F478387
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 738 | 327 | 733 | 355 |
Family's Representative Sequence
| Representative Sequence | 3300013297|Ga0157378_10002051|Ga0157378_100020518 |
| Length | 397 |
| Sequence | MVTDRRRSATAAPKKKQHARFYRSGRNQKLSVAIITGSAGLVGSEAVAYFDSLGMDVVGIDNGMRAEFFGPDASTAWVRDQLTRDLPAYRHYEVDIRDAAAIDRVFEHYGSDVSLIVHTAAQPSHDWAASNPTLDFTVNANGTSVLLEATRKFAHDAVFIFTSTNKVYGDTPNHLPLVEQGTRWELDPSHPYAKNGIPETMSIDHTTHSLFGASKVAADVLVQEYGRYFGMKTACFRGGCLTGPRHSGTQLHGFLAYLMKCAVTRAPYSIFGYKKKQVRDNIHSADLIQAFHEFFKKPRSGEVYNIGGGRFSNCSMLEAITICEQITAKPFNSRYIDQNRRGDHIWWISDISRFQEHYPEWKLRYNVQQILQEIFEFNSERWAQQCVMPANEMSSVS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2522125168 | Dyadobacter beijingensis DSM 21582 | Isolate | Rhizosphere |
| 2 | 2597490356 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 3 | 2842333319 | Skermanella aerolata SEMIA 4010 | Isolate | Nodule |
| 4 | 2846952575 | Azospirillum brasilense sp7 | Isolate | Unclassified |
| 5 | 2886627955 | Nostoc sp. PA-18-2419 JC1668 | Isolate | Unclassified |
| 6 | 3300000545 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled | Metagenome | Rhizosphere |
| 7 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 8 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 9 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 10 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 11 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 12 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 13 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 81 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 93 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 94 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009986 | Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG | Metagenome | Rhizosphere |
| 116 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 130 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 188 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 189 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 192 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 193 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 194 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 195 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 196 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 197 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 198 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 199 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 200 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 201 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 203 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 208 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 209 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 210 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 211 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 212 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 213 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 214 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 215 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 216 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 217 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 218 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 219 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 220 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 221 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 222 | 3300039062 | Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 | Metagenome | Unclassified |
| 223 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 224 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 225 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 226 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 227 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 228 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 229 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 230 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 231 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 232 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 233 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 234 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 235 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 236 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 237 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 252 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 253 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 254 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 255 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 256 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 273 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 274 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 275 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 276 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 277 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 278 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 279 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 280 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 281 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 282 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 283 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 284 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 285 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 286 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 287 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 288 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 289 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 290 | 3300049513 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control | Metagenome | Rhizosphere |
| 291 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 292 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 295 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 296 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 297 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 298 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 299 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 300 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 302 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 303 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 304 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 307 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 308 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 309 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 314 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 315 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 316 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 320 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 321 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 322 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 324 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 325 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 326 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 327 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.64 |
| Metatranscriptomes | 0.68 |
| Isolates | 0.68 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.3 |
| Nodule | 0.14 |
| Rhizoplane | 7.05 |
| Rhizosphere | 87.4 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | CNXas_1000073 | 3300000545 | Bacteria | 18932 |
| 2 | JGI24744J21845_10005804 | 3300002077 | Bacteria | 2557 |
| 3 | JGI25406J46586_10000369 | 3300003203 | Bacteria | 20510 |
| 4 | rootH2_10009286 | 3300003320 | Bacteria | 19164 |
| 5 | rootH2_10100298 | 3300003320 | Bacteria | 7832 |
| 6 | rootH1_10035324 | 3300003323 | Bacteria | 2761 |
| 7 | JGI25405J52794_10000207 | 3300003911 | Bacteria | 7675 |
| 8 | Ga0065712_10001564 | 3300005290 | Bacteria | 8859 |
| 9 | Ga0065712_10013148 | 3300005290 | Bacteria | 3778 |
| 10 | Ga0065715_10091643 | 3300005293 | Bacteria | 5650 |
| 11 | Ga0065715_10092928 | 3300005293 | Bacteria | 4860 |
| 12 | Ga0065715_10219712 | 3300005293 | Unclassified | 1265 |
| 13 | Ga0070658_10078072 | 3300005327 | Bacteria | 2717 |
| 14 | Ga0070676_10006864 | 3300005328 | Bacteria | 6095 |
| 15 | Ga0070676_10037383 | 3300005328 | Bacteria | 2800 |
| 16 | Ga0070676_10083705 | 3300005328 | Bacteria | 1941 |
| 17 | Ga0070676_10206219 | 3300005328 | Bacteria | 1291 |
| 18 | Ga0070683_100001907 | 3300005329 | Bacteria | 16311 |
| 19 | Ga0070683_100007984 | 3300005329 | Bacteria | 8980 |
| 20 | Ga0070683_100022218 | 3300005329 | Bacteria | 5668 |
| 21 | Ga0070683_100029152 | 3300005329 | Bacteria | 4994 |
| 22 | Ga0070683_100037248 | 3300005329 | Bacteria | 4452 |
| 23 | Ga0070683_100227488 | 3300005329 | Bacteria | 1773 |
| 24 | Ga0070690_100070718 | 3300005330 | Bacteria | 2266 |
| 25 | Ga0070670_100013375 | 3300005331 | Bacteria | 7030 |
| 26 | Ga0070670_100029305 | 3300005331 | Bacteria | 4737 |
| 27 | Ga0070670_100061195 | 3300005331 | Bacteria | 3232 |
| 28 | Ga0070670_100182137 | 3300005331 | Bacteria | 1824 |
| 29 | Ga0070670_100316589 | 3300005331 | Bacteria | 1366 |
| 30 | Ga0070677_10000019 | 3300005333 | Bacteria | 50177 |
| 31 | Ga0070666_10027666 | 3300005335 | Unclassified | 3716 |
| 32 | Ga0070666_10044470 | 3300005335 | Bacteria | 2975 |
| 33 | Ga0070666_10147834 | 3300005335 | Bacteria | 1639 |
| 34 | Ga0070680_100023414 | 3300005336 | Bacteria | 4925 |
| 35 | Ga0070682_100000038 | 3300005337 | Bacteria | 145670 |
| 36 | Ga0070682_100032067 | 3300005337 | Bacteria | 3183 |
| 37 | Ga0068868_100000175 | 3300005338 | Bacteria | 42576 |
| 38 | Ga0068868_100041506 | 3300005338 | Bacteria | 3585 |
| 39 | Ga0068868_100097874 | 3300005338 | Bacteria | 2371 |
| 40 | Ga0070660_100045727 | 3300005339 | Bacteria | 3353 |
| 41 | Ga0070689_100005164 | 3300005340 | Bacteria | 8886 |
| 42 | Ga0070689_100042520 | 3300005340 | Unclassified | 3489 |
| 43 | Ga0070687_100037721 | 3300005343 | Bacteria | 2418 |
| 44 | Ga0070661_100006819 | 3300005344 | Bacteria | 7871 |
| 45 | Ga0070661_100071430 | 3300005344 | Unclassified | 2554 |
| 46 | Ga0070692_10042972 | 3300005345 | Bacteria | 2323 |
| 47 | Ga0070668_100004408 | 3300005347 | Bacteria | 10449 |
| 48 | Ga0070668_100036794 | 3300005347 | Bacteria | 3735 |
| 49 | Ga0070668_100038018 | 3300005347 | Bacteria | 3677 |
| 50 | Ga0070668_100124081 | 3300005347 | Bacteria | 2067 |
| 51 | Ga0070668_100362721 | 3300005347 | Bacteria | 1229 |
| 52 | Ga0070669_100007368 | 3300005353 | Bacteria | 7889 |
| 53 | Ga0070669_100187502 | 3300005353 | Bacteria | 1621 |
| 54 | Ga0070675_100075480 | 3300005354 | Bacteria | 2802 |
| 55 | Ga0070675_100076838 | 3300005354 | Bacteria | 2778 |
| 56 | Ga0070675_100122963 | 3300005354 | Bacteria | 2206 |
| 57 | Ga0070675_100138321 | 3300005354 | Unclassified | 2080 |
| 58 | Ga0070675_100219622 | 3300005354 | Unclassified | 1655 |
| 59 | Ga0070671_100001678 | 3300005355 | Bacteria | 16768 |
| 60 | Ga0070671_100011983 | 3300005355 | Bacteria | 6976 |
| 61 | Ga0070671_100061335 | 3300005355 | Bacteria | 3132 |
| 62 | Ga0070671_100162797 | 3300005355 | Bacteria | 1886 |
| 63 | Ga0070674_100002857 | 3300005356 | Bacteria | 9548 |
| 64 | Ga0070674_100166049 | 3300005356 | Bacteria | 1679 |
| 65 | Ga0070673_100053177 | 3300005364 | Bacteria | 3179 |
| 66 | Ga0070673_100053282 | 3300005364 | Bacteria | 3176 |
| 67 | Ga0070688_100005768 | 3300005365 | Bacteria | 6545 |
| 68 | Ga0070688_100021547 | 3300005365 | Bacteria | 3766 |
| 69 | Ga0070688_100021782 | 3300005365 | Unclassified | 3748 |
| 70 | Ga0070659_100141064 | 3300005366 | Bacteria | 1962 |
| 71 | Ga0070659_100150669 | 3300005366 | Bacteria | 1897 |
| 72 | Ga0070659_100163925 | 3300005366 | Bacteria | 1818 |
| 73 | Ga0070659_100200576 | 3300005366 | Bacteria | 1642 |
| 74 | Ga0070659_100221066 | 3300005366 | Bacteria | 1563 |
| 75 | Ga0070659_100241615 | 3300005366 | Unclassified | 1495 |
| 76 | Ga0070667_100006508 | 3300005367 | Bacteria | 9712 |
| 77 | Ga0070667_100080404 | 3300005367 | Bacteria | 2788 |
| 78 | Ga0070667_100267638 | 3300005367 | Unclassified | 1531 |
| 79 | Ga0070703_10002069 | 3300005406 | Bacteria | 5851 |
| 80 | Ga0070709_10132184 | 3300005434 | Bacteria | 1705 |
| 81 | Ga0070714_100101567 | 3300005435 | Bacteria | 2534 |
| 82 | Ga0070714_100138695 | 3300005435 | Bacteria | 2180 |
| 83 | Ga0070714_100156814 | 3300005435 | Unclassified | 2056 |
| 84 | Ga0070714_100395054 | 3300005435 | Bacteria | 1306 |
| 85 | Ga0070713_100393615 | 3300005436 | Unclassified | 1293 |
| 86 | Ga0070711_100010643 | 3300005439 | Bacteria | 5699 |
| 87 | Ga0070711_100397969 | 3300005439 | Unclassified | 1117 |
| 88 | Ga0070705_100001340 | 3300005440 | Bacteria | 13136 |
| 89 | Ga0070705_100007247 | 3300005440 | Bacteria | 5454 |
| 90 | Ga0070705_100023189 | 3300005440 | Bacteria | 3329 |
| 91 | Ga0070705_100026056 | 3300005440 | Bacteria | 3179 |
| 92 | Ga0070705_100064945 | 3300005440 | Bacteria | 2183 |
| 93 | Ga0070700_100024189 | 3300005441 | Bacteria | 3563 |
| 94 | Ga0070700_100041186 | 3300005441 | Bacteria | 2831 |
| 95 | Ga0070694_100051621 | 3300005444 | Bacteria | 2777 |
| 96 | Ga0070694_100056974 | 3300005444 | Bacteria | 2656 |
| 97 | Ga0070694_100205260 | 3300005444 | Bacteria | 1471 |
| 98 | Ga0070708_100001595 | 3300005445 | Bacteria | 17380 |
| 99 | Ga0070708_100008010 | 3300005445 | Bacteria | 8465 |
| 100 | Ga0070708_100021006 | 3300005445 | Bacteria | 5513 |
| 101 | Ga0070708_100059545 | 3300005445 | Unclassified | 3405 |
| 102 | Ga0070708_100059876 | 3300005445 | Bacteria | 3397 |
| 103 | Ga0070708_100229856 | 3300005445 | Bacteria | 1740 |
| 104 | Ga0070708_100246506 | 3300005445 | Bacteria | 1678 |
| 105 | Ga0070708_100386765 | 3300005445 | Bacteria | 1319 |
| 106 | Ga0070663_100013528 | 3300005455 | Bacteria | 5209 |
| 107 | Ga0070663_100037099 | 3300005455 | Bacteria | 3391 |
| 108 | Ga0070663_100095086 | 3300005455 | Bacteria | 2214 |
| 109 | Ga0070678_100000223 | 3300005456 | Bacteria | 25656 |
| 110 | Ga0070678_100002366 | 3300005456 | Bacteria | 10305 |
| 111 | Ga0070678_100092441 | 3300005456 | Bacteria | 2324 |
| 112 | Ga0070662_100000015 | 3300005457 | Bacteria | 109379 |
| 113 | Ga0070662_100058946 | 3300005457 | Unclassified | 2795 |
| 114 | Ga0070681_10005422 | 3300005458 | Bacteria | 12322 |
| 115 | Ga0070681_10036443 | 3300005458 | Bacteria | 4939 |
| 116 | Ga0070681_10041890 | 3300005458 | Bacteria | 4590 |
| 117 | Ga0070681_10134823 | 3300005458 | Bacteria | 2400 |
| 118 | Ga0068867_100000715 | 3300005459 | Bacteria | 22149 |
| 119 | Ga0070685_10080065 | 3300005466 | Bacteria | 1956 |
| 120 | Ga0070685_10082671 | 3300005466 | Bacteria | 1928 |
| 121 | Ga0070706_100000703 | 3300005467 | Bacteria | 37785 |
| 122 | Ga0070706_100006643 | 3300005467 | Bacteria | 10911 |
| 123 | Ga0070706_100008103 | 3300005467 | Bacteria | 9799 |
| 124 | Ga0070706_100023506 | 3300005467 | Bacteria | 5677 |
| 125 | Ga0070706_100026208 | 3300005467 | Bacteria | 5365 |
| 126 | Ga0070706_100047895 | 3300005467 | Bacteria | 3945 |
| 127 | Ga0070706_100271144 | 3300005467 | Bacteria | 1584 |
| 128 | Ga0070706_100362112 | 3300005467 | Bacteria | 1351 |
| 129 | Ga0070707_100001078 | 3300005468 | Bacteria | 26952 |
| 130 | Ga0070707_100001458 | 3300005468 | Bacteria | 23150 |
| 131 | Ga0070707_100001955 | 3300005468 | Bacteria | 19734 |
| 132 | Ga0070707_100004157 | 3300005468 | Bacteria | 13570 |
| 133 | Ga0070707_100014990 | 3300005468 | Bacteria | 7275 |
| 134 | Ga0070707_100044119 | 3300005468 | Bacteria | 4268 |
| 135 | Ga0070707_100055268 | 3300005468 | Bacteria | 3806 |
| 136 | Ga0070707_100069262 | 3300005468 | Bacteria | 3397 |
| 137 | Ga0070707_100129082 | 3300005468 | Bacteria | 2457 |
| 138 | Ga0070707_100280139 | 3300005468 | Bacteria | 1620 |
| 139 | Ga0070698_100000390 | 3300005471 | Bacteria | 46125 |
| 140 | Ga0070698_100001334 | 3300005471 | Bacteria | 27461 |
| 141 | Ga0070698_100020103 | 3300005471 | Bacteria | 6998 |
| 142 | Ga0070698_100186388 | 3300005471 | Unclassified | 2013 |
| 143 | Ga0070699_100050680 | 3300005518 | Bacteria | 3595 |
| 144 | Ga0070679_100033431 | 3300005530 | Bacteria | 5092 |
| 145 | Ga0070679_100068070 | 3300005530 | Bacteria | 3552 |
| 146 | Ga0070684_100000344 | 3300005535 | Bacteria | 31949 |
| 147 | Ga0070684_100017106 | 3300005535 | Bacteria | 5945 |
| 148 | Ga0070684_100020450 | 3300005535 | Bacteria | 5491 |
| 149 | Ga0070684_100099580 | 3300005535 | Unclassified | 2594 |
| 150 | Ga0070684_100152737 | 3300005535 | Bacteria | 2092 |
| 151 | Ga0070684_100182681 | 3300005535 | Bacteria | 1907 |
| 152 | Ga0070684_100186978 | 3300005535 | Bacteria | 1884 |
| 153 | Ga0070697_100000919 | 3300005536 | Bacteria | 22165 |
| 154 | Ga0070697_100007362 | 3300005536 | Bacteria | 8564 |
| 155 | Ga0070697_100212464 | 3300005536 | Bacteria | 1647 |
| 156 | Ga0070697_100461651 | 3300005536 | Unclassified | 1107 |
| 157 | Ga0068853_100017443 | 3300005539 | Bacteria | 5925 |
| 158 | Ga0070672_100066961 | 3300005543 | Bacteria | 2845 |
| 159 | Ga0070672_100213329 | 3300005543 | Bacteria | 1617 |
| 160 | Ga0070686_100000888 | 3300005544 | Bacteria | 17373 |
| 161 | Ga0070686_100001318 | 3300005544 | Bacteria | 14039 |
| 162 | Ga0070686_100071377 | 3300005544 | Bacteria | 2273 |
| 163 | Ga0070695_100008308 | 3300005545 | Bacteria | 6158 |
| 164 | Ga0070696_100003721 | 3300005546 | Bacteria | 10178 |
| 165 | Ga0070696_100004339 | 3300005546 | Bacteria | 9453 |
| 166 | Ga0070665_100000128 | 3300005548 | Bacteria | 142568 |
| 167 | Ga0070665_100017536 | 3300005548 | Bacteria | 7190 |
| 168 | Ga0070665_100035838 | 3300005548 | Bacteria | 4991 |
| 169 | Ga0070665_100035904 | 3300005548 | Bacteria | 4987 |
| 170 | Ga0070665_100059648 | 3300005548 | Bacteria | 3825 |
| 171 | Ga0070665_100060085 | 3300005548 | Bacteria | 3811 |
| 172 | Ga0070665_100079543 | 3300005548 | Bacteria | 3284 |
| 173 | Ga0070665_100085019 | 3300005548 | Bacteria | 3169 |
| 174 | Ga0070704_100005325 | 3300005549 | Bacteria | 7497 |
| 175 | Ga0068855_100002299 | 3300005563 | Bacteria | 23619 |
| 176 | Ga0068855_100370933 | 3300005563 | Bacteria | 1573 |
| 177 | Ga0070664_100027843 | 3300005564 | Bacteria | 4699 |
| 178 | Ga0070664_100032306 | 3300005564 | Bacteria | 4377 |
| 179 | Ga0070664_100062150 | 3300005564 | Unclassified | 3183 |
| 180 | Ga0070664_100107705 | 3300005564 | Bacteria | 2430 |
| 181 | Ga0070664_100294407 | 3300005564 | Bacteria | 1466 |
| 182 | Ga0068857_100148049 | 3300005577 | Unclassified | 2125 |
| 183 | Ga0068854_100003346 | 3300005578 | Bacteria | 9993 |
| 184 | Ga0068854_100003697 | 3300005578 | Bacteria | 9570 |
| 185 | Ga0068856_100007184 | 3300005614 | Bacteria | 10862 |
| 186 | Ga0068856_100011239 | 3300005614 | Bacteria | 8690 |
| 187 | Ga0068856_100078338 | 3300005614 | Unclassified | 3277 |
| 188 | Ga0070702_100000916 | 3300005615 | Bacteria | 11524 |
| 189 | Ga0070702_100082104 | 3300005615 | Bacteria | 1933 |
| 190 | Ga0068852_100179456 | 3300005616 | Bacteria | 1990 |
| 191 | Ga0068859_100173982 | 3300005617 | Bacteria | 2235 |
| 192 | Ga0068859_100188411 | 3300005617 | Bacteria | 2147 |
| 193 | Ga0068864_100043576 | 3300005618 | Bacteria | 3842 |
| 194 | Ga0068863_100001547 | 3300005841 | Bacteria | 22708 |
| 195 | Ga0068863_100223332 | 3300005841 | Bacteria | 1815 |
| 196 | Ga0068858_100000350 | 3300005842 | Bacteria | 48492 |
| 197 | Ga0068858_100002632 | 3300005842 | Bacteria | 18092 |
| 198 | Ga0068858_100003324 | 3300005842 | Bacteria | 16007 |
| 199 | Ga0068858_100402528 | 3300005842 | Bacteria | 1315 |
| 200 | Ga0068860_100014730 | 3300005843 | Bacteria | 7648 |
| 201 | Ga0068860_100024202 | 3300005843 | Bacteria | 5871 |
| 202 | Ga0068860_100024497 | 3300005843 | Bacteria | 5830 |
| 203 | Ga0081455_10000878 | 3300005937 | Bacteria | 38886 |
| 204 | Ga0081455_10004775 | 3300005937 | Bacteria | 15056 |
| 205 | Ga0081455_10026476 | 3300005937 | Bacteria | 5332 |
| 206 | Ga0081455_10057205 | 3300005937 | Bacteria | 3306 |
| 207 | Ga0081455_10065977 | 3300005937 | Bacteria | 3024 |
| 208 | Ga0081540_1058468 | 3300005983 | Unclassified | 1857 |
| 209 | Ga0081539_10000138 | 3300005985 | Bacteria | 170633 |
| 210 | Ga0081539_10001786 | 3300005985 | Bacteria | 34126 |
| 211 | Ga0081539_10014279 | 3300005985 | Bacteria | 5889 |
| 212 | Ga0081539_10060037 | 3300005985 | Bacteria | 2090 |
| 213 | Ga0070717_10007906 | 3300006028 | Bacteria | 7919 |
| 214 | Ga0070717_10017338 | 3300006028 | Bacteria | 5603 |
| 215 | Ga0070717_10159927 | 3300006028 | Unclassified | 1953 |
| 216 | Ga0070717_10183326 | 3300006028 | Bacteria | 1826 |
| 217 | Ga0070717_10385665 | 3300006028 | Bacteria | 1257 |
| 218 | Ga0075365_10013500 | 3300006038 | Bacteria | 4889 |
| 219 | Ga0075363_100045800 | 3300006048 | Bacteria | 2320 |
| 220 | Ga0075364_10022473 | 3300006051 | Bacteria | 3983 |
| 221 | Ga0075364_10038715 | 3300006051 | Bacteria | 3090 |
| 222 | Ga0070715_10021115 | 3300006163 | Bacteria | 2520 |
| 223 | Ga0070716_100076322 | 3300006173 | Bacteria | 1985 |
| 224 | Ga0070716_100215999 | 3300006173 | Bacteria | 1285 |
| 225 | Ga0070712_100012358 | 3300006175 | Bacteria | 5427 |
| 226 | Ga0070712_100048470 | 3300006175 | Bacteria | 2945 |
| 227 | Ga0070712_100175589 | 3300006175 | Unclassified | 1666 |
| 228 | Ga0075362_10000244 | 3300006177 | Bacteria | 15104 |
| 229 | Ga0075367_10007814 | 3300006178 | Bacteria | 5501 |
| 230 | Ga0075366_10006890 | 3300006195 | Bacteria | 6254 |
| 231 | Ga0075370_10007318 | 3300006353 | Bacteria | 5620 |
| 232 | Ga0068871_100034943 | 3300006358 | Unclassified | 3992 |
| 233 | Ga0068871_100083337 | 3300006358 | Bacteria | 2652 |
| 234 | Ga0068871_100096981 | 3300006358 | Bacteria | 2464 |
| 235 | Ga0075428_100008564 | 3300006844 | Bacteria | 11345 |
| 236 | Ga0075431_100029302 | 3300006847 | Bacteria | 5664 |
| 237 | Ga0075433_10047972 | 3300006852 | Bacteria | 3714 |
| 238 | Ga0075433_10176167 | 3300006852 | Bacteria | 1903 |
| 239 | Ga0075433_10388799 | 3300006852 | Bacteria | 1231 |
| 240 | Ga0075434_100015067 | 3300006871 | Bacteria | 7402 |
| 241 | Ga0075434_100164307 | 3300006871 | Bacteria | 2240 |
| 242 | Ga0075434_100179330 | 3300006871 | Bacteria | 2138 |
| 243 | Ga0075434_100223102 | 3300006871 | Bacteria | 1904 |
| 244 | Ga0075434_100247959 | 3300006871 | Bacteria | 1800 |
| 245 | Ga0075434_100582846 | 3300006871 | Bacteria | 1138 |
| 246 | Ga0075429_100087768 | 3300006880 | Bacteria | 2711 |
| 247 | Ga0068865_100000203 | 3300006881 | Bacteria | 33028 |
| 248 | Ga0068865_100021256 | 3300006881 | Bacteria | 4218 |
| 249 | Ga0068865_100042150 | 3300006881 | Bacteria | 3111 |
| 250 | Ga0075436_100010401 | 3300006914 | Bacteria | 6377 |
| 251 | Ga0075436_100102150 | 3300006914 | Bacteria | 1997 |
| 252 | Ga0097620_100173995 | 3300006931 | Bacteria | 2235 |
| 253 | Ga0097620_100188414 | 3300006931 | Bacteria | 2147 |
| 254 | Ga0075435_100047618 | 3300007076 | Bacteria | 3442 |
| 255 | Ga0075435_100177325 | 3300007076 | Bacteria | 1800 |
| 256 | Ga0075435_100336794 | 3300007076 | Bacteria | 1293 |
| 257 | Ga0105240_10177880 | 3300009093 | Bacteria | 2514 |
| 258 | Ga0111539_10016882 | 3300009094 | Bacteria | 9041 |
| 259 | Ga0111539_10033172 | 3300009094 | Bacteria | 6270 |
| 260 | Ga0111539_10162842 | 3300009094 | Bacteria | 2609 |
| 261 | Ga0105245_10000077 | 3300009098 | Bacteria | 101470 |
| 262 | Ga0105245_10000246 | 3300009098 | Bacteria | 51410 |
| 263 | Ga0105245_10002646 | 3300009098 | Bacteria | 16119 |
| 264 | Ga0105245_10221003 | 3300009098 | Bacteria | 1828 |
| 265 | Ga0105245_10292919 | 3300009098 | Bacteria | 1595 |
| 266 | Ga0105247_10057996 | 3300009101 | Bacteria | 2395 |
| 267 | Ga0114129_10004513 | 3300009147 | Bacteria | 19642 |
| 268 | Ga0114129_10119986 | 3300009147 | Bacteria | 3621 |
| 269 | Ga0114129_10361700 | 3300009147 | Bacteria | 1920 |
| 270 | Ga0114129_10527339 | 3300009147 | Bacteria | 1539 |
| 271 | Ga0114129_10615890 | 3300009147 | Bacteria | 1405 |
| 272 | Ga0114129_10634874 | 3300009147 | Bacteria | 1380 |
| 273 | Ga0105243_10000600 | 3300009148 | Bacteria | 35955 |
| 274 | Ga0105241_10053365 | 3300009174 | Bacteria | 3091 |
| 275 | Ga0105241_10056481 | 3300009174 | Bacteria | 3010 |
| 276 | Ga0105242_10001272 | 3300009176 | Bacteria | 19923 |
| 277 | Ga0105242_10035345 | 3300009176 | Bacteria | 4008 |
| 278 | Ga0105242_10071099 | 3300009176 | Bacteria | 2887 |
| 279 | Ga0105248_10058920 | 3300009177 | Bacteria | 4313 |
| 280 | Ga0105237_10021575 | 3300009545 | Bacteria | 6621 |
| 281 | Ga0105238_10000014 | 3300009551 | Bacteria | 241954 |
| 282 | Ga0105238_10089756 | 3300009551 | Bacteria | 3061 |
| 283 | Ga0105238_10146222 | 3300009551 | Bacteria | 2340 |
| 284 | Ga0105238_10163660 | 3300009551 | Bacteria | 2200 |
| 285 | Ga0105238_10374926 | 3300009551 | Bacteria | 1414 |
| 286 | Ga0105249_10000007 | 3300009553 | Bacteria | 349503 |
| 287 | Ga0105249_10000159 | 3300009553 | Bacteria | 82172 |
| 288 | Ga0105249_10001010 | 3300009553 | Bacteria | 24909 |
| 289 | Ga0105249_10293578 | 3300009553 | Bacteria | 1628 |
| 290 | Ga0105249_10372227 | 3300009553 | Bacteria | 1452 |
| 291 | Ga0105033_103607 | 3300009986 | Bacteria | 1306 |
| 292 | Ga0105239_10002392 | 3300010375 | Bacteria | 23925 |
| 293 | Ga0105239_10052367 | 3300010375 | Bacteria | 4477 |
| 294 | Ga0105239_10360545 | 3300010375 | Bacteria | 1642 |
| 295 | Ga0105246_10052091 | 3300011119 | Unclassified | 2812 |
| 296 | Ga0105246_10086571 | 3300011119 | Bacteria | 2247 |
| 297 | Ga0157369_10181276 | 3300013105 | Bacteria | 2216 |
| 298 | Ga0157374_10002924 | 3300013296 | Bacteria | 14313 |
| 299 | Ga0157374_10008085 | 3300013296 | Bacteria | 8993 |
| 300 | Ga0157374_10008425 | 3300013296 | Bacteria | 8808 |
| 301 | Ga0157374_10026700 | 3300013296 | Bacteria | 5198 |
| 302 | Ga0157374_10065244 | 3300013296 | Bacteria | 3419 |
| 303 | Ga0157374_10081337 | 3300013296 | Bacteria | 3074 |
| 304 | Ga0157374_10111312 | 3300013296 | Bacteria | 2634 |
| 305 | Ga0157378_10001806 | 3300013297 | Bacteria | 19219 |
| 306 | Ga0157378_10002051 | 3300013297 | Bacteria | 18038 |
| 307 | Ga0157378_10006138 | 3300013297 | Bacteria | 10527 |
| 308 | Ga0157378_10017866 | 3300013297 | Bacteria | 6225 |
| 309 | Ga0157378_10019273 | 3300013297 | Bacteria | 5997 |
| 310 | Ga0157378_10078367 | 3300013297 | Bacteria | 2980 |
| 311 | Ga0157378_10167785 | 3300013297 | Bacteria | 2057 |
| 312 | Ga0157378_10462137 | 3300013297 | Bacteria | 1261 |
| 313 | Ga0163162_10010416 | 3300013306 | Bacteria | 9038 |
| 314 | Ga0163162_10064142 | 3300013306 | Bacteria | 3718 |
| 315 | Ga0157372_10067392 | 3300013307 | Bacteria | 4022 |
| 316 | Ga0157372_10210973 | 3300013307 | Bacteria | 2251 |
| 317 | Ga0157375_10003227 | 3300013308 | Bacteria | 14154 |
| 318 | Ga0157375_10003763 | 3300013308 | Bacteria | 13155 |
| 319 | Ga0157375_10018677 | 3300013308 | Bacteria | 6292 |
| 320 | Ga0157375_10059461 | 3300013308 | Bacteria | 3787 |
| 321 | Ga0157375_10063462 | 3300013308 | Bacteria | 3675 |
| 322 | Ga0157375_10069598 | 3300013308 | Bacteria | 3526 |
| 323 | Ga0157375_10490189 | 3300013308 | Bacteria | 1394 |
| 324 | Ga0163163_10084342 | 3300014325 | Unclassified | 3183 |
| 325 | Ga0163163_10312370 | 3300014325 | Bacteria | 1625 |
| 326 | Ga0163163_10421497 | 3300014325 | Bacteria | 1394 |
| 327 | Ga0157377_10007781 | 3300014745 | Bacteria | 5193 |
| 328 | Ga0157377_10038886 | 3300014745 | Unclassified | 2629 |
| 329 | Ga0157379_10007342 | 3300014968 | Bacteria | 9538 |
| 330 | Ga0157376_10011942 | 3300014969 | Bacteria | 6423 |
| 331 | Ga0157376_10024206 | 3300014969 | Bacteria | 4764 |
| 332 | Ga0157376_10087585 | 3300014969 | Bacteria | 2688 |
| 333 | Ga0157376_10117520 | 3300014969 | Bacteria | 2351 |
| 334 | Ga0157376_10123212 | 3300014969 | Bacteria | 2301 |
| 335 | Ga0206350_11484488 | 3300020080 | Bacteria | 1621 |
| 336 | Ga0213875_10093389 | 3300021388 | Bacteria | 1403 |
| 337 | Ga0224712_10000396 | 3300022467 | Bacteria | 8529 |
| 338 | Ga0207673_1002046 | 3300025290 | Bacteria | 2258 |
| 339 | Ga0207697_10000218 | 3300025315 | Bacteria | 30853 |
| 340 | Ga0207697_10000653 | 3300025315 | Bacteria | 19754 |
| 341 | Ga0207697_10000931 | 3300025315 | Bacteria | 16521 |
| 342 | Ga0207697_10001937 | 3300025315 | Bacteria | 10996 |
| 343 | Ga0207697_10002320 | 3300025315 | Bacteria | 9910 |
| 344 | Ga0207697_10005089 | 3300025315 | Bacteria | 6155 |
| 345 | Ga0207656_10114981 | 3300025321 | Bacteria | 1247 |
| 346 | Ga0207682_10000090 | 3300025893 | Bacteria | 41635 |
| 347 | Ga0207642_10006535 | 3300025899 | Bacteria | 3885 |
| 348 | Ga0207688_10004307 | 3300025901 | Bacteria | 7764 |
| 349 | Ga0207688_10050257 | 3300025901 | Bacteria | 2333 |
| 350 | Ga0207680_10058038 | 3300025903 | Bacteria | 2344 |
| 351 | Ga0207680_10064363 | 3300025903 | Bacteria | 2248 |
| 352 | Ga0207680_10067711 | 3300025903 | Bacteria | 2200 |
| 353 | Ga0207680_10095094 | 3300025903 | Bacteria | 1903 |
| 354 | Ga0207680_10127890 | 3300025903 | Bacteria | 1670 |
| 355 | Ga0207647_10007107 | 3300025904 | Bacteria | 8117 |
| 356 | Ga0207645_10034480 | 3300025907 | Bacteria | 3252 |
| 357 | Ga0207645_10035580 | 3300025907 | Bacteria | 3197 |
| 358 | Ga0207645_10219350 | 3300025907 | Bacteria | 1253 |
| 359 | Ga0207705_10002062 | 3300025909 | Bacteria | 15632 |
| 360 | Ga0207684_10000411 | 3300025910 | Bacteria | 57343 |
| 361 | Ga0207684_10004005 | 3300025910 | Bacteria | 14087 |
| 362 | Ga0207684_10008367 | 3300025910 | Bacteria | 9198 |
| 363 | Ga0207684_10008585 | 3300025910 | Bacteria | 9084 |
| 364 | Ga0207684_10014028 | 3300025910 | Bacteria | 6921 |
| 365 | Ga0207684_10021655 | 3300025910 | Bacteria | 5488 |
| 366 | Ga0207684_10030332 | 3300025910 | Bacteria | 4603 |
| 367 | Ga0207684_10048304 | 3300025910 | Bacteria | 3609 |
| 368 | Ga0207684_10224653 | 3300025910 | Bacteria | 1620 |
| 369 | Ga0207684_10328179 | 3300025910 | Bacteria | 1318 |
| 370 | Ga0207654_10047896 | 3300025911 | Bacteria | 2444 |
| 371 | Ga0207707_10007665 | 3300025912 | Bacteria | 9402 |
| 372 | Ga0207707_10151495 | 3300025912 | Bacteria | 2027 |
| 373 | Ga0207671_10004777 | 3300025914 | Bacteria | 12771 |
| 374 | Ga0207693_10019169 | 3300025915 | Bacteria | 5445 |
| 375 | Ga0207693_10072733 | 3300025915 | Bacteria | 2692 |
| 376 | Ga0207693_10076429 | 3300025915 | Bacteria | 2622 |
| 377 | Ga0207693_10083748 | 3300025915 | Unclassified | 2498 |
| 378 | Ga0207693_10245249 | 3300025915 | Bacteria | 1406 |
| 379 | Ga0207663_10082280 | 3300025916 | Bacteria | 2111 |
| 380 | Ga0207663_10101178 | 3300025916 | Bacteria | 1936 |
| 381 | Ga0207662_10057219 | 3300025918 | Bacteria | 2330 |
| 382 | Ga0207657_10046056 | 3300025919 | Bacteria | 3822 |
| 383 | Ga0207649_10031067 | 3300025920 | Bacteria | 3171 |
| 384 | Ga0207649_10038413 | 3300025920 | Unclassified | 2898 |
| 385 | Ga0207652_10019090 | 3300025921 | Bacteria | 5633 |
| 386 | Ga0207652_10042839 | 3300025921 | Bacteria | 3854 |
| 387 | Ga0207646_10000108 | 3300025922 | Bacteria | 112950 |
| 388 | Ga0207646_10001336 | 3300025922 | Bacteria | 30626 |
| 389 | Ga0207646_10001362 | 3300025922 | Bacteria | 30269 |
| 390 | Ga0207646_10001652 | 3300025922 | Bacteria | 27279 |
| 391 | Ga0207646_10011599 | 3300025922 | Bacteria | 8520 |
| 392 | Ga0207646_10022496 | 3300025922 | Bacteria | 5807 |
| 393 | Ga0207646_10043024 | 3300025922 | Bacteria | 4057 |
| 394 | Ga0207646_10074972 | 3300025922 | Bacteria | 3022 |
| 395 | Ga0207646_10091277 | 3300025922 | Unclassified | 2726 |
| 396 | Ga0207646_10264216 | 3300025922 | Bacteria | 1555 |
| 397 | Ga0207646_10318984 | 3300025922 | Bacteria | 1404 |
| 398 | Ga0207681_10137053 | 3300025923 | Bacteria | 1818 |
| 399 | Ga0207694_10000008 | 3300025924 | Bacteria | 484902 |
| 400 | Ga0207650_10015166 | 3300025925 | Bacteria | 5362 |
| 401 | Ga0207650_10052928 | 3300025925 | Bacteria | 3008 |
| 402 | Ga0207659_10026094 | 3300025926 | Bacteria | 3938 |
| 403 | Ga0207659_10040426 | 3300025926 | Bacteria | 3261 |
| 404 | Ga0207659_10159866 | 3300025926 | Bacteria | 1767 |
| 405 | Ga0207659_10195160 | 3300025926 | Bacteria | 1613 |
| 406 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 407 | Ga0207687_10000325 | 3300025927 | Bacteria | 32487 |
| 408 | Ga0207687_10004999 | 3300025927 | Bacteria | 8781 |
| 409 | Ga0207687_10005798 | 3300025927 | Bacteria | 8173 |
| 410 | Ga0207687_10107513 | 3300025927 | Bacteria | 2064 |
| 411 | Ga0207700_10251300 | 3300025928 | Bacteria | 1510 |
| 412 | Ga0207644_10051770 | 3300025931 | Bacteria | 2948 |
| 413 | Ga0207644_10059742 | 3300025931 | Bacteria | 2758 |
| 414 | Ga0207644_10062620 | 3300025931 | Bacteria | 2699 |
| 415 | Ga0207644_10136420 | 3300025931 | Bacteria | 1884 |
| 416 | Ga0207690_10071060 | 3300025932 | Bacteria | 2399 |
| 417 | Ga0207690_10071502 | 3300025932 | Bacteria | 2393 |
| 418 | Ga0207690_10172434 | 3300025932 | Bacteria | 1622 |
| 419 | Ga0207706_10000062 | 3300025933 | Bacteria | 109344 |
| 420 | Ga0207686_10000887 | 3300025934 | Bacteria | 18058 |
| 421 | Ga0207686_10085190 | 3300025934 | Bacteria | 2072 |
| 422 | Ga0207709_10000563 | 3300025935 | Bacteria | 31433 |
| 423 | Ga0207670_10011099 | 3300025936 | Bacteria | 5216 |
| 424 | Ga0207670_10018419 | 3300025936 | Bacteria | 4244 |
| 425 | Ga0207670_10077987 | 3300025936 | Bacteria | 2309 |
| 426 | Ga0207669_10003913 | 3300025937 | Bacteria | 6497 |
| 427 | Ga0207669_10144699 | 3300025937 | Bacteria | 1656 |
| 428 | Ga0207704_10002004 | 3300025938 | Bacteria | 9138 |
| 429 | Ga0207704_10193318 | 3300025938 | Bacteria | 1482 |
| 430 | Ga0207665_10009459 | 3300025939 | Bacteria | 6398 |
| 431 | Ga0207665_10089264 | 3300025939 | Bacteria | 2135 |
| 432 | Ga0207665_10261766 | 3300025939 | Bacteria | 1282 |
| 433 | Ga0207691_10001895 | 3300025940 | Bacteria | 20454 |
| 434 | Ga0207691_10021057 | 3300025940 | Bacteria | 6161 |
| 435 | Ga0207691_10055219 | 3300025940 | Bacteria | 3620 |
| 436 | Ga0207691_10147734 | 3300025940 | Bacteria | 2068 |
| 437 | Ga0207689_10002161 | 3300025942 | Bacteria | 18495 |
| 438 | Ga0207661_10006507 | 3300025944 | Bacteria | 8261 |
| 439 | Ga0207661_10008469 | 3300025944 | Bacteria | 7354 |
| 440 | Ga0207661_10016311 | 3300025944 | Bacteria | 5480 |
| 441 | Ga0207661_10034524 | 3300025944 | Unclassified | 3934 |
| 442 | Ga0207661_10065885 | 3300025944 | Bacteria | 2941 |
| 443 | Ga0207679_10028605 | 3300025945 | Bacteria | 3870 |
| 444 | Ga0207679_10050774 | 3300025945 | Bacteria | 3032 |
| 445 | Ga0207679_10386757 | 3300025945 | Bacteria | 1228 |
| 446 | Ga0207667_10299460 | 3300025949 | Bacteria | 1643 |
| 447 | Ga0207667_10376806 | 3300025949 | Bacteria | 1446 |
| 448 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 449 | Ga0207712_10000024 | 3300025961 | Bacteria | 275176 |
| 450 | Ga0207712_10001243 | 3300025961 | Bacteria | 17583 |
| 451 | Ga0207712_10070397 | 3300025961 | Bacteria | 2512 |
| 452 | Ga0207668_10010765 | 3300025972 | Bacteria | 5539 |
| 453 | Ga0207668_10027111 | 3300025972 | Bacteria | 3730 |
| 454 | Ga0207668_10080886 | 3300025972 | Bacteria | 2355 |
| 455 | Ga0207668_10106167 | 3300025972 | Bacteria | 2097 |
| 456 | Ga0207668_10137316 | 3300025972 | Bacteria | 1875 |
| 457 | Ga0207640_10002636 | 3300025981 | Bacteria | 9609 |
| 458 | Ga0207640_10155817 | 3300025981 | Bacteria | 1684 |
| 459 | Ga0207658_10063848 | 3300025986 | Bacteria | 2761 |
| 460 | Ga0207658_10179875 | 3300025986 | Bacteria | 1749 |
| 461 | Ga0207677_10000239 | 3300026023 | Bacteria | 42724 |
| 462 | Ga0207677_10010204 | 3300026023 | Bacteria | 5308 |
| 463 | Ga0207677_10073018 | 3300026023 | Bacteria | 2428 |
| 464 | Ga0207703_10000185 | 3300026035 | Bacteria | 72988 |
| 465 | Ga0207703_10004158 | 3300026035 | Bacteria | 11938 |
| 466 | Ga0207703_10008205 | 3300026035 | Bacteria | 8252 |
| 467 | Ga0207703_10040016 | 3300026035 | Bacteria | 3750 |
| 468 | Ga0207703_10349997 | 3300026035 | Bacteria | 1360 |
| 469 | Ga0207678_10011156 | 3300026067 | Bacteria | 7892 |
| 470 | Ga0207678_10121444 | 3300026067 | Bacteria | 2229 |
| 471 | Ga0207678_10125800 | 3300026067 | Bacteria | 2187 |
| 472 | Ga0207708_10046432 | 3300026075 | Bacteria | 3307 |
| 473 | Ga0207708_10059650 | 3300026075 | Bacteria | 2913 |
| 474 | Ga0207702_10006523 | 3300026078 | Bacteria | 10040 |
| 475 | Ga0207702_10075572 | 3300026078 | Bacteria | 2911 |
| 476 | Ga0207641_10057885 | 3300026088 | Bacteria | 3297 |
| 477 | Ga0207641_10064296 | 3300026088 | Unclassified | 3136 |
| 478 | Ga0207648_10001973 | 3300026089 | Bacteria | 22388 |
| 479 | Ga0207648_10011222 | 3300026089 | Bacteria | 8448 |
| 480 | Ga0207648_10370994 | 3300026089 | Bacteria | 1293 |
| 481 | Ga0207676_10037434 | 3300026095 | Bacteria | 3697 |
| 482 | Ga0207674_10073915 | 3300026116 | Bacteria | 3421 |
| 483 | Ga0207674_10228565 | 3300026116 | Unclassified | 1808 |
| 484 | Ga0207683_10000577 | 3300026121 | Bacteria | 33955 |
| 485 | Ga0207683_10014124 | 3300026121 | Bacteria | 6806 |
| 486 | Ga0207683_10021755 | 3300026121 | Bacteria | 5498 |
| 487 | Ga0207683_10085750 | 3300026121 | Bacteria | 2799 |
| 488 | Ga0207683_10309239 | 3300026121 | Bacteria | 1446 |
| 489 | Ga0207698_10205404 | 3300026142 | Bacteria | 1768 |
| 490 | Ga0207428_10078999 | 3300027907 | Bacteria | 2573 |
| 491 | Ga0207428_10109092 | 3300027907 | Bacteria | 2131 |
| 492 | Ga0265354_1002414 | 3300028016 | Bacteria | 2317 |
| 493 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 494 | Ga0268266_10051158 | 3300028379 | Bacteria | 3546 |
| 495 | Ga0268266_10060269 | 3300028379 | Bacteria | 3271 |
| 496 | Ga0268266_10071700 | 3300028379 | Bacteria | 3003 |
| 497 | Ga0268266_10355927 | 3300028379 | Unclassified | 1376 |
| 498 | Ga0268264_10002175 | 3300028381 | Bacteria | 17444 |
| 499 | Ga0268264_10017108 | 3300028381 | Bacteria | 5937 |
| 500 | Ga0265338_10000088 | 3300028800 | Bacteria | 174641 |
| 501 | Ga0265338_10011120 | 3300028800 | Bacteria | 10433 |
| 502 | Ga0265338_10202267 | 3300028800 | Bacteria | 1497 |
| 503 | Ga0265324_10000259 | 3300029957 | Bacteria | 39278 |
| 504 | Ga0265324_10006364 | 3300029957 | Bacteria | 4936 |
| 505 | Ga0265340_10017943 | 3300031247 | Bacteria | 3658 |
| 506 | Ga0265327_10001388 | 3300031251 | Bacteria | 30912 |
| 507 | Ga0265327_10002361 | 3300031251 | Bacteria | 20110 |
| 508 | Ga0265316_10000157 | 3300031344 | Bacteria | 75589 |
| 509 | Ga0265316_10098465 | 3300031344 | Bacteria | 2225 |
| 510 | Ga0307513_10084123 | 3300031456 | Bacteria | 3269 |
| 511 | Ga0307509_10026563 | 3300031507 | Bacteria | 6452 |
| 512 | Ga0307509_10161092 | 3300031507 | Bacteria | 2141 |
| 513 | Ga0307408_100079087 | 3300031548 | Bacteria | 2453 |
| 514 | Ga0316576_10002934 | 3300031727 | Bacteria | 9873 |
| 515 | Ga0307516_10000246 | 3300031730 | Bacteria | 69826 |
| 516 | Ga0307516_10093224 | 3300031730 | Bacteria | 2837 |
| 517 | Ga0307405_10048962 | 3300031731 | Bacteria | 2610 |
| 518 | Ga0307413_10032842 | 3300031824 | Bacteria | 2947 |
| 519 | Ga0307410_10007994 | 3300031852 | Bacteria | 5833 |
| 520 | Ga0307410_10026170 | 3300031852 | Bacteria | 3669 |
| 521 | Ga0307406_10160373 | 3300031901 | Bacteria | 1616 |
| 522 | Ga0307409_100011355 | 3300031995 | Bacteria | 5609 |
| 523 | Ga0307409_100016885 | 3300031995 | Bacteria | 4846 |
| 524 | Ga0307415_100001128 | 3300032126 | Bacteria | 12471 |
| 525 | Ga0373923_0001414 | 3300035111 | Bacteria | 6858 |
| 526 | Ga0373956_0056399 | 3300035119 | Bacteria | 1774 |
| 527 | Ga0373957_0039621 | 3300035120 | Bacteria | 1768 |
| 528 | Ga0373943_0048300 | 3300035170 | Unclassified | 2085 |
| 529 | Ga0373943_0096159 | 3300035170 | Bacteria | 1542 |
| 530 | Ga0373943_0101215 | 3300035170 | Bacteria | 1507 |
| 531 | Ga0316574_0012522 | 3300035398 | Bacteria | 4853 |
| 532 | Ga0373935_0019215 | 3300035692 | Unclassified | 4167 |
| 533 | Ga0373935_0068315 | 3300035692 | Unclassified | 2287 |
| 534 | Ga0373927_0003847 | 3300035695 | Bacteria | 10665 |
| 535 | Ga0373927_0211189 | 3300035695 | Bacteria | 1275 |
| 536 | Ga0373947_0200245 | 3300035725 | Bacteria | 1306 |
| 537 | Ga0373937_0011688 | 3300036401 | Bacteria | 7698 |
| 538 | Ga0373937_0054004 | 3300036401 | Bacteria | 3686 |
| 539 | Ga0373937_0082721 | 3300036401 | Unclassified | 2970 |
| 540 | Ga0316584_0008388 | 3300036712 | Bacteria | 7119 |
| 541 | Ga0395900_0002199 | 3300037418 | Bacteria | 21783 |
| 542 | Ga0395900_0008047 | 3300037418 | Bacteria | 10855 |
| 543 | Ga0395900_0100697 | 3300037418 | Bacteria | 2968 |
| 544 | Ga0395898_0003325 | 3300037466 | Bacteria | 18061 |
| 545 | Ga0395898_0010931 | 3300037466 | Bacteria | 9467 |
| 546 | Ga0395898_0133061 | 3300037466 | Bacteria | 2381 |
| 547 | Ga0395905_0013608 | 3300037471 | Bacteria | 7795 |
| 548 | Ga0436364_0569377 | 3300037853 | Bacteria | 9550 |
| 549 | Ga0436364_1122451 | 3300037853 | Bacteria | 4905 |
| 550 | Ga0395901_0001234 | 3300038443 | Bacteria | 27294 |
| 551 | Ga0395901_0022192 | 3300038443 | Bacteria | 6505 |
| 552 | Ga0395901_0104812 | 3300038443 | Bacteria | 2968 |
| 553 | Ga0400483_021979 | 3300039062 | Bacteria | 72013 |
| 554 | Ga0400483_026621 | 3300039062 | Bacteria | 3753 |
| 555 | Ga0400483_062586 | 3300039062 | Bacteria | 13225 |
| 556 | Ga0400483_162332 | 3300039062 | Bacteria | 54875 |
| 557 | Ga0400483_289865 | 3300039062 | Bacteria | 2672 |
| 558 | Ga0436365_1863689 | 3300039437 | Bacteria | 1423 |
| 559 | Ga0436361_0301618 | 3300039447 | Bacteria | 4109 |
| 560 | Ga0436361_0626365 | 3300039447 | Bacteria | 2616 |
| 561 | Ga0436361_1038034 | 3300039447 | Bacteria | 12154 |
| 562 | Ga0451853_1931364 | 3300041512 | Bacteria | 1022 |
| 563 | Ga0439433_0016924 | 3300041999 | Bacteria | 1617 |
| 564 | Ga0439434_0018948 | 3300042435 | Bacteria | 2063 |
| 565 | Ga0453683_0003589 | 3300044673 | Bacteria | 11398 |
| 566 | Ga0453683_0191626 | 3300044673 | Bacteria | 1297 |
| 567 | Ga0466966_0001956 | 3300044684 | Bacteria | 13339 |
| 568 | Ga0466961_0105369 | 3300044693 | Bacteria | 1775 |
| 569 | Ga0466963_0022182 | 3300044694 | Bacteria | 4019 |
| 570 | Ga0466963_0264606 | 3300044694 | Bacteria | 1207 |
| 571 | Ga0466957_0050769 | 3300044842 | Bacteria | 2524 |
| 572 | Ga0466959_0119933 | 3300045049 | Bacteria | 1871 |
| 573 | Ga0466959_0279583 | 3300045049 | Bacteria | 1146 |
| 574 | Ga0451576_0014850 | 3300045051 | Bacteria | 8655 |
| 575 | Ga0451576_0021161 | 3300045051 | Bacteria | 7071 |
| 576 | Ga0466958_0023501 | 3300045836 | Bacteria | 3619 |
| 577 | Ga0466967_0000138 | 3300045976 | Bacteria | 28201 |
| 578 | Ga0495592_0114261 | 3300046454 | Unclassified | 1907 |
| 579 | Ga0495603_0095906 | 3300046455 | Bacteria | 1733 |
| 580 | Ga0495629_0038173 | 3300046459 | Bacteria | 3384 |
| 581 | Ga0495641_0063025 | 3300046461 | Bacteria | 1671 |
| 582 | Ga0495651_0004272 | 3300046462 | Bacteria | 10960 |
| 583 | Ga0495651_0123806 | 3300046462 | Unclassified | 1896 |
| 584 | Ga0495653_0000479 | 3300046463 | Bacteria | 30968 |
| 585 | Ga0495653_0025443 | 3300046463 | Unclassified | 4757 |
| 586 | Ga0495580_0008029 | 3300046472 | Bacteria | 8427 |
| 587 | Ga0495582_0049158 | 3300046473 | Bacteria | 2322 |
| 588 | Ga0495582_0071734 | 3300046473 | Bacteria | 1916 |
| 589 | Ga0495594_0056228 | 3300046499 | Bacteria | 2171 |
| 590 | Ga0495618_0059609 | 3300046514 | Unclassified | 2419 |
| 591 | Ga0495620_0000060 | 3300046515 | Bacteria | 95642 |
| 592 | Ga0495628_0047612 | 3300046516 | Bacteria | 3401 |
| 593 | Ga0495628_0073153 | 3300046516 | Unclassified | 2671 |
| 594 | Ga0495630_0005350 | 3300046517 | Bacteria | 9055 |
| 595 | Ga0495630_0089116 | 3300046517 | Unclassified | 2330 |
| 596 | Ga0495644_0000299 | 3300046523 | Bacteria | 22897 |
| 597 | Ga0495665_0000454 | 3300046531 | Bacteria | 20626 |
| 598 | Ga0495598_0043191 | 3300046537 | Bacteria | 1326 |
| 599 | Ga0495621_0000153 | 3300046539 | Bacteria | 15123 |
| 600 | Ga0495645_0008304 | 3300046543 | Bacteria | 7246 |
| 601 | Ga0495645_0046588 | 3300046543 | Unclassified | 3160 |
| 602 | Ga0495634_0000838 | 3300046642 | Bacteria | 29654 |
| 603 | Ga0495635_0006803 | 3300046663 | Bacteria | 7991 |
| 604 | Ga0495657_0005388 | 3300046675 | Bacteria | 10119 |
| 605 | Ga0495599_0005716 | 3300046678 | Bacteria | 7459 |
| 606 | Ga0495646_0002154 | 3300046680 | Bacteria | 11970 |
| 607 | Ga0495646_0011602 | 3300046680 | Bacteria | 5598 |
| 608 | Ga0495647_0000006 | 3300046681 | Bacteria | 105867 |
| 609 | Ga0495647_0089314 | 3300046681 | Bacteria | 1261 |
| 610 | Ga0495669_0000064 | 3300046684 | Bacteria | 70549 |
| 611 | Ga0495613_0030415 | 3300046689 | Unclassified | 4011 |
| 612 | Ga0495624_0008216 | 3300046690 | Bacteria | 7298 |
| 613 | Ga0495581_0001103 | 3300047315 | Bacteria | 14738 |
| 614 | Ga0495581_0023765 | 3300047315 | Bacteria | 3552 |
| 615 | Ga0495604_0024946 | 3300047317 | Unclassified | 4767 |
| 616 | Ga0495674_0005650 | 3300047319 | Bacteria | 11977 |
| 617 | Ga0495675_0000865 | 3300047444 | Bacteria | 18492 |
| 618 | Ga0495684_0023078 | 3300047471 | Bacteria | 4785 |
| 619 | Ga0495593_0015748 | 3300047673 | Unclassified | 4275 |
| 620 | Ga0495602_0065594 | 3300048088 | Bacteria | 3133 |
| 621 | Ga0495614_0008037 | 3300048089 | Unclassified | 4689 |
| 622 | Ga0496100_0000004 | 3300048903 | Bacteria | 321778 |
| 623 | Ga0496100_0018217 | 3300048903 | Bacteria | 4162 |
| 624 | Ga0496100_0021130 | 3300048903 | Bacteria | 3915 |
| 625 | Ga0496101_0000007 | 3300048904 | Bacteria | 321778 |
| 626 | Ga0496101_0001156 | 3300048904 | Bacteria | 15776 |
| 627 | Ga0496101_0292020 | 3300048904 | Bacteria | 1276 |
| 628 | Ga0496102_0000586 | 3300048905 | Bacteria | 38547 |
| 629 | Ga0496102_0068149 | 3300048905 | Bacteria | 3265 |
| 630 | Ga0496102_0282475 | 3300048905 | Bacteria | 1564 |
| 631 | Ga0496103_0000588 | 3300048906 | Bacteria | 28707 |
| 632 | Ga0496103_0011399 | 3300048906 | Bacteria | 5267 |
| 633 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 634 | Ga0496104_0006256 | 3300048907 | Bacteria | 10462 |
| 635 | Ga0496104_0042147 | 3300048907 | Bacteria | 4283 |
| 636 | Ga0496104_0070285 | 3300048907 | Bacteria | 3328 |
| 637 | Ga0496104_0167390 | 3300048907 | Bacteria | 2108 |
| 638 | Ga0496105_0000008 | 3300048908 | Bacteria | 335652 |
| 639 | Ga0496105_0165609 | 3300048908 | Bacteria | 1814 |
| 640 | Ga0496106_0000004 | 3300048909 | Bacteria | 279896 |
| 641 | Ga0496106_0000096 | 3300048909 | Bacteria | 67122 |
| 642 | Ga0496106_0002424 | 3300048909 | Bacteria | 13905 |
| 643 | Ga0496106_0078382 | 3300048909 | Bacteria | 2535 |
| 644 | Ga0496106_0234622 | 3300048909 | Bacteria | 1465 |
| 645 | Ga0496107_0000001 | 3300048910 | Bacteria | 321778 |
| 646 | Ga0496107_0000571 | 3300048910 | Bacteria | 20528 |
| 647 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 648 | Ga0496108_0025876 | 3300048911 | Bacteria | 4840 |
| 649 | Ga0496108_0118299 | 3300048911 | Unclassified | 2271 |
| 650 | Ga0496108_0462058 | 3300048911 | Bacteria | 1109 |
| 651 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 652 | Ga0496109_0003049 | 3300048912 | Bacteria | 13964 |
| 653 | Ga0496109_0004828 | 3300048912 | Bacteria | 11250 |
| 654 | Ga0496110_0089535 | 3300048913 | Bacteria | 2751 |
| 655 | Ga0496110_0249602 | 3300048913 | Unclassified | 1615 |
| 656 | Ga0496110_0350734 | 3300048913 | Unclassified | 1344 |
| 657 | Ga0496111_0054176 | 3300048914 | Bacteria | 2899 |
| 658 | Ga0496112_0001254 | 3300048915 | Bacteria | 19218 |
| 659 | Ga0496112_0016245 | 3300048915 | Bacteria | 6966 |
| 660 | Ga0496112_0107618 | 3300048915 | Bacteria | 2758 |
| 661 | Ga0496112_0316256 | 3300048915 | Bacteria | 1506 |
| 662 | Ga0496113_0014131 | 3300048916 | Bacteria | 5436 |
| 663 | Ga0496114_0000687 | 3300048917 | Bacteria | 25152 |
| 664 | Ga0496114_0001166 | 3300048917 | Bacteria | 19860 |
| 665 | Ga0496114_0012761 | 3300048917 | Bacteria | 6729 |
| 666 | Ga0496114_0013316 | 3300048917 | Bacteria | 6593 |
| 667 | Ga0496114_0037532 | 3300048917 | Bacteria | 4007 |
| 668 | Ga0496115_0000068 | 3300048918 | Bacteria | 93725 |
| 669 | Ga0496115_0001015 | 3300048918 | Bacteria | 20344 |
| 670 | Ga0496115_0067467 | 3300048918 | Unclassified | 2893 |
| 671 | Ga0496115_0132902 | 3300048918 | Bacteria | 2051 |
| 672 | Ga0496115_0178257 | 3300048918 | Bacteria | 1757 |
| 673 | Ga0496115_0432492 | 3300048918 | Bacteria | 1065 |
| 674 | Ga0496125_0059332 | 3300048928 | Bacteria | 3084 |
| 675 | Ga0496126_0039433 | 3300048929 | Bacteria | 4383 |
| 676 | Ga0501290_002058 | 3300049513 | Bacteria | 2639 |
| 677 | Ga0501298_002700 | 3300049521 | Bacteria | 2709 |
| 678 | Ga0501038_0070765 | 3300049574 | Bacteria | 2961 |
| 679 | Ga0501070_0159956 | 3300049586 | Bacteria | 1857 |
| 680 | Ga0501071_0107275 | 3300049587 | Bacteria | 2062 |
| 681 | Ga0501072_0073138 | 3300049588 | Bacteria | 2710 |
| 682 | Ga0501076_0069462 | 3300049592 | Bacteria | 2815 |
| 683 | Ga0501223_004266 | 3300049663 | Bacteria | 3071 |
| 684 | Ga0501257_000140 | 3300049686 | Bacteria | 16197 |
| 685 | Ga0501081_0134592 | 3300049743 | Bacteria | 1768 |
| 686 | Ga0501083_0003423 | 3300049744 | Bacteria | 11084 |
| 687 | Ga0501280_000729 | 3300049776 | Bacteria | 7248 |
| 688 | Ga0501045_0049495 | 3300049824 | Bacteria | 3064 |
| 689 | nmdc:mga03683_7939_c1 | 3300050489 | Bacteria | 3709 |
| 690 | nmdc:mga00v17_37164_c1 | 3300050491 | Bacteria | 2906 |
| 691 | nmdc:mga0yw44_255967_c1 | 3300050492 | Bacteria | 1166 |
| 692 | nmdc:mga0yw44_96529_c1 | 3300050492 | Bacteria | 1876 |
| 693 | nmdc:mga06z11_78709_c1 | 3300050494 | Bacteria | 1763 |
| 694 | nmdc:mga07m45_19135_c1 | 3300050496 | Bacteria | 3706 |
| 695 | nmdc:mga05p37_262118_c1 | 3300050507 | Bacteria | 2068 |
| 696 | nmdc:mga05p37_380489_c1 | 3300050507 | Bacteria | 1654 |
| 697 | nmdc:mga05p37_51110_c1 | 3300050507 | Bacteria | 5084 |
| 698 | nmdc:mga05p37_6368_c1 | 3300050507 | Bacteria | 13906 |
| 699 | nmdc:mga09592_16235_c1 | 3300050508 | Bacteria | 6086 |
| 700 | nmdc:mga0qj67_148751_c1 | 3300050509 | Bacteria | 1899 |
| 701 | nmdc:mga08y16_125638_c1 | 3300050511 | Bacteria | 2668 |
| 702 | nmdc:mga08y16_143040_c1 | 3300050511 | Bacteria | 2486 |
| 703 | nmdc:mga08y16_34214_c1 | 3300050511 | Bacteria | 5338 |
| 704 | nmdc:mga0n895_183165_c1 | 3300050512 | Bacteria | 2126 |
| 705 | nmdc:mga0n895_226967_c1 | 3300050512 | Bacteria | 1896 |
| 706 | nmdc:mga0n895_305693_c1 | 3300050512 | Bacteria | 1612 |
| 707 | nmdc:mga0n895_543537_c1 | 3300050512 | Bacteria | 1168 |
| 708 | nmdc:mga0n895_78178_c1 | 3300050512 | Bacteria | 3293 |
| 709 | nmdc:mga0n895_89466_c1 | 3300050512 | Bacteria | 3079 |
| 710 | nmdc:mga0rr50_104581_c1 | 3300050513 | Bacteria | 2230 |
| 711 | nmdc:mga0rr50_128855_c1 | 3300050513 | Bacteria | 2023 |
| 712 | nmdc:mga08x19_11662_c1 | 3300050514 | Bacteria | 5291 |
| 713 | nmdc:mga0a205_341259_c1 | 3300050515 | Bacteria | 1366 |
| 714 | nmdc:mga0a205_399119_c1 | 3300050515 | Bacteria | 1239 |
| 715 | nmdc:mga0a205_58387_c1 | 3300050515 | Bacteria | 3727 |
| 716 | Ga0495601_0000189 | 3300053077 | Bacteria | 32597 |
| 717 | Ga0495601_0007313 | 3300053077 | Bacteria | 6472 |
| 718 | Ga0495601_0037793 | 3300053077 | Bacteria | 3018 |
| 719 | Ga0495612_0006562 | 3300053078 | Unclassified | 4774 |
| 720 | Ga0495612_0046905 | 3300053078 | Bacteria | 1770 |
| 721 | Ga0495612_0073841 | 3300053078 | Bacteria | 1425 |
| 722 | Ga0495619_0058543 | 3300053085 | Unclassified | 2558 |
| 723 | Ga0495619_0177120 | 3300053085 | Bacteria | 1475 |
| 724 | Ga0495619_0211628 | 3300053085 | Bacteria | 1343 |
| 725 | Ga0500643_001044 | 3300053087 | Bacteria | 16807 |
| 726 | Ga0500644_0000169 | 3300053088 | Bacteria | 41659 |
| 727 | Ga0500616_0017460 | 3300053153 | Bacteria | 4070 |
| 728 | Ga0501084_0307764 | 3300054114 | Bacteria | 1338 |
| 729 | Ga0587080_004277 | 3300059503 | Bacteria | 1842 |
| 730 | Ga0587079_003411 | 3300059647 | Bacteria | 2065 |
| 731 | Ga0587071_007976 | 3300060344 | Bacteria | 1704 |
| 732 | Ga0466962_0032224 | 3300061719 | Bacteria | 2509 |
| 733 | Ga0530510_0312054 | 3300061734 | Bacteria | 1178 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300053078 | Ga0495612_0073841 | Ga0495612_0073841_92_967 | 279 |
| 2 | 3300048918 | Ga0496115_0132902 | Ga0496115_0132902_72_959 | 280 |
| 3 | 3300044693 | Ga0466961_0105369 | Ga0466961_0105369_809_1702 | 287 |
| 4 | 3300050492 | nmdc:mga0yw44_96529_c1 | nmdc:mga0yw44_96529_c1_962_1858 | 291 |
| 5 | 3300050492 | nmdc:mga0yw44_255967_c1 | nmdc:mga0yw44_255967_c1_227_1153 | 303 |
| 6 | 3300048918 | Ga0496115_0432492 | Ga0496115_0432492_13_975 | 304 |
| 7 | 3300009986 | Ga0105033_103607 | Ga0105033_1036072 | 313 |
| 8 | 3300048915 | Ga0496112_0316256 | Ga0496112_0316256_26_970 | 314 |
| 9 | 3300050515 | nmdc:mga0a205_341259_c1 | nmdc:mga0a205_341259_c1_23_970 | 315 |
| 10 | 3300006173 | Ga0070716_100215999 | Ga0070716_1002159992 | 316 |
| 11 | 3300009147 | Ga0114129_10004513 | Ga0114129_100045139 | 317 |
| 12 | 3300050507 | nmdc:mga05p37_6368_c1 | nmdc:mga05p37_6368_c1_5250_6218 | 317 |
| 13 | 3300050512 | nmdc:mga0n895_183165_c1 | nmdc:mga0n895_183165_c1_853_1821 | 317 |
| 14 | 3300025940 | Ga0207691_10147734 | Ga0207691_101477342 | 318 |
| 15 | 3300041512 | Ga0451853_1931364 | Ga0451853_1931364_42_1007 | 318 |
| 16 | 3300044673 | Ga0453683_0191626 | Ga0453683_0191626_287_1249 | 318 |
| 17 | 3300050511 | nmdc:mga08y16_125638_c1 | nmdc:mga08y16_125638_c1_11_970 | 318 |
| 18 | 3300054114 | Ga0501084_0307764 | Ga0501084_0307764_16_978 | 318 |
| 19 | 3300010375 | Ga0105239_10052367 | Ga0105239_100523672 | 327 |
| 20 | 3300039447 | Ga0436361_0626365 | Ga0436361_0626365_719_1729 | 329 |
| 21 | 3300046516 | Ga0495628_0047612 | Ga0495628_0047612_1324_2337 | 331 |
| 22 | 3300048917 | Ga0496114_0013316 | Ga0496114_0013316_643_1656 | 331 |
| 23 | 3300009094 | Ga0111539_10016882 | Ga0111539_1001688211 | 333 |
| 24 | 3300050511 | nmdc:mga08y16_34214_c1 | nmdc:mga08y16_34214_c1_757_1797 | 333 |
| 25 | 3300005985 | Ga0081539_10060037 | Ga0081539_100600372 | 334 |
| 26 | 3300005843 | Ga0068860_100014730 | Ga0068860_1000147304 | 335 |
| 27 | 3300028381 | Ga0268264_10017108 | Ga0268264_100171083 | 335 |
| 28 | 3300028800 | Ga0265338_10202267 | Ga0265338_102022672 | 335 |
| 29 | 3300039437 | Ga0436365_1863689 | Ga0436365_1863689_356_1396 | 340 |
| 30 | 3300045049 | Ga0466959_0279583 | Ga0466959_0279583_24_1064 | 340 |
| 31 | 3300048909 | Ga0496106_0000096 | Ga0496106_0000096_55643_56728 | 340 |
| 32 | 3300005445 | Ga0070708_100059545 | Ga0070708_1000595453 | 341 |
| 33 | 3300005458 | Ga0070681_10036443 | Ga0070681_100364433 | 341 |
| 34 | 3300005467 | Ga0070706_100047895 | Ga0070706_1000478953 | 343 |
| 35 | 3300009147 | Ga0114129_10634874 | Ga0114129_106348741 | 343 |
| 36 | 3300031344 | Ga0265316_10000157 | Ga0265316_1000015747 | 343 |
| 37 | 3300046455 | Ga0495603_0095906 | Ga0495603_0095906_277_1335 | 343 |
| 38 | 3300046681 | Ga0495647_0089314 | Ga0495647_0089314_26_1069 | 343 |
| 39 | 3300050507 | nmdc:mga05p37_380489_c1 | nmdc:mga05p37_380489_c1_116_1195 | 343 |
| 40 | 3300005535 | Ga0070684_100186978 | Ga0070684_1001869782 | 344 |
| 41 | 3300009147 | Ga0114129_10361700 | Ga0114129_103617002 | 344 |
| 42 | 3300005331 | Ga0070670_100182137 | Ga0070670_1001821372 | 345 |
| 43 | 3300005467 | Ga0070706_100006643 | Ga0070706_1000066433 | 345 |
| 44 | 3300005468 | Ga0070707_100001458 | Ga0070707_10000145811 | 345 |
| 45 | 3300005468 | Ga0070707_100055268 | Ga0070707_1000552683 | 345 |
| 46 | 3300005471 | Ga0070698_100000390 | Ga0070698_10000039014 | 345 |
| 47 | 3300006914 | Ga0075436_100010401 | Ga0075436_1000104013 | 345 |
| 48 | 3300025910 | Ga0207684_10014028 | Ga0207684_100140283 | 345 |
| 49 | 3300025922 | Ga0207646_10001336 | Ga0207646_1000133627 | 345 |
| 50 | 3300046499 | Ga0495594_0056228 | Ga0495594_0056228_265_1347 | 345 |
| 51 | 3300050514 | nmdc:mga08x19_11662_c1 | nmdc:mga08x19_11662_c1_3469_4530 | 345 |
| 52 | 3300049588 | Ga0501072_0073138 | Ga0501072_0073138_1268_2335 | 347 |
| 53 | iso_pu_bacteria | 2886627955 | 2886634218 | 347 |
| 54 | 3300005331 | Ga0070670_100013375 | Ga0070670_1000133757 | 348 |
| 55 | 3300005331 | Ga0070670_100316589 | Ga0070670_1003165892 | 348 |
| 56 | 3300005335 | Ga0070666_10044470 | Ga0070666_100444704 | 348 |
| 57 | 3300005354 | Ga0070675_100075480 | Ga0070675_1000754803 | 348 |
| 58 | 3300005355 | Ga0070671_100001678 | Ga0070671_1000016788 | 348 |
| 59 | 3300005548 | Ga0070665_100035838 | Ga0070665_1000358384 | 348 |
| 60 | 3300005548 | Ga0070665_100085019 | Ga0070665_1000850193 | 348 |
| 61 | 3300005564 | Ga0070664_100107705 | Ga0070664_1001077051 | 348 |
| 62 | 3300006358 | Ga0068871_100096981 | Ga0068871_1000969813 | 348 |
| 63 | 3300013296 | Ga0157374_10081337 | Ga0157374_100813373 | 348 |
| 64 | 3300013297 | Ga0157378_10078367 | Ga0157378_100783674 | 348 |
| 65 | 3300013308 | Ga0157375_10018677 | Ga0157375_100186774 | 348 |
| 66 | 3300013308 | Ga0157375_10059461 | Ga0157375_100594611 | 348 |
| 67 | 3300014325 | Ga0163163_10312370 | Ga0163163_103123702 | 348 |
| 68 | 3300025315 | Ga0207697_10005089 | Ga0207697_100050893 | 348 |
| 69 | 3300025903 | Ga0207680_10064363 | Ga0207680_100643631 | 348 |
| 70 | 3300025903 | Ga0207680_10127890 | Ga0207680_101278902 | 348 |
| 71 | 3300025907 | Ga0207645_10035580 | Ga0207645_100355803 | 348 |
| 72 | 3300025923 | Ga0207681_10137053 | Ga0207681_101370532 | 348 |
| 73 | 3300025925 | Ga0207650_10015166 | Ga0207650_100151664 | 348 |
| 74 | 3300025926 | Ga0207659_10195160 | Ga0207659_101951601 | 348 |
| 75 | 3300025936 | Ga0207670_10077987 | Ga0207670_100779872 | 348 |
| 76 | 3300025940 | Ga0207691_10055219 | Ga0207691_100552193 | 348 |
| 77 | 3300025972 | Ga0207668_10080886 | Ga0207668_100808862 | 348 |
| 78 | 3300025986 | Ga0207658_10179875 | Ga0207658_101798752 | 348 |
| 79 | 3300028379 | Ga0268266_10060269 | Ga0268266_100602692 | 348 |
| 80 | iso_pu_bacteria | 2522125168 | 2522552521 | 348 |
| 81 | iso_pu_bacteria | 2597490356 | 2599102489 | 348 |
| 82 | iso_pu_bacteria | 2842333319 | 2842336582 | 348 |
| 83 | iso_pu_bacteria | 2846952575 | 2846958628 | 348 |
| 84 | 3300005328 | Ga0070676_10083705 | Ga0070676_100837052 | 349 |
| 85 | 3300005354 | Ga0070675_100122963 | Ga0070675_1001229633 | 349 |
| 86 | 3300005354 | Ga0070675_100138321 | Ga0070675_1001383212 | 349 |
| 87 | 3300005354 | Ga0070675_100219622 | Ga0070675_1002196222 | 349 |
| 88 | 3300005468 | Ga0070707_100001955 | Ga0070707_10000195510 | 349 |
| 89 | 3300006871 | Ga0075434_100582846 | Ga0075434_1005828461 | 349 |
| 90 | 3300026121 | Ga0207683_10309239 | Ga0207683_103092392 | 349 |
| 91 | 3300031727 | Ga0316576_10002934 | Ga0316576_100029345 | 349 |
| 92 | 3300035170 | Ga0373943_0096159 | Ga0373943_0096159_235_1284 | 349 |
| 93 | 3300035398 | Ga0316574_0012522 | Ga0316574_0012522_54_1106 | 349 |
| 94 | 3300036712 | Ga0316584_0008388 | Ga0316584_0008388_817_1869 | 349 |
| 95 | 3300037418 | Ga0395900_0008047 | Ga0395900_0008047_8194_9246 | 349 |
| 96 | 3300037466 | Ga0395898_0133061 | Ga0395898_0133061_324_1376 | 349 |
| 97 | 3300046539 | Ga0495621_0000153 | Ga0495621_0000153_9868_10935 | 349 |
| 98 | 3300048911 | Ga0496108_0118299 | Ga0496108_0118299_916_1968 | 349 |
| 99 | 3300048913 | Ga0496110_0249602 | Ga0496110_0249602_422_1474 | 349 |
| 100 | 3300048915 | Ga0496112_0016245 | Ga0496112_0016245_2466_3518 | 349 |
| 101 | 3300048929 | Ga0496126_0039433 | Ga0496126_0039433_2887_3957 | 349 |
| 102 | 3300050512 | nmdc:mga0n895_543537_c1 | nmdc:mga0n895_543537_c1_34_1083 | 349 |
| 103 | 3300003320 | rootH2_10100298 | rootH2_101002982 | 350 |
| 104 | 3300005290 | Ga0065712_10013148 | Ga0065712_100131483 | 350 |
| 105 | 3300005328 | Ga0070676_10006864 | Ga0070676_100068641 | 350 |
| 106 | 3300005331 | Ga0070670_100029305 | Ga0070670_1000293054 | 350 |
| 107 | 3300005335 | Ga0070666_10147834 | Ga0070666_101478342 | 350 |
| 108 | 3300005340 | Ga0070689_100005164 | Ga0070689_1000051644 | 350 |
| 109 | 3300005347 | Ga0070668_100036794 | Ga0070668_1000367945 | 350 |
| 110 | 3300005353 | Ga0070669_100007368 | Ga0070669_1000073682 | 350 |
| 111 | 3300005354 | Ga0070675_100076838 | Ga0070675_1000768381 | 350 |
| 112 | 3300005355 | Ga0070671_100011983 | Ga0070671_1000119832 | 350 |
| 113 | 3300005365 | Ga0070688_100021547 | Ga0070688_1000215473 | 350 |
| 114 | 3300005366 | Ga0070659_100141064 | Ga0070659_1001410642 | 350 |
| 115 | 3300005367 | Ga0070667_100006508 | Ga0070667_1000065082 | 350 |
| 116 | 3300005435 | Ga0070714_100101567 | Ga0070714_1001015672 | 350 |
| 117 | 3300005435 | Ga0070714_100395054 | Ga0070714_1003950541 | 350 |
| 118 | 3300005439 | Ga0070711_100397969 | Ga0070711_1003979691 | 350 |
| 119 | 3300005445 | Ga0070708_100246506 | Ga0070708_1002465062 | 350 |
| 120 | 3300005455 | Ga0070663_100013528 | Ga0070663_1000135284 | 350 |
| 121 | 3300005456 | Ga0070678_100002366 | Ga0070678_1000023663 | 350 |
| 122 | 3300005467 | Ga0070706_100008103 | Ga0070706_1000081035 | 350 |
| 123 | 3300005467 | Ga0070706_100023506 | Ga0070706_1000235061 | 350 |
| 124 | 3300005535 | Ga0070684_100152737 | Ga0070684_1001527372 | 350 |
| 125 | 3300005536 | Ga0070697_100007362 | Ga0070697_1000073627 | 350 |
| 126 | 3300005543 | Ga0070672_100213329 | Ga0070672_1002133291 | 350 |
| 127 | 3300005548 | Ga0070665_100017536 | Ga0070665_1000175368 | 350 |
| 128 | 3300005548 | Ga0070665_100059648 | Ga0070665_1000596483 | 350 |
| 129 | 3300005548 | Ga0070665_100079543 | Ga0070665_1000795432 | 350 |
| 130 | 3300005564 | Ga0070664_100032306 | Ga0070664_1000323064 | 350 |
| 131 | 3300005564 | Ga0070664_100294407 | Ga0070664_1002944072 | 350 |
| 132 | 3300005614 | Ga0068856_100011239 | Ga0068856_1000112392 | 350 |
| 133 | 3300005617 | Ga0068859_100188411 | Ga0068859_1001884112 | 350 |
| 134 | 3300005841 | Ga0068863_100223332 | Ga0068863_1002233322 | 350 |
| 135 | 3300005842 | Ga0068858_100002632 | Ga0068858_1000026322 | 350 |
| 136 | 3300005937 | Ga0081455_10057205 | Ga0081455_100572053 | 350 |
| 137 | 3300006028 | Ga0070717_10017338 | Ga0070717_100173383 | 350 |
| 138 | 3300006028 | Ga0070717_10183326 | Ga0070717_101833262 | 350 |
| 139 | 3300006163 | Ga0070715_10021115 | Ga0070715_100211151 | 350 |
| 140 | 3300006852 | Ga0075433_10176167 | Ga0075433_101761672 | 350 |
| 141 | 3300006871 | Ga0075434_100223102 | Ga0075434_1002231022 | 350 |
| 142 | 3300006881 | Ga0068865_100021256 | Ga0068865_1000212565 | 350 |
| 143 | 3300006931 | Ga0097620_100188414 | Ga0097620_1001884142 | 350 |
| 144 | 3300007076 | Ga0075435_100177325 | Ga0075435_1001773252 | 350 |
| 145 | 3300009094 | Ga0111539_10033172 | Ga0111539_100331721 | 350 |
| 146 | 3300009098 | Ga0105245_10221003 | Ga0105245_102210032 | 350 |
| 147 | 3300009147 | Ga0114129_10527339 | Ga0114129_105273391 | 350 |
| 148 | 3300009551 | Ga0105238_10374926 | Ga0105238_103749261 | 350 |
| 149 | 3300011119 | Ga0105246_10086571 | Ga0105246_100865713 | 350 |
| 150 | 3300013296 | Ga0157374_10008425 | Ga0157374_100084255 | 350 |
| 151 | 3300013296 | Ga0157374_10026700 | Ga0157374_100267004 | 350 |
| 152 | 3300013297 | Ga0157378_10019273 | Ga0157378_100192736 | 350 |
| 153 | 3300013297 | Ga0157378_10167785 | Ga0157378_101677851 | 350 |
| 154 | 3300013307 | Ga0157372_10067392 | Ga0157372_100673924 | 350 |
| 155 | 3300013308 | Ga0157375_10003227 | Ga0157375_100032274 | 350 |
| 156 | 3300014969 | Ga0157376_10123212 | Ga0157376_101232122 | 350 |
| 157 | 3300025315 | Ga0207697_10002320 | Ga0207697_100023206 | 350 |
| 158 | 3300025901 | Ga0207688_10004307 | Ga0207688_100043073 | 350 |
| 159 | 3300025903 | Ga0207680_10058038 | Ga0207680_100580382 | 350 |
| 160 | 3300025907 | Ga0207645_10034480 | Ga0207645_100344802 | 350 |
| 161 | 3300025910 | Ga0207684_10004005 | Ga0207684_1000400511 | 350 |
| 162 | 3300025910 | Ga0207684_10021655 | Ga0207684_100216553 | 350 |
| 163 | 3300025915 | Ga0207693_10083748 | Ga0207693_100837483 | 350 |
| 164 | 3300025916 | Ga0207663_10082280 | Ga0207663_100822802 | 350 |
| 165 | 3300025922 | Ga0207646_10043024 | Ga0207646_100430243 | 350 |
| 166 | 3300025927 | Ga0207687_10107513 | Ga0207687_101075132 | 350 |
| 167 | 3300025928 | Ga0207700_10251300 | Ga0207700_102513001 | 350 |
| 168 | 3300025931 | Ga0207644_10051770 | Ga0207644_100517705 | 350 |
| 169 | 3300025936 | Ga0207670_10018419 | Ga0207670_100184193 | 350 |
| 170 | 3300025937 | Ga0207669_10144699 | Ga0207669_101446991 | 350 |
| 171 | 3300025938 | Ga0207704_10193318 | Ga0207704_101933181 | 350 |
| 172 | 3300025939 | Ga0207665_10009459 | Ga0207665_100094594 | 350 |
| 173 | 3300025939 | Ga0207665_10261766 | Ga0207665_102617662 | 350 |
| 174 | 3300025940 | Ga0207691_10001895 | Ga0207691_1000189521 | 350 |
| 175 | 3300025945 | Ga0207679_10050774 | Ga0207679_100507741 | 350 |
| 176 | 3300025945 | Ga0207679_10386757 | Ga0207679_103867572 | 350 |
| 177 | 3300026035 | Ga0207703_10008205 | Ga0207703_100082052 | 350 |
| 178 | 3300026067 | Ga0207678_10011156 | Ga0207678_100111565 | 350 |
| 179 | 3300026078 | Ga0207702_10075572 | Ga0207702_100755722 | 350 |
| 180 | 3300026121 | Ga0207683_10085750 | Ga0207683_100857503 | 350 |
| 181 | 3300027907 | Ga0207428_10078999 | Ga0207428_100789991 | 350 |
| 182 | 3300028800 | Ga0265338_10000088 | Ga0265338_1000008825 | 350 |
| 183 | 3300028800 | Ga0265338_10011120 | Ga0265338_100111205 | 350 |
| 184 | 3300029957 | Ga0265324_10006364 | Ga0265324_100063642 | 350 |
| 185 | 3300031247 | Ga0265340_10017943 | Ga0265340_100179433 | 350 |
| 186 | 3300031251 | Ga0265327_10001388 | Ga0265327_100013888 | 350 |
| 187 | 3300031251 | Ga0265327_10002361 | Ga0265327_1000236110 | 350 |
| 188 | 3300035119 | Ga0373956_0056399 | Ga0373956_0056399_518_1573 | 350 |
| 189 | 3300035170 | Ga0373943_0048300 | Ga0373943_0048300_468_1520 | 350 |
| 190 | 3300035692 | Ga0373935_0068315 | Ga0373935_0068315_1214_2266 | 350 |
| 191 | 3300035725 | Ga0373947_0200245 | Ga0373947_0200245_45_1106 | 350 |
| 192 | 3300046459 | Ga0495629_0038173 | Ga0495629_0038173_1138_2208 | 350 |
| 193 | 3300046462 | Ga0495651_0123806 | Ga0495651_0123806_767_1822 | 350 |
| 194 | 3300046543 | Ga0495645_0008304 | Ga0495645_0008304_742_1797 | 350 |
| 195 | 3300046678 | Ga0495599_0005716 | Ga0495599_0005716_1695_2750 | 350 |
| 196 | 3300046680 | Ga0495646_0011602 | Ga0495646_0011602_16_1071 | 350 |
| 197 | 3300048904 | Ga0496101_0292020 | Ga0496101_0292020_129_1190 | 350 |
| 198 | 3300048911 | Ga0496108_0462058 | Ga0496108_0462058_26_1087 | 350 |
| 199 | 3300049744 | Ga0501083_0003423 | Ga0501083_0003423_3197_4252 | 350 |
| 200 | 3300050512 | nmdc:mga0n895_89466_c1 | nmdc:mga0n895_89466_c1_1428_2501 | 350 |
| 201 | 3300050513 | nmdc:mga0rr50_104581_c1 | nmdc:mga0rr50_104581_c1_111_1181 | 350 |
| 202 | 3300053077 | Ga0495601_0007313 | Ga0495601_0007313_604_1659 | 350 |
| 203 | 3300053078 | Ga0495612_0046905 | Ga0495612_0046905_516_1586 | 350 |
| 204 | 3300002077 | JGI24744J21845_10005804 | JGI24744J21845_100058042 | 351 |
| 205 | 3300003320 | rootH2_10009286 | rootH2_1000928617 | 351 |
| 206 | 3300003323 | rootH1_10035324 | rootH1_100353242 | 351 |
| 207 | 3300005327 | Ga0070658_10078072 | Ga0070658_100780722 | 351 |
| 208 | 3300005329 | Ga0070683_100007984 | Ga0070683_1000079847 | 351 |
| 209 | 3300005329 | Ga0070683_100029152 | Ga0070683_1000291522 | 351 |
| 210 | 3300005329 | Ga0070683_100227488 | Ga0070683_1002274882 | 351 |
| 211 | 3300005331 | Ga0070670_100061195 | Ga0070670_1000611952 | 351 |
| 212 | 3300005333 | Ga0070677_10000019 | Ga0070677_1000001924 | 351 |
| 213 | 3300005337 | Ga0070682_100000038 | Ga0070682_10000003843 | 351 |
| 214 | 3300005338 | Ga0068868_100000175 | Ga0068868_10000017513 | 351 |
| 215 | 3300005338 | Ga0068868_100097874 | Ga0068868_1000978743 | 351 |
| 216 | 3300005345 | Ga0070692_10042972 | Ga0070692_100429723 | 351 |
| 217 | 3300005347 | Ga0070668_100004408 | Ga0070668_1000044089 | 351 |
| 218 | 3300005347 | Ga0070668_100038018 | Ga0070668_1000380183 | 351 |
| 219 | 3300005347 | Ga0070668_100362721 | Ga0070668_1003627211 | 351 |
| 220 | 3300005353 | Ga0070669_100187502 | Ga0070669_1001875022 | 351 |
| 221 | 3300005356 | Ga0070674_100002857 | Ga0070674_1000028577 | 351 |
| 222 | 3300005356 | Ga0070674_100166049 | Ga0070674_1001660492 | 351 |
| 223 | 3300005365 | Ga0070688_100005768 | Ga0070688_1000057683 | 351 |
| 224 | 3300005366 | Ga0070659_100150669 | Ga0070659_1001506692 | 351 |
| 225 | 3300005366 | Ga0070659_100221066 | Ga0070659_1002210662 | 351 |
| 226 | 3300005434 | Ga0070709_10132184 | Ga0070709_101321842 | 351 |
| 227 | 3300005439 | Ga0070711_100010643 | Ga0070711_1000106434 | 351 |
| 228 | 3300005440 | Ga0070705_100001340 | Ga0070705_1000013409 | 351 |
| 229 | 3300005440 | Ga0070705_100007247 | Ga0070705_1000072475 | 351 |
| 230 | 3300005440 | Ga0070705_100023189 | Ga0070705_1000231892 | 351 |
| 231 | 3300005440 | Ga0070705_100026056 | Ga0070705_1000260562 | 351 |
| 232 | 3300005441 | Ga0070700_100041186 | Ga0070700_1000411862 | 351 |
| 233 | 3300005444 | Ga0070694_100051621 | Ga0070694_1000516212 | 351 |
| 234 | 3300005444 | Ga0070694_100056974 | Ga0070694_1000569741 | 351 |
| 235 | 3300005445 | Ga0070708_100021006 | Ga0070708_1000210064 | 351 |
| 236 | 3300005455 | Ga0070663_100037099 | Ga0070663_1000370992 | 351 |
| 237 | 3300005456 | Ga0070678_100000223 | Ga0070678_10000022313 | 351 |
| 238 | 3300005457 | Ga0070662_100000015 | Ga0070662_10000001556 | 351 |
| 239 | 3300005458 | Ga0070681_10134823 | Ga0070681_101348231 | 351 |
| 240 | 3300005459 | Ga0068867_100000715 | Ga0068867_10000071517 | 351 |
| 241 | 3300005466 | Ga0070685_10080065 | Ga0070685_100800652 | 351 |
| 242 | 3300005467 | Ga0070706_100000703 | Ga0070706_1000007034 | 351 |
| 243 | 3300005468 | Ga0070707_100129082 | Ga0070707_1001290822 | 351 |
| 244 | 3300005468 | Ga0070707_100280139 | Ga0070707_1002801391 | 351 |
| 245 | 3300005471 | Ga0070698_100020103 | Ga0070698_1000201032 | 351 |
| 246 | 3300005535 | Ga0070684_100017106 | Ga0070684_1000171064 | 351 |
| 247 | 3300005536 | Ga0070697_100461651 | Ga0070697_1004616511 | 351 |
| 248 | 3300005539 | Ga0068853_100017443 | Ga0068853_1000174435 | 351 |
| 249 | 3300005544 | Ga0070686_100000888 | Ga0070686_1000008884 | 351 |
| 250 | 3300005545 | Ga0070695_100008308 | Ga0070695_1000083084 | 351 |
| 251 | 3300005546 | Ga0070696_100003721 | Ga0070696_1000037218 | 351 |
| 252 | 3300005546 | Ga0070696_100004339 | Ga0070696_1000043397 | 351 |
| 253 | 3300005548 | Ga0070665_100000128 | Ga0070665_10000012834 | 351 |
| 254 | 3300005548 | Ga0070665_100060085 | Ga0070665_1000600852 | 351 |
| 255 | 3300005549 | Ga0070704_100005325 | Ga0070704_1000053254 | 351 |
| 256 | 3300005563 | Ga0068855_100002299 | Ga0068855_10000229920 | 351 |
| 257 | 3300005564 | Ga0070664_100027843 | Ga0070664_1000278432 | 351 |
| 258 | 3300005578 | Ga0068854_100003697 | Ga0068854_1000036977 | 351 |
| 259 | 3300005615 | Ga0070702_100000916 | Ga0070702_1000009169 | 351 |
| 260 | 3300005616 | Ga0068852_100179456 | Ga0068852_1001794561 | 351 |
| 261 | 3300005842 | Ga0068858_100000350 | Ga0068858_10000035028 | 351 |
| 262 | 3300005937 | Ga0081455_10065977 | Ga0081455_100659772 | 351 |
| 263 | 3300006028 | Ga0070717_10159927 | Ga0070717_101599271 | 351 |
| 264 | 3300006038 | Ga0075365_10013500 | Ga0075365_100135005 | 351 |
| 265 | 3300006048 | Ga0075363_100045800 | Ga0075363_1000458002 | 351 |
| 266 | 3300006051 | Ga0075364_10022473 | Ga0075364_100224735 | 351 |
| 267 | 3300006051 | Ga0075364_10038715 | Ga0075364_100387152 | 351 |
| 268 | 3300006175 | Ga0070712_100048470 | Ga0070712_1000484701 | 351 |
| 269 | 3300006177 | Ga0075362_10000244 | Ga0075362_100002448 | 351 |
| 270 | 3300006178 | Ga0075367_10007814 | Ga0075367_100078145 | 351 |
| 271 | 3300006195 | Ga0075366_10006890 | Ga0075366_100068905 | 351 |
| 272 | 3300006353 | Ga0075370_10007318 | Ga0075370_100073183 | 351 |
| 273 | 3300006358 | Ga0068871_100083337 | Ga0068871_1000833372 | 351 |
| 274 | 3300006847 | Ga0075431_100029302 | Ga0075431_1000293025 | 351 |
| 275 | 3300006852 | Ga0075433_10047972 | Ga0075433_100479724 | 351 |
| 276 | 3300006852 | Ga0075433_10388799 | Ga0075433_103887992 | 351 |
| 277 | 3300006871 | Ga0075434_100015067 | Ga0075434_1000150674 | 351 |
| 278 | 3300006871 | Ga0075434_100179330 | Ga0075434_1001793302 | 351 |
| 279 | 3300006871 | Ga0075434_100247959 | Ga0075434_1002479592 | 351 |
| 280 | 3300006880 | Ga0075429_100087768 | Ga0075429_1000877682 | 351 |
| 281 | 3300006881 | Ga0068865_100000203 | Ga0068865_10000020312 | 351 |
| 282 | 3300007076 | Ga0075435_100047618 | Ga0075435_1000476182 | 351 |
| 283 | 3300009098 | Ga0105245_10000077 | Ga0105245_1000007797 | 351 |
| 284 | 3300009098 | Ga0105245_10000246 | Ga0105245_1000024610 | 351 |
| 285 | 3300009147 | Ga0114129_10119986 | Ga0114129_101199862 | 351 |
| 286 | 3300009148 | Ga0105243_10000600 | Ga0105243_1000060014 | 351 |
| 287 | 3300009174 | Ga0105241_10056481 | Ga0105241_100564812 | 351 |
| 288 | 3300009176 | Ga0105242_10001272 | Ga0105242_1000127214 | 351 |
| 289 | 3300009176 | Ga0105242_10071099 | Ga0105242_100710992 | 351 |
| 290 | 3300009545 | Ga0105237_10021575 | Ga0105237_100215754 | 351 |
| 291 | 3300009551 | Ga0105238_10000014 | Ga0105238_1000001415 | 351 |
| 292 | 3300009551 | Ga0105238_10089756 | Ga0105238_100897562 | 351 |
| 293 | 3300009551 | Ga0105238_10146222 | Ga0105238_101462222 | 351 |
| 294 | 3300009551 | Ga0105238_10163660 | Ga0105238_101636602 | 351 |
| 295 | 3300009553 | Ga0105249_10000007 | Ga0105249_1000000788 | 351 |
| 296 | 3300009553 | Ga0105249_10000159 | Ga0105249_1000015951 | 351 |
| 297 | 3300009553 | Ga0105249_10001010 | Ga0105249_100010105 | 351 |
| 298 | 3300009553 | Ga0105249_10372227 | Ga0105249_103722272 | 351 |
| 299 | 3300010375 | Ga0105239_10002392 | Ga0105239_100023925 | 351 |
| 300 | 3300013296 | Ga0157374_10065244 | Ga0157374_100652442 | 351 |
| 301 | 3300013297 | Ga0157378_10001806 | Ga0157378_1000180614 | 351 |
| 302 | 3300013306 | Ga0163162_10064142 | Ga0163162_100641422 | 351 |
| 303 | 3300013307 | Ga0157372_10210973 | Ga0157372_102109732 | 351 |
| 304 | 3300013308 | Ga0157375_10063462 | Ga0157375_100634623 | 351 |
| 305 | 3300014325 | Ga0163163_10421497 | Ga0163163_104214972 | 351 |
| 306 | 3300014968 | Ga0157379_10007342 | Ga0157379_100073427 | 351 |
| 307 | 3300021388 | Ga0213875_10093389 | Ga0213875_100933892 | 351 |
| 308 | 3300025315 | Ga0207697_10001937 | Ga0207697_1000193710 | 351 |
| 309 | 3300025893 | Ga0207682_10000090 | Ga0207682_1000009014 | 351 |
| 310 | 3300025899 | Ga0207642_10006535 | Ga0207642_100065353 | 351 |
| 311 | 3300025901 | Ga0207688_10050257 | Ga0207688_100502572 | 351 |
| 312 | 3300025907 | Ga0207645_10219350 | Ga0207645_102193501 | 351 |
| 313 | 3300025909 | Ga0207705_10002062 | Ga0207705_100020628 | 351 |
| 314 | 3300025910 | Ga0207684_10000411 | Ga0207684_100004114 | 351 |
| 315 | 3300025910 | Ga0207684_10008367 | Ga0207684_100083671 | 351 |
| 316 | 3300025912 | Ga0207707_10151495 | Ga0207707_101514952 | 351 |
| 317 | 3300025914 | Ga0207671_10004777 | Ga0207671_100047779 | 351 |
| 318 | 3300025915 | Ga0207693_10072733 | Ga0207693_100727332 | 351 |
| 319 | 3300025915 | Ga0207693_10076429 | Ga0207693_100764292 | 351 |
| 320 | 3300025916 | Ga0207663_10101178 | Ga0207663_101011782 | 351 |
| 321 | 3300025922 | Ga0207646_10001362 | Ga0207646_100013623 | 351 |
| 322 | 3300025922 | Ga0207646_10264216 | Ga0207646_102642162 | 351 |
| 323 | 3300025922 | Ga0207646_10318984 | Ga0207646_103189841 | 351 |
| 324 | 3300025924 | Ga0207694_10000008 | Ga0207694_10000008223 | 351 |
| 325 | 3300025925 | Ga0207650_10052928 | Ga0207650_100529282 | 351 |
| 326 | 3300025926 | Ga0207659_10159866 | Ga0207659_101598662 | 351 |
| 327 | 3300025927 | Ga0207687_10000012 | Ga0207687_10000012231 | 351 |
| 328 | 3300025927 | Ga0207687_10000325 | Ga0207687_100003256 | 351 |
| 329 | 3300025927 | Ga0207687_10005798 | Ga0207687_100057982 | 351 |
| 330 | 3300025931 | Ga0207644_10059742 | Ga0207644_100597422 | 351 |
| 331 | 3300025932 | Ga0207690_10071502 | Ga0207690_100715022 | 351 |
| 332 | 3300025932 | Ga0207690_10172434 | Ga0207690_101724342 | 351 |
| 333 | 3300025933 | Ga0207706_10000062 | Ga0207706_1000006253 | 351 |
| 334 | 3300025934 | Ga0207686_10000887 | Ga0207686_1000088712 | 351 |
| 335 | 3300025934 | Ga0207686_10085190 | Ga0207686_100851902 | 351 |
| 336 | 3300025935 | Ga0207709_10000563 | Ga0207709_1000056316 | 351 |
| 337 | 3300025937 | Ga0207669_10003913 | Ga0207669_100039136 | 351 |
| 338 | 3300025938 | Ga0207704_10002004 | Ga0207704_100020046 | 351 |
| 339 | 3300025940 | Ga0207691_10021057 | Ga0207691_100210573 | 351 |
| 340 | 3300025944 | Ga0207661_10006507 | Ga0207661_100065078 | 351 |
| 341 | 3300025944 | Ga0207661_10016311 | Ga0207661_100163114 | 351 |
| 342 | 3300025949 | Ga0207667_10376806 | Ga0207667_103768062 | 351 |
| 343 | 3300025961 | Ga0207712_10000003 | Ga0207712_10000003231 | 351 |
| 344 | 3300025961 | Ga0207712_10000024 | Ga0207712_1000002449 | 351 |
| 345 | 3300025961 | Ga0207712_10001243 | Ga0207712_100012435 | 351 |
| 346 | 3300025961 | Ga0207712_10070397 | Ga0207712_100703972 | 351 |
| 347 | 3300025972 | Ga0207668_10010765 | Ga0207668_100107654 | 351 |
| 348 | 3300025972 | Ga0207668_10027111 | Ga0207668_100271112 | 351 |
| 349 | 3300025972 | Ga0207668_10137316 | Ga0207668_101373161 | 351 |
| 350 | 3300025981 | Ga0207640_10002636 | Ga0207640_1000263610 | 351 |
| 351 | 3300026023 | Ga0207677_10000239 | Ga0207677_1000023913 | 351 |
| 352 | 3300026035 | Ga0207703_10000185 | Ga0207703_1000018528 | 351 |
| 353 | 3300026075 | Ga0207708_10059650 | Ga0207708_100596502 | 351 |
| 354 | 3300026089 | Ga0207648_10001973 | Ga0207648_100019737 | 351 |
| 355 | 3300026089 | Ga0207648_10370994 | Ga0207648_103709942 | 351 |
| 356 | 3300026121 | Ga0207683_10000577 | Ga0207683_1000057718 | 351 |
| 357 | 3300026121 | Ga0207683_10021755 | Ga0207683_100217553 | 351 |
| 358 | 3300026142 | Ga0207698_10205404 | Ga0207698_102054042 | 351 |
| 359 | 3300028379 | Ga0268266_10000023 | Ga0268266_10000023114 | 351 |
| 360 | 3300029957 | Ga0265324_10000259 | Ga0265324_1000025923 | 351 |
| 361 | 3300031344 | Ga0265316_10098465 | Ga0265316_100984653 | 351 |
| 362 | 3300031731 | Ga0307405_10048962 | Ga0307405_100489622 | 351 |
| 363 | 3300031824 | Ga0307413_10032842 | Ga0307413_100328423 | 351 |
| 364 | 3300031852 | Ga0307410_10007994 | Ga0307410_100079945 | 351 |
| 365 | 3300031852 | Ga0307410_10026170 | Ga0307410_100261702 | 351 |
| 366 | 3300031901 | Ga0307406_10160373 | Ga0307406_101603732 | 351 |
| 367 | 3300031995 | Ga0307409_100011355 | Ga0307409_1000113553 | 351 |
| 368 | 3300031995 | Ga0307409_100016885 | Ga0307409_1000168852 | 351 |
| 369 | 3300032126 | Ga0307415_100001128 | Ga0307415_10000112811 | 351 |
| 370 | 3300035111 | Ga0373923_0001414 | Ga0373923_0001414_4490_5557 | 351 |
| 371 | 3300035170 | Ga0373943_0101215 | Ga0373943_0101215_90_1172 | 351 |
| 372 | 3300035695 | Ga0373927_0211189 | Ga0373927_0211189_152_1207 | 351 |
| 373 | 3300036401 | Ga0373937_0011688 | Ga0373937_0011688_2456_3523 | 351 |
| 374 | 3300036401 | Ga0373937_0054004 | Ga0373937_0054004_579_1652 | 351 |
| 375 | 3300037418 | Ga0395900_0100697 | Ga0395900_0100697_1488_2564 | 351 |
| 376 | 3300037466 | Ga0395898_0003325 | Ga0395898_0003325_3904_4980 | 351 |
| 377 | 3300037853 | Ga0436364_0569377 | Ga0436364_0569377_4362_5441 | 351 |
| 378 | 3300037853 | Ga0436364_1122451 | Ga0436364_1122451_3685_4749 | 351 |
| 379 | 3300038443 | Ga0395901_0104812 | Ga0395901_0104812_587_1660 | 351 |
| 380 | 3300039062 | Ga0400483_026621 | Ga0400483_026621_1007_2089 | 351 |
| 381 | 3300039062 | Ga0400483_062586 | Ga0400483_062586_9797_10882 | 351 |
| 382 | 3300039062 | Ga0400483_289865 | Ga0400483_289865_1036_2118 | 351 |
| 383 | 3300042435 | Ga0439434_0018948 | Ga0439434_0018948_182_1279 | 351 |
| 384 | 3300044684 | Ga0466966_0001956 | Ga0466966_0001956_11784_12857 | 351 |
| 385 | 3300044694 | Ga0466963_0022182 | Ga0466963_0022182_2374_3447 | 351 |
| 386 | 3300044694 | Ga0466963_0264606 | Ga0466963_0264606_29_1102 | 351 |
| 387 | 3300044842 | Ga0466957_0050769 | Ga0466957_0050769_1061_2134 | 351 |
| 388 | 3300045049 | Ga0466959_0119933 | Ga0466959_0119933_699_1769 | 351 |
| 389 | 3300045836 | Ga0466958_0023501 | Ga0466958_0023501_948_2021 | 351 |
| 390 | 3300046463 | Ga0495653_0000479 | Ga0495653_0000479_19313_20404 | 351 |
| 391 | 3300046473 | Ga0495582_0049158 | Ga0495582_0049158_1040_2122 | 351 |
| 392 | 3300046514 | Ga0495618_0059609 | Ga0495618_0059609_1123_2214 | 351 |
| 393 | 3300046515 | Ga0495620_0000060 | Ga0495620_0000060_43298_44371 | 351 |
| 394 | 3300046517 | Ga0495630_0089116 | Ga0495630_0089116_218_1309 | 351 |
| 395 | 3300046523 | Ga0495644_0000299 | Ga0495644_0000299_2302_3378 | 351 |
| 396 | 3300046537 | Ga0495598_0043191 | Ga0495598_0043191_196_1272 | 351 |
| 397 | 3300046663 | Ga0495635_0006803 | Ga0495635_0006803_2834_3925 | 351 |
| 398 | 3300046681 | Ga0495647_0000006 | Ga0495647_0000006_25805_26878 | 351 |
| 399 | 3300046684 | Ga0495669_0000064 | Ga0495669_0000064_14940_16013 | 351 |
| 400 | 3300047315 | Ga0495581_0001103 | Ga0495581_0001103_1346_2428 | 351 |
| 401 | 3300047471 | Ga0495684_0023078 | Ga0495684_0023078_1297_2388 | 351 |
| 402 | 3300048903 | Ga0496100_0000004 | Ga0496100_0000004_94478_95551 | 351 |
| 403 | 3300048903 | Ga0496100_0018217 | Ga0496100_0018217_972_2030 | 351 |
| 404 | 3300048903 | Ga0496100_0021130 | Ga0496100_0021130_138_1214 | 351 |
| 405 | 3300048904 | Ga0496101_0000007 | Ga0496101_0000007_94478_95551 | 351 |
| 406 | 3300048904 | Ga0496101_0001156 | Ga0496101_0001156_13156_14238 | 351 |
| 407 | 3300048905 | Ga0496102_0000586 | Ga0496102_0000586_13951_15033 | 351 |
| 408 | 3300048906 | Ga0496103_0000588 | Ga0496103_0000588_14451_15533 | 351 |
| 409 | 3300048907 | Ga0496104_0000003 | Ga0496104_0000003_449393_450469 | 351 |
| 410 | 3300048908 | Ga0496105_0000008 | Ga0496105_0000008_22398_23474 | 351 |
| 411 | 3300048908 | Ga0496105_0165609 | Ga0496105_0165609_198_1274 | 351 |
| 412 | 3300048909 | Ga0496106_0000004 | Ga0496106_0000004_55892_56965 | 351 |
| 413 | 3300048909 | Ga0496106_0002424 | Ga0496106_0002424_7612_8694 | 351 |
| 414 | 3300048910 | Ga0496107_0000001 | Ga0496107_0000001_94478_95551 | 351 |
| 415 | 3300048910 | Ga0496107_0000571 | Ga0496107_0000571_6419_7501 | 351 |
| 416 | 3300048911 | Ga0496108_0000002 | Ga0496108_0000002_516473_517546 | 351 |
| 417 | 3300048912 | Ga0496109_0000001 | Ga0496109_0000001_516435_517508 | 351 |
| 418 | 3300048912 | Ga0496109_0003049 | Ga0496109_0003049_1351_2424 | 351 |
| 419 | 3300048912 | Ga0496109_0004828 | Ga0496109_0004828_6929_7996 | 351 |
| 420 | 3300048913 | Ga0496110_0089535 | Ga0496110_0089535_1581_2654 | 351 |
| 421 | 3300048916 | Ga0496113_0014131 | Ga0496113_0014131_638_1711 | 351 |
| 422 | 3300048917 | Ga0496114_0001166 | Ga0496114_0001166_14417_15499 | 351 |
| 423 | 3300048917 | Ga0496114_0037532 | Ga0496114_0037532_1559_2617 | 351 |
| 424 | 3300048918 | Ga0496115_0000068 | Ga0496115_0000068_72192_73268 | 351 |
| 425 | 3300048918 | Ga0496115_0001015 | Ga0496115_0001015_13946_15028 | 351 |
| 426 | 3300048918 | Ga0496115_0067467 | Ga0496115_0067467_26_1084 | 351 |
| 427 | 3300048928 | Ga0496125_0059332 | Ga0496125_0059332_132_1205 | 351 |
| 428 | 3300049513 | Ga0501290_002058 | Ga0501290_002058_1309_2373 | 351 |
| 429 | 3300049521 | Ga0501298_002700 | Ga0501298_002700_1239_2303 | 351 |
| 430 | 3300049586 | Ga0501070_0159956 | Ga0501070_0159956_82_1161 | 351 |
| 431 | 3300049663 | Ga0501223_004266 | Ga0501223_004266_1003_2067 | 351 |
| 432 | 3300049686 | Ga0501257_000140 | Ga0501257_000140_2416_3480 | 351 |
| 433 | 3300049776 | Ga0501280_000729 | Ga0501280_000729_3863_4927 | 351 |
| 434 | 3300050489 | nmdc:mga03683_7939_c1 | nmdc:mga03683_7939_c1_1105_2178 | 351 |
| 435 | 3300050491 | nmdc:mga00v17_37164_c1 | nmdc:mga00v17_37164_c1_232_1305 | 351 |
| 436 | 3300050494 | nmdc:mga06z11_78709_c1 | nmdc:mga06z11_78709_c1_216_1289 | 351 |
| 437 | 3300050496 | nmdc:mga07m45_19135_c1 | nmdc:mga07m45_19135_c1_866_1939 | 351 |
| 438 | 3300050507 | nmdc:mga05p37_262118_c1 | nmdc:mga05p37_262118_c1_366_1439 | 351 |
| 439 | 3300050508 | nmdc:mga09592_16235_c1 | nmdc:mga09592_16235_c1_522_1595 | 351 |
| 440 | 3300050512 | nmdc:mga0n895_305693_c1 | nmdc:mga0n895_305693_c1_453_1526 | 351 |
| 441 | 3300050512 | nmdc:mga0n895_78178_c1 | nmdc:mga0n895_78178_c1_1038_2111 | 351 |
| 442 | 3300050515 | nmdc:mga0a205_399119_c1 | nmdc:mga0a205_399119_c1_72_1145 | 351 |
| 443 | 3300050515 | nmdc:mga0a205_58387_c1 | nmdc:mga0a205_58387_c1_709_1782 | 351 |
| 444 | 3300053077 | Ga0495601_0000189 | Ga0495601_0000189_5713_6786 | 351 |
| 445 | 3300053085 | Ga0495619_0058543 | Ga0495619_0058543_1179_2237 | 351 |
| 446 | 3300053085 | Ga0495619_0211628 | Ga0495619_0211628_135_1208 | 351 |
| 447 | 3300053087 | Ga0500643_001044 | Ga0500643_001044_11600_12664 | 351 |
| 448 | 3300059503 | Ga0587080_004277 | Ga0587080_004277_461_1540 | 351 |
| 449 | 3300059647 | Ga0587079_003411 | Ga0587079_003411_481_1560 | 351 |
| 450 | 3300060344 | Ga0587071_007976 | Ga0587071_007976_362_1441 | 351 |
| 451 | 3300061719 | Ga0466962_0032224 | Ga0466962_0032224_830_1903 | 351 |
| 452 | 3300061734 | Ga0530510_0312054 | Ga0530510_0312054_16_1089 | 351 |
| 453 | 3300000545 | CNXas_1000073 | CNXas_10000735 | 352 |
| 454 | 3300003203 | JGI25406J46586_10000369 | JGI25406J46586_1000036910 | 352 |
| 455 | 3300003911 | JGI25405J52794_10000207 | JGI25405J52794_100002072 | 352 |
| 456 | 3300005290 | Ga0065712_10001564 | Ga0065712_100015648 | 352 |
| 457 | 3300005293 | Ga0065715_10091643 | Ga0065715_100916432 | 352 |
| 458 | 3300005293 | Ga0065715_10092928 | Ga0065715_100929284 | 352 |
| 459 | 3300005293 | Ga0065715_10219712 | Ga0065715_102197121 | 352 |
| 460 | 3300005328 | Ga0070676_10037383 | Ga0070676_100373832 | 352 |
| 461 | 3300005328 | Ga0070676_10206219 | Ga0070676_102062191 | 352 |
| 462 | 3300005329 | Ga0070683_100001907 | Ga0070683_10000190710 | 352 |
| 463 | 3300005329 | Ga0070683_100022218 | Ga0070683_1000222184 | 352 |
| 464 | 3300005329 | Ga0070683_100037248 | Ga0070683_1000372483 | 352 |
| 465 | 3300005330 | Ga0070690_100070718 | Ga0070690_1000707183 | 352 |
| 466 | 3300005335 | Ga0070666_10027666 | Ga0070666_100276663 | 352 |
| 467 | 3300005336 | Ga0070680_100023414 | Ga0070680_1000234145 | 352 |
| 468 | 3300005337 | Ga0070682_100032067 | Ga0070682_1000320672 | 352 |
| 469 | 3300005338 | Ga0068868_100041506 | Ga0068868_1000415062 | 352 |
| 470 | 3300005339 | Ga0070660_100045727 | Ga0070660_1000457274 | 352 |
| 471 | 3300005340 | Ga0070689_100042520 | Ga0070689_1000425202 | 352 |
| 472 | 3300005343 | Ga0070687_100037721 | Ga0070687_1000377212 | 352 |
| 473 | 3300005344 | Ga0070661_100006819 | Ga0070661_1000068196 | 352 |
| 474 | 3300005344 | Ga0070661_100071430 | Ga0070661_1000714302 | 352 |
| 475 | 3300005347 | Ga0070668_100124081 | Ga0070668_1001240812 | 352 |
| 476 | 3300005355 | Ga0070671_100061335 | Ga0070671_1000613352 | 352 |
| 477 | 3300005355 | Ga0070671_100162797 | Ga0070671_1001627972 | 352 |
| 478 | 3300005364 | Ga0070673_100053177 | Ga0070673_1000531774 | 352 |
| 479 | 3300005364 | Ga0070673_100053282 | Ga0070673_1000532823 | 352 |
| 480 | 3300005365 | Ga0070688_100021782 | Ga0070688_1000217825 | 352 |
| 481 | 3300005366 | Ga0070659_100163925 | Ga0070659_1001639251 | 352 |
| 482 | 3300005366 | Ga0070659_100200576 | Ga0070659_1002005762 | 352 |
| 483 | 3300005366 | Ga0070659_100241615 | Ga0070659_1002416152 | 352 |
| 484 | 3300005367 | Ga0070667_100080404 | Ga0070667_1000804045 | 352 |
| 485 | 3300005367 | Ga0070667_100267638 | Ga0070667_1002676382 | 352 |
| 486 | 3300005406 | Ga0070703_10002069 | Ga0070703_100020694 | 352 |
| 487 | 3300005435 | Ga0070714_100138695 | Ga0070714_1001386952 | 352 |
| 488 | 3300005435 | Ga0070714_100156814 | Ga0070714_1001568141 | 352 |
| 489 | 3300005436 | Ga0070713_100393615 | Ga0070713_1003936151 | 352 |
| 490 | 3300005440 | Ga0070705_100064945 | Ga0070705_1000649452 | 352 |
| 491 | 3300005441 | Ga0070700_100024189 | Ga0070700_1000241892 | 352 |
| 492 | 3300005444 | Ga0070694_100205260 | Ga0070694_1002052602 | 352 |
| 493 | 3300005445 | Ga0070708_100001595 | Ga0070708_10000159513 | 352 |
| 494 | 3300005445 | Ga0070708_100008010 | Ga0070708_1000080104 | 352 |
| 495 | 3300005445 | Ga0070708_100059876 | Ga0070708_1000598763 | 352 |
| 496 | 3300005445 | Ga0070708_100229856 | Ga0070708_1002298562 | 352 |
| 497 | 3300005445 | Ga0070708_100386765 | Ga0070708_1003867651 | 352 |
| 498 | 3300005455 | Ga0070663_100095086 | Ga0070663_1000950862 | 352 |
| 499 | 3300005456 | Ga0070678_100092441 | Ga0070678_1000924412 | 352 |
| 500 | 3300005457 | Ga0070662_100058946 | Ga0070662_1000589462 | 352 |
| 501 | 3300005458 | Ga0070681_10005422 | Ga0070681_100054227 | 352 |
| 502 | 3300005458 | Ga0070681_10041890 | Ga0070681_100418902 | 352 |
| 503 | 3300005466 | Ga0070685_10082671 | Ga0070685_100826712 | 352 |
| 504 | 3300005467 | Ga0070706_100026208 | Ga0070706_1000262083 | 352 |
| 505 | 3300005467 | Ga0070706_100271144 | Ga0070706_1002711442 | 352 |
| 506 | 3300005467 | Ga0070706_100362112 | Ga0070706_1003621121 | 352 |
| 507 | 3300005468 | Ga0070707_100001078 | Ga0070707_10000107818 | 352 |
| 508 | 3300005468 | Ga0070707_100004157 | Ga0070707_10000415710 | 352 |
| 509 | 3300005468 | Ga0070707_100014990 | Ga0070707_1000149905 | 352 |
| 510 | 3300005468 | Ga0070707_100044119 | Ga0070707_1000441193 | 352 |
| 511 | 3300005468 | Ga0070707_100069262 | Ga0070707_1000692623 | 352 |
| 512 | 3300005471 | Ga0070698_100001334 | Ga0070698_1000013347 | 352 |
| 513 | 3300005471 | Ga0070698_100186388 | Ga0070698_1001863881 | 352 |
| 514 | 3300005518 | Ga0070699_100050680 | Ga0070699_1000506803 | 352 |
| 515 | 3300005530 | Ga0070679_100033431 | Ga0070679_1000334316 | 352 |
| 516 | 3300005530 | Ga0070679_100068070 | Ga0070679_1000680703 | 352 |
| 517 | 3300005535 | Ga0070684_100000344 | Ga0070684_1000003444 | 352 |
| 518 | 3300005535 | Ga0070684_100020450 | Ga0070684_1000204504 | 352 |
| 519 | 3300005535 | Ga0070684_100099580 | Ga0070684_1000995802 | 352 |
| 520 | 3300005535 | Ga0070684_100182681 | Ga0070684_1001826811 | 352 |
| 521 | 3300005536 | Ga0070697_100000919 | Ga0070697_1000009199 | 352 |
| 522 | 3300005536 | Ga0070697_100212464 | Ga0070697_1002124642 | 352 |
| 523 | 3300005543 | Ga0070672_100066961 | Ga0070672_1000669613 | 352 |
| 524 | 3300005544 | Ga0070686_100001318 | Ga0070686_1000013184 | 352 |
| 525 | 3300005544 | Ga0070686_100071377 | Ga0070686_1000713772 | 352 |
| 526 | 3300005548 | Ga0070665_100035904 | Ga0070665_1000359043 | 352 |
| 527 | 3300005563 | Ga0068855_100370933 | Ga0068855_1003709332 | 352 |
| 528 | 3300005564 | Ga0070664_100062150 | Ga0070664_1000621502 | 352 |
| 529 | 3300005577 | Ga0068857_100148049 | Ga0068857_1001480491 | 352 |
| 530 | 3300005578 | Ga0068854_100003346 | Ga0068854_1000033464 | 352 |
| 531 | 3300005614 | Ga0068856_100007184 | Ga0068856_1000071846 | 352 |
| 532 | 3300005614 | Ga0068856_100078338 | Ga0068856_1000783383 | 352 |
| 533 | 3300005615 | Ga0070702_100082104 | Ga0070702_1000821042 | 352 |
| 534 | 3300005617 | Ga0068859_100173982 | Ga0068859_1001739822 | 352 |
| 535 | 3300005618 | Ga0068864_100043576 | Ga0068864_1000435763 | 352 |
| 536 | 3300005841 | Ga0068863_100001547 | Ga0068863_10000154710 | 352 |
| 537 | 3300005842 | Ga0068858_100003324 | Ga0068858_1000033245 | 352 |
| 538 | 3300005842 | Ga0068858_100402528 | Ga0068858_1004025281 | 352 |
| 539 | 3300005843 | Ga0068860_100024202 | Ga0068860_1000242025 | 352 |
| 540 | 3300005843 | Ga0068860_100024497 | Ga0068860_1000244972 | 352 |
| 541 | 3300005937 | Ga0081455_10000878 | Ga0081455_1000087820 | 352 |
| 542 | 3300005937 | Ga0081455_10004775 | Ga0081455_1000477511 | 352 |
| 543 | 3300005937 | Ga0081455_10026476 | Ga0081455_100264765 | 352 |
| 544 | 3300005983 | Ga0081540_1058468 | Ga0081540_10584682 | 352 |
| 545 | 3300005985 | Ga0081539_10000138 | Ga0081539_1000013810 | 352 |
| 546 | 3300005985 | Ga0081539_10001786 | Ga0081539_1000178618 | 352 |
| 547 | 3300005985 | Ga0081539_10014279 | Ga0081539_100142792 | 352 |
| 548 | 3300006028 | Ga0070717_10007906 | Ga0070717_100079066 | 352 |
| 549 | 3300006028 | Ga0070717_10385665 | Ga0070717_103856651 | 352 |
| 550 | 3300006173 | Ga0070716_100076322 | Ga0070716_1000763223 | 352 |
| 551 | 3300006175 | Ga0070712_100012358 | Ga0070712_1000123583 | 352 |
| 552 | 3300006175 | Ga0070712_100175589 | Ga0070712_1001755892 | 352 |
| 553 | 3300006358 | Ga0068871_100034943 | Ga0068871_1000349432 | 352 |
| 554 | 3300006844 | Ga0075428_100008564 | Ga0075428_1000085642 | 352 |
| 555 | 3300006871 | Ga0075434_100164307 | Ga0075434_1001643072 | 352 |
| 556 | 3300006881 | Ga0068865_100042150 | Ga0068865_1000421502 | 352 |
| 557 | 3300006914 | Ga0075436_100102150 | Ga0075436_1001021501 | 352 |
| 558 | 3300006931 | Ga0097620_100173995 | Ga0097620_1001739952 | 352 |
| 559 | 3300007076 | Ga0075435_100336794 | Ga0075435_1003367942 | 352 |
| 560 | 3300009093 | Ga0105240_10177880 | Ga0105240_101778801 | 352 |
| 561 | 3300009094 | Ga0111539_10162842 | Ga0111539_101628422 | 352 |
| 562 | 3300009098 | Ga0105245_10002646 | Ga0105245_100026469 | 352 |
| 563 | 3300009098 | Ga0105245_10292919 | Ga0105245_102929191 | 352 |
| 564 | 3300009101 | Ga0105247_10057996 | Ga0105247_100579962 | 352 |
| 565 | 3300009147 | Ga0114129_10615890 | Ga0114129_106158902 | 352 |
| 566 | 3300009174 | Ga0105241_10053365 | Ga0105241_100533652 | 352 |
| 567 | 3300009176 | Ga0105242_10035345 | Ga0105242_100353453 | 352 |
| 568 | 3300009177 | Ga0105248_10058920 | Ga0105248_100589203 | 352 |
| 569 | 3300009553 | Ga0105249_10293578 | Ga0105249_102935781 | 352 |
| 570 | 3300010375 | Ga0105239_10360545 | Ga0105239_103605452 | 352 |
| 571 | 3300011119 | Ga0105246_10052091 | Ga0105246_100520914 | 352 |
| 572 | 3300013105 | Ga0157369_10181276 | Ga0157369_101812762 | 352 |
| 573 | 3300013296 | Ga0157374_10002924 | Ga0157374_100029243 | 352 |
| 574 | 3300013296 | Ga0157374_10008085 | Ga0157374_100080853 | 352 |
| 575 | 3300013296 | Ga0157374_10111312 | Ga0157374_101113122 | 352 |
| 576 | 3300013297 | Ga0157378_10002051 | Ga0157378_100020518 | 352 |
| 577 | 3300013297 | Ga0157378_10006138 | Ga0157378_100061383 | 352 |
| 578 | 3300013297 | Ga0157378_10017866 | Ga0157378_100178665 | 352 |
| 579 | 3300013297 | Ga0157378_10462137 | Ga0157378_104621372 | 352 |
| 580 | 3300013306 | Ga0163162_10010416 | Ga0163162_100104162 | 352 |
| 581 | 3300013308 | Ga0157375_10003763 | Ga0157375_100037634 | 352 |
| 582 | 3300013308 | Ga0157375_10069598 | Ga0157375_100695982 | 352 |
| 583 | 3300013308 | Ga0157375_10490189 | Ga0157375_104901892 | 352 |
| 584 | 3300014325 | Ga0163163_10084342 | Ga0163163_100843422 | 352 |
| 585 | 3300014745 | Ga0157377_10007781 | Ga0157377_100077814 | 352 |
| 586 | 3300014745 | Ga0157377_10038886 | Ga0157377_100388863 | 352 |
| 587 | 3300014969 | Ga0157376_10011942 | Ga0157376_100119425 | 352 |
| 588 | 3300014969 | Ga0157376_10024206 | Ga0157376_100242065 | 352 |
| 589 | 3300014969 | Ga0157376_10087585 | Ga0157376_100875853 | 352 |
| 590 | 3300014969 | Ga0157376_10117520 | Ga0157376_101175202 | 352 |
| 591 | 3300020080 | Ga0206350_11484488 | Ga0206350_114844882 | 352 |
| 592 | 3300022467 | Ga0224712_10000396 | Ga0224712_100003962 | 352 |
| 593 | 3300025290 | Ga0207673_1002046 | Ga0207673_10020462 | 352 |
| 594 | 3300025315 | Ga0207697_10000218 | Ga0207697_1000021820 | 352 |
| 595 | 3300025315 | Ga0207697_10000653 | Ga0207697_100006538 | 352 |
| 596 | 3300025315 | Ga0207697_10000931 | Ga0207697_100009317 | 352 |
| 597 | 3300025321 | Ga0207656_10114981 | Ga0207656_101149812 | 352 |
| 598 | 3300025903 | Ga0207680_10067711 | Ga0207680_100677112 | 352 |
| 599 | 3300025903 | Ga0207680_10095094 | Ga0207680_100950942 | 352 |
| 600 | 3300025904 | Ga0207647_10007107 | Ga0207647_100071075 | 352 |
| 601 | 3300025910 | Ga0207684_10008585 | Ga0207684_100085851 | 352 |
| 602 | 3300025910 | Ga0207684_10030332 | Ga0207684_100303324 | 352 |
| 603 | 3300025910 | Ga0207684_10048304 | Ga0207684_100483043 | 352 |
| 604 | 3300025910 | Ga0207684_10224653 | Ga0207684_102246531 | 352 |
| 605 | 3300025910 | Ga0207684_10328179 | Ga0207684_103281792 | 352 |
| 606 | 3300025911 | Ga0207654_10047896 | Ga0207654_100478962 | 352 |
| 607 | 3300025912 | Ga0207707_10007665 | Ga0207707_100076654 | 352 |
| 608 | 3300025915 | Ga0207693_10019169 | Ga0207693_100191693 | 352 |
| 609 | 3300025915 | Ga0207693_10245249 | Ga0207693_102452491 | 352 |
| 610 | 3300025918 | Ga0207662_10057219 | Ga0207662_100572192 | 352 |
| 611 | 3300025919 | Ga0207657_10046056 | Ga0207657_100460562 | 352 |
| 612 | 3300025920 | Ga0207649_10031067 | Ga0207649_100310671 | 352 |
| 613 | 3300025920 | Ga0207649_10038413 | Ga0207649_100384132 | 352 |
| 614 | 3300025921 | Ga0207652_10019090 | Ga0207652_100190903 | 352 |
| 615 | 3300025921 | Ga0207652_10042839 | Ga0207652_100428393 | 352 |
| 616 | 3300025922 | Ga0207646_10000108 | Ga0207646_1000010898 | 352 |
| 617 | 3300025922 | Ga0207646_10001652 | Ga0207646_1000165212 | 352 |
| 618 | 3300025922 | Ga0207646_10011599 | Ga0207646_100115993 | 352 |
| 619 | 3300025922 | Ga0207646_10022496 | Ga0207646_100224965 | 352 |
| 620 | 3300025922 | Ga0207646_10074972 | Ga0207646_100749723 | 352 |
| 621 | 3300025922 | Ga0207646_10091277 | Ga0207646_100912772 | 352 |
| 622 | 3300025926 | Ga0207659_10026094 | Ga0207659_100260942 | 352 |
| 623 | 3300025926 | Ga0207659_10040426 | Ga0207659_100404262 | 352 |
| 624 | 3300025927 | Ga0207687_10004999 | Ga0207687_100049996 | 352 |
| 625 | 3300025931 | Ga0207644_10062620 | Ga0207644_100626203 | 352 |
| 626 | 3300025931 | Ga0207644_10136420 | Ga0207644_101364202 | 352 |
| 627 | 3300025932 | Ga0207690_10071060 | Ga0207690_100710603 | 352 |
| 628 | 3300025936 | Ga0207670_10011099 | Ga0207670_100110995 | 352 |
| 629 | 3300025939 | Ga0207665_10089264 | Ga0207665_100892642 | 352 |
| 630 | 3300025942 | Ga0207689_10002161 | Ga0207689_1000216116 | 352 |
| 631 | 3300025944 | Ga0207661_10008469 | Ga0207661_100084692 | 352 |
| 632 | 3300025944 | Ga0207661_10034524 | Ga0207661_100345243 | 352 |
| 633 | 3300025944 | Ga0207661_10065885 | Ga0207661_100658851 | 352 |
| 634 | 3300025945 | Ga0207679_10028605 | Ga0207679_100286052 | 352 |
| 635 | 3300025949 | Ga0207667_10299460 | Ga0207667_102994602 | 352 |
| 636 | 3300025972 | Ga0207668_10106167 | Ga0207668_101061672 | 352 |
| 637 | 3300025981 | Ga0207640_10155817 | Ga0207640_101558172 | 352 |
| 638 | 3300025986 | Ga0207658_10063848 | Ga0207658_100638482 | 352 |
| 639 | 3300026023 | Ga0207677_10010204 | Ga0207677_100102042 | 352 |
| 640 | 3300026023 | Ga0207677_10073018 | Ga0207677_100730182 | 352 |
| 641 | 3300026035 | Ga0207703_10004158 | Ga0207703_1000415813 | 352 |
| 642 | 3300026035 | Ga0207703_10040016 | Ga0207703_100400163 | 352 |
| 643 | 3300026035 | Ga0207703_10349997 | Ga0207703_103499972 | 352 |
| 644 | 3300026067 | Ga0207678_10121444 | Ga0207678_101214442 | 352 |
| 645 | 3300026067 | Ga0207678_10125800 | Ga0207678_101258002 | 352 |
| 646 | 3300026075 | Ga0207708_10046432 | Ga0207708_100464323 | 352 |
| 647 | 3300026078 | Ga0207702_10006523 | Ga0207702_100065236 | 352 |
| 648 | 3300026088 | Ga0207641_10057885 | Ga0207641_100578854 | 352 |
| 649 | 3300026088 | Ga0207641_10064296 | Ga0207641_100642963 | 352 |
| 650 | 3300026089 | Ga0207648_10011222 | Ga0207648_100112223 | 352 |
| 651 | 3300026095 | Ga0207676_10037434 | Ga0207676_100374343 | 352 |
| 652 | 3300026116 | Ga0207674_10073915 | Ga0207674_100739153 | 352 |
| 653 | 3300026116 | Ga0207674_10228565 | Ga0207674_102285652 | 352 |
| 654 | 3300026121 | Ga0207683_10014124 | Ga0207683_100141245 | 352 |
| 655 | 3300027907 | Ga0207428_10109092 | Ga0207428_101090922 | 352 |
| 656 | 3300028016 | Ga0265354_1002414 | Ga0265354_10024142 | 352 |
| 657 | 3300028379 | Ga0268266_10051158 | Ga0268266_100511584 | 352 |
| 658 | 3300028379 | Ga0268266_10071700 | Ga0268266_100717002 | 352 |
| 659 | 3300028379 | Ga0268266_10355927 | Ga0268266_103559273 | 352 |
| 660 | 3300028381 | Ga0268264_10002175 | Ga0268264_1000217511 | 352 |
| 661 | 3300031456 | Ga0307513_10084123 | Ga0307513_100841233 | 352 |
| 662 | 3300031507 | Ga0307509_10026563 | Ga0307509_100265632 | 352 |
| 663 | 3300031507 | Ga0307509_10161092 | Ga0307509_101610923 | 352 |
| 664 | 3300031548 | Ga0307408_100079087 | Ga0307408_1000790872 | 352 |
| 665 | 3300031730 | Ga0307516_10000246 | Ga0307516_1000024630 | 352 |
| 666 | 3300031730 | Ga0307516_10093224 | Ga0307516_100932243 | 352 |
| 667 | 3300035120 | Ga0373957_0039621 | Ga0373957_0039621_237_1343 | 352 |
| 668 | 3300035692 | Ga0373935_0019215 | Ga0373935_0019215_943_2049 | 352 |
| 669 | 3300035695 | Ga0373927_0003847 | Ga0373927_0003847_4771_5877 | 352 |
| 670 | 3300036401 | Ga0373937_0082721 | Ga0373937_0082721_1778_2884 | 352 |
| 671 | 3300037418 | Ga0395900_0002199 | Ga0395900_0002199_5719_6780 | 352 |
| 672 | 3300037466 | Ga0395898_0010931 | Ga0395898_0010931_6698_7759 | 352 |
| 673 | 3300037471 | Ga0395905_0013608 | Ga0395905_0013608_6190_7251 | 352 |
| 674 | 3300038443 | Ga0395901_0001234 | Ga0395901_0001234_20712_21773 | 352 |
| 675 | 3300038443 | Ga0395901_0022192 | Ga0395901_0022192_2724_3785 | 352 |
| 676 | 3300039062 | Ga0400483_021979 | Ga0400483_021979_23982_25052 | 352 |
| 677 | 3300039062 | Ga0400483_162332 | Ga0400483_162332_23976_25046 | 352 |
| 678 | 3300039447 | Ga0436361_0301618 | Ga0436361_0301618_1901_2980 | 352 |
| 679 | 3300039447 | Ga0436361_1038034 | Ga0436361_1038034_7249_8361 | 352 |
| 680 | 3300041999 | Ga0439433_0016924 | Ga0439433_0016924_289_1359 | 352 |
| 681 | 3300044673 | Ga0453683_0003589 | Ga0453683_0003589_3438_4505 | 352 |
| 682 | 3300045051 | Ga0451576_0014850 | Ga0451576_0014850_343_1410 | 352 |
| 683 | 3300045051 | Ga0451576_0021161 | Ga0451576_0021161_1393_2481 | 352 |
| 684 | 3300045976 | Ga0466967_0000138 | Ga0466967_0000138_6028_7146 | 352 |
| 685 | 3300046454 | Ga0495592_0114261 | Ga0495592_0114261_136_1242 | 352 |
| 686 | 3300046461 | Ga0495641_0063025 | Ga0495641_0063025_288_1352 | 352 |
| 687 | 3300046462 | Ga0495651_0004272 | Ga0495651_0004272_839_1945 | 352 |
| 688 | 3300046463 | Ga0495653_0025443 | Ga0495653_0025443_1185_2291 | 352 |
| 689 | 3300046472 | Ga0495580_0008029 | Ga0495580_0008029_6523_7629 | 352 |
| 690 | 3300046473 | Ga0495582_0071734 | Ga0495582_0071734_266_1330 | 352 |
| 691 | 3300046516 | Ga0495628_0073153 | Ga0495628_0073153_1055_2161 | 352 |
| 692 | 3300046517 | Ga0495630_0005350 | Ga0495630_0005350_6602_7708 | 352 |
| 693 | 3300046531 | Ga0495665_0000454 | Ga0495665_0000454_1993_3099 | 352 |
| 694 | 3300046543 | Ga0495645_0046588 | Ga0495645_0046588_518_1624 | 352 |
| 695 | 3300046642 | Ga0495634_0000838 | Ga0495634_0000838_28135_29241 | 352 |
| 696 | 3300046675 | Ga0495657_0005388 | Ga0495657_0005388_1450_2556 | 352 |
| 697 | 3300046680 | Ga0495646_0002154 | Ga0495646_0002154_4529_5635 | 352 |
| 698 | 3300046689 | Ga0495613_0030415 | Ga0495613_0030415_2858_3964 | 352 |
| 699 | 3300046690 | Ga0495624_0008216 | Ga0495624_0008216_2726_3832 | 352 |
| 700 | 3300047315 | Ga0495581_0023765 | Ga0495581_0023765_404_1468 | 352 |
| 701 | 3300047317 | Ga0495604_0024946 | Ga0495604_0024946_951_2057 | 352 |
| 702 | 3300047319 | Ga0495674_0005650 | Ga0495674_0005650_8175_9281 | 352 |
| 703 | 3300047444 | Ga0495675_0000865 | Ga0495675_0000865_15683_16789 | 352 |
| 704 | 3300047673 | Ga0495593_0015748 | Ga0495593_0015748_2685_3791 | 352 |
| 705 | 3300048088 | Ga0495602_0065594 | Ga0495602_0065594_364_1470 | 352 |
| 706 | 3300048089 | Ga0495614_0008037 | Ga0495614_0008037_1433_2539 | 352 |
| 707 | 3300048905 | Ga0496102_0068149 | Ga0496102_0068149_1558_2661 | 352 |
| 708 | 3300048905 | Ga0496102_0282475 | Ga0496102_0282475_77_1270 | 352 |
| 709 | 3300048906 | Ga0496103_0011399 | Ga0496103_0011399_2809_3912 | 352 |
| 710 | 3300048907 | Ga0496104_0006256 | Ga0496104_0006256_1453_2556 | 352 |
| 711 | 3300048907 | Ga0496104_0042147 | Ga0496104_0042147_2051_3136 | 352 |
| 712 | 3300048907 | Ga0496104_0070285 | Ga0496104_0070285_1257_2318 | 352 |
| 713 | 3300048907 | Ga0496104_0167390 | Ga0496104_0167390_850_1956 | 352 |
| 714 | 3300048909 | Ga0496106_0078382 | Ga0496106_0078382_1167_2228 | 352 |
| 715 | 3300048909 | Ga0496106_0234622 | Ga0496106_0234622_262_1329 | 352 |
| 716 | 3300048911 | Ga0496108_0025876 | Ga0496108_0025876_1889_2950 | 352 |
| 717 | 3300048913 | Ga0496110_0350734 | Ga0496110_0350734_225_1301 | 352 |
| 718 | 3300048914 | Ga0496111_0054176 | Ga0496111_0054176_701_1768 | 352 |
| 719 | 3300048915 | Ga0496112_0001254 | Ga0496112_0001254_12052_13137 | 352 |
| 720 | 3300048915 | Ga0496112_0107618 | Ga0496112_0107618_1052_2113 | 352 |
| 721 | 3300048917 | Ga0496114_0000687 | Ga0496114_0000687_9609_10712 | 352 |
| 722 | 3300048917 | Ga0496114_0012761 | Ga0496114_0012761_2799_3860 | 352 |
| 723 | 3300048918 | Ga0496115_0178257 | Ga0496115_0178257_149_1210 | 352 |
| 724 | 3300049574 | Ga0501038_0070765 | Ga0501038_0070765_1168_2244 | 352 |
| 725 | 3300049587 | Ga0501071_0107275 | Ga0501071_0107275_480_1547 | 352 |
| 726 | 3300049592 | Ga0501076_0069462 | Ga0501076_0069462_831_1898 | 352 |
| 727 | 3300049743 | Ga0501081_0134592 | Ga0501081_0134592_641_1708 | 352 |
| 728 | 3300049824 | Ga0501045_0049495 | Ga0501045_0049495_1769_2836 | 352 |
| 729 | 3300050507 | nmdc:mga05p37_51110_c1 | nmdc:mga05p37_51110_c1_2067_3149 | 352 |
| 730 | 3300050509 | nmdc:mga0qj67_148751_c1 | nmdc:mga0qj67_148751_c1_193_1266 | 352 |
| 731 | 3300050511 | nmdc:mga08y16_143040_c1 | nmdc:mga08y16_143040_c1_192_1265 | 352 |
| 732 | 3300050512 | nmdc:mga0n895_226967_c1 | nmdc:mga0n895_226967_c1_414_1496 | 352 |
| 733 | 3300050513 | nmdc:mga0rr50_128855_c1 | nmdc:mga0rr50_128855_c1_695_1777 | 352 |
| 734 | 3300053077 | Ga0495601_0037793 | Ga0495601_0037793_389_1465 | 352 |
| 735 | 3300053078 | Ga0495612_0006562 | Ga0495612_0006562_2881_3987 | 352 |
| 736 | 3300053085 | Ga0495619_0177120 | Ga0495619_0177120_203_1285 | 352 |
| 737 | 3300053088 | Ga0500644_0000169 | Ga0500644_0000169_19523_20584 | 352 |
| 738 | 3300053153 | Ga0500616_0017460 | Ga0500616_0017460_149_1222 | 352 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1orr-assembly3.cif.gz_C | crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp | 0.9395 | 3 | 350 |
| 1orr-assembly1.cif.gz_A | crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp | 0.9319 | 3 | 350 |
| 1orr-assembly3.cif.gz_C | crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp | 0.9314 | 3 | 350 |
| 1orr-assembly2.cif.gz_D | crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp | 0.9292 | 3 | 350 |
| 1orr-assembly1.cif.gz_A | crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp | 0.9239 | 3 | 350 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1orrD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9292 | 3 | 350 | 3.40.50.720 |
| 1orrD00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9212 | 3 | 350 | 3.40.50.720 |
| af_Q2G289_4_319_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.918 | 1 | 351 | 3.40.50.720 |
| af_B5BM30_1_361_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9114 | 1 | 33 | 3.50.50.60 |
| af_Q2G289_4_319_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9013 | 1 | 351 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V5N5E8-F1-model_v4 | NAD-dependent epimerase | 0.9973 | 1 | 349 |
|
| AF-A0A2V6DPF0-F1-model_v4 | NAD-dependent epimerase | 0.9955 | 1 | 348 |
|
| AF-A0A7W1JDD0-F1-model_v4 | NAD-dependent epimerase/dehydratase family protein | 0.9954 | 1 | 350 |
|
| AF-A0A7C8BED1-F1-model_v4 | deleted | 0.9935 | 1 | 347 |
|
| AF-A0A1F4UQD2-F1-model_v4 | NAD-dependent epimerase/dehydratase domain-containing protein | 0.9933 | 2 | 348 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar