 3300005544 Ga0070686_100786308 Ga0070686_1007863082 161
191 3300005545 Ga0070695_100491387 Ga0070695_1004913872 161
192 3300005546 Ga0070696_100474032 Ga0070696_1004740321 161
193 3300005546 Ga0070696_100848020 Ga0070696_1008480201 161
194 3300005548 Ga0070665_100013512 Ga0070665_1000135126 161
195 3300005548 Ga0070665_100418224 Ga0070665_1004182242 161
196 3300005548 Ga0070665_101557080 Ga0070665_1015570801 161
197 3300005564 Ga0070664_100410022 Ga0070664_1004100221 161
198 3300005577 Ga0068857_100422668 Ga0068857_1004226683 161
199 3300005617 Ga0068859_100999209 Ga0068859_1009992092 161
200 3300005618 Ga0068864_100141094 Ga0068864_1001410941 161
201 3300005718 Ga0068866_10041977 Ga0068866_100419773 161
202 3300005719 Ga0068861_100082176 Ga0068861_1000821764 161
203 3300005840 Ga0068870_10006540 Ga0068870_100065403 161
204 3300005841 Ga0068863_100234098 Ga0068863_1002340984 161
205 3300005841 Ga0068863_100255791 Ga0068863_1002557914 161
206 3300005843 Ga0068860_100189878 Ga0068860_1001898781 161
207 3300005844 Ga0068862_100333529 Ga0068862_1003335291 161
208 3300005844 Ga0068862_100705211 Ga0068862_1007052112 161
209 3300005937 Ga0081455_10011370 Ga0081455_100113709 161
210 3300006173 Ga0070716_100582695 Ga0070716_1005826951 161
211 3300006237 Ga0097621_100043520 Ga0097621_1000435202 161
212 3300006237 Ga0097621_100082575 Ga0097621_1000825754 161
213 3300006237 Ga0097621_100259061 Ga0097621_1002590613 161
214 3300006237 Ga0097621_100534832 Ga0097621_1005348322 161
215 3300006358 Ga0068871_100054380 Ga0068871_1000543802 161
216 3300006358 Ga0068871_100139445 Ga0068871_1001394454 161
217 3300006358 Ga0068871_100402502 Ga0068871_1004025022 161
218 3300006358 Ga0068871_101080116 Ga0068871_1010801161 161
219 3300006358 Ga0068871_101249092 Ga0068871_1012490922 161
220 3300006358 Ga0068871_101420296 Ga0068871_1014202961 161
221 3300006871 Ga0075434_100586146 Ga0075434_1005861463 161
222 3300006881 Ga0068865_100007298 Ga0068865_1000072985 161
223 3300006881 Ga0068865_100113367 Ga0068865_1001133673 161
224 3300006881 Ga0068865_100222952 Ga0068865_1002229523 161
225 3300006931 Ga0097620_100999204 Ga0097620_1009992042 161
226 3300007076 Ga0075435_100061172 Ga0075435_1000611722 161
227 3300009094 Ga0111539_10346936 Ga0111539_103469362 161
228 3300009094 Ga0111539_10768691 Ga0111539_107686912 161
229 3300009147 Ga0114129_10025699 Ga0114129_100256997 161
230 3300009147 Ga0114129_11163833 Ga0114129_111638331 161
231 3300009148 Ga0105243_10033429 Ga0105243_100334293 161
232 3300009176 Ga0105242_10054832 Ga0105242_100548323 161
233 3300009177 Ga0105248_10504300 Ga0105248_105043003 161
234 3300009177 Ga0105248_10924245 Ga0105248_109242452 161
235 3300009553 Ga0105249_11750639 Ga0105249_117506392 161
236 3300011119 Ga0105246_10143229 Ga0105246_101432293 161
237 3300013296 Ga0157374_11382513 Ga0157374_113825131 161
238 3300013306 Ga0163162_10050057 Ga0163162_100500573 161
239 3300013308 Ga0157375_10004605 Ga0157375_1000460510 161
240 3300013308 Ga0157375_10100869 Ga0157375_101008694 161
241 3300013308 Ga0157375_10991118 Ga0157375_109911182 161
242 3300014325 Ga0163163_10110680 Ga0163163_101106801 161
243 3300014325 Ga0163163_10149169 Ga0163163_101491693 161
244 3300014325 Ga0163163_11073988 Ga0163163_110739882 161
245 3300014326 Ga0157380_10050326 Ga0157380_100503264 161
246 3300014326 Ga0157380_10083794 Ga0157380_100837942 161
247 3300014326 Ga0157380_10497769 Ga0157380_104977692 161
248 3300014326 Ga0157380_11115431 Ga0157380_111154311 161
249 3300014326 Ga0157380_11167570 Ga0157380_111675702 161
250 3300014326 Ga0157380_11546732 Ga0157380_115467321 161
251 3300014969 Ga0157376_10015473 Ga0157376_100154736 161
252 3300014969 Ga0157376_10138078 Ga0157376_101380784 161
253 3300017792 Ga0163161_10218456 Ga0163161_102184564 161
254 3300017792 Ga0163161_10404384 Ga0163161_104043843 161
255 3300025315 Ga0207697_10068723 Ga0207697_100687232 161
256 3300025893 Ga0207682_10003132 Ga0207682_100031324 161
257 3300025899 Ga0207642_10040912 Ga0207642_100409123 161
258 3300025908 Ga0207643_10009683 Ga0207643_100096833 161
259 3300025908 Ga0207643_10354455 Ga0207643_103544552 161
260 3300025916 Ga0207663_10205347 Ga0207663_102053472 161
261 3300025923 Ga0207681_10012328 Ga0207681_100123283 161
262 3300025926 Ga0207659_10018902 Ga0207659_100189022 161
263 3300025926 Ga0207659_10344937 Ga0207659_103449371 161
264 3300025933 Ga0207706_10332343 Ga0207706_103323431 161
265 3300025934 Ga0207686_10014515 Ga0207686_100145154 161
266 3300025936 Ga0207670_10158096 Ga0207670_101580963 161
267 3300025937 Ga0207669_10004353 Ga0207669_100043532 161
268 3300025937 Ga0207669_10876497 Ga0207669_108764972 161
269 3300025938 Ga0207704_10055717 Ga0207704_100557172 161
270 3300025938 Ga0207704_10056966 Ga0207704_100569661 161
271 3300025938 Ga0207704_10119811 Ga0207704_101198111 161
272 3300025940 Ga0207691_10007763 Ga0207691_1000776314 161
273 3300025940 Ga0207691_10059504 Ga0207691_100595044 161
274 3300025941 Ga0207711_10299314 Ga0207711_102993142 161
275 3300025942 Ga0207689_10004736 Ga0207689_100047365 161
276 3300025942 Ga0207689_10059539 Ga0207689_100595392 161
277 3300025942 Ga0207689_10109033 Ga0207689_101090332 161
278 3300025942 Ga0207689_10322324 Ga0207689_103223242 161
279 3300025960 Ga0207651_10056014 Ga0207651_100560144 161
280 3300025960 Ga0207651_10163583 Ga0207651_101635833 161
281 3300025986 Ga0207658_10293652 Ga0207658_102936522 161
282 3300026075 Ga0207708_10077192 Ga0207708_100771924 161
283 3300026075 Ga0207708_10248896 Ga0207708_102488962 161
284 3300026075 Ga0207708_10258486 Ga0207708_102584862 161
285 3300026088 Ga0207641_10031738 Ga0207641_100317384 161
286 3300026088 Ga0207641_10107336 Ga0207641_101073361 161
287 3300026089 Ga0207648_10020948 Ga0207648_100209488 161
288 3300026089 Ga0207648_10151364 Ga0207648_101513644 161
289 3300026089 Ga0207648_10995275 Ga0207648_109952752 161
290 3300026089 Ga0207648_11111823 Ga0207648_111118231 161
291 3300026095 Ga0207676_11713335 Ga0207676_117133351 161
292 3300026116 Ga0207674_10394831 Ga0207674_103948313 161
293 3300026118 Ga0207675_100226538 Ga0207675_1002265382 161
294 3300026118 Ga0207675_100503365 Ga0207675_1005033653 161
295 3300026118 Ga0207675_100864074 Ga0207675_1008640741 161
296 3300026121 Ga0207683_10042246 Ga0207683_100422462 161
297 3300028379 Ga0268266_10044966 Ga0268266_100449664 161
298 3300028379 Ga0268266_10165015 Ga0268266_101650154 161
299 3300028379 Ga0268266_11059496 Ga0268266_110594961 161
300 3300028380 Ga0268265_10935066 Ga0268265_109350662 161
301 3300028381 Ga0268264_10196304 Ga0268264_101963042 161
302 3300031456 Ga0307513_10027758 Ga0307513_100277586 161
303 3300031456 Ga0307513_10142449 Ga0307513_101424494 161
304 3300031456 Ga0307513_10145467 Ga0307513_101454672 161
305 3300031507 Ga0307509_10009146 Ga0307509_100091464 161
306 3300031507 Ga0307509_10171419 Ga0307509_101714192 161
307 3300031507 Ga0307509_10348300 Ga0307509_103483002 161
308 3300031548 Ga0307408_100000035 Ga0307408_100000035141 161
309 3300031731 Ga0307405_10485541 Ga0307405_104855411 161
310 3300031824 Ga0307413_10018554 Ga0307413_100185544 161
311 3300031824 Ga0307413_10063789 Ga0307413_100637894 161
312 3300031852 Ga0307410_10055113 Ga0307410_100551133 161
313 3300031852 Ga0307410_11180150 Ga0307410_111801502 161
314 3300031903 Ga0307407_10000211 Ga0307407_100002112 161
315 3300031903 Ga0307407_10020319 Ga0307407_100203192 161
316 3300031903 Ga0307407_10241127 Ga0307407_102411273 161
317 3300031995 Ga0307409_100276992 Ga0307409_1002769923 161
318 3300032005 Ga0307411_10032163 Ga0307411_100321632 161
319 3300032005 Ga0307411_10111617 Ga0307411_101116172 161
320 3300032005 Ga0307411_11366423 Ga0307411_113664231 161
321 3300041443 Ga0451789_1231417 Ga0451789_1231417_301_795 161
322 3300041451 Ga0451791_0550808 Ga0451791_0550808_855_1349 161
323 3300041452 Ga0451793_0639628 Ga0451793_0639628_21_515 161
324 3300041456 Ga0451795_1615507 Ga0451795_1615507_405_899 161
325 3300041458 Ga0451798_0003318 Ga0451798_0003318_429_923 161
326 3300041459 Ga0451800_0601781 Ga0451800_0601781_825_1319 161
327 3300041460 Ga0451802_0233296 Ga0451802_0233296_525_1082 161
328 3300041460 Ga0451802_0842791 Ga0451802_0842791_1068_1562 161
329 3300041486 Ga0451807_0061546 Ga0451807_0061546_6264_6758 161
330 3300041486 Ga0451807_0112940 Ga0451807_0112940_1305_1802 161
331 3300041509 Ga0451843_1694280 Ga0451843_1694280_43_537 161
332 3300042993 Ga0439440_0039545 Ga0439440_0039545_384_881 161
333 3300046457 Ga0495590_0140175 Ga0495590_0140175_250_747 161
334 3300046460 Ga0495638_0005416 Ga0495638_0005416_5161_5655 161
335 3300046519 Ga0495632_0036558 Ga0495632_0036558_787_1284 161
336 3300046520 Ga0495637_0117879 Ga0495637_0117879_174_671 161
337 3300046557 Ga0495622_0199713 Ga0495622_0199713_360_857 161
338 3300046660 Ga0495625_0047730 Ga0495625_0047730_2382_2879 161
339 3300046694 Ga0495649_0003550 Ga0495649_0003550_7445_7942 161
340 3300046694 Ga0495649_0218427 Ga0495649_0218427_221_718 161
341 3300048091 Ga0495626_0117424 Ga0495626_0117424_167_664 161
342 3300048903 Ga0496100_0071424 Ga0496100_0071424_1692_2186 161
343 3300048904 Ga0496101_0107204 Ga0496101_0107204_614_1108 161
344 3300048909 Ga0496106_0606410 Ga0496106_0606410_151_645 161
345 3300048917 Ga0496114_0375359 Ga0496114_0375359_429_923 161
346 3300049572 Ga0501036_0285103 Ga0501036_0285103_369_953 161
347 3300049573 Ga0501037_0088973 Ga0501037_0088973_1582_2076 161
348 3300049576 Ga0501040_0266514 Ga0501040_0266514_418_912 161
349 3300049583 Ga0501067_0010818 Ga0501067_0010818_855_1439 161
350 3300049584 Ga0501068_0001138 Ga0501068_0001138_10182_10766 161
351 3300049586 Ga0501070_0039090 Ga0501070_0039090_1758_2342 161
352 3300049587 Ga0501071_0234659 Ga0501071_0234659_541_1125 161
353 3300049589 Ga0501073_0013731 Ga0501073_0013731_4653_5237 161
354 3300049590 Ga0501074_0000872 Ga0501074_0000872_15016_15600 161
355 3300049592 Ga0501076_0030444 Ga0501076_0030444_479_1063 161
356 3300049741 Ga0501079_0000867 Ga0501079_0000867_18605_19189 161
357 3300049742 Ga0501080_0009692 Ga0501080_0009692_3991_4575 161
358 3300049743 Ga0501081_0262526 Ga0501081_0262526_164_748 161
359 3300049744 Ga0501083_0004795 Ga0501083_0004795_4472_5056 161
360 3300049822 Ga0501035_0000029 Ga0501035_0000029_60947_61444 161
361 3300050507 nmdc:mga05p37_27545_c1 nmdc:mga05p37_27545_c1_1897_2394 161
362 3300050511 nmdc:mga08y16_913115_c1 nmdc:mga08y16_913115_c1_134_628 161
363 3300050512 nmdc:mga0n895_1611240_c1 nmdc:mga0n895_1611240_c1_53_547 161
364 3300050513 nmdc:mga0rr50_283341_c1 nmdc:mga0rr50_283341_c1_162_656 161
365 3300050514 nmdc:mga08x19_333648_c1 nmdc:mga08x19_333648_c1_250_744 161
366 3300054114 Ga0501084_0015268 Ga0501084_0015268_3990_4574 161
367 3300054114 Ga0501084_0256999 Ga0501084_0256999_528_1022 161
368 3300060353 Ga0501082_0040727 Ga0501082_0040727_1445_2029 161
369 3300060353 Ga0501082_0741802 Ga0501082_0741802_44_541 161
370 3300002773 JGI25152J39213_1000011 JGI25152J39213_100001153 162
371 3300002774 JGI25150J39212_1000192 JGI25150J39212_100019230 162
372 3300003215 JGI25153J46596_10008784 JGI25153J46596_100087846 162
373 3300003320 rootH2_10120259 rootH2_101202591 162
374 3300003775 Ga0055524_1000795 Ga0055524_100079515 162
375 3300004803 Ga0058862_12052405 Ga0058862_120524052 162
376 3300005293 Ga0065715_10119334 Ga0065715_101193341 162
377 3300005293 Ga0065715_10193406 Ga0065715_101934062 162
378 3300005293 Ga0065715_10940291 Ga0065715_109402911 162
379 3300005327 Ga0070658_10737086 Ga0070658_107370861 162
380 3300005327 Ga0070658_10756199 Ga0070658_107561991 162
381 3300005328 Ga0070676_10304891 Ga0070676_103048911 162
382 3300005329 Ga0070683_100033350 Ga0070683_1000333506 162
383 3300005329 Ga0070683_100065908 Ga0070683_1000659082 162
384 3300005329 Ga0070683_100110269 Ga0070683_1001102692 162
385 3300005331 Ga0070670_100031186 Ga0070670_1000311862 162
386 3300005331 Ga0070670_100042393 Ga0070670_1000423934 162
387 3300005336 Ga0070680_100120994 Ga0070680_1001209943 162
388 3300005336 Ga0070680_100415512 Ga0070680_1004155122 162
389 3300005344 Ga0070661_100031934 Ga0070661_1000319346 162
390 3300005344 Ga0070661_100167693 Ga0070661_1001676932 162
391 3300005344 Ga0070661_100298197 Ga0070661_1002981971 162
392 3300005345 Ga0070692_10691517 Ga0070692_106915171 162
393 3300005347 Ga0070668_100087591 Ga0070668_1000875911 162
394 3300005353 Ga0070669_100317159 Ga0070669_1003171592 162
395 3300005354 Ga0070675_100014873 Ga0070675_1000148735 162
396 3300005354 Ga0070675_100403557 Ga0070675_1004035572 162
397 3300005354 Ga0070675_101307027 Ga0070675_1013070271 162
398 3300005355 Ga0070671_100030633 Ga0070671_1000306335 162
399 3300005355 Ga0070671_100152731 Ga0070671_1001527313 162
400 3300005356 Ga0070674_100298360 Ga0070674_1002983602 162
401 3300005364 Ga0070673_100458440 Ga0070673_1004584401 162
402 3300005365 Ga0070688_100207811 Ga0070688_1002078112 162
403 3300005367 Ga0070667_100116943 Ga0070667_1001169431 162
404 3300005435 Ga0070714_100037634 Ga0070714_1000376341 162
405 3300005436 Ga0070713_100002093 Ga0070713_1000020939 162
406 3300005438 Ga0070701_10185750 Ga0070701_101857501 162
407 3300005439 Ga0070711_100030774 Ga0070711_1000307741 162
408 3300005439 Ga0070711_100421622 Ga0070711_1004216221 162
409 3300005440 Ga0070705_100057663 Ga0070705_1000576632 162
410 3300005440 Ga0070705_100116584 Ga0070705_1001165842 162
411 3300005445 Ga0070708_100039835 Ga0070708_1000398352 162
412 3300005456 Ga0070678_100188766 Ga0070678_1001887662 162
413 3300005458 Ga0070681_10167376 Ga0070681_101673761 162
414 3300005459 Ga0068867_100200125 Ga0068867_1002001253 162
415 3300005459 Ga0068867_100202031 Ga0068867_1002020312 162
416 3300005459 Ga0068867_100442480 Ga0068867_1004424802 162
417 3300005459 Ga0068867_100629845 Ga0068867_1006298452 162
418 3300005466 Ga0070685_10238155 Ga0070685_102381551 162
419 3300005468 Ga0070707_100219459 Ga0070707_1002194592 162
420 3300005471 Ga0070698_100031386 Ga0070698_1000313866 162
421 3300005518 Ga0070699_100067735 Ga0070699_1000677353 162
422 3300005518 Ga0070699_100164156 Ga0070699_1001641563 162
423 3300005518 Ga0070699_100316473 Ga0070699_1003164731 162
424 3300005518 Ga0070699_101301841 Ga0070699_1013018411 162
425 3300005530 Ga0070679_100094887 Ga0070679_1000948874 162
426 3300005535 Ga0070684_100080666 Ga0070684_1000806664 162
427 3300005535 Ga0070684_100183447 Ga0070684_1001834472 162
428 3300005535 Ga0070684_100333151 Ga0070684_1003331511 162
429 3300005535 Ga0070684_100428813 Ga0070684_1004288131 162
430 3300005536 Ga0070697_100171295 Ga0070697_1001712951 162
431 3300005539 Ga0068853_100194027 Ga0068853_1001940271 162
432 3300005539 Ga0068853_100962404 Ga0068853_1009624042 162
433 3300005543 Ga0070672_100032723 Ga0070672_1000327233 162
434 3300005546 Ga0070696_100094040 Ga0070696_1000940402 162
435 3300005549 Ga0070704_100988525 Ga0070704_1009885252 162
436 3300005563 Ga0068855_100127119 Ga0068855_1001271192 162
437 3300005563 Ga0068855_100636349 Ga0068855_1006363492 162
438 3300005564 Ga0070664_100190205 Ga0070664_1001902052 162
439 3300005564 Ga0070664_100215796 Ga0070664_1002157961 162
440 3300005564 Ga0070664_100282472 Ga0070664_1002824724 162
441 3300005564 Ga0070664_101010890 Ga0070664_1010108901 162
442 3300005577 Ga0068857_100557042 Ga0068857_1005570422 162
443 3300005578 Ga0068854_100082366 Ga0068854_1000823661 162
444 3300005578 Ga0068854_100727676 Ga0068854_1007276761 162
445 3300005578 Ga0068854_101024594 Ga0068854_1010245941 162
446 3300005614 Ga0068856_100232508 Ga0068856_1002325082 162
447 3300005615 Ga0070702_100075076 Ga0070702_1000750762 162
448 3300005615 Ga0070702_100653983 Ga0070702_1006539831 162
449 3300005616 Ga0068852_100000396 Ga0068852_1000003962 162
450 3300005616 Ga0068852_100347911 Ga0068852_1003479111 162
451 3300005616 Ga0068852_101869087 Ga0068852_1018690871 162
452 3300005617 Ga0068859_100199022 Ga0068859_1001990222 162
453 3300005617 Ga0068859_100465542 Ga0068859_1004655422 162
454 3300005618 Ga0068864_100117902 Ga0068864_1001179023 162
455 3300005618 Ga0068864_100518743 Ga0068864_1005187433 162
456 3300005719 Ga0068861_101384939 Ga0068861_1013849391 162
457 3300005840 Ga0068870_10123930 Ga0068870_101239303 162
458 3300005841 Ga0068863_100747581 Ga0068863_1007475812 162
459 3300005843 Ga0068860_100022880 Ga0068860_1000228802 162
460 3300006038 Ga0075365_10220724 Ga0075365_102207242 162
461 3300006058 Ga0075432_10226391 Ga0075432_102263911 162
462 3300006058 Ga0075432_10294029 Ga0075432_102940291 162
463 3300006175 Ga0070712_100101302 Ga0070712_1001013023 162
464 3300006175 Ga0070712_100107804 Ga0070712_1001078043 162
465 3300006195 Ga0075366_10010031 Ga0075366_100100315 162
466 3300006195 Ga0075366_10072120 Ga0075366_100721202 162
467 3300006237 Ga0097621_100531790 Ga0097621_1005317902 162
468 3300006358 Ga0068871_100059349 Ga0068871_1000593494 162
469 3300006358 Ga0068871_100475057 Ga0068871_1004750571 162
470 3300006844 Ga0075428_100011452 Ga0075428_1000114528 162
471 3300006844 Ga0075428_100091957 Ga0075428_1000919571 162
472 3300006844 Ga0075428_100743009 Ga0075428_1007430092 162
473 3300006846 Ga0075430_100005840 Ga0075430_1000058404 162
474 3300006846 Ga0075430_100026577 Ga0075430_1000265773 162
475 3300006846 Ga0075430_100060510 Ga0075430_1000605102 162
476 3300006846 Ga0075430_100491307 Ga0075430_1004913071 162
477 3300006847 Ga0075431_100017186 Ga0075431_1000171864 162
478 3300006847 Ga0075431_100112418 Ga0075431_1001124181 162
479 3300006847 Ga0075431_100153043 Ga0075431_1001530434 162
480 3300006847 Ga0075431_100216254 Ga0075431_1002162541 162
481 3300006847 Ga0075431_100248436 Ga0075431_1002484362 162
482 3300006847 Ga0075431_100333904 Ga0075431_1003339041 162
483 3300006847 Ga0075431_101000440 Ga0075431_1010004401 162
484 3300006852 Ga0075433_10034948 Ga0075433_100349482 162
485 3300006852 Ga0075433_10035427 Ga0075433_100354274 162
486 3300006852 Ga0075433_10299674 Ga0075433_102996742 162
487 3300006871 Ga0075434_100111577 Ga0075434_1001115771 162
488 3300006871 Ga0075434_101146363 Ga0075434_1011463632 162
489 3300006880 Ga0075429_100125808 Ga0075429_1001258082 162
490 3300006914 Ga0075436_100064270 Ga0075436_1000642702 162
491 3300006914 Ga0075436_100243767 Ga0075436_1002437672 162
492 3300006914 Ga0075436_100541691 Ga0075436_1005416911 162
493 3300006931 Ga0097620_100199007 Ga0097620_1001990072 162
494 3300006931 Ga0097620_100465519 Ga0097620_1004655192 162
495 3300007076 Ga0075435_100185703 Ga0075435_1001857032 162
496 3300007076 Ga0075435_101496074 Ga0075435_1014960741 162
497 3300009093 Ga0105240_10036346 Ga0105240_100363463 162
498 3300009093 Ga0105240_10326116 Ga0105240_103261162 162
499 3300009094 Ga0111539_10140806 Ga0111539_101408061 162
500 3300009094 Ga0111539_10225301 Ga0111539_102253011 162
501 3300009094 Ga0111539_10445984 Ga0111539_104459842 162
502 3300009094 Ga0111539_10684231 Ga0111539_106842312 162
503 3300009147 Ga0114129_10193744 Ga0114129_101937442 162
504 3300009147 Ga0114129_10713892 Ga0114129_107138922 162
505 3300009148 Ga0105243_12001656 Ga0105243_120016561 162
506 3300009174 Ga0105241_10508205 Ga0105241_105082051 162
507 3300009174 Ga0105241_11434347 Ga0105241_114343471 162
508 3300009176 Ga0105242_10086811 Ga0105242_100868112 162
509 3300009177 Ga0105248_10175949 Ga0105248_101759494 162
510 3300009177 Ga0105248_10942549 Ga0105248_109425492 162
511 3300009545 Ga0105237_10004247 Ga0105237_100042472 162
512 3300009545 Ga0105237_10369657 Ga0105237_103696571 162
513 3300009545 Ga0105237_11781317 Ga0105237_117813171 162
514 3300009551 Ga0105238_10002845 Ga0105238_100028459 162
515 3300009551 Ga0105238_10089714 Ga0105238_100897142 162
516 3300009551 Ga0105238_10210223 Ga0105238_102102232 162
517 3300010375 Ga0105239_10004502 Ga0105239_1000450213 162
518 3300010375 Ga0105239_10549664 Ga0105239_105496641 162
519 3300012477 Ga0157336_1000062 Ga0157336_10000623 162
520 3300012478 Ga0157328_1007160 Ga0157328_10071602 162
521 3300013100 Ga0157373_10029707 Ga0157373_100297072 162
522 3300013104 Ga0157370_10025403 Ga0157370_100254032 162
523 3300013104 Ga0157370_10074572 Ga0157370_100745722 162
524 3300013104 Ga0157370_10391008 Ga0157370_103910082 162
525 3300013105 Ga0157369_10356063 Ga0157369_103560633 162
526 3300013105 Ga0157369_10584756 Ga0157369_105847562 162
527 3300013297 Ga0157378_10625089 Ga0157378_106250891 162
528 3300013307 Ga0157372_10033879 Ga0157372_100338792 162
529 3300013307 Ga0157372_10166495 Ga0157372_101664952 162
530 3300013307 Ga0157372_10688128 Ga0157372_106881281 162
531 3300013307 Ga0157372_10776969 Ga0157372_107769691 162
532 3300013308 Ga0157375_12250297 Ga0157375_122502972 162
533 3300014325 Ga0163163_10036870 Ga0163163_100368705 162
534 3300014325 Ga0163163_10196396 Ga0163163_101963963 162
535 3300014325 Ga0163163_10256092 Ga0163163_102560923 162
536 3300014969 Ga0157376_10143521 Ga0157376_101435212 162
537 3300014969 Ga0157376_10296161 Ga0157376_102961612 162
538 3300020070 Ga0206356_10923714 Ga0206356_109237142 162
539 3300020076 Ga0206355_1352774 Ga0206355_13527741 162
540 3300020078 Ga0206352_10264359 Ga0206352_102643591 162
541 3300020080 Ga0206350_11660287 Ga0206350_116602871 162
542 3300020082 Ga0206353_10852945 Ga0206353_108529452 162
543 3300022467 Ga0224712_10089302 Ga0224712_100893021 162
544 3300022467 Ga0224712_10318442 Ga0224712_103184421 162
545 3300025245 Ga0207425_1000001 Ga0207425_10000011437 162
546 3300025258 Ga0209129_1000001 Ga0209129_1000001614 162
547 3300025263 Ga0209565_1012991 Ga0209565_10129912 162
548 3300025284 Ga0209130_1037776 Ga0209130_10377762 162
549 3300025297 Ga0209758_1000073 Ga0209758_1000073163 162
550 3300025299 Ga0209256_1000116 Ga0209256_100011691 162
551 3300025893 Ga0207682_10144957 Ga0207682_101449572 162
552 3300025907 Ga0207645_10530371 Ga0207645_105303711 162
553 3300025907 Ga0207645_10657177 Ga0207645_106571772 162
554 3300025908 Ga0207643_10123817 Ga0207643_101238173 162
555 3300025908 Ga0207643_10403801 Ga0207643_104038012 162
556 3300025909 Ga0207705_10190455 Ga0207705_101904553 162
557 3300025910 Ga0207684_10044118 Ga0207684_100441182 162
558 3300025910 Ga0207684_10466335 Ga0207684_104663351 162
559 3300025911 Ga0207654_10416751 Ga0207654_104167512 162
560 3300025911 Ga0207654_10547159 Ga0207654_105471591 162
561 3300025912 Ga0207707_10305746 Ga0207707_103057462 162
562 3300025912 Ga0207707_10692286 Ga0207707_106922862 162
563 3300025912 Ga0207707_10923754 Ga0207707_109237541 162
564 3300025913 Ga0207695_10033025 Ga0207695_100330252 162
565 3300025913 Ga0207695_10039302 Ga0207695_100393023 162
566 3300025913 Ga0207695_10047165 Ga0207695_100471653 162
567 3300025913 Ga0207695_10074603 Ga0207695_100746033 162
568 3300025914 Ga0207671_10003331 Ga0207671_1000333114 162
569 3300025914 Ga0207671_10279308 Ga0207671_102793082 162
570 3300025914 Ga0207671_10742842 Ga0207671_107428422 162
571 3300025915 Ga0207693_10105812 Ga0207693_101058123 162
572 3300025915 Ga0207693_10112576 Ga0207693_101125762 162
573 3300025915 Ga0207693_10650889 Ga0207693_106508891 162
574 3300025917 Ga0207660_10323375 Ga0207660_103233752 162
575 3300025920 Ga0207649_10015896 Ga0207649_100158963 162
576 3300025920 Ga0207649_10137520 Ga0207649_101375202 162
577 3300025920 Ga0207649_10247391 Ga0207649_102473912 162
578 3300025920 Ga0207649_10292041 Ga0207649_102920412 162
579 3300025920 Ga0207649_10448090 Ga0207649_104480902 162
580 3300025920 Ga0207649_10471698 Ga0207649_104716982 162
581 3300025921 Ga0207652_10084265 Ga0207652_100842652 162
582 3300025921 Ga0207652_10163064 Ga0207652_101630642 162
583 3300025922 Ga0207646_10772738 Ga0207646_107727381 162
584 3300025922 Ga0207646_10790545 Ga0207646_107905452 162
585 3300025923 Ga0207681_10151119 Ga0207681_101511192 162
586 3300025924 Ga0207694_10102993 Ga0207694_101029932 162
587 3300025925 Ga0207650_10022091 Ga0207650_100220912 162
588 3300025925 Ga0207650_10026596 Ga0207650_100265965 162
589 3300025926 Ga0207659_10015813 Ga0207659_100158133 162
590 3300025926 Ga0207659_10394097 Ga0207659_103940971 162
591 3300025928 Ga0207700_11201193 Ga0207700_112011931 162
592 3300025929 Ga0207664_10064557 Ga0207664_100645572 162
593 3300025931 Ga0207644_10591383 Ga0207644_105913831 162
594 3300025933 Ga0207706_10023819 Ga0207706_100238194 162
595 3300025934 Ga0207686_10036022 Ga0207686_100360223 162
596 3300025936 Ga0207670_10221074 Ga0207670_102210743 162
597 3300025937 Ga0207669_10138393 Ga0207669_101383932 162
598 3300025938 Ga0207704_10712385 Ga0207704_107123851 162
599 3300025940 Ga0207691_10007022 Ga0207691_100070228 162
600 3300025944 Ga0207661_10060287 Ga0207661_100602871 162
601 3300025944 Ga0207661_10145490 Ga0207661_101454902 162
602 3300025945 Ga0207679_10050528 Ga0207679_100505285 162
603 3300025945 Ga0207679_10115154 Ga0207679_101151542 162
604 3300025949 Ga0207667_10216745 Ga0207667_102167451 162
605 3300025949 Ga0207667_10478557 Ga0207667_104785572 162
606 3300025972 Ga0207668_10241766 Ga0207668_102417661 162
607 3300025981 Ga0207640_10536904 Ga0207640_105369041 162
608 3300025981 Ga0207640_11769984 Ga0207640_117699841 162
609 3300026035 Ga0207703_10966142 Ga0207703_109661422 162
610 3300026041 Ga0207639_11387781 Ga0207639_113877811 162
611 3300026078 Ga0207702_10145458 Ga0207702_101454582 162
612 3300026088 Ga0207641_10541206 Ga0207641_105412063 162
613 3300026089 Ga0207648_10009283 Ga0207648_100092836 162
614 3300026089 Ga0207648_10062126 Ga0207648_100621263 162
615 3300026089 Ga0207648_10259260 Ga0207648_102592603 162
616 3300026089 Ga0207648_10288602 Ga0207648_102886023 162
617 3300026089 Ga0207648_10575804 Ga0207648_105758042 162
618 3300026095 Ga0207676_10180260 Ga0207676_101802602 162
619 3300026095 Ga0207676_10511386 Ga0207676_105113862 162
620 3300026116 Ga0207674_10014406 Ga0207674_100144063 162
621 3300026121 Ga0207683_10370101 Ga0207683_103701011 162
622 3300026142 Ga0207698_10207311 Ga0207698_102073112 162
623 3300026142 Ga0207698_11344855 Ga0207698_113448552 162
624 3300027876 Ga0209974_10104416 Ga0209974_101044163 162
625 3300027907 Ga0207428_10106267 Ga0207428_101062672 162
626 3300027907 Ga0207428_10130719 Ga0207428_101307193 162
627 3300027907 Ga0207428_10263468 Ga0207428_102634682 162
628 3300028380 Ga0268265_10206360 Ga0268265_102063602 162
629 3300028380 Ga0268265_11384946 Ga0268265_113849461 162
630 3300028381 Ga0268264_10037603 Ga0268264_100376032 162
631 3300031548 Ga0307408_100059995 Ga0307408_1000599955 162
632 3300031548 Ga0307408_100079616 Ga0307408_1000796162 162
633 3300031548 Ga0307408_100215788 Ga0307408_1002157883 162
634 3300031548 Ga0307408_100290091 Ga0307408_1002900912 162
635 3300031548 Ga0307408_100753528 Ga0307408_1007535281 162
636 3300031731 Ga0307405_10119361 Ga0307405_101193612 162
637 3300031731 Ga0307405_10150105 Ga0307405_101501051 162
638 3300031824 Ga0307413_10043498 Ga0307413_100434982 162
639 3300031852 Ga0307410_10001136 Ga0307410_100011365 162
640 3300031852 Ga0307410_10132425 Ga0307410_101324251 162
641 3300031852 Ga0307410_10746347 Ga0307410_107463471 162
642 3300031901 Ga0307406_10161069 Ga0307406_101610692 162
643 3300031901 Ga0307406_10396634 Ga0307406_103966341 162
644 3300031901 Ga0307406_10416911 Ga0307406_104169111 162
645 3300031901 Ga0307406_10753971 Ga0307406_107539711 162
646 3300031903 Ga0307407_10124590 Ga0307407_101245902 162
647 3300031911 Ga0307412_10417974 Ga0307412_104179742 162
648 3300031911 Ga0307412_10637084 Ga0307412_106370841 162
649 3300031911 Ga0307412_10946643 Ga0307412_109466431 162
650 3300031995 Ga0307409_100082827 Ga0307409_1000828273 162
651 3300031995 Ga0307409_100099345 Ga0307409_1000993453 162
652 3300031995 Ga0307409_100120220 Ga0307409_1001202204 162
653 3300031995 Ga0307409_100165842 Ga0307409_1001658422 162
654 3300031995 Ga0307409_100367517 Ga0307409_1003675172 162
655 3300031995 Ga0307409_101402152 Ga0307409_1014021521 162
656 3300032002 Ga0307416_100002534 Ga0307416_10000253411 162
657 3300032002 Ga0307416_100061013 Ga0307416_1000610133 162
658 3300032002 Ga0307416_100122064 Ga0307416_1001220641 162
659 3300032002 Ga0307416_101949099 Ga0307416_1019490992 162
660 3300032004 Ga0307414_10060255 Ga0307414_100602555 162
661 3300032004 Ga0307414_10093881 Ga0307414_100938813 162
662 3300032005 Ga0307411_10012291 Ga0307411_100122914 162
663 3300032005 Ga0307411_10579313 Ga0307411_105793131 162
664 3300032005 Ga0307411_11785108 Ga0307411_117851081 162
665 3300032126 Ga0307415_100122991 Ga0307415_1001229914 162
666 3300032126 Ga0307415_100338024 Ga0307415_1003380242 162
667 3300037471 Ga0395905_0037531 Ga0395905_0037531_3993_4511 162
668 3300037471 Ga0395905_0068251 Ga0395905_0068251_2815_3318 162
669 3300037471 Ga0395905_0335818 Ga0395905_0335818_876_1388 162
670 3300041459 Ga0451800_1495159 Ga0451800_1495159_121_633 162
671 3300041512 Ga0451853_2552288 Ga0451853_2552288_110_616 162
672 3300042005 Ga0439448_0037577 Ga0439448_0037577_1015_1527 162
673 3300042008 Ga0439450_081997 Ga0439450_081997_210_722 162
674 3300042012 Ga0439455_0101163 Ga0439455_0101163_36_527 162
675 3300042012 Ga0439455_0111968 Ga0439455_0111968_108_620 162
676 3300042435 Ga0439434_0070809 Ga0439434_0070809_372_863 162
677 3300042438 Ga0439459_0028048 Ga0439459_0028048_61_579 162
678 3300042993 Ga0439440_0118163 Ga0439440_0118163_198_689 162
679 3300044673 Ga0453683_0233109 Ga0453683_0233109_130_630 162
680 3300045051 Ga0451576_0005304 Ga0451576_0005304_1249_1755 162
681 3300045051 Ga0451576_0668619 Ga0451576_0668619_138_638 162
682 3300046522 Ga0495643_0000187 Ga0495643_0000187_56510_57010 162
683 3300046524 Ga0495648_0085742 Ga0495648_0085742_1075_1578 162
684 3300046648 Ga0495611_0192930 Ga0495611_0192930_108_599 162
685 3300048912 Ga0496109_0063212 Ga0496109_0063212_1194_1706 162
686 3300048915 Ga0496112_0590566 Ga0496112_0590566_495_1007 162
687 3300049515 Ga0501292_011320 Ga0501292_011320_491_982 162
688 3300049568 Ga0501031_0832740 Ga0501031_0832740_14_505 162
689 3300049572 Ga0501036_1409461 Ga0501036_1409461_21_509 162
690 3300049575 Ga0501039_0778489 Ga0501039_0778489_185_676 162
691 3300049576 Ga0501040_0112227 Ga0501040_0112227_1318_1806 162
692 3300049576 Ga0501040_0204314 Ga0501040_0204314_805_1293 162
693 3300049578 Ga0501042_0425190 Ga0501042_0425190_328_816 162
694 3300049578 Ga0501042_0426552 Ga0501042_0426552_363_854 162
695 3300049582 Ga0501048_1127038 Ga0501048_1127038_63_551 162
696 3300049583 Ga0501067_0051170 Ga0501067_0051170_1040_1558 162
697 3300049587 Ga0501071_0256423 Ga0501071_0256423_565_1062 162
698 3300049587 Ga0501071_1133262 Ga0501071_1133262_91_582 162
699 3300049588 Ga0501072_0886331 Ga0501072_0886331_11_499 162
700 3300049592 Ga0501076_0035121 Ga0501076_0035121_1042_1530 162
701 3300049656 Ga0501209_090615 Ga0501209_090615_211_714 162
702 3300049659 Ga0501214_013363 Ga0501214_013363_381_872 162
703 3300049741 Ga0501079_0070186 Ga0501079_0070186_976_1464 162
704 3300049742 Ga0501080_0298670 Ga0501080_0298670_88_597 162
705 3300049775 Ga0501279_047025 Ga0501279_047025_35_526 162
706 3300049824 Ga0501045_0101449 Ga0501045_0101449_1518_2006 162
707 3300050492 nmdc:mga0yw44_64592_c1 nmdc:mga0yw44_64592_c1_1459_1959 162
708 3300050493 nmdc:mga0k408_1948_c1 nmdc:mga0k408_1948_c1_2730_3269 162
709 3300050493 nmdc:mga0k408_77471_c1 nmdc:mga0k408_77471_c1_562_1062 162
710 3300050507 nmdc:mga05p37_177134_c1 nmdc:mga05p37_177134_c1_445_966 162
711 3300050507 nmdc:mga05p37_56259_c1 nmdc:mga05p37_56259_c1_654_1145 162
712 3300050507 nmdc:mga05p37_57535_c1 nmdc:mga05p37_57535_c1_1954_2466 162
713 3300050507 nmdc:mga05p37_754021_c1 nmdc:mga05p37_754021_c1_520_1035 162
714 3300050508 nmdc:mga09592_149217_c1 nmdc:mga09592_149217_c1_745_1236 162
715 3300050508 nmdc:mga09592_150457_c1 nmdc:mga09592_150457_c1_1483_1995 162
716 3300050508 nmdc:mga09592_39370_c1 nmdc:mga09592_39370_c1_1218_1736 162
717 3300050509 nmdc:mga0qj67_19842_c1 nmdc:mga0qj67_19842_c1_3852_4349 162
718 3300050509 nmdc:mga0qj67_467598_c1 nmdc:mga0qj67_467598_c1_124_657 162
719 3300050509 nmdc:mga0qj67_61657_c1 nmdc:mga0qj67_61657_c1_2349_2867 162
720 3300050510 nmdc:mga06r32_1014931_c1 nmdc:mga06r32_1014931_c1_152_649 162
721 3300050510 nmdc:mga06r32_101994_c1 nmdc:mga06r32_101994_c1_1107_1613 162
722 3300050510 nmdc:mga06r32_1179849_c1 nmdc:mga06r32_1179849_c1_173_694 162
723 3300050510 nmdc:mga06r32_445579_c1 nmdc:mga06r32_445579_c1_424_942 162
724 3300050510 nmdc:mga06r32_61988_c1 nmdc:mga06r32_61988_c1_535_1026 162
725 3300050510 nmdc:mga06r32_670708_c1 nmdc:mga06r32_670708_c1_185_718 162
726 3300050510 nmdc:mga06r32_698988_c1 nmdc:mga06r32_698988_c1_192_785 162
727 3300050511 nmdc:mga08y16_146165_c1 nmdc:mga08y16_146165_c1_1334_1825 162
728 3300050511 nmdc:mga08y16_703796_c1 nmdc:mga08y16_703796_c1_150_650 162
729 3300050511 nmdc:mga08y16_94777_c1 nmdc:mga08y16_94777_c1_1839_2351 162
730 3300050512 nmdc:mga0n895_8124_c1 nmdc:mga0n895_8124_c1_3551_4063 162
731 3300050512 nmdc:mga0n895_81665_c1 nmdc:mga0n895_81665_c1_1013_1510 162
732 3300050514 nmdc:mga08x19_64853_c1 nmdc:mga08x19_64853_c1_801_1313 162
733 3300050514 nmdc:mga08x19_69996_c1 nmdc:mga08x19_69996_c1_1510_2046 162
734 3300050515 nmdc:mga0a205_31427_c1 nmdc:mga0a205_31427_c1_4174_4701 162
735 3300050515 nmdc:mga0a205_34488_c1 nmdc:mga0a205_34488_c1_187_699 162
736 3300053098 Ga0500650_0360617 Ga0500650_0360617_64_564 162
737 3300059426 Ga0590077_018589 Ga0590077_018589_238_741 162
738 3300061734 Ga0530510_0008234 Ga0530510_0008234_5031_5519 162

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF06983

3-dmu-9_3-mt

3-demethylubiquinone-9 3-methyltransferase

32

152

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9288 2 160
1u69-assembly1.cif.gz_A crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9174 2 160
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9167 2 160
1u69-assembly2.cif.gz_D crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.9116 2 160
1u69-assembly3.cif.gz_C crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 0.905 2 160
ID Description Score Start End Superfamily
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9075 2 160 3.10.180.10
1u69D00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8955 2 160 3.10.180.10
3omsA01 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8137 8 74 3.30.720.100
af_Q2G1U2_73_132_3.30.720.110 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8076 73 123 3.30.720.110
3omsA02 Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; 0.8068 73 123 3.30.720.110
ID Description Score Start End GO Terms
AF-I7ZHF7-F1-model_v4 Putative 3-demethylubiquinone-93-methyltransferase protein 0.9859 107 162 GO:0008168
GO:0032259
AF-A0A533ULV1-F1-model_v4 VOC family protein 0.9793 74 162
AF-A0A0W0XL40-F1-model_v4 DNA binding protein 0.9753 1 162
AF-A0A1H9YI38-F1-model_v4 Glyoxalase superfamily enzyme, possibly 3-demethylubiquinone-9 3-methyltransferase 0.9717 1 162 GO:0008168
GO:0032259
AF-A0A536DWF0-F1-model_v4 VOC family protein 0.9717 1 161

Feature Viewer

pLDDT pTM Quality
92.09 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map