F478387

General Info

Members Datasets Scaffolds Average Seq Length
738 327 733 355

Family's Representative Sequence

Representative Sequence 3300013297|Ga0157378_10002051|Ga0157378_100020518
Length 397
Sequence MVTDRRRSATAAPKKKQHARFYRSGRNQKLSVAIITGSAGLVGSEAVAYFDSLGMDVVGIDNGMRAEFFGPDASTAWVRDQLTRDLPAYRHYEVDIRDAAAIDRVFEHYGSDVSLIVHTAAQPSHDWAASNPTLDFTVNANGTSVLLEATRKFAHDAVFIFTSTNKVYGDTPNHLPLVEQGTRWELDPSHPYAKNGIPETMSIDHTTHSLFGASKVAADVLVQEYGRYFGMKTACFRGGCLTGPRHSGTQLHGFLAYLMKCAVTRAPYSIFGYKKKQVRDNIHSADLIQAFHEFFKKPRSGEVYNIGGGRFSNCSMLEAITICEQITAKPFNSRYIDQNRRGDHIWWISDISRFQEHYPEWKLRYNVQQILQEIFEFNSERWAQQCVMPANEMSSVS

Samples

Sample ID Description Type Environment
1 2522125168 Dyadobacter beijingensis DSM 21582 Isolate Rhizosphere
2 2597490356 Azospirillum brasilense sp7 Isolate Unclassified
3 2842333319 Skermanella aerolata SEMIA 4010 Isolate Nodule
4 2846952575 Azospirillum brasilense sp7 Isolate Unclassified
5 2886627955 Nostoc sp. PA-18-2419 JC1668 Isolate Unclassified
6 3300000545 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNX_Illumina_Assembled Metagenome Rhizosphere
7 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
8 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
104 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
106 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
107 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
109 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
110 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
111 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
112 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
113 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
114 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
115 3300009986 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_92 metaG Metagenome Rhizosphere
116 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
117 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
132 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
188 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
189 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
192 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
193 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
194 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
195 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
196 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
197 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
198 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
199 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
200 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
201 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
202 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
203 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
208 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
209 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
210 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
211 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
212 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
213 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
217 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
218 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
219 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
222 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
223 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
224 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
227 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
228 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
229 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
230 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
231 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
234 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
235 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
236 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
237 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
238 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
239 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
242 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
243 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
244 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
245 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
246 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
247 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
250 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
251 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
252 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
253 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
254 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
257 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
258 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
259 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
260 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
261 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
262 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
263 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
264 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
265 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
266 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
267 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
268 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
269 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
270 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
271 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
272 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
273 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
274 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
275 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
276 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
277 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
278 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
279 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
280 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
281 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
282 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
283 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
284 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
285 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
286 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
287 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
288 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
289 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
290 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
291 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
292 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
294 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
295 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
296 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
297 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
298 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
299 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
300 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
301 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
302 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
303 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
307 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
308 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
309 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
310 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
311 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
312 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
313 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
314 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
315 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
316 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
317 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
318 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
319 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
320 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
321 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
322 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
323 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
327 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.64
Metatranscriptomes 0.68
Isolates 0.68

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.3
Nodule 0.14
Rhizoplane 7.05
Rhizosphere 87.4
Stem 0
Stem Tuber 0
Unclassified 3.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 CNXas_1000073 3300000545 Bacteria 18932
2 JGI24744J21845_10005804 3300002077 Bacteria 2557
3 JGI25406J46586_10000369 3300003203 Bacteria 20510
4 rootH2_10009286 3300003320 Bacteria 19164
5 rootH2_10100298 3300003320 Bacteria 7832
6 rootH1_10035324 3300003323 Bacteria 2761
7 JGI25405J52794_10000207 3300003911 Bacteria 7675
8 Ga0065712_10001564 3300005290 Bacteria 8859
9 Ga0065712_10013148 3300005290 Bacteria 3778
10 Ga0065715_10091643 3300005293 Bacteria 5650
11 Ga0065715_10092928 3300005293 Bacteria 4860
12 Ga0065715_10219712 3300005293 Unclassified 1265
13 Ga0070658_10078072 3300005327 Bacteria 2717
14 Ga0070676_10006864 3300005328 Bacteria 6095
15 Ga0070676_10037383 3300005328 Bacteria 2800
16 Ga0070676_10083705 3300005328 Bacteria 1941
17 Ga0070676_10206219 3300005328 Bacteria 1291
18 Ga0070683_100001907 3300005329 Bacteria 16311
19 Ga0070683_100007984 3300005329 Bacteria 8980
20 Ga0070683_100022218 3300005329 Bacteria 5668
21 Ga0070683_100029152 3300005329 Bacteria 4994
22 Ga0070683_100037248 3300005329 Bacteria 4452
23 Ga0070683_100227488 3300005329 Bacteria 1773
24 Ga0070690_100070718 3300005330 Bacteria 2266
25 Ga0070670_100013375 3300005331 Bacteria 7030
26 Ga0070670_100029305 3300005331 Bacteria 4737
27 Ga0070670_100061195 3300005331 Bacteria 3232
28 Ga0070670_100182137 3300005331 Bacteria 1824
29 Ga0070670_100316589 3300005331 Bacteria 1366
30 Ga0070677_10000019 3300005333 Bacteria 50177
31 Ga0070666_10027666 3300005335 Unclassified 3716
32 Ga0070666_10044470 3300005335 Bacteria 2975
33 Ga0070666_10147834 3300005335 Bacteria 1639
34 Ga0070680_100023414 3300005336 Bacteria 4925
35 Ga0070682_100000038 3300005337 Bacteria 145670
36 Ga0070682_100032067 3300005337 Bacteria 3183
37 Ga0068868_100000175 3300005338 Bacteria 42576
38 Ga0068868_100041506 3300005338 Bacteria 3585
39 Ga0068868_100097874 3300005338 Bacteria 2371
40 Ga0070660_100045727 3300005339 Bacteria 3353
41 Ga0070689_100005164 3300005340 Bacteria 8886
42 Ga0070689_100042520 3300005340 Unclassified 3489
43 Ga0070687_100037721 3300005343 Bacteria 2418
44 Ga0070661_100006819 3300005344 Bacteria 7871
45 Ga0070661_100071430 3300005344 Unclassified 2554
46 Ga0070692_10042972 3300005345 Bacteria 2323
47 Ga0070668_100004408 3300005347 Bacteria 10449
48 Ga0070668_100036794 3300005347 Bacteria 3735
49 Ga0070668_100038018 3300005347 Bacteria 3677
50 Ga0070668_100124081 3300005347 Bacteria 2067
51 Ga0070668_100362721 3300005347 Bacteria 1229
52 Ga0070669_100007368 3300005353 Bacteria 7889
53 Ga0070669_100187502 3300005353 Bacteria 1621
54 Ga0070675_100075480 3300005354 Bacteria 2802
55 Ga0070675_100076838 3300005354 Bacteria 2778
56 Ga0070675_100122963 3300005354 Bacteria 2206
57 Ga0070675_100138321 3300005354 Unclassified 2080
58 Ga0070675_100219622 3300005354 Unclassified 1655
59 Ga0070671_100001678 3300005355 Bacteria 16768
60 Ga0070671_100011983 3300005355 Bacteria 6976
61 Ga0070671_100061335 3300005355 Bacteria 3132
62 Ga0070671_100162797 3300005355 Bacteria 1886
63 Ga0070674_100002857 3300005356 Bacteria 9548
64 Ga0070674_100166049 3300005356 Bacteria 1679
65 Ga0070673_100053177 3300005364 Bacteria 3179
66 Ga0070673_100053282 3300005364 Bacteria 3176
67 Ga0070688_100005768 3300005365 Bacteria 6545
68 Ga0070688_100021547 3300005365 Bacteria 3766
69 Ga0070688_100021782 3300005365 Unclassified 3748
70 Ga0070659_100141064 3300005366 Bacteria 1962
71 Ga0070659_100150669 3300005366 Bacteria 1897
72 Ga0070659_100163925 3300005366 Bacteria 1818
73 Ga0070659_100200576 3300005366 Bacteria 1642
74 Ga0070659_100221066 3300005366 Bacteria 1563
75 Ga0070659_100241615 3300005366 Unclassified 1495
76 Ga0070667_100006508 3300005367 Bacteria 9712
77 Ga0070667_100080404 3300005367 Bacteria 2788
78 Ga0070667_100267638 3300005367 Unclassified 1531
79 Ga0070703_10002069 3300005406 Bacteria 5851
80 Ga0070709_10132184 3300005434 Bacteria 1705
81 Ga0070714_100101567 3300005435 Bacteria 2534
82 Ga0070714_100138695 3300005435 Bacteria 2180
83 Ga0070714_100156814 3300005435 Unclassified 2056
84 Ga0070714_100395054 3300005435 Bacteria 1306
85 Ga0070713_100393615 3300005436 Unclassified 1293
86 Ga0070711_100010643 3300005439 Bacteria 5699
87 Ga0070711_100397969 3300005439 Unclassified 1117
88 Ga0070705_100001340 3300005440 Bacteria 13136
89 Ga0070705_100007247 3300005440 Bacteria 5454
90 Ga0070705_100023189 3300005440 Bacteria 3329
91 Ga0070705_100026056 3300005440 Bacteria 3179
92 Ga0070705_100064945 3300005440 Bacteria 2183
93 Ga0070700_100024189 3300005441 Bacteria 3563
94 Ga0070700_100041186 3300005441 Bacteria 2831
95 Ga0070694_100051621 3300005444 Bacteria 2777
96 Ga0070694_100056974 3300005444 Bacteria 2656
97 Ga0070694_100205260 3300005444 Bacteria 1471
98 Ga0070708_100001595 3300005445 Bacteria 17380
99 Ga0070708_100008010 3300005445 Bacteria 8465
100 Ga0070708_100021006 3300005445 Bacteria 5513
101 Ga0070708_100059545 3300005445 Unclassified 3405
102 Ga0070708_100059876 3300005445 Bacteria 3397
103 Ga0070708_100229856 3300005445 Bacteria 1740
104 Ga0070708_100246506 3300005445 Bacteria 1678
105 Ga0070708_100386765 3300005445 Bacteria 1319
106 Ga0070663_100013528 3300005455 Bacteria 5209
107 Ga0070663_100037099 3300005455 Bacteria 3391
108 Ga0070663_100095086 3300005455 Bacteria 2214
109 Ga0070678_100000223 3300005456 Bacteria 25656
110 Ga0070678_100002366 3300005456 Bacteria 10305
111 Ga0070678_100092441 3300005456 Bacteria 2324
112 Ga0070662_100000015 3300005457 Bacteria 109379
113 Ga0070662_100058946 3300005457 Unclassified 2795
114 Ga0070681_10005422 3300005458 Bacteria 12322
115 Ga0070681_10036443 3300005458 Bacteria 4939
116 Ga0070681_10041890 3300005458 Bacteria 4590
117 Ga0070681_10134823 3300005458 Bacteria 2400
118 Ga0068867_100000715 3300005459 Bacteria 22149
119 Ga0070685_10080065 3300005466 Bacteria 1956
120 Ga0070685_10082671 3300005466 Bacteria 1928
121 Ga0070706_100000703 3300005467 Bacteria 37785
122 Ga0070706_100006643 3300005467 Bacteria 10911
123 Ga0070706_100008103 3300005467 Bacteria 9799
124 Ga0070706_100023506 3300005467 Bacteria 5677
125 Ga0070706_100026208 3300005467 Bacteria 5365
126 Ga0070706_100047895 3300005467 Bacteria 3945
127 Ga0070706_100271144 3300005467 Bacteria 1584
128 Ga0070706_100362112 3300005467 Bacteria 1351
129 Ga0070707_100001078 3300005468 Bacteria 26952
130 Ga0070707_100001458 3300005468 Bacteria 23150
131 Ga0070707_100001955 3300005468 Bacteria 19734
132 Ga0070707_100004157 3300005468 Bacteria 13570
133 Ga0070707_100014990 3300005468 Bacteria 7275
134 Ga0070707_100044119 3300005468 Bacteria 4268
135 Ga0070707_100055268 3300005468 Bacteria 3806
136 Ga0070707_100069262 3300005468 Bacteria 3397
137 Ga0070707_100129082 3300005468 Bacteria 2457
138 Ga0070707_100280139 3300005468 Bacteria 1620
139 Ga0070698_100000390 3300005471 Bacteria 46125
140 Ga0070698_100001334 3300005471 Bacteria 27461
141 Ga0070698_100020103 3300005471 Bacteria 6998
142 Ga0070698_100186388 3300005471 Unclassified 2013
143 Ga0070699_100050680 3300005518 Bacteria 3595
144 Ga0070679_100033431 3300005530 Bacteria 5092
145 Ga0070679_100068070 3300005530 Bacteria 3552
146 Ga0070684_100000344 3300005535 Bacteria 31949
147 Ga0070684_100017106 3300005535 Bacteria 5945
148 Ga0070684_100020450 3300005535 Bacteria 5491
149 Ga0070684_100099580 3300005535 Unclassified 2594
150 Ga0070684_100152737 3300005535 Bacteria 2092
151 Ga0070684_100182681 3300005535 Bacteria 1907
152 Ga0070684_100186978 3300005535 Bacteria 1884
153 Ga0070697_100000919 3300005536 Bacteria 22165
154 Ga0070697_100007362 3300005536 Bacteria 8564
155 Ga0070697_100212464 3300005536 Bacteria 1647
156 Ga0070697_100461651 3300005536 Unclassified 1107
157 Ga0068853_100017443 3300005539 Bacteria 5925
158 Ga0070672_100066961 3300005543 Bacteria 2845
159 Ga0070672_100213329 3300005543 Bacteria 1617
160 Ga0070686_100000888 3300005544 Bacteria 17373
161 Ga0070686_100001318 3300005544 Bacteria 14039
162 Ga0070686_100071377 3300005544 Bacteria 2273
163 Ga0070695_100008308 3300005545 Bacteria 6158
164 Ga0070696_100003721 3300005546 Bacteria 10178
165 Ga0070696_100004339 3300005546 Bacteria 9453
166 Ga0070665_100000128 3300005548 Bacteria 142568
167 Ga0070665_100017536 3300005548 Bacteria 7190
168 Ga0070665_100035838 3300005548 Bacteria 4991
169 Ga0070665_100035904 3300005548 Bacteria 4987
170 Ga0070665_100059648 3300005548 Bacteria 3825
171 Ga0070665_100060085 3300005548 Bacteria 3811
172 Ga0070665_100079543 3300005548 Bacteria 3284
173 Ga0070665_100085019 3300005548 Bacteria 3169
174 Ga0070704_100005325 3300005549 Bacteria 7497
175 Ga0068855_100002299 3300005563 Bacteria 23619
176 Ga0068855_100370933 3300005563 Bacteria 1573
177 Ga0070664_100027843 3300005564 Bacteria 4699
178 Ga0070664_100032306 3300005564 Bacteria 4377
179 Ga0070664_100062150 3300005564 Unclassified 3183
180 Ga0070664_100107705 3300005564 Bacteria 2430
181 Ga0070664_100294407 3300005564 Bacteria 1466
182 Ga0068857_100148049 3300005577 Unclassified 2125
183 Ga0068854_100003346 3300005578 Bacteria 9993
184 Ga0068854_100003697 3300005578 Bacteria 9570
185 Ga0068856_100007184 3300005614 Bacteria 10862
186 Ga0068856_100011239 3300005614 Bacteria 8690
187 Ga0068856_100078338 3300005614 Unclassified 3277
188 Ga0070702_100000916 3300005615 Bacteria 11524
189 Ga0070702_100082104 3300005615 Bacteria 1933
190 Ga0068852_100179456 3300005616 Bacteria 1990
191 Ga0068859_100173982 3300005617 Bacteria 2235
192 Ga0068859_100188411 3300005617 Bacteria 2147
193 Ga0068864_100043576 3300005618 Bacteria 3842
194 Ga0068863_100001547 3300005841 Bacteria 22708
195 Ga0068863_100223332 3300005841 Bacteria 1815
196 Ga0068858_100000350 3300005842 Bacteria 48492
197 Ga0068858_100002632 3300005842 Bacteria 18092
198 Ga0068858_100003324 3300005842 Bacteria 16007
199 Ga0068858_100402528 3300005842 Bacteria 1315
200 Ga0068860_100014730 3300005843 Bacteria 7648
201 Ga0068860_100024202 3300005843 Bacteria 5871
202 Ga0068860_100024497 3300005843 Bacteria 5830
203 Ga0081455_10000878 3300005937 Bacteria 38886
204 Ga0081455_10004775 3300005937 Bacteria 15056
205 Ga0081455_10026476 3300005937 Bacteria 5332
206 Ga0081455_10057205 3300005937 Bacteria 3306
207 Ga0081455_10065977 3300005937 Bacteria 3024
208 Ga0081540_1058468 3300005983 Unclassified 1857
209 Ga0081539_10000138 3300005985 Bacteria 170633
210 Ga0081539_10001786 3300005985 Bacteria 34126
211 Ga0081539_10014279 3300005985 Bacteria 5889
212 Ga0081539_10060037 3300005985 Bacteria 2090
213 Ga0070717_10007906 3300006028 Bacteria 7919
214 Ga0070717_10017338 3300006028 Bacteria 5603
215 Ga0070717_10159927 3300006028 Unclassified 1953
216 Ga0070717_10183326 3300006028 Bacteria 1826
217 Ga0070717_10385665 3300006028 Bacteria 1257
218 Ga0075365_10013500 3300006038 Bacteria 4889
219 Ga0075363_100045800 3300006048 Bacteria 2320
220 Ga0075364_10022473 3300006051 Bacteria 3983
221 Ga0075364_10038715 3300006051 Bacteria 3090
222 Ga0070715_10021115 3300006163 Bacteria 2520
223 Ga0070716_100076322 3300006173 Bacteria 1985
224 Ga0070716_100215999 3300006173 Bacteria 1285
225 Ga0070712_100012358 3300006175 Bacteria 5427
226 Ga0070712_100048470 3300006175 Bacteria 2945
227 Ga0070712_100175589 3300006175 Unclassified 1666
228 Ga0075362_10000244 3300006177 Bacteria 15104
229 Ga0075367_10007814 3300006178 Bacteria 5501
230 Ga0075366_10006890 3300006195 Bacteria 6254
231 Ga0075370_10007318 3300006353 Bacteria 5620
232 Ga0068871_100034943 3300006358 Unclassified 3992
233 Ga0068871_100083337 3300006358 Bacteria 2652
234 Ga0068871_100096981 3300006358 Bacteria 2464
235 Ga0075428_100008564 3300006844 Bacteria 11345
236 Ga0075431_100029302 3300006847 Bacteria 5664
237 Ga0075433_10047972 3300006852 Bacteria 3714
238 Ga0075433_10176167 3300006852 Bacteria 1903
239 Ga0075433_10388799 3300006852 Bacteria 1231
240 Ga0075434_100015067 3300006871 Bacteria 7402
241 Ga0075434_100164307 3300006871 Bacteria 2240
242 Ga0075434_100179330 3300006871 Bacteria 2138
243 Ga0075434_100223102 3300006871 Bacteria 1904
244 Ga0075434_100247959 3300006871 Bacteria 1800
245 Ga0075434_100582846 3300006871 Bacteria 1138
246 Ga0075429_100087768 3300006880 Bacteria 2711
247 Ga0068865_100000203 3300006881 Bacteria 33028
248 Ga0068865_100021256 3300006881 Bacteria 4218
249 Ga0068865_100042150 3300006881 Bacteria 3111
250 Ga0075436_100010401 3300006914 Bacteria 6377
251 Ga0075436_100102150 3300006914 Bacteria 1997
252 Ga0097620_100173995 3300006931 Bacteria 2235
253 Ga0097620_100188414 3300006931 Bacteria 2147
254 Ga0075435_100047618 3300007076 Bacteria 3442
255 Ga0075435_100177325 3300007076 Bacteria 1800
256 Ga0075435_100336794 3300007076 Bacteria 1293
257 Ga0105240_10177880 3300009093 Bacteria 2514
258 Ga0111539_10016882 3300009094 Bacteria 9041
259 Ga0111539_10033172 3300009094 Bacteria 6270
260 Ga0111539_10162842 3300009094 Bacteria 2609
261 Ga0105245_10000077 3300009098 Bacteria 101470
262 Ga0105245_10000246 3300009098 Bacteria 51410
263 Ga0105245_10002646 3300009098 Bacteria 16119
264 Ga0105245_10221003 3300009098 Bacteria 1828
265 Ga0105245_10292919 3300009098 Bacteria 1595
266 Ga0105247_10057996 3300009101 Bacteria 2395
267 Ga0114129_10004513 3300009147 Bacteria 19642
268 Ga0114129_10119986 3300009147 Bacteria 3621
269 Ga0114129_10361700 3300009147 Bacteria 1920
270 Ga0114129_10527339 3300009147 Bacteria 1539
271 Ga0114129_10615890 3300009147 Bacteria 1405
272 Ga0114129_10634874 3300009147 Bacteria 1380
273 Ga0105243_10000600 3300009148 Bacteria 35955
274 Ga0105241_10053365 3300009174 Bacteria 3091
275 Ga0105241_10056481 3300009174 Bacteria 3010
276 Ga0105242_10001272 3300009176 Bacteria 19923
277 Ga0105242_10035345 3300009176 Bacteria 4008
278 Ga0105242_10071099 3300009176 Bacteria 2887
279 Ga0105248_10058920 3300009177 Bacteria 4313
280 Ga0105237_10021575 3300009545 Bacteria 6621
281 Ga0105238_10000014 3300009551 Bacteria 241954
282 Ga0105238_10089756 3300009551 Bacteria 3061
283 Ga0105238_10146222 3300009551 Bacteria 2340
284 Ga0105238_10163660 3300009551 Bacteria 2200
285 Ga0105238_10374926 3300009551 Bacteria 1414
286 Ga0105249_10000007 3300009553 Bacteria 349503
287 Ga0105249_10000159 3300009553 Bacteria 82172
288 Ga0105249_10001010 3300009553 Bacteria 24909
289 Ga0105249_10293578 3300009553 Bacteria 1628
290 Ga0105249_10372227 3300009553 Bacteria 1452
291 Ga0105033_103607 3300009986 Bacteria 1306
292 Ga0105239_10002392 3300010375 Bacteria 23925
293 Ga0105239_10052367 3300010375 Bacteria 4477
294 Ga0105239_10360545 3300010375 Bacteria 1642
295 Ga0105246_10052091 3300011119 Unclassified 2812
296 Ga0105246_10086571 3300011119 Bacteria 2247
297 Ga0157369_10181276 3300013105 Bacteria 2216
298 Ga0157374_10002924 3300013296 Bacteria 14313
299 Ga0157374_10008085 3300013296 Bacteria 8993
300 Ga0157374_10008425 3300013296 Bacteria 8808
301 Ga0157374_10026700 3300013296 Bacteria 5198
302 Ga0157374_10065244 3300013296 Bacteria 3419
303 Ga0157374_10081337 3300013296 Bacteria 3074
304 Ga0157374_10111312 3300013296 Bacteria 2634
305 Ga0157378_10001806 3300013297 Bacteria 19219
306 Ga0157378_10002051 3300013297 Bacteria 18038
307 Ga0157378_10006138 3300013297 Bacteria 10527
308 Ga0157378_10017866 3300013297 Bacteria 6225
309 Ga0157378_10019273 3300013297 Bacteria 5997
310 Ga0157378_10078367 3300013297 Bacteria 2980
311 Ga0157378_10167785 3300013297 Bacteria 2057
312 Ga0157378_10462137 3300013297 Bacteria 1261
313 Ga0163162_10010416 3300013306 Bacteria 9038
314 Ga0163162_10064142 3300013306 Bacteria 3718
315 Ga0157372_10067392 3300013307 Bacteria 4022
316 Ga0157372_10210973 3300013307 Bacteria 2251
317 Ga0157375_10003227 3300013308 Bacteria 14154
318 Ga0157375_10003763 3300013308 Bacteria 13155
319 Ga0157375_10018677 3300013308 Bacteria 6292
320 Ga0157375_10059461 3300013308 Bacteria 3787
321 Ga0157375_10063462 3300013308 Bacteria 3675
322 Ga0157375_10069598 3300013308 Bacteria 3526
323 Ga0157375_10490189 3300013308 Bacteria 1394
324 Ga0163163_10084342 3300014325 Unclassified 3183
325 Ga0163163_10312370 3300014325 Bacteria 1625
326 Ga0163163_10421497 3300014325 Bacteria 1394
327 Ga0157377_10007781 3300014745 Bacteria 5193
328 Ga0157377_10038886 3300014745 Unclassified 2629
329 Ga0157379_10007342 3300014968 Bacteria 9538
330 Ga0157376_10011942 3300014969 Bacteria 6423
331 Ga0157376_10024206 3300014969 Bacteria 4764
332 Ga0157376_10087585 3300014969 Bacteria 2688
333 Ga0157376_10117520 3300014969 Bacteria 2351
334 Ga0157376_10123212 3300014969 Bacteria 2301
335 Ga0206350_11484488 3300020080 Bacteria 1621
336 Ga0213875_10093389 3300021388 Bacteria 1403
337 Ga0224712_10000396 3300022467 Bacteria 8529
338 Ga0207673_1002046 3300025290 Bacteria 2258
339 Ga0207697_10000218 3300025315 Bacteria 30853
340 Ga0207697_10000653 3300025315 Bacteria 19754
341 Ga0207697_10000931 3300025315 Bacteria 16521
342 Ga0207697_10001937 3300025315 Bacteria 10996
343 Ga0207697_10002320 3300025315 Bacteria 9910
344 Ga0207697_10005089 3300025315 Bacteria 6155
345 Ga0207656_10114981 3300025321 Bacteria 1247
346 Ga0207682_10000090 3300025893 Bacteria 41635
347 Ga0207642_10006535 3300025899 Bacteria 3885
348 Ga0207688_10004307 3300025901 Bacteria 7764
349 Ga0207688_10050257 3300025901 Bacteria 2333
350 Ga0207680_10058038 3300025903 Bacteria 2344
351 Ga0207680_10064363 3300025903 Bacteria 2248
352 Ga0207680_10067711 3300025903 Bacteria 2200
353 Ga0207680_10095094 3300025903 Bacteria 1903
354 Ga0207680_10127890 3300025903 Bacteria 1670
355 Ga0207647_10007107 3300025904 Bacteria 8117
356 Ga0207645_10034480 3300025907 Bacteria 3252
357 Ga0207645_10035580 3300025907 Bacteria 3197
358 Ga0207645_10219350 3300025907 Bacteria 1253
359 Ga0207705_10002062 3300025909 Bacteria 15632
360 Ga0207684_10000411 3300025910 Bacteria 57343
361 Ga0207684_10004005 3300025910 Bacteria 14087
362 Ga0207684_10008367 3300025910 Bacteria 9198
363 Ga0207684_10008585 3300025910 Bacteria 9084
364 Ga0207684_10014028 3300025910 Bacteria 6921
365 Ga0207684_10021655 3300025910 Bacteria 5488
366 Ga0207684_10030332 3300025910 Bacteria 4603
367 Ga0207684_10048304 3300025910 Bacteria 3609
368 Ga0207684_10224653 3300025910 Bacteria 1620
369 Ga0207684_10328179 3300025910 Bacteria 1318
370 Ga0207654_10047896 3300025911 Bacteria 2444
371 Ga0207707_10007665 3300025912 Bacteria 9402
372 Ga0207707_10151495 3300025912 Bacteria 2027
373 Ga0207671_10004777 3300025914 Bacteria 12771
374 Ga0207693_10019169 3300025915 Bacteria 5445
375 Ga0207693_10072733 3300025915 Bacteria 2692
376 Ga0207693_10076429 3300025915 Bacteria 2622
377 Ga0207693_10083748 3300025915 Unclassified 2498
378 Ga0207693_10245249 3300025915 Bacteria 1406
379 Ga0207663_10082280 3300025916 Bacteria 2111
380 Ga0207663_10101178 3300025916 Bacteria 1936
381 Ga0207662_10057219 3300025918 Bacteria 2330
382 Ga0207657_10046056 3300025919 Bacteria 3822
383 Ga0207649_10031067 3300025920 Bacteria 3171
384 Ga0207649_10038413 3300025920 Unclassified 2898
385 Ga0207652_10019090 3300025921 Bacteria 5633
386 Ga0207652_10042839 3300025921 Bacteria 3854
387 Ga0207646_10000108 3300025922 Bacteria 112950
388 Ga0207646_10001336 3300025922 Bacteria 30626
389 Ga0207646_10001362 3300025922 Bacteria 30269
390 Ga0207646_10001652 3300025922 Bacteria 27279
391 Ga0207646_10011599 3300025922 Bacteria 8520
392 Ga0207646_10022496 3300025922 Bacteria 5807
393 Ga0207646_10043024 3300025922 Bacteria 4057
394 Ga0207646_10074972 3300025922 Bacteria 3022
395 Ga0207646_10091277 3300025922 Unclassified 2726
396 Ga0207646_10264216 3300025922 Bacteria 1555
397 Ga0207646_10318984 3300025922 Bacteria 1404
398 Ga0207681_10137053 3300025923 Bacteria 1818
399 Ga0207694_10000008 3300025924 Bacteria 484902
400 Ga0207650_10015166 3300025925 Bacteria 5362
401 Ga0207650_10052928 3300025925 Bacteria 3008
402 Ga0207659_10026094 3300025926 Bacteria 3938
403 Ga0207659_10040426 3300025926 Bacteria 3261
404 Ga0207659_10159866 3300025926 Bacteria 1767
405 Ga0207659_10195160 3300025926 Bacteria 1613
406 Ga0207687_10000012 3300025927 Bacteria 370729
407 Ga0207687_10000325 3300025927 Bacteria 32487
408 Ga0207687_10004999 3300025927 Bacteria 8781
409 Ga0207687_10005798 3300025927 Bacteria 8173
410 Ga0207687_10107513 3300025927 Bacteria 2064
411 Ga0207700_10251300 3300025928 Bacteria 1510
412 Ga0207644_10051770 3300025931 Bacteria 2948
413 Ga0207644_10059742 3300025931 Bacteria 2758
414 Ga0207644_10062620 3300025931 Bacteria 2699
415 Ga0207644_10136420 3300025931 Bacteria 1884
416 Ga0207690_10071060 3300025932 Bacteria 2399
417 Ga0207690_10071502 3300025932 Bacteria 2393
418 Ga0207690_10172434 3300025932 Bacteria 1622
419 Ga0207706_10000062 3300025933 Bacteria 109344
420 Ga0207686_10000887 3300025934 Bacteria 18058
421 Ga0207686_10085190 3300025934 Bacteria 2072
422 Ga0207709_10000563 3300025935 Bacteria 31433
423 Ga0207670_10011099 3300025936 Bacteria 5216
424 Ga0207670_10018419 3300025936 Bacteria 4244
425 Ga0207670_10077987 3300025936 Bacteria 2309
426 Ga0207669_10003913 3300025937 Bacteria 6497
427 Ga0207669_10144699 3300025937 Bacteria 1656
428 Ga0207704_10002004 3300025938 Bacteria 9138
429 Ga0207704_10193318 3300025938 Bacteria 1482
430 Ga0207665_10009459 3300025939 Bacteria 6398
431 Ga0207665_10089264 3300025939 Bacteria 2135
432 Ga0207665_10261766 3300025939 Bacteria 1282
433 Ga0207691_10001895 3300025940 Bacteria 20454
434 Ga0207691_10021057 3300025940 Bacteria 6161
435 Ga0207691_10055219 3300025940 Bacteria 3620
436 Ga0207691_10147734 3300025940 Bacteria 2068
437 Ga0207689_10002161 3300025942 Bacteria 18495
438 Ga0207661_10006507 3300025944 Bacteria 8261
439 Ga0207661_10008469 3300025944 Bacteria 7354
440 Ga0207661_10016311 3300025944 Bacteria 5480
441 Ga0207661_10034524 3300025944 Unclassified 3934
442 Ga0207661_10065885 3300025944 Bacteria 2941
443 Ga0207679_10028605 3300025945 Bacteria 3870
444 Ga0207679_10050774 3300025945 Bacteria 3032
445 Ga0207679_10386757 3300025945 Bacteria 1228
446 Ga0207667_10299460 3300025949 Bacteria 1643
447 Ga0207667_10376806 3300025949 Bacteria 1446
448 Ga0207712_10000003 3300025961 Bacteria 615314
449 Ga0207712_10000024 3300025961 Bacteria 275176
450 Ga0207712_10001243 3300025961 Bacteria 17583
451 Ga0207712_10070397 3300025961 Bacteria 2512
452 Ga0207668_10010765 3300025972 Bacteria 5539
453 Ga0207668_10027111 3300025972 Bacteria 3730
454 Ga0207668_10080886 3300025972 Bacteria 2355
455 Ga0207668_10106167 3300025972 Bacteria 2097
456 Ga0207668_10137316 3300025972 Bacteria 1875
457 Ga0207640_10002636 3300025981 Bacteria 9609
458 Ga0207640_10155817 3300025981 Bacteria 1684
459 Ga0207658_10063848 3300025986 Bacteria 2761
460 Ga0207658_10179875 3300025986 Bacteria 1749
461 Ga0207677_10000239 3300026023 Bacteria 42724
462 Ga0207677_10010204 3300026023 Bacteria 5308
463 Ga0207677_10073018 3300026023 Bacteria 2428
464 Ga0207703_10000185 3300026035 Bacteria 72988
465 Ga0207703_10004158 3300026035 Bacteria 11938
466 Ga0207703_10008205 3300026035 Bacteria 8252
467 Ga0207703_10040016 3300026035 Bacteria 3750
468 Ga0207703_10349997 3300026035 Bacteria 1360
469 Ga0207678_10011156 3300026067 Bacteria 7892
470 Ga0207678_10121444 3300026067 Bacteria 2229
471 Ga0207678_10125800 3300026067 Bacteria 2187
472 Ga0207708_10046432 3300026075 Bacteria 3307
473 Ga0207708_10059650 3300026075 Bacteria 2913
474 Ga0207702_10006523 3300026078 Bacteria 10040
475 Ga0207702_10075572 3300026078 Bacteria 2911
476 Ga0207641_10057885 3300026088 Bacteria 3297
477 Ga0207641_10064296 3300026088 Unclassified 3136
478 Ga0207648_10001973 3300026089 Bacteria 22388
479 Ga0207648_10011222 3300026089 Bacteria 8448
480 Ga0207648_10370994 3300026089 Bacteria 1293
481 Ga0207676_10037434 3300026095 Bacteria 3697
482 Ga0207674_10073915 3300026116 Bacteria 3421
483 Ga0207674_10228565 3300026116 Unclassified 1808
484 Ga0207683_10000577 3300026121 Bacteria 33955
485 Ga0207683_10014124 3300026121 Bacteria 6806
486 Ga0207683_10021755 3300026121 Bacteria 5498
487 Ga0207683_10085750 3300026121 Bacteria 2799
488 Ga0207683_10309239 3300026121 Bacteria 1446
489 Ga0207698_10205404 3300026142 Bacteria 1768
490 Ga0207428_10078999 3300027907 Bacteria 2573
491 Ga0207428_10109092 3300027907 Bacteria 2131
492 Ga0265354_1002414 3300028016 Bacteria 2317
493 Ga0268266_10000023 3300028379 Bacteria 501899
494 Ga0268266_10051158 3300028379 Bacteria 3546
495 Ga0268266_10060269 3300028379 Bacteria 3271
496 Ga0268266_10071700 3300028379 Bacteria 3003
497 Ga0268266_10355927 3300028379 Unclassified 1376
498 Ga0268264_10002175 3300028381 Bacteria 17444
499 Ga0268264_10017108 3300028381 Bacteria 5937
500 Ga0265338_10000088 3300028800 Bacteria 174641
501 Ga0265338_10011120 3300028800 Bacteria 10433
502 Ga0265338_10202267 3300028800 Bacteria 1497
503 Ga0265324_10000259 3300029957 Bacteria 39278
504 Ga0265324_10006364 3300029957 Bacteria 4936
505 Ga0265340_10017943 3300031247 Bacteria 3658
506 Ga0265327_10001388 3300031251 Bacteria 30912
507 Ga0265327_10002361 3300031251 Bacteria 20110
508 Ga0265316_10000157 3300031344 Bacteria 75589
509 Ga0265316_10098465 3300031344 Bacteria 2225
510 Ga0307513_10084123 3300031456 Bacteria 3269
511 Ga0307509_10026563 3300031507 Bacteria 6452
512 Ga0307509_10161092 3300031507 Bacteria 2141
513 Ga0307408_100079087 3300031548 Bacteria 2453
514 Ga0316576_10002934 3300031727 Bacteria 9873
515 Ga0307516_10000246 3300031730 Bacteria 69826
516 Ga0307516_10093224 3300031730 Bacteria 2837
517 Ga0307405_10048962 3300031731 Bacteria 2610
518 Ga0307413_10032842 3300031824 Bacteria 2947
519 Ga0307410_10007994 3300031852 Bacteria 5833
520 Ga0307410_10026170 3300031852 Bacteria 3669
521 Ga0307406_10160373 3300031901 Bacteria 1616
522 Ga0307409_100011355 3300031995 Bacteria 5609
523 Ga0307409_100016885 3300031995 Bacteria 4846
524 Ga0307415_100001128 3300032126 Bacteria 12471
525 Ga0373923_0001414 3300035111 Bacteria 6858
526 Ga0373956_0056399 3300035119 Bacteria 1774
527 Ga0373957_0039621 3300035120 Bacteria 1768
528 Ga0373943_0048300 3300035170 Unclassified 2085
529 Ga0373943_0096159 3300035170 Bacteria 1542
530 Ga0373943_0101215 3300035170 Bacteria 1507
531 Ga0316574_0012522 3300035398 Bacteria 4853
532 Ga0373935_0019215 3300035692 Unclassified 4167
533 Ga0373935_0068315 3300035692 Unclassified 2287
534 Ga0373927_0003847 3300035695 Bacteria 10665
535 Ga0373927_0211189 3300035695 Bacteria 1275
536 Ga0373947_0200245 3300035725 Bacteria 1306
537 Ga0373937_0011688 3300036401 Bacteria 7698
538 Ga0373937_0054004 3300036401 Bacteria 3686
539 Ga0373937_0082721 3300036401 Unclassified 2970
540 Ga0316584_0008388 3300036712 Bacteria 7119
541 Ga0395900_0002199 3300037418 Bacteria 21783
542 Ga0395900_0008047 3300037418 Bacteria 10855
543 Ga0395900_0100697 3300037418 Bacteria 2968
544 Ga0395898_0003325 3300037466 Bacteria 18061
545 Ga0395898_0010931 3300037466 Bacteria 9467
546 Ga0395898_0133061 3300037466 Bacteria 2381
547 Ga0395905_0013608 3300037471 Bacteria 7795
548 Ga0436364_0569377 3300037853 Bacteria 9550
549 Ga0436364_1122451 3300037853 Bacteria 4905
550 Ga0395901_0001234 3300038443 Bacteria 27294
551 Ga0395901_0022192 3300038443 Bacteria 6505
552 Ga0395901_0104812 3300038443 Bacteria 2968
553 Ga0400483_021979 3300039062 Bacteria 72013
554 Ga0400483_026621 3300039062 Bacteria 3753
555 Ga0400483_062586 3300039062 Bacteria 13225
556 Ga0400483_162332 3300039062 Bacteria 54875
557 Ga0400483_289865 3300039062 Bacteria 2672
558 Ga0436365_1863689 3300039437 Bacteria 1423
559 Ga0436361_0301618 3300039447 Bacteria 4109
560 Ga0436361_0626365 3300039447 Bacteria 2616
561 Ga0436361_1038034 3300039447 Bacteria 12154
562 Ga0451853_1931364 3300041512 Bacteria 1022
563 Ga0439433_0016924 3300041999 Bacteria 1617
564 Ga0439434_0018948 3300042435 Bacteria 2063
565 Ga0453683_0003589 3300044673 Bacteria 11398
566 Ga0453683_0191626 3300044673 Bacteria 1297
567 Ga0466966_0001956 3300044684 Bacteria 13339
568 Ga0466961_0105369 3300044693 Bacteria 1775
569 Ga0466963_0022182 3300044694 Bacteria 4019
570 Ga0466963_0264606 3300044694 Bacteria 1207
571 Ga0466957_0050769 3300044842 Bacteria 2524
572 Ga0466959_0119933 3300045049 Bacteria 1871
573 Ga0466959_0279583 3300045049 Bacteria 1146
574 Ga0451576_0014850 3300045051 Bacteria 8655
575 Ga0451576_0021161 3300045051 Bacteria 7071
576 Ga0466958_0023501 3300045836 Bacteria 3619
577 Ga0466967_0000138 3300045976 Bacteria 28201
578 Ga0495592_0114261 3300046454 Unclassified 1907
579 Ga0495603_0095906 3300046455 Bacteria 1733
580 Ga0495629_0038173 3300046459 Bacteria 3384
581 Ga0495641_0063025 3300046461 Bacteria 1671
582 Ga0495651_0004272 3300046462 Bacteria 10960
583 Ga0495651_0123806 3300046462 Unclassified 1896
584 Ga0495653_0000479 3300046463 Bacteria 30968
585 Ga0495653_0025443 3300046463 Unclassified 4757
586 Ga0495580_0008029 3300046472 Bacteria 8427
587 Ga0495582_0049158 3300046473 Bacteria 2322
588 Ga0495582_0071734 3300046473 Bacteria 1916
589 Ga0495594_0056228 3300046499 Bacteria 2171
590 Ga0495618_0059609 3300046514 Unclassified 2419
591 Ga0495620_0000060 3300046515 Bacteria 95642
592 Ga0495628_0047612 3300046516 Bacteria 3401
593 Ga0495628_0073153 3300046516 Unclassified 2671
594 Ga0495630_0005350 3300046517 Bacteria 9055
595 Ga0495630_0089116 3300046517 Unclassified 2330
596 Ga0495644_0000299 3300046523 Bacteria 22897
597 Ga0495665_0000454 3300046531 Bacteria 20626
598 Ga0495598_0043191 3300046537 Bacteria 1326
599 Ga0495621_0000153 3300046539 Bacteria 15123
600 Ga0495645_0008304 3300046543 Bacteria 7246
601 Ga0495645_0046588 3300046543 Unclassified 3160
602 Ga0495634_0000838 3300046642 Bacteria 29654
603 Ga0495635_0006803 3300046663 Bacteria 7991
604 Ga0495657_0005388 3300046675 Bacteria 10119
605 Ga0495599_0005716 3300046678 Bacteria 7459
606 Ga0495646_0002154 3300046680 Bacteria 11970
607 Ga0495646_0011602 3300046680 Bacteria 5598
608 Ga0495647_0000006 3300046681 Bacteria 105867
609 Ga0495647_0089314 3300046681 Bacteria 1261
610 Ga0495669_0000064 3300046684 Bacteria 70549
611 Ga0495613_0030415 3300046689 Unclassified 4011
612 Ga0495624_0008216 3300046690 Bacteria 7298
613 Ga0495581_0001103 3300047315 Bacteria 14738
614 Ga0495581_0023765 3300047315 Bacteria 3552
615 Ga0495604_0024946 3300047317 Unclassified 4767
616 Ga0495674_0005650 3300047319 Bacteria 11977
617 Ga0495675_0000865 3300047444 Bacteria 18492
618 Ga0495684_0023078 3300047471 Bacteria 4785
619 Ga0495593_0015748 3300047673 Unclassified 4275
620 Ga0495602_0065594 3300048088 Bacteria 3133
621 Ga0495614_0008037 3300048089 Unclassified 4689
622 Ga0496100_0000004 3300048903 Bacteria 321778
623 Ga0496100_0018217 3300048903 Bacteria 4162
624 Ga0496100_0021130 3300048903 Bacteria 3915
625 Ga0496101_0000007 3300048904 Bacteria 321778
626 Ga0496101_0001156 3300048904 Bacteria 15776
627 Ga0496101_0292020 3300048904 Bacteria 1276
628 Ga0496102_0000586 3300048905 Bacteria 38547
629 Ga0496102_0068149 3300048905 Bacteria 3265
630 Ga0496102_0282475 3300048905 Bacteria 1564
631 Ga0496103_0000588 3300048906 Bacteria 28707
632 Ga0496103_0011399 3300048906 Bacteria 5267
633 Ga0496104_0000003 3300048907 Bacteria 669219
634 Ga0496104_0006256 3300048907 Bacteria 10462
635 Ga0496104_0042147 3300048907 Bacteria 4283
636 Ga0496104_0070285 3300048907 Bacteria 3328
637 Ga0496104_0167390 3300048907 Bacteria 2108
638 Ga0496105_0000008 3300048908 Bacteria 335652
639 Ga0496105_0165609 3300048908 Bacteria 1814
640 Ga0496106_0000004 3300048909 Bacteria 279896
641 Ga0496106_0000096 3300048909 Bacteria 67122
642 Ga0496106_0002424 3300048909 Bacteria 13905
643 Ga0496106_0078382 3300048909 Bacteria 2535
644 Ga0496106_0234622 3300048909 Bacteria 1465
645 Ga0496107_0000001 3300048910 Bacteria 321778
646 Ga0496107_0000571 3300048910 Bacteria 20528
647 Ga0496108_0000002 3300048911 Bacteria 700890
648 Ga0496108_0025876 3300048911 Bacteria 4840
649 Ga0496108_0118299 3300048911 Unclassified 2271
650 Ga0496108_0462058 3300048911 Bacteria 1109
651 Ga0496109_0000001 3300048912 Bacteria 700852
652 Ga0496109_0003049 3300048912 Bacteria 13964
653 Ga0496109_0004828 3300048912 Bacteria 11250
654 Ga0496110_0089535 3300048913 Bacteria 2751
655 Ga0496110_0249602 3300048913 Unclassified 1615
656 Ga0496110_0350734 3300048913 Unclassified 1344
657 Ga0496111_0054176 3300048914 Bacteria 2899
658 Ga0496112_0001254 3300048915 Bacteria 19218
659 Ga0496112_0016245 3300048915 Bacteria 6966
660 Ga0496112_0107618 3300048915 Bacteria 2758
661 Ga0496112_0316256 3300048915 Bacteria 1506
662 Ga0496113_0014131 3300048916 Bacteria 5436
663 Ga0496114_0000687 3300048917 Bacteria 25152
664 Ga0496114_0001166 3300048917 Bacteria 19860
665 Ga0496114_0012761 3300048917 Bacteria 6729
666 Ga0496114_0013316 3300048917 Bacteria 6593
667 Ga0496114_0037532 3300048917 Bacteria 4007
668 Ga0496115_0000068 3300048918 Bacteria 93725
669 Ga0496115_0001015 3300048918 Bacteria 20344
670 Ga0496115_0067467 3300048918 Unclassified 2893
671 Ga0496115_0132902 3300048918 Bacteria 2051
672 Ga0496115_0178257 3300048918 Bacteria 1757
673 Ga0496115_0432492 3300048918 Bacteria 1065
674 Ga0496125_0059332 3300048928 Bacteria 3084
675 Ga0496126_0039433 3300048929 Bacteria 4383
676 Ga0501290_002058 3300049513 Bacteria 2639
677 Ga0501298_002700 3300049521 Bacteria 2709
678 Ga0501038_0070765 3300049574 Bacteria 2961
679 Ga0501070_0159956 3300049586 Bacteria 1857
680 Ga0501071_0107275 3300049587 Bacteria 2062
681 Ga0501072_0073138 3300049588 Bacteria 2710
682 Ga0501076_0069462 3300049592 Bacteria 2815
683 Ga0501223_004266 3300049663 Bacteria 3071
684 Ga0501257_000140 3300049686 Bacteria 16197
685 Ga0501081_0134592 3300049743 Bacteria 1768
686 Ga0501083_0003423 3300049744 Bacteria 11084
687 Ga0501280_000729 3300049776 Bacteria 7248
688 Ga0501045_0049495 3300049824 Bacteria 3064
689 nmdc:mga03683_7939_c1 3300050489 Bacteria 3709
690 nmdc:mga00v17_37164_c1 3300050491 Bacteria 2906
691 nmdc:mga0yw44_255967_c1 3300050492 Bacteria 1166
692 nmdc:mga0yw44_96529_c1 3300050492 Bacteria 1876
693 nmdc:mga06z11_78709_c1 3300050494 Bacteria 1763
694 nmdc:mga07m45_19135_c1 3300050496 Bacteria 3706
695 nmdc:mga05p37_262118_c1 3300050507 Bacteria 2068
696 nmdc:mga05p37_380489_c1 3300050507 Bacteria 1654
697 nmdc:mga05p37_51110_c1 3300050507 Bacteria 5084
698 nmdc:mga05p37_6368_c1 3300050507 Bacteria 13906
699 nmdc:mga09592_16235_c1 3300050508 Bacteria 6086
700 nmdc:mga0qj67_148751_c1 3300050509 Bacteria 1899
701 nmdc:mga08y16_125638_c1 3300050511 Bacteria 2668
702 nmdc:mga08y16_143040_c1 3300050511 Bacteria 2486
703 nmdc:mga08y16_34214_c1 3300050511 Bacteria 5338
704 nmdc:mga0n895_183165_c1 3300050512 Bacteria 2126
705 nmdc:mga0n895_226967_c1 3300050512 Bacteria 1896
706 nmdc:mga0n895_305693_c1 3300050512 Bacteria 1612
707 nmdc:mga0n895_543537_c1 3300050512 Bacteria 1168
708 nmdc:mga0n895_78178_c1 3300050512 Bacteria 3293
709 nmdc:mga0n895_89466_c1 3300050512 Bacteria 3079
710 nmdc:mga0rr50_104581_c1 3300050513 Bacteria 2230
711 nmdc:mga0rr50_128855_c1 3300050513 Bacteria 2023
712 nmdc:mga08x19_11662_c1 3300050514 Bacteria 5291
713 nmdc:mga0a205_341259_c1 3300050515 Bacteria 1366
714 nmdc:mga0a205_399119_c1 3300050515 Bacteria 1239
715 nmdc:mga0a205_58387_c1 3300050515 Bacteria 3727
716 Ga0495601_0000189 3300053077 Bacteria 32597
717 Ga0495601_0007313 3300053077 Bacteria 6472
718 Ga0495601_0037793 3300053077 Bacteria 3018
719 Ga0495612_0006562 3300053078 Unclassified 4774
720 Ga0495612_0046905 3300053078 Bacteria 1770
721 Ga0495612_0073841 3300053078 Bacteria 1425
722 Ga0495619_0058543 3300053085 Unclassified 2558
723 Ga0495619_0177120 3300053085 Bacteria 1475
724 Ga0495619_0211628 3300053085 Bacteria 1343
725 Ga0500643_001044 3300053087 Bacteria 16807
726 Ga0500644_0000169 3300053088 Bacteria 41659
727 Ga0500616_0017460 3300053153 Bacteria 4070
728 Ga0501084_0307764 3300054114 Bacteria 1338
729 Ga0587080_004277 3300059503 Bacteria 1842
730 Ga0587079_003411 3300059647 Bacteria 2065
731 Ga0587071_007976 3300060344 Bacteria 1704
732 Ga0466962_0032224 3300061719 Bacteria 2509
733 Ga0530510_0312054 3300061734 Bacteria 1178

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300053078 Ga0495612_0073841 Ga0495612_0073841_92_967 279
2 3300048918 Ga0496115_0132902 Ga0496115_0132902_72_959 280
3 3300044693 Ga0466961_0105369 Ga0466961_0105369_809_1702 287
4 3300050492 nmdc:mga0yw44_96529_c1 nmdc:mga0yw44_96529_c1_962_1858 291
5 3300050492 nmdc:mga0yw44_255967_c1 nmdc:mga0yw44_255967_c1_227_1153 303
6 3300048918 Ga0496115_0432492 Ga0496115_0432492_13_975 304
7 3300009986 Ga0105033_103607 Ga0105033_1036072 313
8 3300048915 Ga0496112_0316256 Ga0496112_0316256_26_970 314
9 3300050515 nmdc:mga0a205_341259_c1 nmdc:mga0a205_341259_c1_23_970 315
10 3300006173 Ga0070716_100215999 Ga0070716_1002159992 316
11 3300009147 Ga0114129_10004513 Ga0114129_100045139 317
12 3300050507 nmdc:mga05p37_6368_c1 nmdc:mga05p37_6368_c1_5250_6218 317
13 3300050512 nmdc:mga0n895_183165_c1 nmdc:mga0n895_183165_c1_853_1821 317
14 3300025940 Ga0207691_10147734 Ga0207691_101477342 318
15 3300041512 Ga0451853_1931364 Ga0451853_1931364_42_1007 318
16 3300044673 Ga0453683_0191626 Ga0453683_0191626_287_1249 318
17 3300050511 nmdc:mga08y16_125638_c1 nmdc:mga08y16_125638_c1_11_970 318
18 3300054114 Ga0501084_0307764 Ga0501084_0307764_16_978 318
19 3300010375 Ga0105239_10052367 Ga0105239_100523672 327
20 3300039447 Ga0436361_0626365 Ga0436361_0626365_719_1729 329
21 3300046516 Ga0495628_0047612 Ga0495628_0047612_1324_2337 331
22 3300048917 Ga0496114_0013316 Ga0496114_0013316_643_1656 331
23 3300009094 Ga0111539_10016882 Ga0111539_1001688211 333
24 3300050511 nmdc:mga08y16_34214_c1 nmdc:mga08y16_34214_c1_757_1797 333
25 3300005985 Ga0081539_10060037 Ga0081539_100600372 334
26 3300005843 Ga0068860_100014730 Ga0068860_1000147304 335
27 3300028381 Ga0268264_10017108 Ga0268264_100171083 335
28 3300028800 Ga0265338_10202267 Ga0265338_102022672 335
29 3300039437 Ga0436365_1863689 Ga0436365_1863689_356_1396 340
30 3300045049 Ga0466959_0279583 Ga0466959_0279583_24_1064 340
31 3300048909 Ga0496106_0000096 Ga0496106_0000096_55643_56728 340
32 3300005445 Ga0070708_100059545 Ga0070708_1000595453 341
33 3300005458 Ga0070681_10036443 Ga0070681_100364433 341
34 3300005467 Ga0070706_100047895 Ga0070706_1000478953 343
35 3300009147 Ga0114129_10634874 Ga0114129_106348741 343
36 3300031344 Ga0265316_10000157 Ga0265316_1000015747 343
37 3300046455 Ga0495603_0095906 Ga0495603_0095906_277_1335 343
38 3300046681 Ga0495647_0089314 Ga0495647_0089314_26_1069 343
39 3300050507 nmdc:mga05p37_380489_c1 nmdc:mga05p37_380489_c1_116_1195 343
40 3300005535 Ga0070684_100186978 Ga0070684_1001869782 344
41 3300009147 Ga0114129_10361700 Ga0114129_103617002 344
42 3300005331 Ga0070670_100182137 Ga0070670_1001821372 345
43 3300005467 Ga0070706_100006643 Ga0070706_1000066433 345
44 3300005468 Ga0070707_100001458 Ga0070707_10000145811 345
45 3300005468 Ga0070707_100055268 Ga0070707_1000552683 345
46 3300005471 Ga0070698_100000390 Ga0070698_10000039014 345
47 3300006914 Ga0075436_100010401 Ga0075436_1000104013 345
48 3300025910 Ga0207684_10014028 Ga0207684_100140283 345
49 3300025922 Ga0207646_10001336 Ga0207646_1000133627 345
50 3300046499 Ga0495594_0056228 Ga0495594_0056228_265_1347 345
51 3300050514 nmdc:mga08x19_11662_c1 nmdc:mga08x19_11662_c1_3469_4530 345
52 3300049588 Ga0501072_0073138 Ga0501072_0073138_1268_2335 347
53 iso_pu_bacteria 2886627955 2886634218 347
54 3300005331 Ga0070670_100013375 Ga0070670_1000133757 348
55 3300005331 Ga0070670_100316589 Ga0070670_1003165892 348
56 3300005335 Ga0070666_10044470 Ga0070666_100444704 348
57 3300005354 Ga0070675_100075480 Ga0070675_1000754803 348
58 3300005355 Ga0070671_100001678 Ga0070671_1000016788 348
59 3300005548 Ga0070665_100035838 Ga0070665_1000358384 348
60 3300005548 Ga0070665_100085019 Ga0070665_1000850193 348
61 3300005564 Ga0070664_100107705 Ga0070664_1001077051 348
62 3300006358 Ga0068871_100096981 Ga0068871_1000969813 348
63 3300013296 Ga0157374_10081337 Ga0157374_100813373 348
64 3300013297 Ga0157378_10078367 Ga0157378_100783674 348
65 3300013308 Ga0157375_10018677 Ga0157375_100186774 348
66 3300013308 Ga0157375_10059461 Ga0157375_100594611 348
67 3300014325 Ga0163163_10312370 Ga0163163_103123702 348
68 3300025315 Ga0207697_10005089 Ga0207697_100050893 348
69 3300025903 Ga0207680_10064363 Ga0207680_100643631 348
70 3300025903 Ga0207680_10127890 Ga0207680_101278902 348
71 3300025907 Ga0207645_10035580 Ga0207645_100355803 348
72 3300025923 Ga0207681_10137053 Ga0207681_101370532 348
73 3300025925 Ga0207650_10015166 Ga0207650_100151664 348
74 3300025926 Ga0207659_10195160 Ga0207659_101951601 348
75 3300025936 Ga0207670_10077987 Ga0207670_100779872 348
76 3300025940 Ga0207691_10055219 Ga0207691_100552193 348
77 3300025972 Ga0207668_10080886 Ga0207668_100808862 348
78 3300025986 Ga0207658_10179875 Ga0207658_101798752 348
79 3300028379 Ga0268266_10060269 Ga0268266_100602692 348
80 iso_pu_bacteria 2522125168 2522552521 348
81 iso_pu_bacteria 2597490356 2599102489 348
82 iso_pu_bacteria 2842333319 2842336582 348
83 iso_pu_bacteria 2846952575 2846958628 348
84 3300005328 Ga0070676_10083705 Ga0070676_100837052 349
85 3300005354 Ga0070675_100122963 Ga0070675_1001229633 349
86 3300005354 Ga0070675_100138321 Ga0070675_1001383212 349
87 3300005354 Ga0070675_100219622 Ga0070675_1002196222 349
88 3300005468 Ga0070707_100001955 Ga0070707_10000195510 349
89 3300006871 Ga0075434_100582846 Ga0075434_1005828461 349
90 3300026121 Ga0207683_10309239 Ga0207683_103092392 349
91 3300031727 Ga0316576_10002934 Ga0316576_100029345 349
92 3300035170 Ga0373943_0096159 Ga0373943_0096159_235_1284 349
93 3300035398 Ga0316574_0012522 Ga0316574_0012522_54_1106 349
94 3300036712 Ga0316584_0008388 Ga0316584_0008388_817_1869 349
95 3300037418 Ga0395900_0008047 Ga0395900_0008047_8194_9246 349
96 3300037466 Ga0395898_0133061 Ga0395898_0133061_324_1376 349
97 3300046539 Ga0495621_0000153 Ga0495621_0000153_9868_10935 349
98 3300048911 Ga0496108_0118299 Ga0496108_0118299_916_1968 349
99 3300048913 Ga0496110_0249602 Ga0496110_0249602_422_1474 349
100 3300048915 Ga0496112_0016245 Ga0496112_0016245_2466_3518 349
101 3300048929 Ga0496126_0039433 Ga0496126_0039433_2887_3957 349
102 3300050512 nmdc:mga0n895_543537_c1 nmdc:mga0n895_543537_c1_34_1083 349
103 3300003320 rootH2_10100298 rootH2_101002982 350
104 3300005290 Ga0065712_10013148 Ga0065712_100131483 350
105 3300005328 Ga0070676_10006864 Ga0070676_100068641 350
106 3300005331 Ga0070670_100029305 Ga0070670_1000293054 350
107 3300005335 Ga0070666_10147834 Ga0070666_101478342 350
108 3300005340 Ga0070689_100005164 Ga0070689_1000051644 350
109 3300005347 Ga0070668_100036794 Ga0070668_1000367945 350
110 3300005353 Ga0070669_100007368 Ga0070669_1000073682 350
111 3300005354 Ga0070675_100076838 Ga0070675_1000768381 350
112 3300005355 Ga0070671_100011983 Ga0070671_1000119832 350
113 3300005365 Ga0070688_100021547 Ga0070688_1000215473 350
114 3300005366 Ga0070659_100141064 Ga0070659_1001410642 350
115 3300005367 Ga0070667_100006508 Ga0070667_1000065082 350
116 3300005435 Ga0070714_100101567 Ga0070714_1001015672 350
117 3300005435 Ga0070714_100395054 Ga0070714_1003950541 350
118 3300005439 Ga0070711_100397969 Ga0070711_1003979691 350
119 3300005445 Ga0070708_100246506 Ga0070708_1002465062 350
120 3300005455 Ga0070663_100013528 Ga0070663_1000135284 350
121 3300005456 Ga0070678_100002366 Ga0070678_1000023663 350
122 3300005467 Ga0070706_100008103 Ga0070706_1000081035 350
123 3300005467 Ga0070706_100023506 Ga0070706_1000235061 350
124 3300005535 Ga0070684_100152737 Ga0070684_1001527372 350
125 3300005536 Ga0070697_100007362 Ga0070697_1000073627 350
126 3300005543 Ga0070672_100213329 Ga0070672_1002133291 350
127 3300005548 Ga0070665_100017536 Ga0070665_1000175368 350
128 3300005548 Ga0070665_100059648 Ga0070665_1000596483 350
129 3300005548 Ga0070665_100079543 Ga0070665_1000795432 350
130 3300005564 Ga0070664_100032306 Ga0070664_1000323064 350
131 3300005564 Ga0070664_100294407 Ga0070664_1002944072 350
132 3300005614 Ga0068856_100011239 Ga0068856_1000112392 350
133 3300005617 Ga0068859_100188411 Ga0068859_1001884112 350
134 3300005841 Ga0068863_100223332 Ga0068863_1002233322 350
135 3300005842 Ga0068858_100002632 Ga0068858_1000026322 350
136 3300005937 Ga0081455_10057205 Ga0081455_100572053 350
137 3300006028 Ga0070717_10017338 Ga0070717_100173383 350
138 3300006028 Ga0070717_10183326 Ga0070717_101833262 350
139 3300006163 Ga0070715_10021115 Ga0070715_100211151 350
140 3300006852 Ga0075433_10176167 Ga0075433_101761672 350
141 3300006871 Ga0075434_100223102 Ga0075434_1002231022 350
142 3300006881 Ga0068865_100021256 Ga0068865_1000212565 350
143 3300006931 Ga0097620_100188414 Ga0097620_1001884142 350
144 3300007076 Ga0075435_100177325 Ga0075435_1001773252 350
145 3300009094 Ga0111539_10033172 Ga0111539_100331721 350
146 3300009098 Ga0105245_10221003 Ga0105245_102210032 350
147 3300009147 Ga0114129_10527339 Ga0114129_105273391 350
148 3300009551 Ga0105238_10374926 Ga0105238_103749261 350
149 3300011119 Ga0105246_10086571 Ga0105246_100865713 350
150 3300013296 Ga0157374_10008425 Ga0157374_100084255 350
151 3300013296 Ga0157374_10026700 Ga0157374_100267004 350
152 3300013297 Ga0157378_10019273 Ga0157378_100192736 350
153 3300013297 Ga0157378_10167785 Ga0157378_101677851 350
154 3300013307 Ga0157372_10067392 Ga0157372_100673924 350
155 3300013308 Ga0157375_10003227 Ga0157375_100032274 350
156 3300014969 Ga0157376_10123212 Ga0157376_101232122 350
157 3300025315 Ga0207697_10002320 Ga0207697_100023206 350
158 3300025901 Ga0207688_10004307 Ga0207688_100043073 350
159 3300025903 Ga0207680_10058038 Ga0207680_100580382 350
160 3300025907 Ga0207645_10034480 Ga0207645_100344802 350
161 3300025910 Ga0207684_10004005 Ga0207684_1000400511 350
162 3300025910 Ga0207684_10021655 Ga0207684_100216553 350
163 3300025915 Ga0207693_10083748 Ga0207693_100837483 350
164 3300025916 Ga0207663_10082280 Ga0207663_100822802 350
165 3300025922 Ga0207646_10043024 Ga0207646_100430243 350
166 3300025927 Ga0207687_10107513 Ga0207687_101075132 350
167 3300025928 Ga0207700_10251300 Ga0207700_102513001 350
168 3300025931 Ga0207644_10051770 Ga0207644_100517705 350
169 3300025936 Ga0207670_10018419 Ga0207670_100184193 350
170 3300025937 Ga0207669_10144699 Ga0207669_101446991 350
171 3300025938 Ga0207704_10193318 Ga0207704_101933181 350
172 3300025939 Ga0207665_10009459 Ga0207665_100094594 350
173 3300025939 Ga0207665_10261766 Ga0207665_102617662 350
174 3300025940 Ga0207691_10001895 Ga0207691_1000189521 350
175 3300025945 Ga0207679_10050774 Ga0207679_100507741 350
176 3300025945 Ga0207679_10386757 Ga0207679_103867572 350
177 3300026035 Ga0207703_10008205 Ga0207703_100082052 350
178 3300026067 Ga0207678_10011156 Ga0207678_100111565 350
179 3300026078 Ga0207702_10075572 Ga0207702_100755722 350
180 3300026121 Ga0207683_10085750 Ga0207683_100857503 350
181 3300027907 Ga0207428_10078999 Ga0207428_100789991 350
182 3300028800 Ga0265338_10000088 Ga0265338_1000008825 350
183 3300028800 Ga0265338_10011120 Ga0265338_100111205 350
184 3300029957 Ga0265324_10006364 Ga0265324_100063642 350
185 3300031247 Ga0265340_10017943 Ga0265340_100179433 350
186 3300031251 Ga0265327_10001388 Ga0265327_100013888 350
187 3300031251 Ga0265327_10002361 Ga0265327_1000236110 350
188 3300035119 Ga0373956_0056399 Ga0373956_0056399_518_1573 350
189 3300035170 Ga0373943_0048300 Ga0373943_0048300_468_1520 350
190 3300035692 Ga0373935_0068315 Ga0373935_0068315_1214_2266 350
191 3300035725 Ga0373947_0200245 Ga0373947_0200245_45_1106 350
192 3300046459 Ga0495629_0038173 Ga0495629_0038173_1138_2208 350
193 3300046462 Ga0495651_0123806 Ga0495651_0123806_767_1822 350
194 3300046543 Ga0495645_0008304 Ga0495645_0008304_742_1797 350
195 3300046678 Ga0495599_0005716 Ga0495599_0005716_1695_2750 350
196 3300046680 Ga0495646_0011602 Ga0495646_0011602_16_1071 350
197 3300048904 Ga0496101_0292020 Ga0496101_0292020_129_1190 350
198 3300048911 Ga0496108_0462058 Ga0496108_0462058_26_1087 350
199 3300049744 Ga0501083_0003423 Ga0501083_0003423_3197_4252 350
200 3300050512 nmdc:mga0n895_89466_c1 nmdc:mga0n895_89466_c1_1428_2501 350
201 3300050513 nmdc:mga0rr50_104581_c1 nmdc:mga0rr50_104581_c1_111_1181 350
202 3300053077 Ga0495601_0007313 Ga0495601_0007313_604_1659 350
203 3300053078 Ga0495612_0046905 Ga0495612_0046905_516_1586 350
204 3300002077 JGI24744J21845_10005804 JGI24744J21845_100058042 351
205 3300003320 rootH2_10009286 rootH2_1000928617 351
206 3300003323 rootH1_10035324 rootH1_100353242 351
207 3300005327 Ga0070658_10078072 Ga0070658_100780722 351
208 3300005329 Ga0070683_100007984 Ga0070683_1000079847 351
209 3300005329 Ga0070683_100029152 Ga0070683_1000291522 351
210 3300005329 Ga0070683_100227488 Ga0070683_1002274882 351
211 3300005331 Ga0070670_100061195 Ga0070670_1000611952 351
212 3300005333 Ga0070677_10000019 Ga0070677_1000001924 351
213 3300005337 Ga0070682_100000038 Ga0070682_10000003843 351
214 3300005338 Ga0068868_100000175 Ga0068868_10000017513 351
215 3300005338 Ga0068868_100097874 Ga0068868_1000978743 351
216 3300005345 Ga0070692_10042972 Ga0070692_100429723 351
217 3300005347 Ga0070668_100004408 Ga0070668_1000044089 351
218 3300005347 Ga0070668_100038018 Ga0070668_1000380183 351
219 3300005347 Ga0070668_100362721 Ga0070668_1003627211 351
220 3300005353 Ga0070669_100187502 Ga0070669_1001875022 351
221 3300005356 Ga0070674_100002857 Ga0070674_1000028577 351
222 3300005356 Ga0070674_100166049 Ga0070674_1001660492 351
223 3300005365 Ga0070688_100005768 Ga0070688_1000057683 351
224 3300005366 Ga0070659_100150669 Ga0070659_1001506692 351
225 3300005366 Ga0070659_100221066 Ga0070659_1002210662 351
226 3300005434 Ga0070709_10132184 Ga0070709_101321842 351
227 3300005439 Ga0070711_100010643 Ga0070711_1000106434 351
228 3300005440 Ga0070705_100001340 Ga0070705_1000013409 351
229 3300005440 Ga0070705_100007247 Ga0070705_1000072475 351
230 3300005440 Ga0070705_100023189 Ga0070705_1000231892 351
231 3300005440 Ga0070705_100026056 Ga0070705_1000260562 351
232 3300005441 Ga0070700_100041186 Ga0070700_1000411862 351
233 3300005444 Ga0070694_100051621 Ga0070694_1000516212 351
234 3300005444 Ga0070694_100056974 Ga0070694_1000569741 351
235 3300005445 Ga0070708_100021006 Ga0070708_1000210064 351
236 3300005455 Ga0070663_100037099 Ga0070663_1000370992 351
237 3300005456 Ga0070678_100000223 Ga0070678_10000022313 351
238 3300005457 Ga0070662_100000015 Ga0070662_10000001556 351
239 3300005458 Ga0070681_10134823 Ga0070681_101348231 351
240 3300005459 Ga0068867_100000715 Ga0068867_10000071517 351
241 3300005466 Ga0070685_10080065 Ga0070685_100800652 351
242 3300005467 Ga0070706_100000703 Ga0070706_1000007034 351
243 3300005468 Ga0070707_100129082 Ga0070707_1001290822 351
244 3300005468 Ga0070707_100280139 Ga0070707_1002801391 351
245 3300005471 Ga0070698_100020103 Ga0070698_1000201032 351
246 3300005535 Ga0070684_100017106 Ga0070684_1000171064 351
247 3300005536 Ga0070697_100461651 Ga0070697_1004616511 351
248 3300005539 Ga0068853_100017443 Ga0068853_1000174435 351
249 3300005544 Ga0070686_100000888 Ga0070686_1000008884 351
250 3300005545 Ga0070695_100008308 Ga0070695_1000083084 351
251 3300005546 Ga0070696_100003721 Ga0070696_1000037218 351
252 3300005546 Ga0070696_100004339 Ga0070696_1000043397 351
253 3300005548 Ga0070665_100000128 Ga0070665_10000012834 351
254 3300005548 Ga0070665_100060085 Ga0070665_1000600852 351
255 3300005549 Ga0070704_100005325 Ga0070704_1000053254 351
256 3300005563 Ga0068855_100002299 Ga0068855_10000229920 351
257 3300005564 Ga0070664_100027843 Ga0070664_1000278432 351
258 3300005578 Ga0068854_100003697 Ga0068854_1000036977 351
259 3300005615 Ga0070702_100000916 Ga0070702_1000009169 351
260 3300005616 Ga0068852_100179456 Ga0068852_1001794561 351
261 3300005842 Ga0068858_100000350 Ga0068858_10000035028 351
262 3300005937 Ga0081455_10065977 Ga0081455_100659772 351
263 3300006028 Ga0070717_10159927 Ga0070717_101599271 351
264 3300006038 Ga0075365_10013500 Ga0075365_100135005 351
265 3300006048 Ga0075363_100045800 Ga0075363_1000458002 351
266 3300006051 Ga0075364_10022473 Ga0075364_100224735 351
267 3300006051 Ga0075364_10038715 Ga0075364_100387152 351
268 3300006175 Ga0070712_100048470 Ga0070712_1000484701 351
269 3300006177 Ga0075362_10000244 Ga0075362_100002448 351
270 3300006178 Ga0075367_10007814 Ga0075367_100078145 351
271 3300006195 Ga0075366_10006890 Ga0075366_100068905 351
272 3300006353 Ga0075370_10007318 Ga0075370_100073183 351
273 3300006358 Ga0068871_100083337 Ga0068871_1000833372 351
274 3300006847 Ga0075431_100029302 Ga0075431_1000293025 351
275 3300006852 Ga0075433_10047972 Ga0075433_100479724 351
276 3300006852 Ga0075433_10388799 Ga0075433_103887992 351
277 3300006871 Ga0075434_100015067 Ga0075434_1000150674 351
278 3300006871 Ga0075434_100179330 Ga0075434_1001793302 351
279 3300006871 Ga0075434_100247959 Ga0075434_1002479592 351
280 3300006880 Ga0075429_100087768 Ga0075429_1000877682 351
281 3300006881 Ga0068865_100000203 Ga0068865_10000020312 351
282 3300007076 Ga0075435_100047618 Ga0075435_1000476182 351
283 3300009098 Ga0105245_10000077 Ga0105245_1000007797 351
284 3300009098 Ga0105245_10000246 Ga0105245_1000024610 351
285 3300009147 Ga0114129_10119986 Ga0114129_101199862 351
286 3300009148 Ga0105243_10000600 Ga0105243_1000060014 351
287 3300009174 Ga0105241_10056481 Ga0105241_100564812 351
288 3300009176 Ga0105242_10001272 Ga0105242_1000127214 351
289 3300009176 Ga0105242_10071099 Ga0105242_100710992 351
290 3300009545 Ga0105237_10021575 Ga0105237_100215754 351
291 3300009551 Ga0105238_10000014 Ga0105238_1000001415 351
292 3300009551 Ga0105238_10089756 Ga0105238_100897562 351
293 3300009551 Ga0105238_10146222 Ga0105238_101462222 351
294 3300009551 Ga0105238_10163660 Ga0105238_101636602 351
295 3300009553 Ga0105249_10000007 Ga0105249_1000000788 351
296 3300009553 Ga0105249_10000159 Ga0105249_1000015951 351
297 3300009553 Ga0105249_10001010 Ga0105249_100010105 351
298 3300009553 Ga0105249_10372227 Ga0105249_103722272 351
299 3300010375 Ga0105239_10002392 Ga0105239_100023925 351
300 3300013296 Ga0157374_10065244 Ga0157374_100652442 351
301 3300013297 Ga0157378_10001806 Ga0157378_1000180614 351
302 3300013306 Ga0163162_10064142 Ga0163162_100641422 351
303 3300013307 Ga0157372_10210973 Ga0157372_102109732 351
304 3300013308 Ga0157375_10063462 Ga0157375_100634623 351
305 3300014325 Ga0163163_10421497 Ga0163163_104214972 351
306 3300014968 Ga0157379_10007342 Ga0157379_100073427 351
307 3300021388 Ga0213875_10093389 Ga0213875_100933892 351
308 3300025315 Ga0207697_10001937 Ga0207697_1000193710 351
309 3300025893 Ga0207682_10000090 Ga0207682_1000009014 351
310 3300025899 Ga0207642_10006535 Ga0207642_100065353 351
311 3300025901 Ga0207688_10050257 Ga0207688_100502572 351
312 3300025907 Ga0207645_10219350 Ga0207645_102193501 351
313 3300025909 Ga0207705_10002062 Ga0207705_100020628 351
314 3300025910 Ga0207684_10000411 Ga0207684_100004114 351
315 3300025910 Ga0207684_10008367 Ga0207684_100083671 351
316 3300025912 Ga0207707_10151495 Ga0207707_101514952 351
317 3300025914 Ga0207671_10004777 Ga0207671_100047779 351
318 3300025915 Ga0207693_10072733 Ga0207693_100727332 351
319 3300025915 Ga0207693_10076429 Ga0207693_100764292 351
320 3300025916 Ga0207663_10101178 Ga0207663_101011782 351
321 3300025922 Ga0207646_10001362 Ga0207646_100013623 351
322 3300025922 Ga0207646_10264216 Ga0207646_102642162 351
323 3300025922 Ga0207646_10318984 Ga0207646_103189841 351
324 3300025924 Ga0207694_10000008 Ga0207694_10000008223 351
325 3300025925 Ga0207650_10052928 Ga0207650_100529282 351
326 3300025926 Ga0207659_10159866 Ga0207659_101598662 351
327 3300025927 Ga0207687_10000012 Ga0207687_10000012231 351
328 3300025927 Ga0207687_10000325 Ga0207687_100003256 351
329 3300025927 Ga0207687_10005798 Ga0207687_100057982 351
330 3300025931 Ga0207644_10059742 Ga0207644_100597422 351
331 3300025932 Ga0207690_10071502 Ga0207690_100715022 351
332 3300025932 Ga0207690_10172434 Ga0207690_101724342 351
333 3300025933 Ga0207706_10000062 Ga0207706_1000006253 351
334 3300025934 Ga0207686_10000887 Ga0207686_1000088712 351
335 3300025934 Ga0207686_10085190 Ga0207686_100851902 351
336 3300025935 Ga0207709_10000563 Ga0207709_1000056316 351
337 3300025937 Ga0207669_10003913 Ga0207669_100039136 351
338 3300025938 Ga0207704_10002004 Ga0207704_100020046 351
339 3300025940 Ga0207691_10021057 Ga0207691_100210573 351
340 3300025944 Ga0207661_10006507 Ga0207661_100065078 351
341 3300025944 Ga0207661_10016311 Ga0207661_100163114 351
342 3300025949 Ga0207667_10376806 Ga0207667_103768062 351
343 3300025961 Ga0207712_10000003 Ga0207712_10000003231 351
344 3300025961 Ga0207712_10000024 Ga0207712_1000002449 351
345 3300025961 Ga0207712_10001243 Ga0207712_100012435 351
346 3300025961 Ga0207712_10070397 Ga0207712_100703972 351
347 3300025972 Ga0207668_10010765 Ga0207668_100107654 351
348 3300025972 Ga0207668_10027111 Ga0207668_100271112 351
349 3300025972 Ga0207668_10137316 Ga0207668_101373161 351
350 3300025981 Ga0207640_10002636 Ga0207640_1000263610 351
351 3300026023 Ga0207677_10000239 Ga0207677_1000023913 351
352 3300026035 Ga0207703_10000185 Ga0207703_1000018528 351
353 3300026075 Ga0207708_10059650 Ga0207708_100596502 351
354 3300026089 Ga0207648_10001973 Ga0207648_100019737 351
355 3300026089 Ga0207648_10370994 Ga0207648_103709942 351
356 3300026121 Ga0207683_10000577 Ga0207683_1000057718 351
357 3300026121 Ga0207683_10021755 Ga0207683_100217553 351
358 3300026142 Ga0207698_10205404 Ga0207698_102054042 351
359 3300028379 Ga0268266_10000023 Ga0268266_10000023114 351
360 3300029957 Ga0265324_10000259 Ga0265324_1000025923 351
361 3300031344 Ga0265316_10098465 Ga0265316_100984653 351
362 3300031731 Ga0307405_10048962 Ga0307405_100489622 351
363 3300031824 Ga0307413_10032842 Ga0307413_100328423 351
364 3300031852 Ga0307410_10007994 Ga0307410_100079945 351
365 3300031852 Ga0307410_10026170 Ga0307410_100261702 351
366 3300031901 Ga0307406_10160373 Ga0307406_101603732 351
367 3300031995 Ga0307409_100011355 Ga0307409_1000113553 351
368 3300031995 Ga0307409_100016885 Ga0307409_1000168852 351
369 3300032126 Ga0307415_100001128 Ga0307415_10000112811 351
370 3300035111 Ga0373923_0001414 Ga0373923_0001414_4490_5557 351
371 3300035170 Ga0373943_0101215 Ga0373943_0101215_90_1172 351
372 3300035695 Ga0373927_0211189 Ga0373927_0211189_152_1207 351
373 3300036401 Ga0373937_0011688 Ga0373937_0011688_2456_3523 351
374 3300036401 Ga0373937_0054004 Ga0373937_0054004_579_1652 351
375 3300037418 Ga0395900_0100697 Ga0395900_0100697_1488_2564 351
376 3300037466 Ga0395898_0003325 Ga0395898_0003325_3904_4980 351
377 3300037853 Ga0436364_0569377 Ga0436364_0569377_4362_5441 351
378 3300037853 Ga0436364_1122451 Ga0436364_1122451_3685_4749 351
379 3300038443 Ga0395901_0104812 Ga0395901_0104812_587_1660 351
380 3300039062 Ga0400483_026621 Ga0400483_026621_1007_2089 351
381 3300039062 Ga0400483_062586 Ga0400483_062586_9797_10882 351
382 3300039062 Ga0400483_289865 Ga0400483_289865_1036_2118 351
383 3300042435 Ga0439434_0018948 Ga0439434_0018948_182_1279 351
384 3300044684 Ga0466966_0001956 Ga0466966_0001956_11784_12857 351
385 3300044694 Ga0466963_0022182 Ga0466963_0022182_2374_3447 351
386 3300044694 Ga0466963_0264606 Ga0466963_0264606_29_1102 351
387 3300044842 Ga0466957_0050769 Ga0466957_0050769_1061_2134 351
388 3300045049 Ga0466959_0119933 Ga0466959_0119933_699_1769 351
389 3300045836 Ga0466958_0023501 Ga0466958_0023501_948_2021 351
390 3300046463 Ga0495653_0000479 Ga0495653_0000479_19313_20404 351
391 3300046473 Ga0495582_0049158 Ga0495582_0049158_1040_2122 351
392 3300046514 Ga0495618_0059609 Ga0495618_0059609_1123_2214 351
393 3300046515 Ga0495620_0000060 Ga0495620_0000060_43298_44371 351
394 3300046517 Ga0495630_0089116 Ga0495630_0089116_218_1309 351
395 3300046523 Ga0495644_0000299 Ga0495644_0000299_2302_3378 351
396 3300046537 Ga0495598_0043191 Ga0495598_0043191_196_1272 351
397 3300046663 Ga0495635_0006803 Ga0495635_0006803_2834_3925 351
398 3300046681 Ga0495647_0000006 Ga0495647_0000006_25805_26878 351
399 3300046684 Ga0495669_0000064 Ga0495669_0000064_14940_16013 351
400 3300047315 Ga0495581_0001103 Ga0495581_0001103_1346_2428 351
401 3300047471 Ga0495684_0023078 Ga0495684_0023078_1297_2388 351
402 3300048903 Ga0496100_0000004 Ga0496100_0000004_94478_95551 351
403 3300048903 Ga0496100_0018217 Ga0496100_0018217_972_2030 351
404 3300048903 Ga0496100_0021130 Ga0496100_0021130_138_1214 351
405 3300048904 Ga0496101_0000007 Ga0496101_0000007_94478_95551 351
406 3300048904 Ga0496101_0001156 Ga0496101_0001156_13156_14238 351
407 3300048905 Ga0496102_0000586 Ga0496102_0000586_13951_15033 351
408 3300048906 Ga0496103_0000588 Ga0496103_0000588_14451_15533 351
409 3300048907 Ga0496104_0000003 Ga0496104_0000003_449393_450469 351
410 3300048908 Ga0496105_0000008 Ga0496105_0000008_22398_23474 351
411 3300048908 Ga0496105_0165609 Ga0496105_0165609_198_1274 351
412 3300048909 Ga0496106_0000004 Ga0496106_0000004_55892_56965 351
413 3300048909 Ga0496106_0002424 Ga0496106_0002424_7612_8694 351
414 3300048910 Ga0496107_0000001 Ga0496107_0000001_94478_95551 351
415 3300048910 Ga0496107_0000571 Ga0496107_0000571_6419_7501 351
416 3300048911 Ga0496108_0000002 Ga0496108_0000002_516473_517546 351
417 3300048912 Ga0496109_0000001 Ga0496109_0000001_516435_517508 351
418 3300048912 Ga0496109_0003049 Ga0496109_0003049_1351_2424 351
419 3300048912 Ga0496109_0004828 Ga0496109_0004828_6929_7996 351
420 3300048913 Ga0496110_0089535 Ga0496110_0089535_1581_2654 351
421 3300048916 Ga0496113_0014131 Ga0496113_0014131_638_1711 351
422 3300048917 Ga0496114_0001166 Ga0496114_0001166_14417_15499 351
423 3300048917 Ga0496114_0037532 Ga0496114_0037532_1559_2617 351
424 3300048918 Ga0496115_0000068 Ga0496115_0000068_72192_73268 351
425 3300048918 Ga0496115_0001015 Ga0496115_0001015_13946_15028 351
426 3300048918 Ga0496115_0067467 Ga0496115_0067467_26_1084 351
427 3300048928 Ga0496125_0059332 Ga0496125_0059332_132_1205 351
428 3300049513 Ga0501290_002058 Ga0501290_002058_1309_2373 351
429 3300049521 Ga0501298_002700 Ga0501298_002700_1239_2303 351
430 3300049586 Ga0501070_0159956 Ga0501070_0159956_82_1161 351
431 3300049663 Ga0501223_004266 Ga0501223_004266_1003_2067 351
432 3300049686 Ga0501257_000140 Ga0501257_000140_2416_3480 351
433 3300049776 Ga0501280_000729 Ga0501280_000729_3863_4927 351
434 3300050489 nmdc:mga03683_7939_c1 nmdc:mga03683_7939_c1_1105_2178 351
435 3300050491 nmdc:mga00v17_37164_c1 nmdc:mga00v17_37164_c1_232_1305 351
436 3300050494 nmdc:mga06z11_78709_c1 nmdc:mga06z11_78709_c1_216_1289 351
437 3300050496 nmdc:mga07m45_19135_c1 nmdc:mga07m45_19135_c1_866_1939 351
438 3300050507 nmdc:mga05p37_262118_c1 nmdc:mga05p37_262118_c1_366_1439 351
439 3300050508 nmdc:mga09592_16235_c1 nmdc:mga09592_16235_c1_522_1595 351
440 3300050512 nmdc:mga0n895_305693_c1 nmdc:mga0n895_305693_c1_453_1526 351
441 3300050512 nmdc:mga0n895_78178_c1 nmdc:mga0n895_78178_c1_1038_2111 351
442 3300050515 nmdc:mga0a205_399119_c1 nmdc:mga0a205_399119_c1_72_1145 351
443 3300050515 nmdc:mga0a205_58387_c1 nmdc:mga0a205_58387_c1_709_1782 351
444 3300053077 Ga0495601_0000189 Ga0495601_0000189_5713_6786 351
445 3300053085 Ga0495619_0058543 Ga0495619_0058543_1179_2237 351
446 3300053085 Ga0495619_0211628 Ga0495619_0211628_135_1208 351
447 3300053087 Ga0500643_001044 Ga0500643_001044_11600_12664 351
448 3300059503 Ga0587080_004277 Ga0587080_004277_461_1540 351
449 3300059647 Ga0587079_003411 Ga0587079_003411_481_1560 351
450 3300060344 Ga0587071_007976 Ga0587071_007976_362_1441 351
451 3300061719 Ga0466962_0032224 Ga0466962_0032224_830_1903 351
452 3300061734 Ga0530510_0312054 Ga0530510_0312054_16_1089 351
453 3300000545 CNXas_1000073 CNXas_10000735 352
454 3300003203 JGI25406J46586_10000369 JGI25406J46586_1000036910 352
455 3300003911 JGI25405J52794_10000207 JGI25405J52794_100002072 352
456 3300005290 Ga0065712_10001564 Ga0065712_100015648 352
457 3300005293 Ga0065715_10091643 Ga0065715_100916432 352
458 3300005293 Ga0065715_10092928 Ga0065715_100929284 352
459 3300005293 Ga0065715_10219712 Ga0065715_102197121 352
460 3300005328 Ga0070676_10037383 Ga0070676_100373832 352
461 3300005328 Ga0070676_10206219 Ga0070676_102062191 352
462 3300005329 Ga0070683_100001907 Ga0070683_10000190710 352
463 3300005329 Ga0070683_100022218 Ga0070683_1000222184 352
464 3300005329 Ga0070683_100037248 Ga0070683_1000372483 352
465 3300005330 Ga0070690_100070718 Ga0070690_1000707183 352
466 3300005335 Ga0070666_10027666 Ga0070666_100276663 352
467 3300005336 Ga0070680_100023414 Ga0070680_1000234145 352
468 3300005337 Ga0070682_100032067 Ga0070682_1000320672 352
469 3300005338 Ga0068868_100041506 Ga0068868_1000415062 352
470 3300005339 Ga0070660_100045727 Ga0070660_1000457274 352
471 3300005340 Ga0070689_100042520 Ga0070689_1000425202 352
472 3300005343 Ga0070687_100037721 Ga0070687_1000377212 352
473 3300005344 Ga0070661_100006819 Ga0070661_1000068196 352
474 3300005344 Ga0070661_100071430 Ga0070661_1000714302 352
475 3300005347 Ga0070668_100124081 Ga0070668_1001240812 352
476 3300005355 Ga0070671_100061335 Ga0070671_1000613352 352
477 3300005355 Ga0070671_100162797 Ga0070671_1001627972 352
478 3300005364 Ga0070673_100053177 Ga0070673_1000531774 352
479 3300005364 Ga0070673_100053282 Ga0070673_1000532823 352
480 3300005365 Ga0070688_100021782 Ga0070688_1000217825 352
481 3300005366 Ga0070659_100163925 Ga0070659_1001639251 352
482 3300005366 Ga0070659_100200576 Ga0070659_1002005762 352
483 3300005366 Ga0070659_100241615 Ga0070659_1002416152 352
484 3300005367 Ga0070667_100080404 Ga0070667_1000804045 352
485 3300005367 Ga0070667_100267638 Ga0070667_1002676382 352
486 3300005406 Ga0070703_10002069 Ga0070703_100020694 352
487 3300005435 Ga0070714_100138695 Ga0070714_1001386952 352
488 3300005435 Ga0070714_100156814 Ga0070714_1001568141 352
489 3300005436 Ga0070713_100393615 Ga0070713_1003936151 352
490 3300005440 Ga0070705_100064945 Ga0070705_1000649452 352
491 3300005441 Ga0070700_100024189 Ga0070700_1000241892 352
492 3300005444 Ga0070694_100205260 Ga0070694_1002052602 352
493 3300005445 Ga0070708_100001595 Ga0070708_10000159513 352
494 3300005445 Ga0070708_100008010 Ga0070708_1000080104 352
495 3300005445 Ga0070708_100059876 Ga0070708_1000598763 352
496 3300005445 Ga0070708_100229856 Ga0070708_1002298562 352
497 3300005445 Ga0070708_100386765 Ga0070708_1003867651 352
498 3300005455 Ga0070663_100095086 Ga0070663_1000950862 352
499 3300005456 Ga0070678_100092441 Ga0070678_1000924412 352
500 3300005457 Ga0070662_100058946 Ga0070662_1000589462 352
501 3300005458 Ga0070681_10005422 Ga0070681_100054227 352
502 3300005458 Ga0070681_10041890 Ga0070681_100418902 352
503 3300005466 Ga0070685_10082671 Ga0070685_100826712 352
504 3300005467 Ga0070706_100026208 Ga0070706_1000262083 352
505 3300005467 Ga0070706_100271144 Ga0070706_1002711442 352
506 3300005467 Ga0070706_100362112 Ga0070706_1003621121 352
507 3300005468 Ga0070707_100001078 Ga0070707_10000107818 352
508 3300005468 Ga0070707_100004157 Ga0070707_10000415710 352
509 3300005468 Ga0070707_100014990 Ga0070707_1000149905 352
510 3300005468 Ga0070707_100044119 Ga0070707_1000441193 352
511 3300005468 Ga0070707_100069262 Ga0070707_1000692623 352
512 3300005471 Ga0070698_100001334 Ga0070698_1000013347 352
513 3300005471 Ga0070698_100186388 Ga0070698_1001863881 352
514 3300005518 Ga0070699_100050680 Ga0070699_1000506803 352
515 3300005530 Ga0070679_100033431 Ga0070679_1000334316 352
516 3300005530 Ga0070679_100068070 Ga0070679_1000680703 352
517 3300005535 Ga0070684_100000344 Ga0070684_1000003444 352
518 3300005535 Ga0070684_100020450 Ga0070684_1000204504 352
519 3300005535 Ga0070684_100099580 Ga0070684_1000995802 352
520 3300005535 Ga0070684_100182681 Ga0070684_1001826811 352
521 3300005536 Ga0070697_100000919 Ga0070697_1000009199 352
522 3300005536 Ga0070697_100212464 Ga0070697_1002124642 352
523 3300005543 Ga0070672_100066961 Ga0070672_1000669613 352
524 3300005544 Ga0070686_100001318 Ga0070686_1000013184 352
525 3300005544 Ga0070686_100071377 Ga0070686_1000713772 352
526 3300005548 Ga0070665_100035904 Ga0070665_1000359043 352
527 3300005563 Ga0068855_100370933 Ga0068855_1003709332 352
528 3300005564 Ga0070664_100062150 Ga0070664_1000621502 352
529 3300005577 Ga0068857_100148049 Ga0068857_1001480491 352
530 3300005578 Ga0068854_100003346 Ga0068854_1000033464 352
531 3300005614 Ga0068856_100007184 Ga0068856_1000071846 352
532 3300005614 Ga0068856_100078338 Ga0068856_1000783383 352
533 3300005615 Ga0070702_100082104 Ga0070702_1000821042 352
534 3300005617 Ga0068859_100173982 Ga0068859_1001739822 352
535 3300005618 Ga0068864_100043576 Ga0068864_1000435763 352
536 3300005841 Ga0068863_100001547 Ga0068863_10000154710 352
537 3300005842 Ga0068858_100003324 Ga0068858_1000033245 352
538 3300005842 Ga0068858_100402528 Ga0068858_1004025281 352
539 3300005843 Ga0068860_100024202 Ga0068860_1000242025 352
540 3300005843 Ga0068860_100024497 Ga0068860_1000244972 352
541 3300005937 Ga0081455_10000878 Ga0081455_1000087820 352
542 3300005937 Ga0081455_10004775 Ga0081455_1000477511 352
543 3300005937 Ga0081455_10026476 Ga0081455_100264765 352
544 3300005983 Ga0081540_1058468 Ga0081540_10584682 352
545 3300005985 Ga0081539_10000138 Ga0081539_1000013810 352
546 3300005985 Ga0081539_10001786 Ga0081539_1000178618 352
547 3300005985 Ga0081539_10014279 Ga0081539_100142792 352
548 3300006028 Ga0070717_10007906 Ga0070717_100079066 352
549 3300006028 Ga0070717_10385665 Ga0070717_103856651 352
550 3300006173 Ga0070716_100076322 Ga0070716_1000763223 352
551 3300006175 Ga0070712_100012358 Ga0070712_1000123583 352
552 3300006175 Ga0070712_100175589 Ga0070712_1001755892 352
553 3300006358 Ga0068871_100034943 Ga0068871_1000349432 352
554 3300006844 Ga0075428_100008564 Ga0075428_1000085642 352
555 3300006871 Ga0075434_100164307 Ga0075434_1001643072 352
556 3300006881 Ga0068865_100042150 Ga0068865_1000421502 352
557 3300006914 Ga0075436_100102150 Ga0075436_1001021501 352
558 3300006931 Ga0097620_100173995 Ga0097620_1001739952 352
559 3300007076 Ga0075435_100336794 Ga0075435_1003367942 352
560 3300009093 Ga0105240_10177880 Ga0105240_101778801 352
561 3300009094 Ga0111539_10162842 Ga0111539_101628422 352
562 3300009098 Ga0105245_10002646 Ga0105245_100026469 352
563 3300009098 Ga0105245_10292919 Ga0105245_102929191 352
564 3300009101 Ga0105247_10057996 Ga0105247_100579962 352
565 3300009147 Ga0114129_10615890 Ga0114129_106158902 352
566 3300009174 Ga0105241_10053365 Ga0105241_100533652 352
567 3300009176 Ga0105242_10035345 Ga0105242_100353453 352
568 3300009177 Ga0105248_10058920 Ga0105248_100589203 352
569 3300009553 Ga0105249_10293578 Ga0105249_102935781 352
570 3300010375 Ga0105239_10360545 Ga0105239_103605452 352
571 3300011119 Ga0105246_10052091 Ga0105246_100520914 352
572 3300013105 Ga0157369_10181276 Ga0157369_101812762 352
573 3300013296 Ga0157374_10002924 Ga0157374_100029243 352
574 3300013296 Ga0157374_10008085 Ga0157374_100080853 352
575 3300013296 Ga0157374_10111312 Ga0157374_101113122 352
576 3300013297 Ga0157378_10002051 Ga0157378_100020518 352
577 3300013297 Ga0157378_10006138 Ga0157378_100061383 352
578 3300013297 Ga0157378_10017866 Ga0157378_100178665 352
579 3300013297 Ga0157378_10462137 Ga0157378_104621372 352
580 3300013306 Ga0163162_10010416 Ga0163162_100104162 352
581 3300013308 Ga0157375_10003763 Ga0157375_100037634 352
582 3300013308 Ga0157375_10069598 Ga0157375_100695982 352
583 3300013308 Ga0157375_10490189 Ga0157375_104901892 352
584 3300014325 Ga0163163_10084342 Ga0163163_100843422 352
585 3300014745 Ga0157377_10007781 Ga0157377_100077814 352
586 3300014745 Ga0157377_10038886 Ga0157377_100388863 352
587 3300014969 Ga0157376_10011942 Ga0157376_100119425 352
588 3300014969 Ga0157376_10024206 Ga0157376_100242065 352
589 3300014969 Ga0157376_10087585 Ga0157376_100875853 352
590 3300014969 Ga0157376_10117520 Ga0157376_101175202 352
591 3300020080 Ga0206350_11484488 Ga0206350_114844882 352
592 3300022467 Ga0224712_10000396 Ga0224712_100003962 352
593 3300025290 Ga0207673_1002046 Ga0207673_10020462 352
594 3300025315 Ga0207697_10000218 Ga0207697_1000021820 352
595 3300025315 Ga0207697_10000653 Ga0207697_100006538 352
596 3300025315 Ga0207697_10000931 Ga0207697_100009317 352
597 3300025321 Ga0207656_10114981 Ga0207656_101149812 352
598 3300025903 Ga0207680_10067711 Ga0207680_100677112 352
599 3300025903 Ga0207680_10095094 Ga0207680_100950942 352
600 3300025904 Ga0207647_10007107 Ga0207647_100071075 352
601 3300025910 Ga0207684_10008585 Ga0207684_100085851 352
602 3300025910 Ga0207684_10030332 Ga0207684_100303324 352
603 3300025910 Ga0207684_10048304 Ga0207684_100483043 352
604 3300025910 Ga0207684_10224653 Ga0207684_102246531 352
605 3300025910 Ga0207684_10328179 Ga0207684_103281792 352
606 3300025911 Ga0207654_10047896 Ga0207654_100478962 352
607 3300025912 Ga0207707_10007665 Ga0207707_100076654 352
608 3300025915 Ga0207693_10019169 Ga0207693_100191693 352
609 3300025915 Ga0207693_10245249 Ga0207693_102452491 352
610 3300025918 Ga0207662_10057219 Ga0207662_100572192 352
611 3300025919 Ga0207657_10046056 Ga0207657_100460562 352
612 3300025920 Ga0207649_10031067 Ga0207649_100310671 352
613 3300025920 Ga0207649_10038413 Ga0207649_100384132 352
614 3300025921 Ga0207652_10019090 Ga0207652_100190903 352
615 3300025921 Ga0207652_10042839 Ga0207652_100428393 352
616 3300025922 Ga0207646_10000108 Ga0207646_1000010898 352
617 3300025922 Ga0207646_10001652 Ga0207646_1000165212 352
618 3300025922 Ga0207646_10011599 Ga0207646_100115993 352
619 3300025922 Ga0207646_10022496 Ga0207646_100224965 352
620 3300025922 Ga0207646_10074972 Ga0207646_100749723 352
621 3300025922 Ga0207646_10091277 Ga0207646_100912772 352
622 3300025926 Ga0207659_10026094 Ga0207659_100260942 352
623 3300025926 Ga0207659_10040426 Ga0207659_100404262 352
624 3300025927 Ga0207687_10004999 Ga0207687_100049996 352
625 3300025931 Ga0207644_10062620 Ga0207644_100626203 352
626 3300025931 Ga0207644_10136420 Ga0207644_101364202 352
627 3300025932 Ga0207690_10071060 Ga0207690_100710603 352
628 3300025936 Ga0207670_10011099 Ga0207670_100110995 352
629 3300025939 Ga0207665_10089264 Ga0207665_100892642 352
630 3300025942 Ga0207689_10002161 Ga0207689_1000216116 352
631 3300025944 Ga0207661_10008469 Ga0207661_100084692 352
632 3300025944 Ga0207661_10034524 Ga0207661_100345243 352
633 3300025944 Ga0207661_10065885 Ga0207661_100658851 352
634 3300025945 Ga0207679_10028605 Ga0207679_100286052 352
635 3300025949 Ga0207667_10299460 Ga0207667_102994602 352
636 3300025972 Ga0207668_10106167 Ga0207668_101061672 352
637 3300025981 Ga0207640_10155817 Ga0207640_101558172 352
638 3300025986 Ga0207658_10063848 Ga0207658_100638482 352
639 3300026023 Ga0207677_10010204 Ga0207677_100102042 352
640 3300026023 Ga0207677_10073018 Ga0207677_100730182 352
641 3300026035 Ga0207703_10004158 Ga0207703_1000415813 352
642 3300026035 Ga0207703_10040016 Ga0207703_100400163 352
643 3300026035 Ga0207703_10349997 Ga0207703_103499972 352
644 3300026067 Ga0207678_10121444 Ga0207678_101214442 352
645 3300026067 Ga0207678_10125800 Ga0207678_101258002 352
646 3300026075 Ga0207708_10046432 Ga0207708_100464323 352
647 3300026078 Ga0207702_10006523 Ga0207702_100065236 352
648 3300026088 Ga0207641_10057885 Ga0207641_100578854 352
649 3300026088 Ga0207641_10064296 Ga0207641_100642963 352
650 3300026089 Ga0207648_10011222 Ga0207648_100112223 352
651 3300026095 Ga0207676_10037434 Ga0207676_100374343 352
652 3300026116 Ga0207674_10073915 Ga0207674_100739153 352
653 3300026116 Ga0207674_10228565 Ga0207674_102285652 352
654 3300026121 Ga0207683_10014124 Ga0207683_100141245 352
655 3300027907 Ga0207428_10109092 Ga0207428_101090922 352
656 3300028016 Ga0265354_1002414 Ga0265354_10024142 352
657 3300028379 Ga0268266_10051158 Ga0268266_100511584 352
658 3300028379 Ga0268266_10071700 Ga0268266_100717002 352
659 3300028379 Ga0268266_10355927 Ga0268266_103559273 352
660 3300028381 Ga0268264_10002175 Ga0268264_1000217511 352
661 3300031456 Ga0307513_10084123 Ga0307513_100841233 352
662 3300031507 Ga0307509_10026563 Ga0307509_100265632 352
663 3300031507 Ga0307509_10161092 Ga0307509_101610923 352
664 3300031548 Ga0307408_100079087 Ga0307408_1000790872 352
665 3300031730 Ga0307516_10000246 Ga0307516_1000024630 352
666 3300031730 Ga0307516_10093224 Ga0307516_100932243 352
667 3300035120 Ga0373957_0039621 Ga0373957_0039621_237_1343 352
668 3300035692 Ga0373935_0019215 Ga0373935_0019215_943_2049 352
669 3300035695 Ga0373927_0003847 Ga0373927_0003847_4771_5877 352
670 3300036401 Ga0373937_0082721 Ga0373937_0082721_1778_2884 352
671 3300037418 Ga0395900_0002199 Ga0395900_0002199_5719_6780 352
672 3300037466 Ga0395898_0010931 Ga0395898_0010931_6698_7759 352
673 3300037471 Ga0395905_0013608 Ga0395905_0013608_6190_7251 352
674 3300038443 Ga0395901_0001234 Ga0395901_0001234_20712_21773 352
675 3300038443 Ga0395901_0022192 Ga0395901_0022192_2724_3785 352
676 3300039062 Ga0400483_021979 Ga0400483_021979_23982_25052 352
677 3300039062 Ga0400483_162332 Ga0400483_162332_23976_25046 352
678 3300039447 Ga0436361_0301618 Ga0436361_0301618_1901_2980 352
679 3300039447 Ga0436361_1038034 Ga0436361_1038034_7249_8361 352
680 3300041999 Ga0439433_0016924 Ga0439433_0016924_289_1359 352
681 3300044673 Ga0453683_0003589 Ga0453683_0003589_3438_4505 352
682 3300045051 Ga0451576_0014850 Ga0451576_0014850_343_1410 352
683 3300045051 Ga0451576_0021161 Ga0451576_0021161_1393_2481 352
684 3300045976 Ga0466967_0000138 Ga0466967_0000138_6028_7146 352
685 3300046454 Ga0495592_0114261 Ga0495592_0114261_136_1242 352
686 3300046461 Ga0495641_0063025 Ga0495641_0063025_288_1352 352
687 3300046462 Ga0495651_0004272 Ga0495651_0004272_839_1945 352
688 3300046463 Ga0495653_0025443 Ga0495653_0025443_1185_2291 352
689 3300046472 Ga0495580_0008029 Ga0495580_0008029_6523_7629 352
690 3300046473 Ga0495582_0071734 Ga0495582_0071734_266_1330 352
691 3300046516 Ga0495628_0073153 Ga0495628_0073153_1055_2161 352
692 3300046517 Ga0495630_0005350 Ga0495630_0005350_6602_7708 352
693 3300046531 Ga0495665_0000454 Ga0495665_0000454_1993_3099 352
694 3300046543 Ga0495645_0046588 Ga0495645_0046588_518_1624 352
695 3300046642 Ga0495634_0000838 Ga0495634_0000838_28135_29241 352
696 3300046675 Ga0495657_0005388 Ga0495657_0005388_1450_2556 352
697 3300046680 Ga0495646_0002154 Ga0495646_0002154_4529_5635 352
698 3300046689 Ga0495613_0030415 Ga0495613_0030415_2858_3964 352
699 3300046690 Ga0495624_0008216 Ga0495624_0008216_2726_3832 352
700 3300047315 Ga0495581_0023765 Ga0495581_0023765_404_1468 352
701 3300047317 Ga0495604_0024946 Ga0495604_0024946_951_2057 352
702 3300047319 Ga0495674_0005650 Ga0495674_0005650_8175_9281 352
703 3300047444 Ga0495675_0000865 Ga0495675_0000865_15683_16789 352
704 3300047673 Ga0495593_0015748 Ga0495593_0015748_2685_3791 352
705 3300048088 Ga0495602_0065594 Ga0495602_0065594_364_1470 352
706 3300048089 Ga0495614_0008037 Ga0495614_0008037_1433_2539 352
707 3300048905 Ga0496102_0068149 Ga0496102_0068149_1558_2661 352
708 3300048905 Ga0496102_0282475 Ga0496102_0282475_77_1270 352
709 3300048906 Ga0496103_0011399 Ga0496103_0011399_2809_3912 352
710 3300048907 Ga0496104_0006256 Ga0496104_0006256_1453_2556 352
711 3300048907 Ga0496104_0042147 Ga0496104_0042147_2051_3136 352
712 3300048907 Ga0496104_0070285 Ga0496104_0070285_1257_2318 352
713 3300048907 Ga0496104_0167390 Ga0496104_0167390_850_1956 352
714 3300048909 Ga0496106_0078382 Ga0496106_0078382_1167_2228 352
715 3300048909 Ga0496106_0234622 Ga0496106_0234622_262_1329 352
716 3300048911 Ga0496108_0025876 Ga0496108_0025876_1889_2950 352
717 3300048913 Ga0496110_0350734 Ga0496110_0350734_225_1301 352
718 3300048914 Ga0496111_0054176 Ga0496111_0054176_701_1768 352
719 3300048915 Ga0496112_0001254 Ga0496112_0001254_12052_13137 352
720 3300048915 Ga0496112_0107618 Ga0496112_0107618_1052_2113 352
721 3300048917 Ga0496114_0000687 Ga0496114_0000687_9609_10712 352
722 3300048917 Ga0496114_0012761 Ga0496114_0012761_2799_3860 352
723 3300048918 Ga0496115_0178257 Ga0496115_0178257_149_1210 352
724 3300049574 Ga0501038_0070765 Ga0501038_0070765_1168_2244 352
725 3300049587 Ga0501071_0107275 Ga0501071_0107275_480_1547 352
726 3300049592 Ga0501076_0069462 Ga0501076_0069462_831_1898 352
727 3300049743 Ga0501081_0134592 Ga0501081_0134592_641_1708 352
728 3300049824 Ga0501045_0049495 Ga0501045_0049495_1769_2836 352
729 3300050507 nmdc:mga05p37_51110_c1 nmdc:mga05p37_51110_c1_2067_3149 352
730 3300050509 nmdc:mga0qj67_148751_c1 nmdc:mga0qj67_148751_c1_193_1266 352
731 3300050511 nmdc:mga08y16_143040_c1 nmdc:mga08y16_143040_c1_192_1265 352
732 3300050512 nmdc:mga0n895_226967_c1 nmdc:mga0n895_226967_c1_414_1496 352
733 3300050513 nmdc:mga0rr50_128855_c1 nmdc:mga0rr50_128855_c1_695_1777 352
734 3300053077 Ga0495601_0037793 Ga0495601_0037793_389_1465 352
735 3300053078 Ga0495612_0006562 Ga0495612_0006562_2881_3987 352
736 3300053085 Ga0495619_0177120 Ga0495619_0177120_203_1285 352
737 3300053088 Ga0500644_0000169 Ga0500644_0000169_19523_20584 352
738 3300053153 Ga0500616_0017460 Ga0500616_0017460_149_1222 352

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04321

RmlD_sub_bind

RmlD substrate binding domain

32

228

0.91

PF01370

Epimerase

NAD dependent epimerase/dehydratase family

33

307

0.9

PF16363

GDP_Man_Dehyd

GDP-mannose 4,6 dehydratase

34

374

0.79

PF07993

NAD_binding_4

Male sterility protein

100

289

0.74

PF01073

3Beta_HSD

3-beta hydroxysteroid dehydrogenase/isomerase family

34

205

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
1orr-assembly3.cif.gz_C crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.9395 3 350
1orr-assembly1.cif.gz_A crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.9319 3 350
1orr-assembly3.cif.gz_C crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.9314 3 350
1orr-assembly2.cif.gz_D crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.9292 3 350
1orr-assembly1.cif.gz_A crystal structure of cdp-tyvelose 2-epimerase complexed with nad and cdp 0.9239 3 350
ID Description Score Start End Superfamily
1orrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9292 3 350 3.40.50.720
1orrD00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9212 3 350 3.40.50.720
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.918 1 351 3.40.50.720
af_B5BM30_1_361_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9114 1 33 3.50.50.60
af_Q2G289_4_319_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9013 1 351 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A2V5N5E8-F1-model_v4 NAD-dependent epimerase 0.9973 1 349
AF-A0A2V6DPF0-F1-model_v4 NAD-dependent epimerase 0.9955 1 348
AF-A0A7W1JDD0-F1-model_v4 NAD-dependent epimerase/dehydratase family protein 0.9954 1 350
AF-A0A7C8BED1-F1-model_v4 deleted 0.9935 1 347
AF-A0A1F4UQD2-F1-model_v4 NAD-dependent epimerase/dehydratase domain-containing protein 0.9933 2 348

Feature Viewer

pLDDT pTM Quality
93.63 0.93 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map