F478420
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 738 | 306 | 738 | 167 |
Family's Representative Sequence
| Representative Sequence | 3300050510|nmdc:mga06r32_698988_c1|nmdc:mga06r32_698988_c1_192_785 |
| Length | 197 |
| Sequence | VLDGARAAGSLRGFRGPFFTLHREAHLMAKSPKIAPCLWFDDQAEEAARFYTGIFRKAKILTITRYGAAGFEVHHRPAGSVMTVEFELDGQRFTALNGGPEFKFNEAISFQVYCESQEEIDYYWSKLGEGGDPSAQQCGWLKDRYGVSWQVVPQGMEELFKDENSPAAQRTMEAMLKMKKLDLAELKRAHDGELANV |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 2 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 3 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 4 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 5 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 6 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 52 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 62 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 63 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 65 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 66 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 67 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 68 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 69 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 70 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 71 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 72 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 73 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 76 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 77 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 78 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 79 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 81 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 82 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 83 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 84 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 85 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 86 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 87 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 88 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 89 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 91 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300012477 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 | Metagenome | Rhizosphere |
| 104 | 3300012478 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.9.old.080610 | Metagenome | Rhizosphere |
| 105 | 3300012487 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.4.old.130510 | Metagenome | Rhizosphere |
| 106 | 3300012510 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.9.old.080610 | Metagenome | Rhizosphere |
| 107 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 108 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 121 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 122 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 123 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 124 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 125 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 126 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 129 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 130 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 192 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 193 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 194 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 195 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 196 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 197 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 198 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 199 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 200 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 201 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 202 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 203 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 204 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 205 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 206 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 207 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 208 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 209 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 210 | 3300041451 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 215 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 216 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 217 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 218 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 219 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 220 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 221 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 222 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 223 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 224 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 225 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 226 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 227 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 228 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 229 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 249 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 250 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 251 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 252 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 254 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 255 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 256 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 257 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 258 | 3300049515 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought | Metagenome | Rhizosphere |
| 259 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 260 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 261 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 262 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 263 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 264 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 265 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 266 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 267 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 268 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 271 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 272 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 273 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 274 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 275 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 276 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 277 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 278 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 279 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 280 | 3300049659 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control | Metagenome | Rhizosphere |
| 281 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 282 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 283 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 284 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 285 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 286 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 287 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 288 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 289 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 290 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 291 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 292 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 293 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 294 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 295 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 296 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 297 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 298 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 299 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 300 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 301 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 302 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 303 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 304 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 305 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 306 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.92 |
| Metatranscriptomes | 1.08 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.3 |
| Nodule | 0 |
| Rhizoplane | 3.79 |
| Rhizosphere | 92.55 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 1.36 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25152J39213_1000011 | 3300002773 | Bacteria | 130992 |
| 2 | JGI25150J39212_1000192 | 3300002774 | Bacteria | 34489 |
| 3 | JGI25153J46596_10008784 | 3300003215 | Bacteria | 4782 |
| 4 | rootH2_10120259 | 3300003320 | Bacteria | 3099 |
| 5 | rootL2_10058686 | 3300003322 | Bacteria | 6147 |
| 6 | Ga0055524_1000795 | 3300003775 | Bacteria | 20983 |
| 7 | Ga0058862_12052405 | 3300004803 | Bacteria | 700 |
| 8 | Ga0065715_10119334 | 3300005293 | Bacteria | 2289 |
| 9 | Ga0065715_10193406 | 3300005293 | Bacteria | 1402 |
| 10 | Ga0065715_10940291 | 3300005293 | Bacteria | 562 |
| 11 | Ga0065707_10093493 | 3300005295 | Bacteria | 3622 |
| 12 | Ga0070658_10737086 | 3300005327 | Bacteria | 856 |
| 13 | Ga0070658_10756199 | 3300005327 | Bacteria | 844 |
| 14 | Ga0070676_10182569 | 3300005328 | Bacteria | 1365 |
| 15 | Ga0070676_10304891 | 3300005328 | Bacteria | 1081 |
| 16 | Ga0070676_10980852 | 3300005328 | Bacteria | 633 |
| 17 | Ga0070683_100033350 | 3300005329 | Bacteria | 4695 |
| 18 | Ga0070683_100065908 | 3300005329 | Bacteria | 3373 |
| 19 | Ga0070683_100110269 | 3300005329 | Bacteria | 2596 |
| 20 | Ga0070670_100031186 | 3300005331 | Bacteria | 4591 |
| 21 | Ga0070670_100042393 | 3300005331 | Bacteria | 3912 |
| 22 | Ga0070670_100082100 | 3300005331 | Bacteria | 2770 |
| 23 | Ga0070677_10001919 | 3300005333 | Bacteria | 6581 |
| 24 | Ga0068869_100016143 | 3300005334 | Bacteria | 5029 |
| 25 | Ga0068869_100119397 | 3300005334 | Bacteria | 2015 |
| 26 | Ga0068869_100248006 | 3300005334 | Bacteria | 1421 |
| 27 | Ga0068869_100282571 | 3300005334 | Bacteria | 1335 |
| 28 | Ga0068869_100536813 | 3300005334 | Bacteria | 981 |
| 29 | Ga0068869_100714118 | 3300005334 | Bacteria | 856 |
| 30 | Ga0070680_100120994 | 3300005336 | Bacteria | 2185 |
| 31 | Ga0070680_100415512 | 3300005336 | Bacteria | 1147 |
| 32 | Ga0070682_100009256 | 3300005337 | Bacteria | 5574 |
| 33 | Ga0070660_101457688 | 3300005339 | Bacteria | 582 |
| 34 | Ga0070689_100119399 | 3300005340 | Bacteria | 2105 |
| 35 | Ga0070689_100230900 | 3300005340 | Bacteria | 1521 |
| 36 | Ga0070691_10360555 | 3300005341 | Bacteria | 810 |
| 37 | Ga0070661_100031934 | 3300005344 | Bacteria | 3809 |
| 38 | Ga0070661_100167693 | 3300005344 | Bacteria | 1666 |
| 39 | Ga0070661_100298197 | 3300005344 | Bacteria | 1254 |
| 40 | Ga0070692_10691517 | 3300005345 | Bacteria | 685 |
| 41 | Ga0070692_10807599 | 3300005345 | Bacteria | 641 |
| 42 | Ga0070668_100087591 | 3300005347 | Bacteria | 2450 |
| 43 | Ga0070668_100358947 | 3300005347 | Bacteria | 1235 |
| 44 | Ga0070669_100317159 | 3300005353 | Bacteria | 1258 |
| 45 | Ga0070669_100729996 | 3300005353 | Bacteria | 838 |
| 46 | Ga0070675_100002529 | 3300005354 | Bacteria | 13684 |
| 47 | Ga0070675_100014873 | 3300005354 | Bacteria | 6143 |
| 48 | Ga0070675_100403557 | 3300005354 | Bacteria | 1220 |
| 49 | Ga0070675_100527867 | 3300005354 | Bacteria | 1066 |
| 50 | Ga0070675_100754570 | 3300005354 | Bacteria | 888 |
| 51 | Ga0070675_100790667 | 3300005354 | Bacteria | 867 |
| 52 | Ga0070675_101307027 | 3300005354 | Bacteria | 668 |
| 53 | Ga0070671_100030633 | 3300005355 | Bacteria | 4440 |
| 54 | Ga0070671_100152731 | 3300005355 | Bacteria | 1950 |
| 55 | Ga0070671_100281642 | 3300005355 | Bacteria | 1414 |
| 56 | Ga0070674_100018210 | 3300005356 | Bacteria | 4436 |
| 57 | Ga0070674_100083924 | 3300005356 | Bacteria | 2283 |
| 58 | Ga0070674_100298360 | 3300005356 | Bacteria | 1284 |
| 59 | Ga0070674_100473995 | 3300005356 | Bacteria | 1038 |
| 60 | Ga0070674_100703632 | 3300005356 | Bacteria | 864 |
| 61 | Ga0070674_100766179 | 3300005356 | Bacteria | 830 |
| 62 | Ga0070673_100015314 | 3300005364 | Bacteria | 5381 |
| 63 | Ga0070673_100048831 | 3300005364 | Bacteria | 3301 |
| 64 | Ga0070673_100458440 | 3300005364 | Bacteria | 1148 |
| 65 | Ga0070688_100207811 | 3300005365 | Bacteria | 1373 |
| 66 | Ga0070688_100729718 | 3300005365 | Bacteria | 770 |
| 67 | Ga0070659_100879991 | 3300005366 | Bacteria | 782 |
| 68 | Ga0070667_100035679 | 3300005367 | Bacteria | 4167 |
| 69 | Ga0070667_100116943 | 3300005367 | Bacteria | 2316 |
| 70 | Ga0070714_100037634 | 3300005435 | Bacteria | 4066 |
| 71 | Ga0070713_100002093 | 3300005436 | Bacteria | 12895 |
| 72 | Ga0070701_10014341 | 3300005438 | Bacteria | 3630 |
| 73 | Ga0070701_10185750 | 3300005438 | Unclassified | 1220 |
| 74 | Ga0070701_10406858 | 3300005438 | Bacteria | 863 |
| 75 | Ga0070711_100030774 | 3300005439 | Bacteria | 3557 |
| 76 | Ga0070711_100161473 | 3300005439 | Bacteria | 1699 |
| 77 | Ga0070711_100421622 | 3300005439 | Bacteria | 1087 |
| 78 | Ga0070705_100057663 | 3300005440 | Bacteria | 2292 |
| 79 | Ga0070705_100116584 | 3300005440 | Bacteria | 1717 |
| 80 | Ga0070700_100073767 | 3300005441 | Bacteria | 2185 |
| 81 | Ga0070700_101167386 | 3300005441 | Bacteria | 641 |
| 82 | Ga0070694_100013925 | 3300005444 | Bacteria | 5030 |
| 83 | Ga0070708_100039835 | 3300005445 | Bacteria | 4113 |
| 84 | Ga0070663_100336736 | 3300005455 | Bacteria | 1218 |
| 85 | Ga0070663_101475071 | 3300005455 | Bacteria | 604 |
| 86 | Ga0070678_100030884 | 3300005456 | Bacteria | 3688 |
| 87 | Ga0070678_100188766 | 3300005456 | Bacteria | 1693 |
| 88 | Ga0070678_101173206 | 3300005456 | Bacteria | 711 |
| 89 | Ga0070681_10167376 | 3300005458 | Bacteria | 2120 |
| 90 | Ga0068867_100018494 | 3300005459 | Bacteria | 4953 |
| 91 | Ga0068867_100200125 | 3300005459 | Bacteria | 1599 |
| 92 | Ga0068867_100202031 | 3300005459 | Bacteria | 1591 |
| 93 | Ga0068867_100331777 | 3300005459 | Bacteria | 1264 |
| 94 | Ga0068867_100442480 | 3300005459 | Bacteria | 1105 |
| 95 | Ga0068867_100508773 | 3300005459 | Bacteria | 1036 |
| 96 | Ga0068867_100629845 | 3300005459 | Bacteria | 939 |
| 97 | Ga0070685_10010519 | 3300005466 | Bacteria | 4810 |
| 98 | Ga0070685_10103790 | 3300005466 | Bacteria | 1740 |
| 99 | Ga0070685_10238155 | 3300005466 | Bacteria | 1200 |
| 100 | Ga0070685_10426688 | 3300005466 | Bacteria | 924 |
| 101 | Ga0070707_100219459 | 3300005468 | Bacteria | 1852 |
| 102 | Ga0070698_100031386 | 3300005471 | Bacteria | 5509 |
| 103 | Ga0070698_100884261 | 3300005471 | Bacteria | 839 |
| 104 | Ga0070699_100067735 | 3300005518 | Bacteria | 3100 |
| 105 | Ga0070699_100164156 | 3300005518 | Archaea | 1967 |
| 106 | Ga0070699_100316473 | 3300005518 | Bacteria | 1402 |
| 107 | Ga0070699_101101123 | 3300005518 | Bacteria | 729 |
| 108 | Ga0070699_101301841 | 3300005518 | Bacteria | 667 |
| 109 | Ga0070679_100094887 | 3300005530 | Bacteria | 2971 |
| 110 | Ga0070679_100323167 | 3300005530 | Bacteria | 1492 |
| 111 | Ga0070684_100080666 | 3300005535 | Bacteria | 2878 |
| 112 | Ga0070684_100183447 | 3300005535 | Bacteria | 1903 |
| 113 | Ga0070684_100333151 | 3300005535 | Bacteria | 1395 |
| 114 | Ga0070684_100428813 | 3300005535 | Bacteria | 1221 |
| 115 | Ga0070697_100171295 | 3300005536 | Bacteria | 1838 |
| 116 | Ga0070697_100415699 | 3300005536 | Bacteria | 1168 |
| 117 | Ga0068853_100194027 | 3300005539 | Bacteria | 1846 |
| 118 | Ga0068853_100962404 | 3300005539 | Bacteria | 821 |
| 119 | Ga0068853_101616134 | 3300005539 | Bacteria | 628 |
| 120 | Ga0070672_100003495 | 3300005543 | Bacteria | 10182 |
| 121 | Ga0070672_100005464 | 3300005543 | Bacteria | 8426 |
| 122 | Ga0070672_100032723 | 3300005543 | Bacteria | 3928 |
| 123 | Ga0070686_100014728 | 3300005544 | Bacteria | 4513 |
| 124 | Ga0070686_100786308 | 3300005544 | Bacteria | 766 |
| 125 | Ga0070695_100491387 | 3300005545 | Bacteria | 947 |
| 126 | Ga0070696_100094040 | 3300005546 | Bacteria | 2138 |
| 127 | Ga0070696_100474032 | 3300005546 | Bacteria | 991 |
| 128 | Ga0070696_100848020 | 3300005546 | Bacteria | 755 |
| 129 | Ga0070665_100013512 | 3300005548 | Bacteria | 8213 |
| 130 | Ga0070665_100418224 | 3300005548 | Bacteria | 1349 |
| 131 | Ga0070665_101557080 | 3300005548 | Bacteria | 669 |
| 132 | Ga0070704_100022238 | 3300005549 | Bacteria | 4124 |
| 133 | Ga0070704_100988525 | 3300005549 | Bacteria | 761 |
| 134 | Ga0068855_100127119 | 3300005563 | Bacteria | 2913 |
| 135 | Ga0068855_100480758 | 3300005563 | Bacteria | 1352 |
| 136 | Ga0068855_100636349 | 3300005563 | Bacteria | 1147 |
| 137 | Ga0070664_100190205 | 3300005564 | Bacteria | 1828 |
| 138 | Ga0070664_100215796 | 3300005564 | Bacteria | 1715 |
| 139 | Ga0070664_100282472 | 3300005564 | Bacteria | 1497 |
| 140 | Ga0070664_100410022 | 3300005564 | Bacteria | 1240 |
| 141 | Ga0070664_101010890 | 3300005564 | Bacteria | 782 |
| 142 | Ga0068857_100422668 | 3300005577 | Bacteria | 1243 |
| 143 | Ga0068857_100557042 | 3300005577 | Bacteria | 1080 |
| 144 | Ga0068854_100056259 | 3300005578 | Bacteria | 2834 |
| 145 | Ga0068854_100082366 | 3300005578 | Bacteria | 2378 |
| 146 | Ga0068854_100727676 | 3300005578 | Bacteria | 859 |
| 147 | Ga0068854_101024594 | 3300005578 | Bacteria | 732 |
| 148 | Ga0068856_100232508 | 3300005614 | Bacteria | 1859 |
| 149 | Ga0068856_100378288 | 3300005614 | Bacteria | 1435 |
| 150 | Ga0070702_100075076 | 3300005615 | Bacteria | 2008 |
| 151 | Ga0070702_100653983 | 3300005615 | Bacteria | 795 |
| 152 | Ga0068852_100000396 | 3300005616 | Bacteria | 29216 |
| 153 | Ga0068852_100347911 | 3300005616 | Bacteria | 1446 |
| 154 | Ga0068852_100807824 | 3300005616 | Bacteria | 952 |
| 155 | Ga0068852_101869087 | 3300005616 | Bacteria | 623 |
| 156 | Ga0068859_100199022 | 3300005617 | Bacteria | 2088 |
| 157 | Ga0068859_100215382 | 3300005617 | Bacteria | 2008 |
| 158 | Ga0068859_100465542 | 3300005617 | Bacteria | 1360 |
| 159 | Ga0068859_100999209 | 3300005617 | Bacteria | 919 |
| 160 | Ga0068864_100117902 | 3300005618 | Bacteria | 2370 |
| 161 | Ga0068864_100141094 | 3300005618 | Bacteria | 2173 |
| 162 | Ga0068864_100518743 | 3300005618 | Bacteria | 1148 |
| 163 | Ga0068866_10041977 | 3300005718 | Bacteria | 2273 |
| 164 | Ga0068861_100042324 | 3300005719 | Bacteria | 3413 |
| 165 | Ga0068861_100082176 | 3300005719 | Bacteria | 2524 |
| 166 | Ga0068861_101384939 | 3300005719 | Bacteria | 686 |
| 167 | Ga0068870_10006540 | 3300005840 | Bacteria | 5141 |
| 168 | Ga0068870_10123930 | 3300005840 | Bacteria | 1492 |
| 169 | Ga0068863_100234098 | 3300005841 | Bacteria | 1772 |
| 170 | Ga0068863_100255791 | 3300005841 | Bacteria | 1692 |
| 171 | Ga0068863_100747581 | 3300005841 | Bacteria | 974 |
| 172 | Ga0068860_100022880 | 3300005843 | Bacteria | 6044 |
| 173 | Ga0068860_100189878 | 3300005843 | Bacteria | 1988 |
| 174 | Ga0068860_100235990 | 3300005843 | Bacteria | 1778 |
| 175 | Ga0068862_100333529 | 3300005844 | Bacteria | 1403 |
| 176 | Ga0068862_100705211 | 3300005844 | Bacteria | 978 |
| 177 | Ga0081455_10011370 | 3300005937 | Bacteria | 8946 |
| 178 | Ga0075365_10220724 | 3300006038 | Bacteria | 1330 |
| 179 | Ga0075432_10226391 | 3300006058 | Bacteria | 750 |
| 180 | Ga0075432_10294029 | 3300006058 | Bacteria | 672 |
| 181 | Ga0070716_100582695 | 3300006173 | Bacteria | 839 |
| 182 | Ga0070712_100101302 | 3300006175 | Bacteria | 2130 |
| 183 | Ga0070712_100107804 | 3300006175 | Bacteria | 2073 |
| 184 | Ga0070712_100382950 | 3300006175 | Bacteria | 1158 |
| 185 | Ga0075366_10010031 | 3300006195 | Bacteria | 5308 |
| 186 | Ga0075366_10072120 | 3300006195 | Bacteria | 2057 |
| 187 | Ga0097621_100043520 | 3300006237 | Bacteria | 3620 |
| 188 | Ga0097621_100082575 | 3300006237 | Bacteria | 2676 |
| 189 | Ga0097621_100259061 | 3300006237 | Bacteria | 1525 |
| 190 | Ga0097621_100531790 | 3300006237 | Bacteria | 1068 |
| 191 | Ga0097621_100534832 | 3300006237 | Bacteria | 1065 |
| 192 | Ga0068871_100054380 | 3300006358 | Bacteria | 3248 |
| 193 | Ga0068871_100059349 | 3300006358 | Bacteria | 3117 |
| 194 | Ga0068871_100139445 | 3300006358 | Bacteria | 2061 |
| 195 | Ga0068871_100402502 | 3300006358 | Bacteria | 1219 |
| 196 | Ga0068871_100475057 | 3300006358 | Bacteria | 1124 |
| 197 | Ga0068871_101080116 | 3300006358 | Bacteria | 750 |
| 198 | Ga0068871_101249092 | 3300006358 | Bacteria | 698 |
| 199 | Ga0068871_101420296 | 3300006358 | Bacteria | 654 |
| 200 | Ga0075428_100011452 | 3300006844 | Bacteria | 9866 |
| 201 | Ga0075428_100091957 | 3300006844 | Bacteria | 3308 |
| 202 | Ga0075428_100743009 | 3300006844 | Bacteria | 1044 |
| 203 | Ga0075430_100005840 | 3300006846 | Bacteria | 10387 |
| 204 | Ga0075430_100026577 | 3300006846 | Bacteria | 4922 |
| 205 | Ga0075430_100060510 | 3300006846 | Bacteria | 3183 |
| 206 | Ga0075430_100491307 | 3300006846 | Bacteria | 1013 |
| 207 | Ga0075431_100017186 | 3300006847 | Bacteria | 7351 |
| 208 | Ga0075431_100112418 | 3300006847 | Bacteria | 2811 |
| 209 | Ga0075431_100153043 | 3300006847 | Bacteria | 2374 |
| 210 | Ga0075431_100216254 | 3300006847 | Bacteria | 1956 |
| 211 | Ga0075431_100248436 | 3300006847 | Bacteria | 1808 |
| 212 | Ga0075431_100333904 | 3300006847 | Archaea | 1526 |
| 213 | Ga0075431_100547166 | 3300006847 | Bacteria | 1145 |
| 214 | Ga0075431_101000440 | 3300006847 | Bacteria | 803 |
| 215 | Ga0075433_10034948 | 3300006852 | Bacteria | 4320 |
| 216 | Ga0075433_10035427 | 3300006852 | Bacteria | 4292 |
| 217 | Ga0075433_10072810 | 3300006852 | Bacteria | 3022 |
| 218 | Ga0075433_10299674 | 3300006852 | Bacteria | 1423 |
| 219 | Ga0075434_100111577 | 3300006871 | Bacteria | 2745 |
| 220 | Ga0075434_100278673 | 3300006871 | Bacteria | 1692 |
| 221 | Ga0075434_100586146 | 3300006871 | Bacteria | 1134 |
| 222 | Ga0075434_101146363 | 3300006871 | Bacteria | 790 |
| 223 | Ga0075429_100125808 | 3300006880 | Bacteria | 2241 |
| 224 | Ga0068865_100007298 | 3300006881 | Bacteria | 6792 |
| 225 | Ga0068865_100113367 | 3300006881 | Bacteria | 2004 |
| 226 | Ga0068865_100222952 | 3300006881 | Bacteria | 1475 |
| 227 | Ga0068865_100415415 | 3300006881 | Bacteria | 1105 |
| 228 | Ga0075436_100064270 | 3300006914 | Bacteria | 2536 |
| 229 | Ga0075436_100243767 | 3300006914 | Bacteria | 1279 |
| 230 | Ga0075436_100541691 | 3300006914 | Unclassified | 854 |
| 231 | Ga0097620_100199007 | 3300006931 | Bacteria | 2088 |
| 232 | Ga0097620_100215390 | 3300006931 | Bacteria | 2008 |
| 233 | Ga0097620_100465519 | 3300006931 | Bacteria | 1360 |
| 234 | Ga0097620_100999204 | 3300006931 | Bacteria | 919 |
| 235 | Ga0075435_100061172 | 3300007076 | Bacteria | 3055 |
| 236 | Ga0075435_100185703 | 3300007076 | Bacteria | 1758 |
| 237 | Ga0075435_101496074 | 3300007076 | Bacteria | 592 |
| 238 | Ga0105240_10036346 | 3300009093 | Bacteria | 6338 |
| 239 | Ga0105240_10326116 | 3300009093 | Bacteria | 1749 |
| 240 | Ga0111539_10140806 | 3300009094 | Bacteria | 2824 |
| 241 | Ga0111539_10220381 | 3300009094 | Bacteria | 2210 |
| 242 | Ga0111539_10225301 | 3300009094 | Archaea | 2184 |
| 243 | Ga0111539_10346936 | 3300009094 | Bacteria | 1728 |
| 244 | Ga0111539_10445984 | 3300009094 | Bacteria | 1507 |
| 245 | Ga0111539_10684231 | 3300009094 | Bacteria | 1194 |
| 246 | Ga0111539_10724161 | 3300009094 | Bacteria | 1158 |
| 247 | Ga0111539_10768691 | 3300009094 | Bacteria | 1121 |
| 248 | Ga0111539_10827994 | 3300009094 | Bacteria | 1077 |
| 249 | Ga0114129_10025699 | 3300009147 | Bacteria | 8342 |
| 250 | Ga0114129_10193744 | 3300009147 | Bacteria | 2758 |
| 251 | Ga0114129_10206847 | 3300009147 | Bacteria | 2655 |
| 252 | Ga0114129_10713892 | 3300009147 | Bacteria | 1287 |
| 253 | Ga0114129_11163833 | 3300009147 | Bacteria | 962 |
| 254 | Ga0105243_10033429 | 3300009148 | Bacteria | 3977 |
| 255 | Ga0105243_12001656 | 3300009148 | Bacteria | 614 |
| 256 | Ga0105241_10508205 | 3300009174 | Bacteria | 1076 |
| 257 | Ga0105241_11434347 | 3300009174 | Bacteria | 662 |
| 258 | Ga0105242_10054832 | 3300009176 | Bacteria | 3260 |
| 259 | Ga0105242_10086811 | 3300009176 | Bacteria | 2626 |
| 260 | Ga0105248_10175949 | 3300009177 | Bacteria | 2412 |
| 261 | Ga0105248_10504300 | 3300009177 | Bacteria | 1364 |
| 262 | Ga0105248_10924245 | 3300009177 | Bacteria | 985 |
| 263 | Ga0105248_10942549 | 3300009177 | Bacteria | 975 |
| 264 | Ga0105237_10004247 | 3300009545 | Bacteria | 16672 |
| 265 | Ga0105237_10369657 | 3300009545 | Bacteria | 1439 |
| 266 | Ga0105237_11781317 | 3300009545 | Bacteria | 623 |
| 267 | Ga0105238_10002845 | 3300009551 | Bacteria | 17273 |
| 268 | Ga0105238_10089714 | 3300009551 | Bacteria | 3061 |
| 269 | Ga0105238_10210223 | 3300009551 | Bacteria | 1922 |
| 270 | Ga0105249_11750639 | 3300009553 | Bacteria | 694 |
| 271 | Ga0105239_10004502 | 3300010375 | Bacteria | 16626 |
| 272 | Ga0105239_10549664 | 3300010375 | Bacteria | 1315 |
| 273 | Ga0105239_11426096 | 3300010375 | Bacteria | 800 |
| 274 | Ga0105246_10143229 | 3300011119 | Bacteria | 1800 |
| 275 | Ga0105246_10621704 | 3300011119 | Bacteria | 936 |
| 276 | Ga0157336_1000062 | 3300012477 | Archaea | 4154 |
| 277 | Ga0157328_1007160 | 3300012478 | Bacteria | 699 |
| 278 | Ga0157321_1013075 | 3300012487 | Bacteria | 671 |
| 279 | Ga0157316_1011411 | 3300012510 | Bacteria | 834 |
| 280 | Ga0157373_10029707 | 3300013100 | Bacteria | 3935 |
| 281 | Ga0157373_10186697 | 3300013100 | Bacteria | 1460 |
| 282 | Ga0157371_10000830 | 3300013102 | Bacteria | 35437 |
| 283 | Ga0157371_10003303 | 3300013102 | Bacteria | 14760 |
| 284 | Ga0157370_10025403 | 3300013104 | Bacteria | 5863 |
| 285 | Ga0157370_10051040 | 3300013104 | Bacteria | 3952 |
| 286 | Ga0157370_10074572 | 3300013104 | Bacteria | 3200 |
| 287 | Ga0157370_10391008 | 3300013104 | Bacteria | 1280 |
| 288 | Ga0157370_10449123 | 3300013104 | Unclassified | 1185 |
| 289 | Ga0157369_10356063 | 3300013105 | Bacteria | 1520 |
| 290 | Ga0157369_10584756 | 3300013105 | Bacteria | 1153 |
| 291 | Ga0157374_11382513 | 3300013296 | Bacteria | 727 |
| 292 | Ga0157378_10074037 | 3300013297 | Bacteria | 3064 |
| 293 | Ga0157378_10625089 | 3300013297 | Bacteria | 1090 |
| 294 | Ga0163162_10050057 | 3300013306 | Bacteria | 4189 |
| 295 | Ga0163162_10073872 | 3300013306 | Bacteria | 3467 |
| 296 | Ga0157372_10033879 | 3300013307 | Bacteria | 5613 |
| 297 | Ga0157372_10166495 | 3300013307 | Bacteria | 2549 |
| 298 | Ga0157372_10688128 | 3300013307 | Bacteria | 1190 |
| 299 | Ga0157372_10776969 | 3300013307 | Bacteria | 1113 |
| 300 | Ga0157372_10888001 | 3300013307 | Bacteria | 1034 |
| 301 | Ga0157375_10004605 | 3300013308 | Bacteria | 11987 |
| 302 | Ga0157375_10100869 | 3300013308 | Bacteria | 2968 |
| 303 | Ga0157375_10621796 | 3300013308 | Bacteria | 1238 |
| 304 | Ga0157375_10991118 | 3300013308 | Bacteria | 980 |
| 305 | Ga0157375_12250297 | 3300013308 | Bacteria | 650 |
| 306 | Ga0163163_10036870 | 3300014325 | Bacteria | 4752 |
| 307 | Ga0163163_10110680 | 3300014325 | Bacteria | 2775 |
| 308 | Ga0163163_10149169 | 3300014325 | Bacteria | 2383 |
| 309 | Ga0163163_10196396 | 3300014325 | Bacteria | 2066 |
| 310 | Ga0163163_10256092 | 3300014325 | Bacteria | 1801 |
| 311 | Ga0163163_11073988 | 3300014325 | Bacteria | 868 |
| 312 | Ga0157380_10050326 | 3300014326 | Bacteria | 3290 |
| 313 | Ga0157380_10083794 | 3300014326 | Bacteria | 2613 |
| 314 | Ga0157380_10497769 | 3300014326 | Bacteria | 1183 |
| 315 | Ga0157380_11115431 | 3300014326 | Bacteria | 828 |
| 316 | Ga0157380_11167570 | 3300014326 | Bacteria | 812 |
| 317 | Ga0157380_11546732 | 3300014326 | Bacteria | 718 |
| 318 | Ga0157380_11995517 | 3300014326 | Bacteria | 642 |
| 319 | Ga0157376_10015473 | 3300014969 | Bacteria | 5764 |
| 320 | Ga0157376_10138078 | 3300014969 | Bacteria | 2183 |
| 321 | Ga0157376_10143521 | 3300014969 | Bacteria | 2145 |
| 322 | Ga0157376_10296161 | 3300014969 | Bacteria | 1530 |
| 323 | Ga0157376_10772862 | 3300014969 | Bacteria | 971 |
| 324 | Ga0163161_10218456 | 3300017792 | Bacteria | 1475 |
| 325 | Ga0163161_10404384 | 3300017792 | Bacteria | 1095 |
| 326 | Ga0206356_10923714 | 3300020070 | Unclassified | 2177 |
| 327 | Ga0206355_1352774 | 3300020076 | Bacteria | 979 |
| 328 | Ga0206352_10264359 | 3300020078 | Bacteria | 703 |
| 329 | Ga0206350_11660287 | 3300020080 | Bacteria | 957 |
| 330 | Ga0206353_10852945 | 3300020082 | Bacteria | 1448 |
| 331 | Ga0224712_10089302 | 3300022467 | Bacteria | 1288 |
| 332 | Ga0224712_10318442 | 3300022467 | Bacteria | 730 |
| 333 | Ga0207425_1000001 | 3300025245 | Bacteria | 2525432 |
| 334 | Ga0209129_1000001 | 3300025258 | Bacteria | 1452436 |
| 335 | Ga0209565_1012991 | 3300025263 | Bacteria | 1965 |
| 336 | Ga0209130_1037776 | 3300025284 | Bacteria | 951 |
| 337 | Ga0209758_1000073 | 3300025297 | Bacteria | 276262 |
| 338 | Ga0209256_1000116 | 3300025299 | Bacteria | 169876 |
| 339 | Ga0207697_10068723 | 3300025315 | Bacteria | 1482 |
| 340 | Ga0207682_10003132 | 3300025893 | Bacteria | 7246 |
| 341 | Ga0207682_10144957 | 3300025893 | Bacteria | 1068 |
| 342 | Ga0207642_10040912 | 3300025899 | Bacteria | 2026 |
| 343 | Ga0207645_10530371 | 3300025907 | Bacteria | 798 |
| 344 | Ga0207645_10657177 | 3300025907 | Bacteria | 712 |
| 345 | Ga0207643_10009683 | 3300025908 | Bacteria | 5171 |
| 346 | Ga0207643_10123817 | 3300025908 | Bacteria | 1533 |
| 347 | Ga0207643_10354455 | 3300025908 | Bacteria | 921 |
| 348 | Ga0207643_10403801 | 3300025908 | Bacteria | 864 |
| 349 | Ga0207705_10190455 | 3300025909 | Bacteria | 1551 |
| 350 | Ga0207684_10044118 | 3300025910 | Bacteria | 3780 |
| 351 | Ga0207684_10466335 | 3300025910 | Bacteria | 1084 |
| 352 | Ga0207654_10416751 | 3300025911 | Bacteria | 936 |
| 353 | Ga0207654_10547159 | 3300025911 | Bacteria | 822 |
| 354 | Ga0207707_10305746 | 3300025912 | Bacteria | 1374 |
| 355 | Ga0207707_10692286 | 3300025912 | Bacteria | 856 |
| 356 | Ga0207707_10923754 | 3300025912 | Bacteria | 720 |
| 357 | Ga0207695_10033025 | 3300025913 | Bacteria | 5654 |
| 358 | Ga0207695_10039302 | 3300025913 | Bacteria | 5087 |
| 359 | Ga0207695_10047165 | 3300025913 | Unclassified | 4562 |
| 360 | Ga0207695_10074603 | 3300025913 | Bacteria | 3454 |
| 361 | Ga0207671_10003331 | 3300025914 | Bacteria | 16145 |
| 362 | Ga0207671_10279308 | 3300025914 | Bacteria | 1317 |
| 363 | Ga0207671_10742842 | 3300025914 | Bacteria | 780 |
| 364 | Ga0207693_10105812 | 3300025915 | Bacteria | 2206 |
| 365 | Ga0207693_10112576 | 3300025915 | Bacteria | 2135 |
| 366 | Ga0207693_10650889 | 3300025915 | Bacteria | 818 |
| 367 | Ga0207663_10205347 | 3300025916 | Bacteria | 1424 |
| 368 | Ga0207660_10323375 | 3300025917 | Bacteria | 1232 |
| 369 | Ga0207649_10015896 | 3300025920 | Bacteria | 4233 |
| 370 | Ga0207649_10137520 | 3300025920 | Bacteria | 1668 |
| 371 | Ga0207649_10247391 | 3300025920 | Bacteria | 1283 |
| 372 | Ga0207649_10292041 | 3300025920 | Bacteria | 1189 |
| 373 | Ga0207649_10448090 | 3300025920 | Bacteria | 974 |
| 374 | Ga0207649_10471698 | 3300025920 | Unclassified | 950 |
| 375 | Ga0207652_10084265 | 3300025921 | Bacteria | 2784 |
| 376 | Ga0207652_10163064 | 3300025921 | Bacteria | 1998 |
| 377 | Ga0207646_10772738 | 3300025922 | Bacteria | 856 |
| 378 | Ga0207646_10790545 | 3300025922 | Bacteria | 845 |
| 379 | Ga0207681_10012328 | 3300025923 | Bacteria | 5274 |
| 380 | Ga0207681_10151119 | 3300025923 | Bacteria | 1740 |
| 381 | Ga0207694_10102993 | 3300025924 | Bacteria | 2263 |
| 382 | Ga0207650_10022091 | 3300025925 | Bacteria | 4503 |
| 383 | Ga0207650_10026596 | 3300025925 | Bacteria | 4129 |
| 384 | Ga0207659_10015813 | 3300025926 | Bacteria | 4900 |
| 385 | Ga0207659_10018902 | 3300025926 | Bacteria | 4525 |
| 386 | Ga0207659_10344937 | 3300025926 | Bacteria | 1234 |
| 387 | Ga0207659_10394097 | 3300025926 | Bacteria | 1157 |
| 388 | Ga0207687_11559023 | 3300025927 | Bacteria | 567 |
| 389 | Ga0207700_11201193 | 3300025928 | Bacteria | 677 |
| 390 | Ga0207664_10064557 | 3300025929 | Bacteria | 2929 |
| 391 | Ga0207644_10591383 | 3300025931 | Bacteria | 921 |
| 392 | Ga0207706_10023819 | 3300025933 | Bacteria | 5492 |
| 393 | Ga0207706_10263413 | 3300025933 | Bacteria | 1505 |
| 394 | Ga0207706_10332343 | 3300025933 | Bacteria | 1322 |
| 395 | Ga0207686_10014515 | 3300025934 | Bacteria | 4387 |
| 396 | Ga0207686_10036022 | 3300025934 | Bacteria | 2975 |
| 397 | Ga0207670_10158096 | 3300025936 | Bacteria | 1689 |
| 398 | Ga0207670_10216643 | 3300025936 | Bacteria | 1463 |
| 399 | Ga0207670_10221074 | 3300025936 | Bacteria | 1450 |
| 400 | Ga0207670_10905268 | 3300025936 | Bacteria | 739 |
| 401 | Ga0207669_10004353 | 3300025937 | Bacteria | 6220 |
| 402 | Ga0207669_10138393 | 3300025937 | Unclassified | 1686 |
| 403 | Ga0207669_10876497 | 3300025937 | Bacteria | 748 |
| 404 | Ga0207704_10012153 | 3300025938 | Bacteria | 4265 |
| 405 | Ga0207704_10055717 | 3300025938 | Bacteria | 2418 |
| 406 | Ga0207704_10056966 | 3300025938 | Bacteria | 2398 |
| 407 | Ga0207704_10119811 | 3300025938 | Bacteria | 1798 |
| 408 | Ga0207704_10712385 | 3300025938 | Bacteria | 832 |
| 409 | Ga0207691_10007022 | 3300025940 | Bacteria | 10862 |
| 410 | Ga0207691_10007763 | 3300025940 | Bacteria | 10333 |
| 411 | Ga0207691_10028018 | 3300025940 | Bacteria | 5278 |
| 412 | Ga0207691_10059504 | 3300025940 | Bacteria | 3473 |
| 413 | Ga0207711_10299314 | 3300025941 | Bacteria | 1483 |
| 414 | Ga0207689_10004736 | 3300025942 | Bacteria | 12267 |
| 415 | Ga0207689_10059539 | 3300025942 | Bacteria | 3141 |
| 416 | Ga0207689_10109033 | 3300025942 | Bacteria | 2275 |
| 417 | Ga0207689_10322324 | 3300025942 | Bacteria | 1282 |
| 418 | Ga0207689_10390238 | 3300025942 | Bacteria | 1160 |
| 419 | Ga0207661_10060287 | 3300025944 | Bacteria | 3061 |
| 420 | Ga0207661_10145490 | 3300025944 | Bacteria | 2044 |
| 421 | Ga0207679_10050528 | 3300025945 | Bacteria | 3039 |
| 422 | Ga0207679_10115154 | 3300025945 | Bacteria | 2129 |
| 423 | Ga0207667_10216745 | 3300025949 | Bacteria | 1961 |
| 424 | Ga0207667_10478557 | 3300025949 | Bacteria | 1264 |
| 425 | Ga0207651_10056014 | 3300025960 | Bacteria | 2711 |
| 426 | Ga0207651_10163583 | 3300025960 | Bacteria | 1747 |
| 427 | Ga0207712_10074160 | 3300025961 | Bacteria | 2456 |
| 428 | Ga0207668_10241766 | 3300025972 | Bacteria | 1461 |
| 429 | Ga0207668_10257967 | 3300025972 | Bacteria | 1419 |
| 430 | Ga0207640_10085407 | 3300025981 | Bacteria | 2170 |
| 431 | Ga0207640_10536904 | 3300025981 | Bacteria | 980 |
| 432 | Ga0207640_11038540 | 3300025981 | Bacteria | 722 |
| 433 | Ga0207640_11769984 | 3300025981 | Bacteria | 558 |
| 434 | Ga0207658_10194895 | 3300025986 | Bacteria | 1687 |
| 435 | Ga0207658_10293652 | 3300025986 | Bacteria | 1398 |
| 436 | Ga0207658_10604108 | 3300025986 | Bacteria | 986 |
| 437 | Ga0207677_10313924 | 3300026023 | Bacteria | 1300 |
| 438 | Ga0207677_11097683 | 3300026023 | Bacteria | 725 |
| 439 | Ga0207703_10966142 | 3300026035 | Bacteria | 817 |
| 440 | Ga0207639_11387781 | 3300026041 | Bacteria | 659 |
| 441 | Ga0207708_10077192 | 3300026075 | Bacteria | 2556 |
| 442 | Ga0207708_10248896 | 3300026075 | Bacteria | 1431 |
| 443 | Ga0207708_10258486 | 3300026075 | Bacteria | 1405 |
| 444 | Ga0207708_10449492 | 3300026075 | Bacteria | 1073 |
| 445 | Ga0207702_10145458 | 3300026078 | Bacteria | 2150 |
| 446 | Ga0207641_10031738 | 3300026088 | Bacteria | 4383 |
| 447 | Ga0207641_10107336 | 3300026088 | Bacteria | 2469 |
| 448 | Ga0207641_10264573 | 3300026088 | Bacteria | 1611 |
| 449 | Ga0207641_10541206 | 3300026088 | Bacteria | 1135 |
| 450 | Ga0207648_10001800 | 3300026089 | Bacteria | 23485 |
| 451 | Ga0207648_10009283 | 3300026089 | Bacteria | 9435 |
| 452 | Ga0207648_10020948 | 3300026089 | Bacteria | 5886 |
| 453 | Ga0207648_10062126 | 3300026089 | Bacteria | 3257 |
| 454 | Ga0207648_10151364 | 3300026089 | Bacteria | 2047 |
| 455 | Ga0207648_10259260 | 3300026089 | Bacteria | 1551 |
| 456 | Ga0207648_10288602 | 3300026089 | Bacteria | 1469 |
| 457 | Ga0207648_10575804 | 3300026089 | Bacteria | 1036 |
| 458 | Ga0207648_10995275 | 3300026089 | Bacteria | 785 |
| 459 | Ga0207648_11111823 | 3300026089 | Bacteria | 741 |
| 460 | Ga0207676_10132857 | 3300026095 | Bacteria | 2119 |
| 461 | Ga0207676_10180260 | 3300026095 | Bacteria | 1849 |
| 462 | Ga0207676_10511386 | 3300026095 | Archaea | 1142 |
| 463 | Ga0207676_11713335 | 3300026095 | Bacteria | 627 |
| 464 | Ga0207674_10014406 | 3300026116 | Bacteria | 8734 |
| 465 | Ga0207674_10394831 | 3300026116 | Bacteria | 1337 |
| 466 | Ga0207675_100226538 | 3300026118 | Bacteria | 1802 |
| 467 | Ga0207675_100503365 | 3300026118 | Bacteria | 1206 |
| 468 | Ga0207675_100864074 | 3300026118 | Bacteria | 920 |
| 469 | Ga0207683_10042246 | 3300026121 | Bacteria | 3982 |
| 470 | Ga0207683_10341566 | 3300026121 | Bacteria | 1373 |
| 471 | Ga0207683_10370101 | 3300026121 | Bacteria | 1316 |
| 472 | Ga0207698_10207311 | 3300026142 | Bacteria | 1761 |
| 473 | Ga0207698_11344855 | 3300026142 | Bacteria | 729 |
| 474 | Ga0209982_1003561 | 3300027552 | Bacteria | 2214 |
| 475 | Ga0209974_10104416 | 3300027876 | Bacteria | 992 |
| 476 | Ga0207428_10106267 | 3300027907 | Bacteria | 2164 |
| 477 | Ga0207428_10130719 | 3300027907 | Bacteria | 1921 |
| 478 | Ga0207428_10263468 | 3300027907 | Archaea | 1283 |
| 479 | Ga0207428_10352052 | 3300027907 | Bacteria | 1083 |
| 480 | Ga0207428_10696316 | 3300027907 | Bacteria | 727 |
| 481 | Ga0268266_10044966 | 3300028379 | Bacteria | 3775 |
| 482 | Ga0268266_10165015 | 3300028379 | Bacteria | 2006 |
| 483 | Ga0268266_10664971 | 3300028379 | Bacteria | 1003 |
| 484 | Ga0268266_11059496 | 3300028379 | Unclassified | 785 |
| 485 | Ga0268265_10206360 | 3300028380 | Bacteria | 1709 |
| 486 | Ga0268265_10823681 | 3300028380 | Bacteria | 906 |
| 487 | Ga0268265_10935066 | 3300028380 | Bacteria | 853 |
| 488 | Ga0268265_11384946 | 3300028380 | Bacteria | 705 |
| 489 | Ga0268265_11563257 | 3300028380 | Bacteria | 664 |
| 490 | Ga0268264_10037603 | 3300028381 | Bacteria | 3991 |
| 491 | Ga0268264_10180315 | 3300028381 | Bacteria | 1917 |
| 492 | Ga0268264_10196304 | 3300028381 | Bacteria | 1843 |
| 493 | Ga0307513_10027758 | 3300031456 | Bacteria | 6489 |
| 494 | Ga0307513_10142449 | 3300031456 | Bacteria | 2321 |
| 495 | Ga0307513_10145467 | 3300031456 | Bacteria | 2289 |
| 496 | Ga0307509_10009146 | 3300031507 | Bacteria | 12455 |
| 497 | Ga0307509_10171419 | 3300031507 | Bacteria | 2049 |
| 498 | Ga0307509_10348300 | 3300031507 | Bacteria | 1205 |
| 499 | Ga0307408_100000035 | 3300031548 | Bacteria | 205352 |
| 500 | Ga0307408_100059995 | 3300031548 | Unclassified | 2771 |
| 501 | Ga0307408_100079616 | 3300031548 | Bacteria | 2445 |
| 502 | Ga0307408_100215788 | 3300031548 | Bacteria | 1562 |
| 503 | Ga0307408_100290091 | 3300031548 | Bacteria | 1366 |
| 504 | Ga0307408_100753528 | 3300031548 | Bacteria | 880 |
| 505 | Ga0307408_101981692 | 3300031548 | Bacteria | 560 |
| 506 | Ga0307405_10119361 | 3300031731 | Bacteria | 1802 |
| 507 | Ga0307405_10150105 | 3300031731 | Bacteria | 1637 |
| 508 | Ga0307405_10485541 | 3300031731 | Bacteria | 987 |
| 509 | Ga0307413_10018554 | 3300031824 | Bacteria | 3654 |
| 510 | Ga0307413_10043498 | 3300031824 | Unclassified | 2647 |
| 511 | Ga0307413_10063789 | 3300031824 | Bacteria | 2286 |
| 512 | Ga0307410_10001136 | 3300031852 | Bacteria | 11682 |
| 513 | Ga0307410_10055113 | 3300031852 | Bacteria | 2698 |
| 514 | Ga0307410_10132425 | 3300031852 | Bacteria | 1833 |
| 515 | Ga0307410_10746347 | 3300031852 | Bacteria | 828 |
| 516 | Ga0307410_11180150 | 3300031852 | Bacteria | 666 |
| 517 | Ga0307406_10161069 | 3300031901 | Bacteria | 1613 |
| 518 | Ga0307406_10396634 | 3300031901 | Bacteria | 1092 |
| 519 | Ga0307406_10416911 | 3300031901 | Bacteria | 1069 |
| 520 | Ga0307406_10753971 | 3300031901 | Bacteria | 817 |
| 521 | Ga0307407_10000211 | 3300031903 | Bacteria | 17579 |
| 522 | Ga0307407_10020319 | 3300031903 | Bacteria | 3400 |
| 523 | Ga0307407_10124590 | 3300031903 | Bacteria | 1639 |
| 524 | Ga0307407_10241127 | 3300031903 | Bacteria | 1233 |
| 525 | Ga0307407_10590083 | 3300031903 | Bacteria | 826 |
| 526 | Ga0307412_10417974 | 3300031911 | Bacteria | 1096 |
| 527 | Ga0307412_10637084 | 3300031911 | Bacteria | 907 |
| 528 | Ga0307412_10946643 | 3300031911 | Bacteria | 758 |
| 529 | Ga0307409_100082827 | 3300031995 | Bacteria | 2599 |
| 530 | Ga0307409_100099345 | 3300031995 | Bacteria | 2410 |
| 531 | Ga0307409_100120220 | 3300031995 | Bacteria | 2223 |
| 532 | Ga0307409_100165842 | 3300031995 | Bacteria | 1938 |
| 533 | Ga0307409_100276992 | 3300031995 | Bacteria | 1548 |
| 534 | Ga0307409_100367517 | 3300031995 | Bacteria | 1363 |
| 535 | Ga0307409_101402152 | 3300031995 | Bacteria | 725 |
| 536 | Ga0307416_100002534 | 3300032002 | Bacteria | 10514 |
| 537 | Ga0307416_100061013 | 3300032002 | Bacteria | 3075 |
| 538 | Ga0307416_100122064 | 3300032002 | Unclassified | 2324 |
| 539 | Ga0307416_101949099 | 3300032002 | Bacteria | 690 |
| 540 | Ga0307414_10060255 | 3300032004 | Unclassified | 2683 |
| 541 | Ga0307414_10093881 | 3300032004 | Bacteria | 2238 |
| 542 | Ga0307411_10012291 | 3300032005 | Bacteria | 4664 |
| 543 | Ga0307411_10032163 | 3300032005 | Bacteria | 3238 |
| 544 | Ga0307411_10111617 | 3300032005 | Bacteria | 1958 |
| 545 | Ga0307411_10345411 | 3300032005 | Bacteria | 1211 |
| 546 | Ga0307411_10579313 | 3300032005 | Bacteria | 962 |
| 547 | Ga0307411_11366423 | 3300032005 | Bacteria | 647 |
| 548 | Ga0307411_11785108 | 3300032005 | Bacteria | 571 |
| 549 | Ga0307415_100122991 | 3300032126 | Bacteria | 1949 |
| 550 | Ga0307415_100338024 | 3300032126 | Bacteria | 1262 |
| 551 | Ga0373961_0199491 | 3300035241 | Bacteria | 705 |
| 552 | Ga0373931_0850481 | 3300035691 | Bacteria | 611 |
| 553 | Ga0395905_0037531 | 3300037471 | Bacteria | 4548 |
| 554 | Ga0395905_0068251 | 3300037471 | Bacteria | 3331 |
| 555 | Ga0395905_0162438 | 3300037471 | Bacteria | 2099 |
| 556 | Ga0395905_0335818 | 3300037471 | Bacteria | 1402 |
| 557 | Ga0395905_0420721 | 3300037471 | Bacteria | 1232 |
| 558 | Ga0395901_0061333 | 3300038443 | Bacteria | 3913 |
| 559 | Ga0451789_1231417 | 3300041443 | Bacteria | 964 |
| 560 | Ga0451791_0550808 | 3300041451 | Bacteria | 1744 |
| 561 | Ga0451793_0639628 | 3300041452 | Bacteria | 1189 |
| 562 | Ga0451795_1615507 | 3300041456 | Bacteria | 1139 |
| 563 | Ga0451798_0003318 | 3300041458 | Bacteria | 1593 |
| 564 | Ga0451800_0601781 | 3300041459 | Bacteria | 1415 |
| 565 | Ga0451800_1495159 | 3300041459 | Bacteria | 859 |
| 566 | Ga0451802_0233296 | 3300041460 | Bacteria | 1157 |
| 567 | Ga0451802_0842791 | 3300041460 | Bacteria | 1958 |
| 568 | Ga0451807_0061546 | 3300041486 | Bacteria | 8117 |
| 569 | Ga0451807_0112940 | 3300041486 | Bacteria | 2804 |
| 570 | Ga0451843_1694280 | 3300041509 | Bacteria | 556 |
| 571 | Ga0451853_2552288 | 3300041512 | Bacteria | 674 |
| 572 | Ga0439448_0037577 | 3300042005 | Bacteria | 1556 |
| 573 | Ga0439450_081997 | 3300042008 | Bacteria | 803 |
| 574 | Ga0439455_0101163 | 3300042012 | Archaea | 797 |
| 575 | Ga0439455_0111968 | 3300042012 | Bacteria | 760 |
| 576 | Ga0439434_0070809 | 3300042435 | Archaea | 1098 |
| 577 | Ga0439444_0120909 | 3300042437 | Bacteria | 611 |
| 578 | Ga0439459_0028048 | 3300042438 | Bacteria | 1127 |
| 579 | Ga0451577_0494948 | 3300042876 | Unclassified | 1110 |
| 580 | Ga0439440_0039545 | 3300042993 | Bacteria | 1145 |
| 581 | Ga0439440_0118163 | 3300042993 | Archaea | 736 |
| 582 | Ga0453683_0233109 | 3300044673 | Bacteria | 1172 |
| 583 | Ga0451576_0005304 | 3300045051 | Bacteria | 16202 |
| 584 | Ga0451576_0668619 | 3300045051 | Bacteria | 1091 |
| 585 | Ga0495590_0140175 | 3300046457 | Bacteria | 872 |
| 586 | Ga0495638_0005416 | 3300046460 | Bacteria | 9498 |
| 587 | Ga0495584_0014170 | 3300046491 | Bacteria | 4063 |
| 588 | Ga0495585_0080608 | 3300046492 | Bacteria | 1764 |
| 589 | Ga0495632_0036558 | 3300046519 | Bacteria | 2497 |
| 590 | Ga0495637_0117879 | 3300046520 | Bacteria | 1024 |
| 591 | Ga0495643_0000187 | 3300046522 | Bacteria | 99364 |
| 592 | Ga0495644_0186699 | 3300046523 | Bacteria | 798 |
| 593 | Ga0495648_0085742 | 3300046524 | Bacteria | 1778 |
| 594 | Ga0495663_0037513 | 3300046525 | Bacteria | 1462 |
| 595 | Ga0495622_0199713 | 3300046557 | Bacteria | 891 |
| 596 | Ga0495611_0192930 | 3300046648 | Archaea | 951 |
| 597 | Ga0495625_0013132 | 3300046660 | Bacteria | 6674 |
| 598 | Ga0495625_0047730 | 3300046660 | Bacteria | 3087 |
| 599 | Ga0495670_0031366 | 3300046691 | Bacteria | 2641 |
| 600 | Ga0495649_0003550 | 3300046694 | Bacteria | 10477 |
| 601 | Ga0495649_0218427 | 3300046694 | Bacteria | 986 |
| 602 | Ga0495636_0065204 | 3300047318 | Bacteria | 1547 |
| 603 | Ga0495626_0117424 | 3300048091 | Bacteria | 1147 |
| 604 | Ga0496100_0071424 | 3300048903 | Bacteria | 2318 |
| 605 | Ga0496101_0107204 | 3300048904 | Bacteria | 2099 |
| 606 | Ga0496101_0496720 | 3300048904 | Bacteria | 964 |
| 607 | Ga0496101_0724207 | 3300048904 | Bacteria | 785 |
| 608 | Ga0496102_0010277 | 3300048905 | Bacteria | 8047 |
| 609 | Ga0496103_0256254 | 3300048906 | Bacteria | 1126 |
| 610 | Ga0496106_0606410 | 3300048909 | Bacteria | 877 |
| 611 | Ga0496106_1011285 | 3300048909 | Bacteria | 653 |
| 612 | Ga0496107_0348334 | 3300048910 | Bacteria | 1102 |
| 613 | Ga0496108_0350096 | 3300048911 | Bacteria | 1289 |
| 614 | Ga0496109_0063212 | 3300048912 | Bacteria | 3386 |
| 615 | Ga0496109_0607344 | 3300048912 | Bacteria | 1030 |
| 616 | Ga0496110_0219863 | 3300048913 | Bacteria | 1727 |
| 617 | Ga0496111_0435953 | 3300048914 | Bacteria | 967 |
| 618 | Ga0496112_0219229 | 3300048915 | Bacteria | 1859 |
| 619 | Ga0496112_0590566 | 3300048915 | Bacteria | 1043 |
| 620 | Ga0496114_0375359 | 3300048917 | Bacteria | 1259 |
| 621 | Ga0501292_011320 | 3300049515 | Archaea | 1349 |
| 622 | Ga0501031_0832740 | 3300049568 | Archaea | 591 |
| 623 | Ga0501033_0021211 | 3300049570 | Bacteria | 4901 |
| 624 | Ga0501036_0062762 | 3300049572 | Bacteria | 3147 |
| 625 | Ga0501036_0285103 | 3300049572 | Bacteria | 1382 |
| 626 | Ga0501036_0998356 | 3300049572 | Archaea | 685 |
| 627 | Ga0501036_1409461 | 3300049572 | Bacteria | 565 |
| 628 | Ga0501037_0088973 | 3300049573 | Bacteria | 2235 |
| 629 | Ga0501038_0074323 | 3300049574 | Bacteria | 2876 |
| 630 | Ga0501038_0470097 | 3300049574 | Archaea | 965 |
| 631 | Ga0501039_0078025 | 3300049575 | Bacteria | 2576 |
| 632 | Ga0501039_0348830 | 3300049575 | Archaea | 1163 |
| 633 | Ga0501039_0778489 | 3300049575 | Unclassified | 747 |
| 634 | Ga0501040_0010704 | 3300049576 | Bacteria | 5998 |
| 635 | Ga0501040_0112227 | 3300049576 | Bacteria | 1907 |
| 636 | Ga0501040_0204314 | 3300049576 | Bacteria | 1403 |
| 637 | Ga0501040_0266514 | 3300049576 | Bacteria | 1223 |
| 638 | Ga0501042_0081006 | 3300049578 | Bacteria | 2326 |
| 639 | Ga0501042_0332486 | 3300049578 | Archaea | 1098 |
| 640 | Ga0501042_0425190 | 3300049578 | Bacteria | 963 |
| 641 | Ga0501042_0426552 | 3300049578 | Archaea | 961 |
| 642 | Ga0501043_0107682 | 3300049579 | Bacteria | 2189 |
| 643 | Ga0501048_0006223 | 3300049582 | Bacteria | 9079 |
| 644 | Ga0501048_1127038 | 3300049582 | Bacteria | 564 |
| 645 | Ga0501067_0010818 | 3300049583 | Bacteria | 5048 |
| 646 | Ga0501067_0051170 | 3300049583 | Bacteria | 2290 |
| 647 | Ga0501068_0001138 | 3300049584 | Bacteria | 14094 |
| 648 | Ga0501068_0043293 | 3300049584 | Bacteria | 2708 |
| 649 | Ga0501070_0039090 | 3300049586 | Bacteria | 3958 |
| 650 | Ga0501071_0137500 | 3300049587 | Bacteria | 1818 |
| 651 | Ga0501071_0234659 | 3300049587 | Bacteria | 1382 |
| 652 | Ga0501071_0256423 | 3300049587 | Bacteria | 1321 |
| 653 | Ga0501071_0498111 | 3300049587 | Bacteria | 934 |
| 654 | Ga0501071_1133262 | 3300049587 | Unclassified | 604 |
| 655 | Ga0501072_0089424 | 3300049588 | Bacteria | 2444 |
| 656 | Ga0501072_0886331 | 3300049588 | Bacteria | 697 |
| 657 | Ga0501072_0922408 | 3300049588 | Bacteria | 682 |
| 658 | Ga0501073_0013731 | 3300049589 | Bacteria | 5891 |
| 659 | Ga0501074_0000872 | 3300049590 | Bacteria | 19243 |
| 660 | Ga0501074_0066817 | 3300049590 | Bacteria | 2586 |
| 661 | Ga0501075_0008080 | 3300049591 | Bacteria | 7317 |
| 662 | Ga0501076_0004790 | 3300049592 | Bacteria | 9654 |
| 663 | Ga0501076_0030444 | 3300049592 | Bacteria | 4204 |
| 664 | Ga0501076_0035121 | 3300049592 | Bacteria | 3922 |
| 665 | Ga0501077_0009972 | 3300049593 | Bacteria | 5912 |
| 666 | Ga0501077_0025001 | 3300049593 | Bacteria | 3792 |
| 667 | Ga0501209_090615 | 3300049656 | Bacteria | 889 |
| 668 | Ga0501214_013363 | 3300049659 | Archaea | 951 |
| 669 | Ga0501233_088704 | 3300049668 | Archaea | 805 |
| 670 | Ga0501225_0041800 | 3300049705 | Archaea | 1265 |
| 671 | Ga0501245_007318 | 3300049708 | Archaea | 1559 |
| 672 | Ga0501079_0000867 | 3300049741 | Bacteria | 20732 |
| 673 | Ga0501079_0070186 | 3300049741 | Bacteria | 2705 |
| 674 | Ga0501080_0009692 | 3300049742 | Bacteria | 8795 |
| 675 | Ga0501080_0298670 | 3300049742 | Bacteria | 1461 |
| 676 | Ga0501081_0033632 | 3300049743 | Bacteria | 3484 |
| 677 | Ga0501081_0262526 | 3300049743 | Bacteria | 1262 |
| 678 | Ga0501083_0004795 | 3300049744 | Bacteria | 9555 |
| 679 | Ga0501279_047025 | 3300049775 | Archaea | 676 |
| 680 | Ga0501035_0000029 | 3300049822 | Bacteria | 179018 |
| 681 | Ga0501035_0061005 | 3300049822 | Bacteria | 3357 |
| 682 | Ga0501045_0008524 | 3300049824 | Bacteria | 7145 |
| 683 | Ga0501045_0101449 | 3300049824 | Bacteria | 2131 |
| 684 | nmdc:mga0yw44_64592_c1 | 3300050492 | Bacteria | 2253 |
| 685 | nmdc:mga0k408_1948_c1 | 3300050493 | Bacteria | 11061 |
| 686 | nmdc:mga0k408_77471_c1 | 3300050493 | Bacteria | 1944 |
| 687 | nmdc:mga05p37_1106957_c1 | 3300050507 | Bacteria | 829 |
| 688 | nmdc:mga05p37_176990_c1 | 3300050507 | Bacteria | 2598 |
| 689 | nmdc:mga05p37_177134_c1 | 3300050507 | Bacteria | 2597 |
| 690 | nmdc:mga05p37_27545_c1 | 3300050507 | Bacteria | 6919 |
| 691 | nmdc:mga05p37_56259_c1 | 3300050507 | Archaea | 1343 |
| 692 | nmdc:mga05p37_57535_c1 | 3300050507 | Bacteria | 4789 |
| 693 | nmdc:mga05p37_754021_c1 | 3300050507 | Bacteria | 1072 |
| 694 | nmdc:mga09592_149217_c1 | 3300050508 | Archaea | 2017 |
| 695 | nmdc:mga09592_150457_c1 | 3300050508 | Bacteria | 2008 |
| 696 | nmdc:mga09592_39370_c1 | 3300050508 | Bacteria | 3971 |
| 697 | nmdc:mga0qj67_19842_c1 | 3300050509 | Bacteria | 5141 |
| 698 | nmdc:mga0qj67_467598_c1 | 3300050509 | Bacteria | 1015 |
| 699 | nmdc:mga0qj67_61657_c1 | 3300050509 | Bacteria | 2978 |
| 700 | nmdc:mga06r32_1014931_c1 | 3300050510 | Bacteria | 782 |
| 701 | nmdc:mga06r32_101994_c1 | 3300050510 | Bacteria | 2816 |
| 702 | nmdc:mga06r32_102749_c1 | 3300050510 | Bacteria | 2806 |
| 703 | nmdc:mga06r32_1179849_c1 | 3300050510 | Bacteria | 712 |
| 704 | nmdc:mga06r32_254850_c1 | 3300050510 | Bacteria | 1742 |
| 705 | nmdc:mga06r32_445579_c1 | 3300050510 | Bacteria | 1275 |
| 706 | nmdc:mga06r32_61988_c1 | 3300050510 | Archaea | 3602 |
| 707 | nmdc:mga06r32_670708_c1 | 3300050510 | Bacteria | 1004 |
| 708 | nmdc:mga06r32_698988_c1 | 3300050510 | Bacteria | 980 |
| 709 | nmdc:mga06r32_749856_c1 | 3300050510 | Bacteria | 939 |
| 710 | nmdc:mga06r32_98773_c2 | 3300050510 | Bacteria | 1145 |
| 711 | nmdc:mga08y16_119395_c1 | 3300050511 | Bacteria | 2744 |
| 712 | nmdc:mga08y16_146165_c1 | 3300050511 | Archaea | 2458 |
| 713 | nmdc:mga08y16_626458_c1 | 3300050511 | Bacteria | 1082 |
| 714 | nmdc:mga08y16_649414_c1 | 3300050511 | Bacteria | 1059 |
| 715 | nmdc:mga08y16_703796_c1 | 3300050511 | Bacteria | 1010 |
| 716 | nmdc:mga08y16_913115_c1 | 3300050511 | Bacteria | 863 |
| 717 | nmdc:mga08y16_94777_c1 | 3300050511 | Bacteria | 3109 |
| 718 | nmdc:mga0n895_1611240_c1 | 3300050512 | Bacteria | 613 |
| 719 | nmdc:mga0n895_8124_c1 | 3300050512 | Bacteria | 9066 |
| 720 | nmdc:mga0n895_81665_c1 | 3300050512 | Unclassified | 3221 |
| 721 | nmdc:mga0rr50_283341_c1 | 3300050513 | Bacteria | 1383 |
| 722 | nmdc:mga08x19_333648_c1 | 3300050514 | Bacteria | 1057 |
| 723 | nmdc:mga08x19_64853_c1 | 3300050514 | Bacteria | 1475 |
| 724 | nmdc:mga08x19_69996_c1 | 3300050514 | Bacteria | 2285 |
| 725 | nmdc:mga0a205_29717_c2 | 3300050515 | Bacteria | 3178 |
| 726 | nmdc:mga0a205_31427_c1 | 3300050515 | Bacteria | 5086 |
| 727 | nmdc:mga0a205_34488_c1 | 3300050515 | Bacteria | 4854 |
| 728 | Ga0500650_0360617 | 3300053098 | Bacteria | 634 |
| 729 | Ga0501084_0015268 | 3300054114 | Bacteria | 6368 |
| 730 | Ga0501084_0025479 | 3300054114 | Bacteria | 4935 |
| 731 | Ga0501084_0256999 | 3300054114 | Bacteria | 1475 |
| 732 | Ga0590077_018589 | 3300059426 | Bacteria | 1468 |
| 733 | Ga0501082_0022789 | 3300060353 | Bacteria | 5394 |
| 734 | Ga0501082_0040727 | 3300060353 | Bacteria | 4006 |
| 735 | Ga0501082_0741802 | 3300060353 | Bacteria | 859 |
| 736 | Ga0530510_0008234 | 3300061734 | Bacteria | 7269 |
| 737 | Ga0530510_0077575 | 3300061734 | Bacteria | 2414 |
| 738 | Ga0530510_0976918 | 3300061734 | Bacteria | 648 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025927 | Ga0207687_11559023 | Ga0207687_115590231 | 155 |
| 2 | 3300025933 | Ga0207706_10263413 | Ga0207706_102634133 | 155 |
| 3 | 3300025936 | Ga0207670_10905268 | Ga0207670_109052681 | 155 |
| 4 | 3300025938 | Ga0207704_10012153 | Ga0207704_100121532 | 155 |
| 5 | 3300025940 | Ga0207691_10028018 | Ga0207691_100280183 | 155 |
| 6 | 3300025961 | Ga0207712_10074160 | Ga0207712_100741602 | 155 |
| 7 | 3300025986 | Ga0207658_10194895 | Ga0207658_101948952 | 155 |
| 8 | 3300026023 | Ga0207677_10313924 | Ga0207677_103139243 | 155 |
| 9 | 3300026088 | Ga0207641_10264573 | Ga0207641_102645733 | 155 |
| 10 | 3300026089 | Ga0207648_10001800 | Ga0207648_100018009 | 155 |
| 11 | 3300026095 | Ga0207676_10132857 | Ga0207676_101328572 | 155 |
| 12 | 3300028379 | Ga0268266_10664971 | Ga0268266_106649712 | 155 |
| 13 | 3300028380 | Ga0268265_11563257 | Ga0268265_115632571 | 155 |
| 14 | 3300028381 | Ga0268264_10180315 | Ga0268264_101803152 | 155 |
| 15 | 3300050510 | nmdc:mga06r32_102749_c1 | nmdc:mga06r32_102749_c1_2282_2767 | 155 |
| 16 | 3300050510 | nmdc:mga06r32_254850_c1 | nmdc:mga06r32_254850_c1_11_499 | 155 |
| 17 | 3300042876 | Ga0451577_0494948 | Ga0451577_0494948_21_497 | 156 |
| 18 | 3300025981 | Ga0207640_11038540 | Ga0207640_110385401 | 157 |
| 19 | 3300005295 | Ga0065707_10093493 | Ga0065707_100934934 | 158 |
| 20 | 3300013100 | Ga0157373_10186697 | Ga0157373_101866973 | 158 |
| 21 | 3300013102 | Ga0157371_10000830 | Ga0157371_1000083026 | 158 |
| 22 | 3300013102 | Ga0157371_10003303 | Ga0157371_1000330311 | 158 |
| 23 | 3300013104 | Ga0157370_10051040 | Ga0157370_100510404 | 158 |
| 24 | 3300013104 | Ga0157370_10449123 | Ga0157370_104491232 | 158 |
| 25 | 3300031548 | Ga0307408_101981692 | Ga0307408_1019816921 | 158 |
| 26 | 3300042437 | Ga0439444_0120909 | Ga0439444_0120909_53_538 | 158 |
| 27 | 3300049668 | Ga0501233_088704 | Ga0501233_088704_224_703 | 158 |
| 28 | 3300049705 | Ga0501225_0041800 | Ga0501225_0041800_565_1044 | 158 |
| 29 | 3300049708 | Ga0501245_007318 | Ga0501245_007318_105_584 | 158 |
| 30 | 3300037471 | Ga0395905_0420721 | Ga0395905_0420721_553_1041 | 159 |
| 31 | 3300046523 | Ga0495644_0186699 | Ga0495644_0186699_169_651 | 159 |
| 32 | 3300049572 | Ga0501036_0998356 | Ga0501036_0998356_120_647 | 159 |
| 33 | 3300049574 | Ga0501038_0470097 | Ga0501038_0470097_317_844 | 159 |
| 34 | 3300049575 | Ga0501039_0348830 | Ga0501039_0348830_305_832 | 159 |
| 35 | 3300049578 | Ga0501042_0332486 | Ga0501042_0332486_155_682 | 159 |
| 36 | 3300050510 | nmdc:mga06r32_749856_c1 | nmdc:mga06r32_749856_c1_348_836 | 159 |
| 37 | 3300005328 | Ga0070676_10980852 | Ga0070676_109808521 | 160 |
| 38 | 3300005334 | Ga0068869_100714118 | Ga0068869_1007141181 | 160 |
| 39 | 3300005339 | Ga0070660_101457688 | Ga0070660_1014576881 | 160 |
| 40 | 3300005341 | Ga0070691_10360555 | Ga0070691_103605552 | 160 |
| 41 | 3300005345 | Ga0070692_10807599 | Ga0070692_108075991 | 160 |
| 42 | 3300005347 | Ga0070668_100358947 | Ga0070668_1003589472 | 160 |
| 43 | 3300005354 | Ga0070675_100754570 | Ga0070675_1007545702 | 160 |
| 44 | 3300005354 | Ga0070675_100790667 | Ga0070675_1007906671 | 160 |
| 45 | 3300005355 | Ga0070671_100281642 | Ga0070671_1002816421 | 160 |
| 46 | 3300005356 | Ga0070674_100083924 | Ga0070674_1000839242 | 160 |
| 47 | 3300005444 | Ga0070694_100013925 | Ga0070694_1000139252 | 160 |
| 48 | 3300005455 | Ga0070663_101475071 | Ga0070663_1014750711 | 160 |
| 49 | 3300005530 | Ga0070679_100323167 | Ga0070679_1003231671 | 160 |
| 50 | 3300005549 | Ga0070704_100022238 | Ga0070704_1000222382 | 160 |
| 51 | 3300005563 | Ga0068855_100480758 | Ga0068855_1004807582 | 160 |
| 52 | 3300005578 | Ga0068854_100056259 | Ga0068854_1000562591 | 160 |
| 53 | 3300005614 | Ga0068856_100378288 | Ga0068856_1003782882 | 160 |
| 54 | 3300005616 | Ga0068852_100807824 | Ga0068852_1008078242 | 160 |
| 55 | 3300005617 | Ga0068859_100215382 | Ga0068859_1002153823 | 160 |
| 56 | 3300005719 | Ga0068861_100042324 | Ga0068861_1000423242 | 160 |
| 57 | 3300005843 | Ga0068860_100235990 | Ga0068860_1002359903 | 160 |
| 58 | 3300006175 | Ga0070712_100382950 | Ga0070712_1003829502 | 160 |
| 59 | 3300006847 | Ga0075431_100547166 | Ga0075431_1005471662 | 160 |
| 60 | 3300006852 | Ga0075433_10072810 | Ga0075433_100728104 | 160 |
| 61 | 3300006871 | Ga0075434_100278673 | Ga0075434_1002786734 | 160 |
| 62 | 3300006881 | Ga0068865_100415415 | Ga0068865_1004154152 | 160 |
| 63 | 3300006931 | Ga0097620_100215390 | Ga0097620_1002153903 | 160 |
| 64 | 3300009094 | Ga0111539_10220381 | Ga0111539_102203812 | 160 |
| 65 | 3300009094 | Ga0111539_10724161 | Ga0111539_107241612 | 160 |
| 66 | 3300009094 | Ga0111539_10827994 | Ga0111539_108279942 | 160 |
| 67 | 3300009147 | Ga0114129_10206847 | Ga0114129_102068474 | 160 |
| 68 | 3300010375 | Ga0105239_11426096 | Ga0105239_114260962 | 160 |
| 69 | 3300011119 | Ga0105246_10621704 | Ga0105246_106217042 | 160 |
| 70 | 3300012487 | Ga0157321_1013075 | Ga0157321_10130751 | 160 |
| 71 | 3300012510 | Ga0157316_1011411 | Ga0157316_10114112 | 160 |
| 72 | 3300013297 | Ga0157378_10074037 | Ga0157378_100740373 | 160 |
| 73 | 3300013306 | Ga0163162_10073872 | Ga0163162_100738723 | 160 |
| 74 | 3300013307 | Ga0157372_10888001 | Ga0157372_108880012 | 160 |
| 75 | 3300013308 | Ga0157375_10621796 | Ga0157375_106217962 | 160 |
| 76 | 3300014326 | Ga0157380_11995517 | Ga0157380_119955171 | 160 |
| 77 | 3300014969 | Ga0157376_10772862 | Ga0157376_107728622 | 160 |
| 78 | 3300025936 | Ga0207670_10216643 | Ga0207670_102166433 | 160 |
| 79 | 3300025942 | Ga0207689_10390238 | Ga0207689_103902382 | 160 |
| 80 | 3300025972 | Ga0207668_10257967 | Ga0207668_102579672 | 160 |
| 81 | 3300025981 | Ga0207640_10085407 | Ga0207640_100854074 | 160 |
| 82 | 3300025986 | Ga0207658_10604108 | Ga0207658_106041081 | 160 |
| 83 | 3300026023 | Ga0207677_11097683 | Ga0207677_110976831 | 160 |
| 84 | 3300026075 | Ga0207708_10449492 | Ga0207708_104494922 | 160 |
| 85 | 3300026121 | Ga0207683_10341566 | Ga0207683_103415662 | 160 |
| 86 | 3300027552 | Ga0209982_1003561 | Ga0209982_10035612 | 160 |
| 87 | 3300027907 | Ga0207428_10352052 | Ga0207428_103520522 | 160 |
| 88 | 3300027907 | Ga0207428_10696316 | Ga0207428_106963161 | 160 |
| 89 | 3300028380 | Ga0268265_10823681 | Ga0268265_108236812 | 160 |
| 90 | 3300031903 | Ga0307407_10590083 | Ga0307407_105900832 | 160 |
| 91 | 3300032005 | Ga0307411_10345411 | Ga0307411_103454112 | 160 |
| 92 | 3300035241 | Ga0373961_0199491 | Ga0373961_0199491_188_691 | 160 |
| 93 | 3300035691 | Ga0373931_0850481 | Ga0373931_0850481_61_564 | 160 |
| 94 | 3300037471 | Ga0395905_0162438 | Ga0395905_0162438_1427_1918 | 160 |
| 95 | 3300038443 | Ga0395901_0061333 | Ga0395901_0061333_1595_2086 | 160 |
| 96 | 3300046491 | Ga0495584_0014170 | Ga0495584_0014170_329_841 | 160 |
| 97 | 3300046492 | Ga0495585_0080608 | Ga0495585_0080608_465_977 | 160 |
| 98 | 3300046525 | Ga0495663_0037513 | Ga0495663_0037513_454_966 | 160 |
| 99 | 3300046660 | Ga0495625_0013132 | Ga0495625_0013132_947_1441 | 160 |
| 100 | 3300046691 | Ga0495670_0031366 | Ga0495670_0031366_1506_2018 | 160 |
| 101 | 3300047318 | Ga0495636_0065204 | Ga0495636_0065204_272_784 | 160 |
| 102 | 3300048904 | Ga0496101_0496720 | Ga0496101_0496720_180_677 | 160 |
| 103 | 3300048904 | Ga0496101_0724207 | Ga0496101_0724207_257_760 | 160 |
| 104 | 3300048905 | Ga0496102_0010277 | Ga0496102_0010277_6390_6893 | 160 |
| 105 | 3300048906 | Ga0496103_0256254 | Ga0496103_0256254_424_927 | 160 |
| 106 | 3300048909 | Ga0496106_1011285 | Ga0496106_1011285_22_525 | 160 |
| 107 | 3300048910 | Ga0496107_0348334 | Ga0496107_0348334_530_1033 | 160 |
| 108 | 3300048911 | Ga0496108_0350096 | Ga0496108_0350096_383_886 | 160 |
| 109 | 3300048912 | Ga0496109_0607344 | Ga0496109_0607344_64_567 | 160 |
| 110 | 3300048913 | Ga0496110_0219863 | Ga0496110_0219863_512_1015 | 160 |
| 111 | 3300048914 | Ga0496111_0435953 | Ga0496111_0435953_146_649 | 160 |
| 112 | 3300048915 | Ga0496112_0219229 | Ga0496112_0219229_256_759 | 160 |
| 113 | 3300049570 | Ga0501033_0021211 | Ga0501033_0021211_1042_1545 | 160 |
| 114 | 3300049572 | Ga0501036_0062762 | Ga0501036_0062762_516_1019 | 160 |
| 115 | 3300049574 | Ga0501038_0074323 | Ga0501038_0074323_729_1232 | 160 |
| 116 | 3300049575 | Ga0501039_0078025 | Ga0501039_0078025_1714_2217 | 160 |
| 117 | 3300049576 | Ga0501040_0010704 | Ga0501040_0010704_993_1496 | 160 |
| 118 | 3300049578 | Ga0501042_0081006 | Ga0501042_0081006_184_687 | 160 |
| 119 | 3300049579 | Ga0501043_0107682 | Ga0501043_0107682_216_719 | 160 |
| 120 | 3300049582 | Ga0501048_0006223 | Ga0501048_0006223_4587_5090 | 160 |
| 121 | 3300049584 | Ga0501068_0043293 | Ga0501068_0043293_822_1325 | 160 |
| 122 | 3300049587 | Ga0501071_0137500 | Ga0501071_0137500_163_666 | 160 |
| 123 | 3300049587 | Ga0501071_0498111 | Ga0501071_0498111_254_772 | 160 |
| 124 | 3300049588 | Ga0501072_0089424 | Ga0501072_0089424_1082_1585 | 160 |
| 125 | 3300049588 | Ga0501072_0922408 | Ga0501072_0922408_11_496 | 160 |
| 126 | 3300049590 | Ga0501074_0066817 | Ga0501074_0066817_10_513 | 160 |
| 127 | 3300049591 | Ga0501075_0008080 | Ga0501075_0008080_4958_5461 | 160 |
| 128 | 3300049592 | Ga0501076_0004790 | Ga0501076_0004790_5790_6293 | 160 |
| 129 | 3300049593 | Ga0501077_0009972 | Ga0501077_0009972_3730_4233 | 160 |
| 130 | 3300049593 | Ga0501077_0025001 | Ga0501077_0025001_2743_3246 | 160 |
| 131 | 3300049743 | Ga0501081_0033632 | Ga0501081_0033632_993_1496 | 160 |
| 132 | 3300049822 | Ga0501035_0061005 | Ga0501035_0061005_519_1022 | 160 |
| 133 | 3300049824 | Ga0501045_0008524 | Ga0501045_0008524_2751_3254 | 160 |
| 134 | 3300050507 | nmdc:mga05p37_1106957_c1 | nmdc:mga05p37_1106957_c1_86_589 | 160 |
| 135 | 3300050507 | nmdc:mga05p37_176990_c1 | nmdc:mga05p37_176990_c1_234_737 | 160 |
| 136 | 3300050510 | nmdc:mga06r32_98773_c2 | nmdc:mga06r32_98773_c2_167_670 | 160 |
| 137 | 3300050511 | nmdc:mga08y16_119395_c1 | nmdc:mga08y16_119395_c1_385_888 | 160 |
| 138 | 3300050511 | nmdc:mga08y16_626458_c1 | nmdc:mga08y16_626458_c1_233_745 | 160 |
| 139 | 3300050511 | nmdc:mga08y16_649414_c1 | nmdc:mga08y16_649414_c1_161_664 | 160 |
| 140 | 3300050515 | nmdc:mga0a205_29717_c2 | nmdc:mga0a205_29717_c2_1944_2447 | 160 |
| 141 | 3300054114 | Ga0501084_0025479 | Ga0501084_0025479_688_1191 | 160 |
| 142 | 3300060353 | Ga0501082_0022789 | Ga0501082_0022789_4677_5180 | 160 |
| 143 | 3300061734 | Ga0530510_0077575 | Ga0530510_0077575_46_549 | 160 |
| 144 | 3300061734 | Ga0530510_0976918 | Ga0530510_0976918_37_522 | 160 |
| 145 | 3300003322 | rootL2_10058686 | rootL2_100586866 | 161 |
| 146 | 3300005328 | Ga0070676_10182569 | Ga0070676_101825692 | 161 |
| 147 | 3300005331 | Ga0070670_100082100 | Ga0070670_1000821004 | 161 |
| 148 | 3300005333 | Ga0070677_10001919 | Ga0070677_100019193 | 161 |
| 149 | 3300005334 | Ga0068869_100016143 | Ga0068869_1000161434 | 161 |
| 150 | 3300005334 | Ga0068869_100119397 | Ga0068869_1001193973 | 161 |
| 151 | 3300005334 | Ga0068869_100248006 | Ga0068869_1002480062 | 161 |
| 152 | 3300005334 | Ga0068869_100282571 | Ga0068869_1002825712 | 161 |
| 153 | 3300005334 | Ga0068869_100536813 | Ga0068869_1005368131 | 161 |
| 154 | 3300005337 | Ga0070682_100009256 | Ga0070682_1000092564 | 161 |
| 155 | 3300005340 | Ga0070689_100119399 | Ga0070689_1001193993 | 161 |
| 156 | 3300005340 | Ga0070689_100230900 | Ga0070689_1002309002 | 161 |
| 157 | 3300005353 | Ga0070669_100729996 | Ga0070669_1007299962 | 161 |
| 158 | 3300005354 | Ga0070675_100002529 | Ga0070675_1000025298 | 161 |
| 159 | 3300005354 | Ga0070675_100527867 | Ga0070675_1005278672 | 161 |
| 160 | 3300005356 | Ga0070674_100018210 | Ga0070674_1000182104 | 161 |
| 161 | 3300005356 | Ga0070674_100473995 | Ga0070674_1004739953 | 161 |
| 162 | 3300005356 | Ga0070674_100703632 | Ga0070674_1007036322 | 161 |
| 163 | 3300005356 | Ga0070674_100766179 | Ga0070674_1007661792 | 161 |
| 164 | 3300005364 | Ga0070673_100015314 | Ga0070673_1000153145 | 161 |
| 165 | 3300005364 | Ga0070673_100048831 | Ga0070673_1000488313 | 161 |
| 166 | 3300005365 | Ga0070688_100729718 | Ga0070688_1007297181 | 161 |
| 167 | 3300005366 | Ga0070659_100879991 | Ga0070659_1008799912 | 161 |
| 168 | 3300005367 | Ga0070667_100035679 | Ga0070667_1000356794 | 161 |
| 169 | 3300005438 | Ga0070701_10014341 | Ga0070701_100143414 | 161 |
| 170 | 3300005438 | Ga0070701_10406858 | Ga0070701_104068582 | 161 |
| 171 | 3300005439 | Ga0070711_100161473 | Ga0070711_1001614732 | 161 |
| 172 | 3300005441 | Ga0070700_100073767 | Ga0070700_1000737672 | 161 |
| 173 | 3300005441 | Ga0070700_101167386 | Ga0070700_1011673861 | 161 |
| 174 | 3300005455 | Ga0070663_100336736 | Ga0070663_1003367363 | 161 |
| 175 | 3300005456 | Ga0070678_100030884 | Ga0070678_1000308844 | 161 |
| 176 | 3300005456 | Ga0070678_101173206 | Ga0070678_1011732061 | 161 |
| 177 | 3300005459 | Ga0068867_100018494 | Ga0068867_1000184941 | 161 |
| 178 | 3300005459 | Ga0068867_100331777 | Ga0068867_1003317772 | 161 |
| 179 | 3300005459 | Ga0068867_100508773 | Ga0068867_1005087731 | 161 |
| 180 | 3300005466 | Ga0070685_10010519 | Ga0070685_100105195 | 161 |
| 181 | 3300005466 | Ga0070685_10103790 | Ga0070685_101037902 | 161 |
| 182 | 3300005466 | Ga0070685_10426688 | Ga0070685_104266882 | 161 |
| 183 | 3300005471 | Ga0070698_100884261 | Ga0070698_1008842611 | 161 |
| 184 | 3300005518 | Ga0070699_101101123 | Ga0070699_1011011231 | 161 |
| 185 | 3300005536 | Ga0070697_100415699 | Ga0070697_1004156993 | 161 |
| 186 | 3300005539 | Ga0068853_101616134 | Ga0068853_1016161341 | 161 |
| 187 | 3300005543 | Ga0070672_100003495 | Ga0070672_1000034952 | 161 |
| 188 | 3300005543 | Ga0070672_100005464 | Ga0070672_1000054649 | 161 |
| 189 | 3300005544 | Ga0070686_100014728 | Ga0070686_1000147285 | 161 |
| 190 | 3300005544 | Ga0070686_100786308 | Ga0070686_1007863082 | 161 |
| 191 | 3300005545 | Ga0070695_100491387 | Ga0070695_1004913872 | 161 |
| 192 | 3300005546 | Ga0070696_100474032 | Ga0070696_1004740321 | 161 |
| 193 | 3300005546 | Ga0070696_100848020 | Ga0070696_1008480201 | 161 |
| 194 | 3300005548 | Ga0070665_100013512 | Ga0070665_1000135126 | 161 |
| 195 | 3300005548 | Ga0070665_100418224 | Ga0070665_1004182242 | 161 |
| 196 | 3300005548 | Ga0070665_101557080 | Ga0070665_1015570801 | 161 |
| 197 | 3300005564 | Ga0070664_100410022 | Ga0070664_1004100221 | 161 |
| 198 | 3300005577 | Ga0068857_100422668 | Ga0068857_1004226683 | 161 |
| 199 | 3300005617 | Ga0068859_100999209 | Ga0068859_1009992092 | 161 |
| 200 | 3300005618 | Ga0068864_100141094 | Ga0068864_1001410941 | 161 |
| 201 | 3300005718 | Ga0068866_10041977 | Ga0068866_100419773 | 161 |
| 202 | 3300005719 | Ga0068861_100082176 | Ga0068861_1000821764 | 161 |
| 203 | 3300005840 | Ga0068870_10006540 | Ga0068870_100065403 | 161 |
| 204 | 3300005841 | Ga0068863_100234098 | Ga0068863_1002340984 | 161 |
| 205 | 3300005841 | Ga0068863_100255791 | Ga0068863_1002557914 | 161 |
| 206 | 3300005843 | Ga0068860_100189878 | Ga0068860_1001898781 | 161 |
| 207 | 3300005844 | Ga0068862_100333529 | Ga0068862_1003335291 | 161 |
| 208 | 3300005844 | Ga0068862_100705211 | Ga0068862_1007052112 | 161 |
| 209 | 3300005937 | Ga0081455_10011370 | Ga0081455_100113709 | 161 |
| 210 | 3300006173 | Ga0070716_100582695 | Ga0070716_1005826951 | 161 |
| 211 | 3300006237 | Ga0097621_100043520 | Ga0097621_1000435202 | 161 |
| 212 | 3300006237 | Ga0097621_100082575 | Ga0097621_1000825754 | 161 |
| 213 | 3300006237 | Ga0097621_100259061 | Ga0097621_1002590613 | 161 |
| 214 | 3300006237 | Ga0097621_100534832 | Ga0097621_1005348322 | 161 |
| 215 | 3300006358 | Ga0068871_100054380 | Ga0068871_1000543802 | 161 |
| 216 | 3300006358 | Ga0068871_100139445 | Ga0068871_1001394454 | 161 |
| 217 | 3300006358 | Ga0068871_100402502 | Ga0068871_1004025022 | 161 |
| 218 | 3300006358 | Ga0068871_101080116 | Ga0068871_1010801161 | 161 |
| 219 | 3300006358 | Ga0068871_101249092 | Ga0068871_1012490922 | 161 |
| 220 | 3300006358 | Ga0068871_101420296 | Ga0068871_1014202961 | 161 |
| 221 | 3300006871 | Ga0075434_100586146 | Ga0075434_1005861463 | 161 |
| 222 | 3300006881 | Ga0068865_100007298 | Ga0068865_1000072985 | 161 |
| 223 | 3300006881 | Ga0068865_100113367 | Ga0068865_1001133673 | 161 |
| 224 | 3300006881 | Ga0068865_100222952 | Ga0068865_1002229523 | 161 |
| 225 | 3300006931 | Ga0097620_100999204 | Ga0097620_1009992042 | 161 |
| 226 | 3300007076 | Ga0075435_100061172 | Ga0075435_1000611722 | 161 |
| 227 | 3300009094 | Ga0111539_10346936 | Ga0111539_103469362 | 161 |
| 228 | 3300009094 | Ga0111539_10768691 | Ga0111539_107686912 | 161 |
| 229 | 3300009147 | Ga0114129_10025699 | Ga0114129_100256997 | 161 |
| 230 | 3300009147 | Ga0114129_11163833 | Ga0114129_111638331 | 161 |
| 231 | 3300009148 | Ga0105243_10033429 | Ga0105243_100334293 | 161 |
| 232 | 3300009176 | Ga0105242_10054832 | Ga0105242_100548323 | 161 |
| 233 | 3300009177 | Ga0105248_10504300 | Ga0105248_105043003 | 161 |
| 234 | 3300009177 | Ga0105248_10924245 | Ga0105248_109242452 | 161 |
| 235 | 3300009553 | Ga0105249_11750639 | Ga0105249_117506392 | 161 |
| 236 | 3300011119 | Ga0105246_10143229 | Ga0105246_101432293 | 161 |
| 237 | 3300013296 | Ga0157374_11382513 | Ga0157374_113825131 | 161 |
| 238 | 3300013306 | Ga0163162_10050057 | Ga0163162_100500573 | 161 |
| 239 | 3300013308 | Ga0157375_10004605 | Ga0157375_1000460510 | 161 |
| 240 | 3300013308 | Ga0157375_10100869 | Ga0157375_101008694 | 161 |
| 241 | 3300013308 | Ga0157375_10991118 | Ga0157375_109911182 | 161 |
| 242 | 3300014325 | Ga0163163_10110680 | Ga0163163_101106801 | 161 |
| 243 | 3300014325 | Ga0163163_10149169 | Ga0163163_101491693 | 161 |
| 244 | 3300014325 | Ga0163163_11073988 | Ga0163163_110739882 | 161 |
| 245 | 3300014326 | Ga0157380_10050326 | Ga0157380_100503264 | 161 |
| 246 | 3300014326 | Ga0157380_10083794 | Ga0157380_100837942 | 161 |
| 247 | 3300014326 | Ga0157380_10497769 | Ga0157380_104977692 | 161 |
| 248 | 3300014326 | Ga0157380_11115431 | Ga0157380_111154311 | 161 |
| 249 | 3300014326 | Ga0157380_11167570 | Ga0157380_111675702 | 161 |
| 250 | 3300014326 | Ga0157380_11546732 | Ga0157380_115467321 | 161 |
| 251 | 3300014969 | Ga0157376_10015473 | Ga0157376_100154736 | 161 |
| 252 | 3300014969 | Ga0157376_10138078 | Ga0157376_101380784 | 161 |
| 253 | 3300017792 | Ga0163161_10218456 | Ga0163161_102184564 | 161 |
| 254 | 3300017792 | Ga0163161_10404384 | Ga0163161_104043843 | 161 |
| 255 | 3300025315 | Ga0207697_10068723 | Ga0207697_100687232 | 161 |
| 256 | 3300025893 | Ga0207682_10003132 | Ga0207682_100031324 | 161 |
| 257 | 3300025899 | Ga0207642_10040912 | Ga0207642_100409123 | 161 |
| 258 | 3300025908 | Ga0207643_10009683 | Ga0207643_100096833 | 161 |
| 259 | 3300025908 | Ga0207643_10354455 | Ga0207643_103544552 | 161 |
| 260 | 3300025916 | Ga0207663_10205347 | Ga0207663_102053472 | 161 |
| 261 | 3300025923 | Ga0207681_10012328 | Ga0207681_100123283 | 161 |
| 262 | 3300025926 | Ga0207659_10018902 | Ga0207659_100189022 | 161 |
| 263 | 3300025926 | Ga0207659_10344937 | Ga0207659_103449371 | 161 |
| 264 | 3300025933 | Ga0207706_10332343 | Ga0207706_103323431 | 161 |
| 265 | 3300025934 | Ga0207686_10014515 | Ga0207686_100145154 | 161 |
| 266 | 3300025936 | Ga0207670_10158096 | Ga0207670_101580963 | 161 |
| 267 | 3300025937 | Ga0207669_10004353 | Ga0207669_100043532 | 161 |
| 268 | 3300025937 | Ga0207669_10876497 | Ga0207669_108764972 | 161 |
| 269 | 3300025938 | Ga0207704_10055717 | Ga0207704_100557172 | 161 |
| 270 | 3300025938 | Ga0207704_10056966 | Ga0207704_100569661 | 161 |
| 271 | 3300025938 | Ga0207704_10119811 | Ga0207704_101198111 | 161 |
| 272 | 3300025940 | Ga0207691_10007763 | Ga0207691_1000776314 | 161 |
| 273 | 3300025940 | Ga0207691_10059504 | Ga0207691_100595044 | 161 |
| 274 | 3300025941 | Ga0207711_10299314 | Ga0207711_102993142 | 161 |
| 275 | 3300025942 | Ga0207689_10004736 | Ga0207689_100047365 | 161 |
| 276 | 3300025942 | Ga0207689_10059539 | Ga0207689_100595392 | 161 |
| 277 | 3300025942 | Ga0207689_10109033 | Ga0207689_101090332 | 161 |
| 278 | 3300025942 | Ga0207689_10322324 | Ga0207689_103223242 | 161 |
| 279 | 3300025960 | Ga0207651_10056014 | Ga0207651_100560144 | 161 |
| 280 | 3300025960 | Ga0207651_10163583 | Ga0207651_101635833 | 161 |
| 281 | 3300025986 | Ga0207658_10293652 | Ga0207658_102936522 | 161 |
| 282 | 3300026075 | Ga0207708_10077192 | Ga0207708_100771924 | 161 |
| 283 | 3300026075 | Ga0207708_10248896 | Ga0207708_102488962 | 161 |
| 284 | 3300026075 | Ga0207708_10258486 | Ga0207708_102584862 | 161 |
| 285 | 3300026088 | Ga0207641_10031738 | Ga0207641_100317384 | 161 |
| 286 | 3300026088 | Ga0207641_10107336 | Ga0207641_101073361 | 161 |
| 287 | 3300026089 | Ga0207648_10020948 | Ga0207648_100209488 | 161 |
| 288 | 3300026089 | Ga0207648_10151364 | Ga0207648_101513644 | 161 |
| 289 | 3300026089 | Ga0207648_10995275 | Ga0207648_109952752 | 161 |
| 290 | 3300026089 | Ga0207648_11111823 | Ga0207648_111118231 | 161 |
| 291 | 3300026095 | Ga0207676_11713335 | Ga0207676_117133351 | 161 |
| 292 | 3300026116 | Ga0207674_10394831 | Ga0207674_103948313 | 161 |
| 293 | 3300026118 | Ga0207675_100226538 | Ga0207675_1002265382 | 161 |
| 294 | 3300026118 | Ga0207675_100503365 | Ga0207675_1005033653 | 161 |
| 295 | 3300026118 | Ga0207675_100864074 | Ga0207675_1008640741 | 161 |
| 296 | 3300026121 | Ga0207683_10042246 | Ga0207683_100422462 | 161 |
| 297 | 3300028379 | Ga0268266_10044966 | Ga0268266_100449664 | 161 |
| 298 | 3300028379 | Ga0268266_10165015 | Ga0268266_101650154 | 161 |
| 299 | 3300028379 | Ga0268266_11059496 | Ga0268266_110594961 | 161 |
| 300 | 3300028380 | Ga0268265_10935066 | Ga0268265_109350662 | 161 |
| 301 | 3300028381 | Ga0268264_10196304 | Ga0268264_101963042 | 161 |
| 302 | 3300031456 | Ga0307513_10027758 | Ga0307513_100277586 | 161 |
| 303 | 3300031456 | Ga0307513_10142449 | Ga0307513_101424494 | 161 |
| 304 | 3300031456 | Ga0307513_10145467 | Ga0307513_101454672 | 161 |
| 305 | 3300031507 | Ga0307509_10009146 | Ga0307509_100091464 | 161 |
| 306 | 3300031507 | Ga0307509_10171419 | Ga0307509_101714192 | 161 |
| 307 | 3300031507 | Ga0307509_10348300 | Ga0307509_103483002 | 161 |
| 308 | 3300031548 | Ga0307408_100000035 | Ga0307408_100000035141 | 161 |
| 309 | 3300031731 | Ga0307405_10485541 | Ga0307405_104855411 | 161 |
| 310 | 3300031824 | Ga0307413_10018554 | Ga0307413_100185544 | 161 |
| 311 | 3300031824 | Ga0307413_10063789 | Ga0307413_100637894 | 161 |
| 312 | 3300031852 | Ga0307410_10055113 | Ga0307410_100551133 | 161 |
| 313 | 3300031852 | Ga0307410_11180150 | Ga0307410_111801502 | 161 |
| 314 | 3300031903 | Ga0307407_10000211 | Ga0307407_100002112 | 161 |
| 315 | 3300031903 | Ga0307407_10020319 | Ga0307407_100203192 | 161 |
| 316 | 3300031903 | Ga0307407_10241127 | Ga0307407_102411273 | 161 |
| 317 | 3300031995 | Ga0307409_100276992 | Ga0307409_1002769923 | 161 |
| 318 | 3300032005 | Ga0307411_10032163 | Ga0307411_100321632 | 161 |
| 319 | 3300032005 | Ga0307411_10111617 | Ga0307411_101116172 | 161 |
| 320 | 3300032005 | Ga0307411_11366423 | Ga0307411_113664231 | 161 |
| 321 | 3300041443 | Ga0451789_1231417 | Ga0451789_1231417_301_795 | 161 |
| 322 | 3300041451 | Ga0451791_0550808 | Ga0451791_0550808_855_1349 | 161 |
| 323 | 3300041452 | Ga0451793_0639628 | Ga0451793_0639628_21_515 | 161 |
| 324 | 3300041456 | Ga0451795_1615507 | Ga0451795_1615507_405_899 | 161 |
| 325 | 3300041458 | Ga0451798_0003318 | Ga0451798_0003318_429_923 | 161 |
| 326 | 3300041459 | Ga0451800_0601781 | Ga0451800_0601781_825_1319 | 161 |
| 327 | 3300041460 | Ga0451802_0233296 | Ga0451802_0233296_525_1082 | 161 |
| 328 | 3300041460 | Ga0451802_0842791 | Ga0451802_0842791_1068_1562 | 161 |
| 329 | 3300041486 | Ga0451807_0061546 | Ga0451807_0061546_6264_6758 | 161 |
| 330 | 3300041486 | Ga0451807_0112940 | Ga0451807_0112940_1305_1802 | 161 |
| 331 | 3300041509 | Ga0451843_1694280 | Ga0451843_1694280_43_537 | 161 |
| 332 | 3300042993 | Ga0439440_0039545 | Ga0439440_0039545_384_881 | 161 |
| 333 | 3300046457 | Ga0495590_0140175 | Ga0495590_0140175_250_747 | 161 |
| 334 | 3300046460 | Ga0495638_0005416 | Ga0495638_0005416_5161_5655 | 161 |
| 335 | 3300046519 | Ga0495632_0036558 | Ga0495632_0036558_787_1284 | 161 |
| 336 | 3300046520 | Ga0495637_0117879 | Ga0495637_0117879_174_671 | 161 |
| 337 | 3300046557 | Ga0495622_0199713 | Ga0495622_0199713_360_857 | 161 |
| 338 | 3300046660 | Ga0495625_0047730 | Ga0495625_0047730_2382_2879 | 161 |
| 339 | 3300046694 | Ga0495649_0003550 | Ga0495649_0003550_7445_7942 | 161 |
| 340 | 3300046694 | Ga0495649_0218427 | Ga0495649_0218427_221_718 | 161 |
| 341 | 3300048091 | Ga0495626_0117424 | Ga0495626_0117424_167_664 | 161 |
| 342 | 3300048903 | Ga0496100_0071424 | Ga0496100_0071424_1692_2186 | 161 |
| 343 | 3300048904 | Ga0496101_0107204 | Ga0496101_0107204_614_1108 | 161 |
| 344 | 3300048909 | Ga0496106_0606410 | Ga0496106_0606410_151_645 | 161 |
| 345 | 3300048917 | Ga0496114_0375359 | Ga0496114_0375359_429_923 | 161 |
| 346 | 3300049572 | Ga0501036_0285103 | Ga0501036_0285103_369_953 | 161 |
| 347 | 3300049573 | Ga0501037_0088973 | Ga0501037_0088973_1582_2076 | 161 |
| 348 | 3300049576 | Ga0501040_0266514 | Ga0501040_0266514_418_912 | 161 |
| 349 | 3300049583 | Ga0501067_0010818 | Ga0501067_0010818_855_1439 | 161 |
| 350 | 3300049584 | Ga0501068_0001138 | Ga0501068_0001138_10182_10766 | 161 |
| 351 | 3300049586 | Ga0501070_0039090 | Ga0501070_0039090_1758_2342 | 161 |
| 352 | 3300049587 | Ga0501071_0234659 | Ga0501071_0234659_541_1125 | 161 |
| 353 | 3300049589 | Ga0501073_0013731 | Ga0501073_0013731_4653_5237 | 161 |
| 354 | 3300049590 | Ga0501074_0000872 | Ga0501074_0000872_15016_15600 | 161 |
| 355 | 3300049592 | Ga0501076_0030444 | Ga0501076_0030444_479_1063 | 161 |
| 356 | 3300049741 | Ga0501079_0000867 | Ga0501079_0000867_18605_19189 | 161 |
| 357 | 3300049742 | Ga0501080_0009692 | Ga0501080_0009692_3991_4575 | 161 |
| 358 | 3300049743 | Ga0501081_0262526 | Ga0501081_0262526_164_748 | 161 |
| 359 | 3300049744 | Ga0501083_0004795 | Ga0501083_0004795_4472_5056 | 161 |
| 360 | 3300049822 | Ga0501035_0000029 | Ga0501035_0000029_60947_61444 | 161 |
| 361 | 3300050507 | nmdc:mga05p37_27545_c1 | nmdc:mga05p37_27545_c1_1897_2394 | 161 |
| 362 | 3300050511 | nmdc:mga08y16_913115_c1 | nmdc:mga08y16_913115_c1_134_628 | 161 |
| 363 | 3300050512 | nmdc:mga0n895_1611240_c1 | nmdc:mga0n895_1611240_c1_53_547 | 161 |
| 364 | 3300050513 | nmdc:mga0rr50_283341_c1 | nmdc:mga0rr50_283341_c1_162_656 | 161 |
| 365 | 3300050514 | nmdc:mga08x19_333648_c1 | nmdc:mga08x19_333648_c1_250_744 | 161 |
| 366 | 3300054114 | Ga0501084_0015268 | Ga0501084_0015268_3990_4574 | 161 |
| 367 | 3300054114 | Ga0501084_0256999 | Ga0501084_0256999_528_1022 | 161 |
| 368 | 3300060353 | Ga0501082_0040727 | Ga0501082_0040727_1445_2029 | 161 |
| 369 | 3300060353 | Ga0501082_0741802 | Ga0501082_0741802_44_541 | 161 |
| 370 | 3300002773 | JGI25152J39213_1000011 | JGI25152J39213_100001153 | 162 |
| 371 | 3300002774 | JGI25150J39212_1000192 | JGI25150J39212_100019230 | 162 |
| 372 | 3300003215 | JGI25153J46596_10008784 | JGI25153J46596_100087846 | 162 |
| 373 | 3300003320 | rootH2_10120259 | rootH2_101202591 | 162 |
| 374 | 3300003775 | Ga0055524_1000795 | Ga0055524_100079515 | 162 |
| 375 | 3300004803 | Ga0058862_12052405 | Ga0058862_120524052 | 162 |
| 376 | 3300005293 | Ga0065715_10119334 | Ga0065715_101193341 | 162 |
| 377 | 3300005293 | Ga0065715_10193406 | Ga0065715_101934062 | 162 |
| 378 | 3300005293 | Ga0065715_10940291 | Ga0065715_109402911 | 162 |
| 379 | 3300005327 | Ga0070658_10737086 | Ga0070658_107370861 | 162 |
| 380 | 3300005327 | Ga0070658_10756199 | Ga0070658_107561991 | 162 |
| 381 | 3300005328 | Ga0070676_10304891 | Ga0070676_103048911 | 162 |
| 382 | 3300005329 | Ga0070683_100033350 | Ga0070683_1000333506 | 162 |
| 383 | 3300005329 | Ga0070683_100065908 | Ga0070683_1000659082 | 162 |
| 384 | 3300005329 | Ga0070683_100110269 | Ga0070683_1001102692 | 162 |
| 385 | 3300005331 | Ga0070670_100031186 | Ga0070670_1000311862 | 162 |
| 386 | 3300005331 | Ga0070670_100042393 | Ga0070670_1000423934 | 162 |
| 387 | 3300005336 | Ga0070680_100120994 | Ga0070680_1001209943 | 162 |
| 388 | 3300005336 | Ga0070680_100415512 | Ga0070680_1004155122 | 162 |
| 389 | 3300005344 | Ga0070661_100031934 | Ga0070661_1000319346 | 162 |
| 390 | 3300005344 | Ga0070661_100167693 | Ga0070661_1001676932 | 162 |
| 391 | 3300005344 | Ga0070661_100298197 | Ga0070661_1002981971 | 162 |
| 392 | 3300005345 | Ga0070692_10691517 | Ga0070692_106915171 | 162 |
| 393 | 3300005347 | Ga0070668_100087591 | Ga0070668_1000875911 | 162 |
| 394 | 3300005353 | Ga0070669_100317159 | Ga0070669_1003171592 | 162 |
| 395 | 3300005354 | Ga0070675_100014873 | Ga0070675_1000148735 | 162 |
| 396 | 3300005354 | Ga0070675_100403557 | Ga0070675_1004035572 | 162 |
| 397 | 3300005354 | Ga0070675_101307027 | Ga0070675_1013070271 | 162 |
| 398 | 3300005355 | Ga0070671_100030633 | Ga0070671_1000306335 | 162 |
| 399 | 3300005355 | Ga0070671_100152731 | Ga0070671_1001527313 | 162 |
| 400 | 3300005356 | Ga0070674_100298360 | Ga0070674_1002983602 | 162 |
| 401 | 3300005364 | Ga0070673_100458440 | Ga0070673_1004584401 | 162 |
| 402 | 3300005365 | Ga0070688_100207811 | Ga0070688_1002078112 | 162 |
| 403 | 3300005367 | Ga0070667_100116943 | Ga0070667_1001169431 | 162 |
| 404 | 3300005435 | Ga0070714_100037634 | Ga0070714_1000376341 | 162 |
| 405 | 3300005436 | Ga0070713_100002093 | Ga0070713_1000020939 | 162 |
| 406 | 3300005438 | Ga0070701_10185750 | Ga0070701_101857501 | 162 |
| 407 | 3300005439 | Ga0070711_100030774 | Ga0070711_1000307741 | 162 |
| 408 | 3300005439 | Ga0070711_100421622 | Ga0070711_1004216221 | 162 |
| 409 | 3300005440 | Ga0070705_100057663 | Ga0070705_1000576632 | 162 |
| 410 | 3300005440 | Ga0070705_100116584 | Ga0070705_1001165842 | 162 |
| 411 | 3300005445 | Ga0070708_100039835 | Ga0070708_1000398352 | 162 |
| 412 | 3300005456 | Ga0070678_100188766 | Ga0070678_1001887662 | 162 |
| 413 | 3300005458 | Ga0070681_10167376 | Ga0070681_101673761 | 162 |
| 414 | 3300005459 | Ga0068867_100200125 | Ga0068867_1002001253 | 162 |
| 415 | 3300005459 | Ga0068867_100202031 | Ga0068867_1002020312 | 162 |
| 416 | 3300005459 | Ga0068867_100442480 | Ga0068867_1004424802 | 162 |
| 417 | 3300005459 | Ga0068867_100629845 | Ga0068867_1006298452 | 162 |
| 418 | 3300005466 | Ga0070685_10238155 | Ga0070685_102381551 | 162 |
| 419 | 3300005468 | Ga0070707_100219459 | Ga0070707_1002194592 | 162 |
| 420 | 3300005471 | Ga0070698_100031386 | Ga0070698_1000313866 | 162 |
| 421 | 3300005518 | Ga0070699_100067735 | Ga0070699_1000677353 | 162 |
| 422 | 3300005518 | Ga0070699_100164156 | Ga0070699_1001641563 | 162 |
| 423 | 3300005518 | Ga0070699_100316473 | Ga0070699_1003164731 | 162 |
| 424 | 3300005518 | Ga0070699_101301841 | Ga0070699_1013018411 | 162 |
| 425 | 3300005530 | Ga0070679_100094887 | Ga0070679_1000948874 | 162 |
| 426 | 3300005535 | Ga0070684_100080666 | Ga0070684_1000806664 | 162 |
| 427 | 3300005535 | Ga0070684_100183447 | Ga0070684_1001834472 | 162 |
| 428 | 3300005535 | Ga0070684_100333151 | Ga0070684_1003331511 | 162 |
| 429 | 3300005535 | Ga0070684_100428813 | Ga0070684_1004288131 | 162 |
| 430 | 3300005536 | Ga0070697_100171295 | Ga0070697_1001712951 | 162 |
| 431 | 3300005539 | Ga0068853_100194027 | Ga0068853_1001940271 | 162 |
| 432 | 3300005539 | Ga0068853_100962404 | Ga0068853_1009624042 | 162 |
| 433 | 3300005543 | Ga0070672_100032723 | Ga0070672_1000327233 | 162 |
| 434 | 3300005546 | Ga0070696_100094040 | Ga0070696_1000940402 | 162 |
| 435 | 3300005549 | Ga0070704_100988525 | Ga0070704_1009885252 | 162 |
| 436 | 3300005563 | Ga0068855_100127119 | Ga0068855_1001271192 | 162 |
| 437 | 3300005563 | Ga0068855_100636349 | Ga0068855_1006363492 | 162 |
| 438 | 3300005564 | Ga0070664_100190205 | Ga0070664_1001902052 | 162 |
| 439 | 3300005564 | Ga0070664_100215796 | Ga0070664_1002157961 | 162 |
| 440 | 3300005564 | Ga0070664_100282472 | Ga0070664_1002824724 | 162 |
| 441 | 3300005564 | Ga0070664_101010890 | Ga0070664_1010108901 | 162 |
| 442 | 3300005577 | Ga0068857_100557042 | Ga0068857_1005570422 | 162 |
| 443 | 3300005578 | Ga0068854_100082366 | Ga0068854_1000823661 | 162 |
| 444 | 3300005578 | Ga0068854_100727676 | Ga0068854_1007276761 | 162 |
| 445 | 3300005578 | Ga0068854_101024594 | Ga0068854_1010245941 | 162 |
| 446 | 3300005614 | Ga0068856_100232508 | Ga0068856_1002325082 | 162 |
| 447 | 3300005615 | Ga0070702_100075076 | Ga0070702_1000750762 | 162 |
| 448 | 3300005615 | Ga0070702_100653983 | Ga0070702_1006539831 | 162 |
| 449 | 3300005616 | Ga0068852_100000396 | Ga0068852_1000003962 | 162 |
| 450 | 3300005616 | Ga0068852_100347911 | Ga0068852_1003479111 | 162 |
| 451 | 3300005616 | Ga0068852_101869087 | Ga0068852_1018690871 | 162 |
| 452 | 3300005617 | Ga0068859_100199022 | Ga0068859_1001990222 | 162 |
| 453 | 3300005617 | Ga0068859_100465542 | Ga0068859_1004655422 | 162 |
| 454 | 3300005618 | Ga0068864_100117902 | Ga0068864_1001179023 | 162 |
| 455 | 3300005618 | Ga0068864_100518743 | Ga0068864_1005187433 | 162 |
| 456 | 3300005719 | Ga0068861_101384939 | Ga0068861_1013849391 | 162 |
| 457 | 3300005840 | Ga0068870_10123930 | Ga0068870_101239303 | 162 |
| 458 | 3300005841 | Ga0068863_100747581 | Ga0068863_1007475812 | 162 |
| 459 | 3300005843 | Ga0068860_100022880 | Ga0068860_1000228802 | 162 |
| 460 | 3300006038 | Ga0075365_10220724 | Ga0075365_102207242 | 162 |
| 461 | 3300006058 | Ga0075432_10226391 | Ga0075432_102263911 | 162 |
| 462 | 3300006058 | Ga0075432_10294029 | Ga0075432_102940291 | 162 |
| 463 | 3300006175 | Ga0070712_100101302 | Ga0070712_1001013023 | 162 |
| 464 | 3300006175 | Ga0070712_100107804 | Ga0070712_1001078043 | 162 |
| 465 | 3300006195 | Ga0075366_10010031 | Ga0075366_100100315 | 162 |
| 466 | 3300006195 | Ga0075366_10072120 | Ga0075366_100721202 | 162 |
| 467 | 3300006237 | Ga0097621_100531790 | Ga0097621_1005317902 | 162 |
| 468 | 3300006358 | Ga0068871_100059349 | Ga0068871_1000593494 | 162 |
| 469 | 3300006358 | Ga0068871_100475057 | Ga0068871_1004750571 | 162 |
| 470 | 3300006844 | Ga0075428_100011452 | Ga0075428_1000114528 | 162 |
| 471 | 3300006844 | Ga0075428_100091957 | Ga0075428_1000919571 | 162 |
| 472 | 3300006844 | Ga0075428_100743009 | Ga0075428_1007430092 | 162 |
| 473 | 3300006846 | Ga0075430_100005840 | Ga0075430_1000058404 | 162 |
| 474 | 3300006846 | Ga0075430_100026577 | Ga0075430_1000265773 | 162 |
| 475 | 3300006846 | Ga0075430_100060510 | Ga0075430_1000605102 | 162 |
| 476 | 3300006846 | Ga0075430_100491307 | Ga0075430_1004913071 | 162 |
| 477 | 3300006847 | Ga0075431_100017186 | Ga0075431_1000171864 | 162 |
| 478 | 3300006847 | Ga0075431_100112418 | Ga0075431_1001124181 | 162 |
| 479 | 3300006847 | Ga0075431_100153043 | Ga0075431_1001530434 | 162 |
| 480 | 3300006847 | Ga0075431_100216254 | Ga0075431_1002162541 | 162 |
| 481 | 3300006847 | Ga0075431_100248436 | Ga0075431_1002484362 | 162 |
| 482 | 3300006847 | Ga0075431_100333904 | Ga0075431_1003339041 | 162 |
| 483 | 3300006847 | Ga0075431_101000440 | Ga0075431_1010004401 | 162 |
| 484 | 3300006852 | Ga0075433_10034948 | Ga0075433_100349482 | 162 |
| 485 | 3300006852 | Ga0075433_10035427 | Ga0075433_100354274 | 162 |
| 486 | 3300006852 | Ga0075433_10299674 | Ga0075433_102996742 | 162 |
| 487 | 3300006871 | Ga0075434_100111577 | Ga0075434_1001115771 | 162 |
| 488 | 3300006871 | Ga0075434_101146363 | Ga0075434_1011463632 | 162 |
| 489 | 3300006880 | Ga0075429_100125808 | Ga0075429_1001258082 | 162 |
| 490 | 3300006914 | Ga0075436_100064270 | Ga0075436_1000642702 | 162 |
| 491 | 3300006914 | Ga0075436_100243767 | Ga0075436_1002437672 | 162 |
| 492 | 3300006914 | Ga0075436_100541691 | Ga0075436_1005416911 | 162 |
| 493 | 3300006931 | Ga0097620_100199007 | Ga0097620_1001990072 | 162 |
| 494 | 3300006931 | Ga0097620_100465519 | Ga0097620_1004655192 | 162 |
| 495 | 3300007076 | Ga0075435_100185703 | Ga0075435_1001857032 | 162 |
| 496 | 3300007076 | Ga0075435_101496074 | Ga0075435_1014960741 | 162 |
| 497 | 3300009093 | Ga0105240_10036346 | Ga0105240_100363463 | 162 |
| 498 | 3300009093 | Ga0105240_10326116 | Ga0105240_103261162 | 162 |
| 499 | 3300009094 | Ga0111539_10140806 | Ga0111539_101408061 | 162 |
| 500 | 3300009094 | Ga0111539_10225301 | Ga0111539_102253011 | 162 |
| 501 | 3300009094 | Ga0111539_10445984 | Ga0111539_104459842 | 162 |
| 502 | 3300009094 | Ga0111539_10684231 | Ga0111539_106842312 | 162 |
| 503 | 3300009147 | Ga0114129_10193744 | Ga0114129_101937442 | 162 |
| 504 | 3300009147 | Ga0114129_10713892 | Ga0114129_107138922 | 162 |
| 505 | 3300009148 | Ga0105243_12001656 | Ga0105243_120016561 | 162 |
| 506 | 3300009174 | Ga0105241_10508205 | Ga0105241_105082051 | 162 |
| 507 | 3300009174 | Ga0105241_11434347 | Ga0105241_114343471 | 162 |
| 508 | 3300009176 | Ga0105242_10086811 | Ga0105242_100868112 | 162 |
| 509 | 3300009177 | Ga0105248_10175949 | Ga0105248_101759494 | 162 |
| 510 | 3300009177 | Ga0105248_10942549 | Ga0105248_109425492 | 162 |
| 511 | 3300009545 | Ga0105237_10004247 | Ga0105237_100042472 | 162 |
| 512 | 3300009545 | Ga0105237_10369657 | Ga0105237_103696571 | 162 |
| 513 | 3300009545 | Ga0105237_11781317 | Ga0105237_117813171 | 162 |
| 514 | 3300009551 | Ga0105238_10002845 | Ga0105238_100028459 | 162 |
| 515 | 3300009551 | Ga0105238_10089714 | Ga0105238_100897142 | 162 |
| 516 | 3300009551 | Ga0105238_10210223 | Ga0105238_102102232 | 162 |
| 517 | 3300010375 | Ga0105239_10004502 | Ga0105239_1000450213 | 162 |
| 518 | 3300010375 | Ga0105239_10549664 | Ga0105239_105496641 | 162 |
| 519 | 3300012477 | Ga0157336_1000062 | Ga0157336_10000623 | 162 |
| 520 | 3300012478 | Ga0157328_1007160 | Ga0157328_10071602 | 162 |
| 521 | 3300013100 | Ga0157373_10029707 | Ga0157373_100297072 | 162 |
| 522 | 3300013104 | Ga0157370_10025403 | Ga0157370_100254032 | 162 |
| 523 | 3300013104 | Ga0157370_10074572 | Ga0157370_100745722 | 162 |
| 524 | 3300013104 | Ga0157370_10391008 | Ga0157370_103910082 | 162 |
| 525 | 3300013105 | Ga0157369_10356063 | Ga0157369_103560633 | 162 |
| 526 | 3300013105 | Ga0157369_10584756 | Ga0157369_105847562 | 162 |
| 527 | 3300013297 | Ga0157378_10625089 | Ga0157378_106250891 | 162 |
| 528 | 3300013307 | Ga0157372_10033879 | Ga0157372_100338792 | 162 |
| 529 | 3300013307 | Ga0157372_10166495 | Ga0157372_101664952 | 162 |
| 530 | 3300013307 | Ga0157372_10688128 | Ga0157372_106881281 | 162 |
| 531 | 3300013307 | Ga0157372_10776969 | Ga0157372_107769691 | 162 |
| 532 | 3300013308 | Ga0157375_12250297 | Ga0157375_122502972 | 162 |
| 533 | 3300014325 | Ga0163163_10036870 | Ga0163163_100368705 | 162 |
| 534 | 3300014325 | Ga0163163_10196396 | Ga0163163_101963963 | 162 |
| 535 | 3300014325 | Ga0163163_10256092 | Ga0163163_102560923 | 162 |
| 536 | 3300014969 | Ga0157376_10143521 | Ga0157376_101435212 | 162 |
| 537 | 3300014969 | Ga0157376_10296161 | Ga0157376_102961612 | 162 |
| 538 | 3300020070 | Ga0206356_10923714 | Ga0206356_109237142 | 162 |
| 539 | 3300020076 | Ga0206355_1352774 | Ga0206355_13527741 | 162 |
| 540 | 3300020078 | Ga0206352_10264359 | Ga0206352_102643591 | 162 |
| 541 | 3300020080 | Ga0206350_11660287 | Ga0206350_116602871 | 162 |
| 542 | 3300020082 | Ga0206353_10852945 | Ga0206353_108529452 | 162 |
| 543 | 3300022467 | Ga0224712_10089302 | Ga0224712_100893021 | 162 |
| 544 | 3300022467 | Ga0224712_10318442 | Ga0224712_103184421 | 162 |
| 545 | 3300025245 | Ga0207425_1000001 | Ga0207425_10000011437 | 162 |
| 546 | 3300025258 | Ga0209129_1000001 | Ga0209129_1000001614 | 162 |
| 547 | 3300025263 | Ga0209565_1012991 | Ga0209565_10129912 | 162 |
| 548 | 3300025284 | Ga0209130_1037776 | Ga0209130_10377762 | 162 |
| 549 | 3300025297 | Ga0209758_1000073 | Ga0209758_1000073163 | 162 |
| 550 | 3300025299 | Ga0209256_1000116 | Ga0209256_100011691 | 162 |
| 551 | 3300025893 | Ga0207682_10144957 | Ga0207682_101449572 | 162 |
| 552 | 3300025907 | Ga0207645_10530371 | Ga0207645_105303711 | 162 |
| 553 | 3300025907 | Ga0207645_10657177 | Ga0207645_106571772 | 162 |
| 554 | 3300025908 | Ga0207643_10123817 | Ga0207643_101238173 | 162 |
| 555 | 3300025908 | Ga0207643_10403801 | Ga0207643_104038012 | 162 |
| 556 | 3300025909 | Ga0207705_10190455 | Ga0207705_101904553 | 162 |
| 557 | 3300025910 | Ga0207684_10044118 | Ga0207684_100441182 | 162 |
| 558 | 3300025910 | Ga0207684_10466335 | Ga0207684_104663351 | 162 |
| 559 | 3300025911 | Ga0207654_10416751 | Ga0207654_104167512 | 162 |
| 560 | 3300025911 | Ga0207654_10547159 | Ga0207654_105471591 | 162 |
| 561 | 3300025912 | Ga0207707_10305746 | Ga0207707_103057462 | 162 |
| 562 | 3300025912 | Ga0207707_10692286 | Ga0207707_106922862 | 162 |
| 563 | 3300025912 | Ga0207707_10923754 | Ga0207707_109237541 | 162 |
| 564 | 3300025913 | Ga0207695_10033025 | Ga0207695_100330252 | 162 |
| 565 | 3300025913 | Ga0207695_10039302 | Ga0207695_100393023 | 162 |
| 566 | 3300025913 | Ga0207695_10047165 | Ga0207695_100471653 | 162 |
| 567 | 3300025913 | Ga0207695_10074603 | Ga0207695_100746033 | 162 |
| 568 | 3300025914 | Ga0207671_10003331 | Ga0207671_1000333114 | 162 |
| 569 | 3300025914 | Ga0207671_10279308 | Ga0207671_102793082 | 162 |
| 570 | 3300025914 | Ga0207671_10742842 | Ga0207671_107428422 | 162 |
| 571 | 3300025915 | Ga0207693_10105812 | Ga0207693_101058123 | 162 |
| 572 | 3300025915 | Ga0207693_10112576 | Ga0207693_101125762 | 162 |
| 573 | 3300025915 | Ga0207693_10650889 | Ga0207693_106508891 | 162 |
| 574 | 3300025917 | Ga0207660_10323375 | Ga0207660_103233752 | 162 |
| 575 | 3300025920 | Ga0207649_10015896 | Ga0207649_100158963 | 162 |
| 576 | 3300025920 | Ga0207649_10137520 | Ga0207649_101375202 | 162 |
| 577 | 3300025920 | Ga0207649_10247391 | Ga0207649_102473912 | 162 |
| 578 | 3300025920 | Ga0207649_10292041 | Ga0207649_102920412 | 162 |
| 579 | 3300025920 | Ga0207649_10448090 | Ga0207649_104480902 | 162 |
| 580 | 3300025920 | Ga0207649_10471698 | Ga0207649_104716982 | 162 |
| 581 | 3300025921 | Ga0207652_10084265 | Ga0207652_100842652 | 162 |
| 582 | 3300025921 | Ga0207652_10163064 | Ga0207652_101630642 | 162 |
| 583 | 3300025922 | Ga0207646_10772738 | Ga0207646_107727381 | 162 |
| 584 | 3300025922 | Ga0207646_10790545 | Ga0207646_107905452 | 162 |
| 585 | 3300025923 | Ga0207681_10151119 | Ga0207681_101511192 | 162 |
| 586 | 3300025924 | Ga0207694_10102993 | Ga0207694_101029932 | 162 |
| 587 | 3300025925 | Ga0207650_10022091 | Ga0207650_100220912 | 162 |
| 588 | 3300025925 | Ga0207650_10026596 | Ga0207650_100265965 | 162 |
| 589 | 3300025926 | Ga0207659_10015813 | Ga0207659_100158133 | 162 |
| 590 | 3300025926 | Ga0207659_10394097 | Ga0207659_103940971 | 162 |
| 591 | 3300025928 | Ga0207700_11201193 | Ga0207700_112011931 | 162 |
| 592 | 3300025929 | Ga0207664_10064557 | Ga0207664_100645572 | 162 |
| 593 | 3300025931 | Ga0207644_10591383 | Ga0207644_105913831 | 162 |
| 594 | 3300025933 | Ga0207706_10023819 | Ga0207706_100238194 | 162 |
| 595 | 3300025934 | Ga0207686_10036022 | Ga0207686_100360223 | 162 |
| 596 | 3300025936 | Ga0207670_10221074 | Ga0207670_102210743 | 162 |
| 597 | 3300025937 | Ga0207669_10138393 | Ga0207669_101383932 | 162 |
| 598 | 3300025938 | Ga0207704_10712385 | Ga0207704_107123851 | 162 |
| 599 | 3300025940 | Ga0207691_10007022 | Ga0207691_100070228 | 162 |
| 600 | 3300025944 | Ga0207661_10060287 | Ga0207661_100602871 | 162 |
| 601 | 3300025944 | Ga0207661_10145490 | Ga0207661_101454902 | 162 |
| 602 | 3300025945 | Ga0207679_10050528 | Ga0207679_100505285 | 162 |
| 603 | 3300025945 | Ga0207679_10115154 | Ga0207679_101151542 | 162 |
| 604 | 3300025949 | Ga0207667_10216745 | Ga0207667_102167451 | 162 |
| 605 | 3300025949 | Ga0207667_10478557 | Ga0207667_104785572 | 162 |
| 606 | 3300025972 | Ga0207668_10241766 | Ga0207668_102417661 | 162 |
| 607 | 3300025981 | Ga0207640_10536904 | Ga0207640_105369041 | 162 |
| 608 | 3300025981 | Ga0207640_11769984 | Ga0207640_117699841 | 162 |
| 609 | 3300026035 | Ga0207703_10966142 | Ga0207703_109661422 | 162 |
| 610 | 3300026041 | Ga0207639_11387781 | Ga0207639_113877811 | 162 |
| 611 | 3300026078 | Ga0207702_10145458 | Ga0207702_101454582 | 162 |
| 612 | 3300026088 | Ga0207641_10541206 | Ga0207641_105412063 | 162 |
| 613 | 3300026089 | Ga0207648_10009283 | Ga0207648_100092836 | 162 |
| 614 | 3300026089 | Ga0207648_10062126 | Ga0207648_100621263 | 162 |
| 615 | 3300026089 | Ga0207648_10259260 | Ga0207648_102592603 | 162 |
| 616 | 3300026089 | Ga0207648_10288602 | Ga0207648_102886023 | 162 |
| 617 | 3300026089 | Ga0207648_10575804 | Ga0207648_105758042 | 162 |
| 618 | 3300026095 | Ga0207676_10180260 | Ga0207676_101802602 | 162 |
| 619 | 3300026095 | Ga0207676_10511386 | Ga0207676_105113862 | 162 |
| 620 | 3300026116 | Ga0207674_10014406 | Ga0207674_100144063 | 162 |
| 621 | 3300026121 | Ga0207683_10370101 | Ga0207683_103701011 | 162 |
| 622 | 3300026142 | Ga0207698_10207311 | Ga0207698_102073112 | 162 |
| 623 | 3300026142 | Ga0207698_11344855 | Ga0207698_113448552 | 162 |
| 624 | 3300027876 | Ga0209974_10104416 | Ga0209974_101044163 | 162 |
| 625 | 3300027907 | Ga0207428_10106267 | Ga0207428_101062672 | 162 |
| 626 | 3300027907 | Ga0207428_10130719 | Ga0207428_101307193 | 162 |
| 627 | 3300027907 | Ga0207428_10263468 | Ga0207428_102634682 | 162 |
| 628 | 3300028380 | Ga0268265_10206360 | Ga0268265_102063602 | 162 |
| 629 | 3300028380 | Ga0268265_11384946 | Ga0268265_113849461 | 162 |
| 630 | 3300028381 | Ga0268264_10037603 | Ga0268264_100376032 | 162 |
| 631 | 3300031548 | Ga0307408_100059995 | Ga0307408_1000599955 | 162 |
| 632 | 3300031548 | Ga0307408_100079616 | Ga0307408_1000796162 | 162 |
| 633 | 3300031548 | Ga0307408_100215788 | Ga0307408_1002157883 | 162 |
| 634 | 3300031548 | Ga0307408_100290091 | Ga0307408_1002900912 | 162 |
| 635 | 3300031548 | Ga0307408_100753528 | Ga0307408_1007535281 | 162 |
| 636 | 3300031731 | Ga0307405_10119361 | Ga0307405_101193612 | 162 |
| 637 | 3300031731 | Ga0307405_10150105 | Ga0307405_101501051 | 162 |
| 638 | 3300031824 | Ga0307413_10043498 | Ga0307413_100434982 | 162 |
| 639 | 3300031852 | Ga0307410_10001136 | Ga0307410_100011365 | 162 |
| 640 | 3300031852 | Ga0307410_10132425 | Ga0307410_101324251 | 162 |
| 641 | 3300031852 | Ga0307410_10746347 | Ga0307410_107463471 | 162 |
| 642 | 3300031901 | Ga0307406_10161069 | Ga0307406_101610692 | 162 |
| 643 | 3300031901 | Ga0307406_10396634 | Ga0307406_103966341 | 162 |
| 644 | 3300031901 | Ga0307406_10416911 | Ga0307406_104169111 | 162 |
| 645 | 3300031901 | Ga0307406_10753971 | Ga0307406_107539711 | 162 |
| 646 | 3300031903 | Ga0307407_10124590 | Ga0307407_101245902 | 162 |
| 647 | 3300031911 | Ga0307412_10417974 | Ga0307412_104179742 | 162 |
| 648 | 3300031911 | Ga0307412_10637084 | Ga0307412_106370841 | 162 |
| 649 | 3300031911 | Ga0307412_10946643 | Ga0307412_109466431 | 162 |
| 650 | 3300031995 | Ga0307409_100082827 | Ga0307409_1000828273 | 162 |
| 651 | 3300031995 | Ga0307409_100099345 | Ga0307409_1000993453 | 162 |
| 652 | 3300031995 | Ga0307409_100120220 | Ga0307409_1001202204 | 162 |
| 653 | 3300031995 | Ga0307409_100165842 | Ga0307409_1001658422 | 162 |
| 654 | 3300031995 | Ga0307409_100367517 | Ga0307409_1003675172 | 162 |
| 655 | 3300031995 | Ga0307409_101402152 | Ga0307409_1014021521 | 162 |
| 656 | 3300032002 | Ga0307416_100002534 | Ga0307416_10000253411 | 162 |
| 657 | 3300032002 | Ga0307416_100061013 | Ga0307416_1000610133 | 162 |
| 658 | 3300032002 | Ga0307416_100122064 | Ga0307416_1001220641 | 162 |
| 659 | 3300032002 | Ga0307416_101949099 | Ga0307416_1019490992 | 162 |
| 660 | 3300032004 | Ga0307414_10060255 | Ga0307414_100602555 | 162 |
| 661 | 3300032004 | Ga0307414_10093881 | Ga0307414_100938813 | 162 |
| 662 | 3300032005 | Ga0307411_10012291 | Ga0307411_100122914 | 162 |
| 663 | 3300032005 | Ga0307411_10579313 | Ga0307411_105793131 | 162 |
| 664 | 3300032005 | Ga0307411_11785108 | Ga0307411_117851081 | 162 |
| 665 | 3300032126 | Ga0307415_100122991 | Ga0307415_1001229914 | 162 |
| 666 | 3300032126 | Ga0307415_100338024 | Ga0307415_1003380242 | 162 |
| 667 | 3300037471 | Ga0395905_0037531 | Ga0395905_0037531_3993_4511 | 162 |
| 668 | 3300037471 | Ga0395905_0068251 | Ga0395905_0068251_2815_3318 | 162 |
| 669 | 3300037471 | Ga0395905_0335818 | Ga0395905_0335818_876_1388 | 162 |
| 670 | 3300041459 | Ga0451800_1495159 | Ga0451800_1495159_121_633 | 162 |
| 671 | 3300041512 | Ga0451853_2552288 | Ga0451853_2552288_110_616 | 162 |
| 672 | 3300042005 | Ga0439448_0037577 | Ga0439448_0037577_1015_1527 | 162 |
| 673 | 3300042008 | Ga0439450_081997 | Ga0439450_081997_210_722 | 162 |
| 674 | 3300042012 | Ga0439455_0101163 | Ga0439455_0101163_36_527 | 162 |
| 675 | 3300042012 | Ga0439455_0111968 | Ga0439455_0111968_108_620 | 162 |
| 676 | 3300042435 | Ga0439434_0070809 | Ga0439434_0070809_372_863 | 162 |
| 677 | 3300042438 | Ga0439459_0028048 | Ga0439459_0028048_61_579 | 162 |
| 678 | 3300042993 | Ga0439440_0118163 | Ga0439440_0118163_198_689 | 162 |
| 679 | 3300044673 | Ga0453683_0233109 | Ga0453683_0233109_130_630 | 162 |
| 680 | 3300045051 | Ga0451576_0005304 | Ga0451576_0005304_1249_1755 | 162 |
| 681 | 3300045051 | Ga0451576_0668619 | Ga0451576_0668619_138_638 | 162 |
| 682 | 3300046522 | Ga0495643_0000187 | Ga0495643_0000187_56510_57010 | 162 |
| 683 | 3300046524 | Ga0495648_0085742 | Ga0495648_0085742_1075_1578 | 162 |
| 684 | 3300046648 | Ga0495611_0192930 | Ga0495611_0192930_108_599 | 162 |
| 685 | 3300048912 | Ga0496109_0063212 | Ga0496109_0063212_1194_1706 | 162 |
| 686 | 3300048915 | Ga0496112_0590566 | Ga0496112_0590566_495_1007 | 162 |
| 687 | 3300049515 | Ga0501292_011320 | Ga0501292_011320_491_982 | 162 |
| 688 | 3300049568 | Ga0501031_0832740 | Ga0501031_0832740_14_505 | 162 |
| 689 | 3300049572 | Ga0501036_1409461 | Ga0501036_1409461_21_509 | 162 |
| 690 | 3300049575 | Ga0501039_0778489 | Ga0501039_0778489_185_676 | 162 |
| 691 | 3300049576 | Ga0501040_0112227 | Ga0501040_0112227_1318_1806 | 162 |
| 692 | 3300049576 | Ga0501040_0204314 | Ga0501040_0204314_805_1293 | 162 |
| 693 | 3300049578 | Ga0501042_0425190 | Ga0501042_0425190_328_816 | 162 |
| 694 | 3300049578 | Ga0501042_0426552 | Ga0501042_0426552_363_854 | 162 |
| 695 | 3300049582 | Ga0501048_1127038 | Ga0501048_1127038_63_551 | 162 |
| 696 | 3300049583 | Ga0501067_0051170 | Ga0501067_0051170_1040_1558 | 162 |
| 697 | 3300049587 | Ga0501071_0256423 | Ga0501071_0256423_565_1062 | 162 |
| 698 | 3300049587 | Ga0501071_1133262 | Ga0501071_1133262_91_582 | 162 |
| 699 | 3300049588 | Ga0501072_0886331 | Ga0501072_0886331_11_499 | 162 |
| 700 | 3300049592 | Ga0501076_0035121 | Ga0501076_0035121_1042_1530 | 162 |
| 701 | 3300049656 | Ga0501209_090615 | Ga0501209_090615_211_714 | 162 |
| 702 | 3300049659 | Ga0501214_013363 | Ga0501214_013363_381_872 | 162 |
| 703 | 3300049741 | Ga0501079_0070186 | Ga0501079_0070186_976_1464 | 162 |
| 704 | 3300049742 | Ga0501080_0298670 | Ga0501080_0298670_88_597 | 162 |
| 705 | 3300049775 | Ga0501279_047025 | Ga0501279_047025_35_526 | 162 |
| 706 | 3300049824 | Ga0501045_0101449 | Ga0501045_0101449_1518_2006 | 162 |
| 707 | 3300050492 | nmdc:mga0yw44_64592_c1 | nmdc:mga0yw44_64592_c1_1459_1959 | 162 |
| 708 | 3300050493 | nmdc:mga0k408_1948_c1 | nmdc:mga0k408_1948_c1_2730_3269 | 162 |
| 709 | 3300050493 | nmdc:mga0k408_77471_c1 | nmdc:mga0k408_77471_c1_562_1062 | 162 |
| 710 | 3300050507 | nmdc:mga05p37_177134_c1 | nmdc:mga05p37_177134_c1_445_966 | 162 |
| 711 | 3300050507 | nmdc:mga05p37_56259_c1 | nmdc:mga05p37_56259_c1_654_1145 | 162 |
| 712 | 3300050507 | nmdc:mga05p37_57535_c1 | nmdc:mga05p37_57535_c1_1954_2466 | 162 |
| 713 | 3300050507 | nmdc:mga05p37_754021_c1 | nmdc:mga05p37_754021_c1_520_1035 | 162 |
| 714 | 3300050508 | nmdc:mga09592_149217_c1 | nmdc:mga09592_149217_c1_745_1236 | 162 |
| 715 | 3300050508 | nmdc:mga09592_150457_c1 | nmdc:mga09592_150457_c1_1483_1995 | 162 |
| 716 | 3300050508 | nmdc:mga09592_39370_c1 | nmdc:mga09592_39370_c1_1218_1736 | 162 |
| 717 | 3300050509 | nmdc:mga0qj67_19842_c1 | nmdc:mga0qj67_19842_c1_3852_4349 | 162 |
| 718 | 3300050509 | nmdc:mga0qj67_467598_c1 | nmdc:mga0qj67_467598_c1_124_657 | 162 |
| 719 | 3300050509 | nmdc:mga0qj67_61657_c1 | nmdc:mga0qj67_61657_c1_2349_2867 | 162 |
| 720 | 3300050510 | nmdc:mga06r32_1014931_c1 | nmdc:mga06r32_1014931_c1_152_649 | 162 |
| 721 | 3300050510 | nmdc:mga06r32_101994_c1 | nmdc:mga06r32_101994_c1_1107_1613 | 162 |
| 722 | 3300050510 | nmdc:mga06r32_1179849_c1 | nmdc:mga06r32_1179849_c1_173_694 | 162 |
| 723 | 3300050510 | nmdc:mga06r32_445579_c1 | nmdc:mga06r32_445579_c1_424_942 | 162 |
| 724 | 3300050510 | nmdc:mga06r32_61988_c1 | nmdc:mga06r32_61988_c1_535_1026 | 162 |
| 725 | 3300050510 | nmdc:mga06r32_670708_c1 | nmdc:mga06r32_670708_c1_185_718 | 162 |
| 726 | 3300050510 | nmdc:mga06r32_698988_c1 | nmdc:mga06r32_698988_c1_192_785 | 162 |
| 727 | 3300050511 | nmdc:mga08y16_146165_c1 | nmdc:mga08y16_146165_c1_1334_1825 | 162 |
| 728 | 3300050511 | nmdc:mga08y16_703796_c1 | nmdc:mga08y16_703796_c1_150_650 | 162 |
| 729 | 3300050511 | nmdc:mga08y16_94777_c1 | nmdc:mga08y16_94777_c1_1839_2351 | 162 |
| 730 | 3300050512 | nmdc:mga0n895_8124_c1 | nmdc:mga0n895_8124_c1_3551_4063 | 162 |
| 731 | 3300050512 | nmdc:mga0n895_81665_c1 | nmdc:mga0n895_81665_c1_1013_1510 | 162 |
| 732 | 3300050514 | nmdc:mga08x19_64853_c1 | nmdc:mga08x19_64853_c1_801_1313 | 162 |
| 733 | 3300050514 | nmdc:mga08x19_69996_c1 | nmdc:mga08x19_69996_c1_1510_2046 | 162 |
| 734 | 3300050515 | nmdc:mga0a205_31427_c1 | nmdc:mga0a205_31427_c1_4174_4701 | 162 |
| 735 | 3300050515 | nmdc:mga0a205_34488_c1 | nmdc:mga0a205_34488_c1_187_699 | 162 |
| 736 | 3300053098 | Ga0500650_0360617 | Ga0500650_0360617_64_564 | 162 |
| 737 | 3300059426 | Ga0590077_018589 | Ga0590077_018589_238_741 | 162 |
| 738 | 3300061734 | Ga0530510_0008234 | Ga0530510_0008234_5031_5519 | 162 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1u69-assembly1.cif.gz_A | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.9288 | 2 | 160 |
| 1u69-assembly1.cif.gz_A | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.9174 | 2 | 160 |
| 1u69-assembly3.cif.gz_C | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.9167 | 2 | 160 |
| 1u69-assembly2.cif.gz_D | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.9116 | 2 | 160 |
| 1u69-assembly3.cif.gz_C | crystal structure of pa2721 protein of unknown function from pseudomonas aeruginosa pao1 | 0.905 | 2 | 160 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1u69D00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9075 | 2 | 160 | 3.10.180.10 |
| 1u69D00 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8955 | 2 | 160 | 3.10.180.10 |
| 3omsA01 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8137 | 8 | 74 | 3.30.720.100 |
| af_Q2G1U2_73_132_3.30.720.110 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8076 | 73 | 123 | 3.30.720.110 |
| 3omsA02 | Alpha Beta;2-Layer Sandwich;Signal recognition particle alu RNA binding heterodimer, srp9/1; | 0.8068 | 73 | 123 | 3.30.720.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-I7ZHF7-F1-model_v4 | Putative 3-demethylubiquinone-93-methyltransferase protein | 0.9859 | 107 | 162 |
GO:0008168
GO:0032259 |
| AF-A0A533ULV1-F1-model_v4 | VOC family protein | 0.9793 | 74 | 162 |
|
| AF-A0A0W0XL40-F1-model_v4 | DNA binding protein | 0.9753 | 1 | 162 |
|
| AF-A0A1H9YI38-F1-model_v4 | Glyoxalase superfamily enzyme, possibly 3-demethylubiquinone-9 3-methyltransferase | 0.9717 | 1 | 162 |
GO:0008168
GO:0032259 |
| AF-A0A536DWF0-F1-model_v4 | VOC family protein | 0.9717 | 1 | 161 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar