F478334

General Info

Members Datasets Scaffolds Average Seq Length
737 457 1474 101

Family's Representative Sequence

Representative Sequence 3300030521|Ga0307511_10021783|Ga0307511_100217837
Length 114
Sequence MPVDEYIVDWQTDYMIDLAALQALGNDRRLQILDWLKDPAAHFRPQVDGDLIKDGVCAALIAEKLGISQPTLSEHMRVLSQAGLVQSKRIKQWTFYKRDETRIREIKRSLARNL

Samples

Sample ID Description Type Environment
1 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
6 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
7 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
8 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
32 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
35 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
56 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
57 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
82 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
83 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
130 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
133 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
134 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
135 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
136 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
137 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
138 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
204 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
205 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
206 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
207 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
208 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
209 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
210 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
211 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
212 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
213 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
214 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
215 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
216 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
217 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
218 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
219 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
220 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
221 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
222 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
223 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
224 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
225 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
226 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
227 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
232 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
233 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
234 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
235 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
236 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
237 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
240 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
241 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
242 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
245 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
246 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
247 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
248 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
249 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
250 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
251 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
254 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
255 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
256 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
257 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
258 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
259 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
260 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
261 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
262 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
263 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
264 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
265 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
266 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
267 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
268 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
269 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
270 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
271 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
272 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
273 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
274 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
275 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
276 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
280 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
281 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
282 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
283 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
284 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
285 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
286 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
287 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
288 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
289 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
290 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
291 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
292 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
293 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
294 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
295 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
296 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
297 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
298 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
306 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
307 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
308 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
309 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
310 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
311 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
312 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
313 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
314 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
315 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
316 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
317 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
318 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
319 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
320 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
321 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
322 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
323 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
324 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
325 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
326 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
327 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
329 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
330 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
331 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
332 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
333 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
334 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
335 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
336 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
337 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
338 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
339 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
340 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
341 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
342 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
343 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
344 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
345 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
346 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
347 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
348 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
349 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
350 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
351 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
352 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
353 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
354 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
355 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
356 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
357 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
358 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
359 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
360 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
361 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
362 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
363 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
364 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
365 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
366 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
367 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
368 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
369 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
370 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
371 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
372 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
373 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
374 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
375 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
376 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
377 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
378 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
379 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
380 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
381 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
382 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
383 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
384 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
385 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
386 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
387 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
388 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
389 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
390 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
391 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
392 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
393 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
394 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
395 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
396 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
397 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
398 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
399 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
400 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
401 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
402 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
403 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
404 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
405 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
406 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
407 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
408 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
409 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
410 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
411 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
412 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
413 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
414 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
415 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
416 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
417 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
418 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
419 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
420 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
421 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
422 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
423 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
424 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
425 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
426 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
427 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
428 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
429 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
430 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
431 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
432 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
433 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
434 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
435 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
436 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
437 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
438 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
439 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
440 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
441 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
442 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
443 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
444 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
445 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
446 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
447 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
448 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
449 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
450 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
451 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
452 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
453 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
454 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
455 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
456 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
457 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 86.57
Metatranscriptomes 0.14
Isolates 13.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.72
Nodule 10.72
Rhizoplane 1.9
Rhizosphere 70.42
Stem 0
Stem Tuber 0
Unclassified 4.34

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307511_10021783 3300030521 Bacteria 6019
2 JGI24740J21852_10143765 3300001979 Bacteria 593
3 JGI24739J22299_10010075 3300001989 Bacteria 3512
4 JGI24737J22298_10209159 3300001990 Bacteria 576
5 JGI24735J21928_10034581 3300002067 Bacteria 1489
6 JGI24735J21928_10144021 3300002067 Bacteria 688
7 JGI25157J39369_1002844 3300002741 Bacteria 3908
8 JGI25406J46586_10042112 3300003203 Bacteria 1601
9 JGI25404J52841_10006480 3300003659 Bacteria 2452
10 JGI25404J52841_10140927 3300003659 Unclassified 511
11 Ga0070658_10075042 3300005327 Bacteria 2774
12 Ga0070676_10221905 3300005328 Bacteria 1249
13 Ga0070676_10486082 3300005328 Bacteria 874
14 Ga0070676_10732052 3300005328 Bacteria 725
15 Ga0070683_101720009 3300005329 Bacteria 603
16 Ga0070690_100000696 3300005330 Bacteria 17233
17 Ga0070690_100714071 3300005330 Bacteria 771
18 Ga0068869_100001460 3300005334 Bacteria 13997
19 Ga0068869_100224722 3300005334 Bacteria 1489
20 Ga0070666_10169352 3300005335 Bacteria 1529
21 Ga0070680_100000230 3300005336 Bacteria 36894
22 Ga0070680_101629324 3300005336 Bacteria 559
23 Ga0070682_100920393 3300005337 Bacteria 720
24 Ga0068868_100015723 3300005338 Bacteria 5605
25 Ga0068868_100509114 3300005338 Bacteria 1055
26 Ga0070660_100054680 3300005339 Bacteria 3083
27 Ga0070660_100917731 3300005339 Bacteria 739
28 Ga0070689_100001581 3300005340 Bacteria 14522
29 Ga0070689_100028549 3300005340 Bacteria 4218
30 Ga0070689_100385654 3300005340 Bacteria 1182
31 Ga0070691_10001108 3300005341 Bacteria 11205
32 Ga0070691_10198998 3300005341 Bacteria 1052
33 Ga0070687_100005995 3300005343 Bacteria 4951
34 Ga0070661_100230272 3300005344 Bacteria 1424
35 Ga0070692_10669085 3300005345 Bacteria 695
36 Ga0070668_100228985 3300005347 Bacteria 1536
37 Ga0070668_101538543 3300005347 Bacteria 608
38 Ga0070669_100201389 3300005353 Bacteria 1567
39 Ga0070674_101038866 3300005356 Bacteria 721
40 Ga0070673_100113525 3300005364 Bacteria 2250
41 Ga0070673_100200807 3300005364 Bacteria 1717
42 Ga0070673_102269997 3300005364 Bacteria 516
43 Ga0070688_100090716 3300005365 Bacteria 1996
44 Ga0070688_100185656 3300005365 Bacteria 1445
45 Ga0070688_100354544 3300005365 Bacteria 1075
46 Ga0070659_100792183 3300005366 Bacteria 824
47 Ga0070659_100862160 3300005366 Bacteria 790
48 Ga0070659_102101717 3300005366 Bacteria 508
49 Ga0070667_100512494 3300005367 Bacteria 1100
50 Ga0070667_100974183 3300005367 Bacteria 791
51 Ga0070667_101430499 3300005367 Bacteria 649
52 Ga0070703_10020485 3300005406 Bacteria 1924
53 Ga0070709_10290866 3300005434 Bacteria 1190
54 Ga0070709_11229271 3300005434 Bacteria 603
55 Ga0070713_100027187 3300005436 Bacteria 4502
56 Ga0070710_10060241 3300005437 Bacteria 2159
57 Ga0070701_10000101 3300005438 Bacteria 24234
58 Ga0070711_100393164 3300005439 Bacteria 1124
59 Ga0070705_100000610 3300005440 Bacteria 20692
60 Ga0070705_100901387 3300005440 Bacteria 711
61 Ga0070705_101017363 3300005440 Unclassified 673
62 Ga0070700_100000280 3300005441 Bacteria 27286
63 Ga0070700_100566892 3300005441 Bacteria 885
64 Ga0070700_101146057 3300005441 Bacteria 647
65 Ga0070694_100001047 3300005444 Bacteria 15786
66 Ga0070708_100206340 3300005445 Bacteria 1841
67 Ga0070708_100637943 3300005445 Bacteria 1004
68 Ga0070708_100742635 3300005445 Bacteria 923
69 Ga0070663_100562228 3300005455 Bacteria 955
70 Ga0070678_100029184 3300005456 Bacteria 3774
71 Ga0070678_100435931 3300005456 Bacteria 1145
72 Ga0070662_100664840 3300005457 Bacteria 879
73 Ga0070681_10499963 3300005458 Bacteria 1129
74 Ga0068867_100000225 3300005459 Bacteria 37110
75 Ga0070698_100526299 3300005471 Bacteria 1121
76 Ga0070679_100017000 3300005530 Bacteria 7032
77 Ga0070684_100406370 3300005535 Bacteria 1256
78 Ga0070684_100752142 3300005535 Bacteria 910
79 Ga0068853_100126648 3300005539 Bacteria 2282
80 Ga0068853_100265727 3300005539 Bacteria 1578
81 Ga0068853_100639917 3300005539 Bacteria 1012
82 Ga0068853_100719935 3300005539 Bacteria 953
83 Ga0068853_101585859 3300005539 Bacteria 634
84 Ga0070672_100326520 3300005543 Bacteria 1305
85 Ga0070686_100002476 3300005544 Bacteria 10166
86 Ga0070686_100354594 3300005544 Bacteria 1103
87 Ga0070695_100000408 3300005545 Bacteria 22184
88 Ga0070696_100000061 3300005546 Bacteria 52371
89 Ga0070696_100004202 3300005546 Bacteria 9592
90 Ga0070696_100409935 3300005546 Bacteria 1062
91 Ga0070693_100000016 3300005547 Bacteria 63019
92 Ga0070665_100763821 3300005548 Bacteria 980
93 Ga0070704_100000587 3300005549 Bacteria 17511
94 Ga0070704_100090161 3300005549 Bacteria 2283
95 Ga0068855_100018082 3300005563 Bacteria 8471
96 Ga0068855_100096405 3300005563 Bacteria 3408
97 Ga0068855_100345911 3300005563 Bacteria 1639
98 Ga0068855_100740775 3300005563 Bacteria 1049
99 Ga0068857_100258241 3300005577 Bacteria 1599
100 Ga0068857_101847193 3300005577 Bacteria 592
101 Ga0068854_100008405 3300005578 Bacteria 6635
102 Ga0068854_100510551 3300005578 Bacteria 1014
103 Ga0068854_101278452 3300005578 Bacteria 660
104 Ga0068856_100153708 3300005614 Bacteria 2311
105 Ga0068856_100817012 3300005614 Bacteria 952
106 Ga0070702_100000017 3300005615 Bacteria 47208
107 Ga0068852_100043637 3300005616 Bacteria 3804
108 Ga0068852_100273617 3300005616 Bacteria 1626
109 Ga0068859_100000738 3300005617 Bacteria 32951
110 Ga0068859_100055291 3300005617 Bacteria 3994
111 Ga0068859_100512644 3300005617 Bacteria 1294
112 Ga0068859_100585798 3300005617 Bacteria 1209
113 Ga0068864_100258942 3300005618 Bacteria 1618
114 Ga0068866_10000586 3300005718 Bacteria 16569
115 Ga0068866_10035434 3300005718 Bacteria 2438
116 Ga0068861_100000309 3300005719 Bacteria 27335
117 Ga0068861_101702410 3300005719 Bacteria 624
118 Ga0068870_10618947 3300005840 Bacteria 738
119 Ga0068870_10750703 3300005840 Bacteria 677
120 Ga0068863_100309766 3300005841 Bacteria 1532
121 Ga0068863_101059414 3300005841 Bacteria 815
122 Ga0068863_102108907 3300005841 Bacteria 574
123 Ga0068863_102290809 3300005841 Unclassified 550
124 Ga0068858_100001011 3300005842 Bacteria 28980
125 Ga0068858_100190884 3300005842 Bacteria 1936
126 Ga0068858_101518695 3300005842 Bacteria 661
127 Ga0068860_100005129 3300005843 Bacteria 13321
128 Ga0068860_100054093 3300005843 Bacteria 3816
129 Ga0068862_100007976 3300005844 Bacteria 8759
130 Ga0068862_100015096 3300005844 Bacteria 6417
131 Ga0068862_100501726 3300005844 Bacteria 1152
132 Ga0068862_100579796 3300005844 Bacteria 1074
133 Ga0081455_10024687 3300005937 Bacteria 5561
134 Ga0081538_10061134 3300005981 Bacteria 2159
135 Ga0081540_1000956 3300005983 Bacteria 26046
136 Ga0081540_1007782 3300005983 Bacteria 7584
137 Ga0081540_1037511 3300005983 Bacteria 2568
138 Ga0081539_10078485 3300005985 Bacteria 1743
139 Ga0070717_10543525 3300006028 Bacteria 1052
140 Ga0070717_11787827 3300006028 Unclassified 556
141 Ga0075365_10003700 3300006038 Bacteria 7946
142 Ga0075365_10076578 3300006038 Bacteria 2259
143 Ga0075365_10091981 3300006038 Bacteria 2067
144 Ga0075365_10404529 3300006038 Unclassified 963
145 Ga0075368_10052282 3300006042 Bacteria 1625
146 Ga0075368_10151502 3300006042 Bacteria 969
147 Ga0075368_10171783 3300006042 Bacteria 911
148 Ga0075363_100068278 3300006048 Bacteria 1928
149 Ga0075363_100104438 3300006048 Unclassified 1570
150 Ga0075363_100385056 3300006048 Bacteria 823
151 Ga0075363_100833768 3300006048 Bacteria 562
152 Ga0075364_10097462 3300006051 Bacteria 1956
153 Ga0075364_10161644 3300006051 Bacteria 1512
154 Ga0075364_10298360 3300006051 Bacteria 1097
155 Ga0075364_10360025 3300006051 Bacteria 992
156 Ga0070712_100234134 3300006175 Bacteria 1460
157 Ga0075362_10154840 3300006177 Bacteria 1101
158 Ga0075362_10231633 3300006177 Bacteria 905
159 Ga0075367_10007746 3300006178 Bacteria 5522
160 Ga0075367_10064786 3300006178 Bacteria 2187
161 Ga0075367_10120954 3300006178 Bacteria 1613
162 Ga0075367_10330131 3300006178 Unclassified 961
163 Ga0075369_10042176 3300006186 Bacteria 1955
164 Ga0075369_10045465 3300006186 Bacteria 1888
165 Ga0075369_10306760 3300006186 Bacteria 741
166 Ga0075366_10157477 3300006195 Bacteria 1376
167 Ga0075366_10276762 3300006195 Bacteria 1025
168 Ga0097621_100001304 3300006237 Bacteria 17162
169 Ga0075370_10025424 3300006353 Bacteria 3276
170 Ga0075370_10707287 3300006353 Bacteria 613
171 Ga0075370_10891394 3300006353 Bacteria 544
172 Ga0068871_100000848 3300006358 Bacteria 20451
173 Ga0068871_101086153 3300006358 Bacteria 748
174 Ga0068871_101181718 3300006358 Unclassified 717
175 Ga0068871_102079218 3300006358 Bacteria 541
176 Ga0075428_100635454 3300006844 Bacteria 1139
177 Ga0075433_10004441 3300006852 Bacteria 10924
178 Ga0075433_10258978 3300006852 Unclassified 1543
179 Ga0075433_10726599 3300006852 Bacteria 869
180 Ga0075434_100010768 3300006871 Bacteria 8588
181 Ga0075434_100088139 3300006871 Unclassified 3104
182 Ga0068865_100000576 3300006881 Bacteria 20549
183 Ga0068865_100832905 3300006881 Bacteria 798
184 Ga0075436_100005555 3300006914 Bacteria 8665
185 Ga0075436_100026423 3300006914 Bacteria 3996
186 Ga0097620_100000738 3300006931 Bacteria 32951
187 Ga0097620_100055300 3300006931 Bacteria 3994
188 Ga0097620_100512645 3300006931 Bacteria 1294
189 Ga0097620_100585840 3300006931 Bacteria 1209
190 Ga0075435_100000241 3300007076 Bacteria 33718
191 Ga0075435_100527125 3300007076 Unclassified 1022
192 Ga0075435_101864818 3300007076 Bacteria 528
193 Ga0099794_10015815 3300007265 Bacteria 3337
194 Ga0099795_10002927 3300007788 Bacteria 4137
195 Ga0099795_10110042 3300007788 Bacteria 1091
196 Ga0105240_10006636 3300009093 Bacteria 16984
197 Ga0105240_10069029 3300009093 Bacteria 4376
198 Ga0105240_10314225 3300009093 Bacteria 1788
199 Ga0105240_10918894 3300009093 Bacteria 940
200 Ga0105240_11197429 3300009093 Bacteria 804
201 Ga0111539_10009061 3300009094 Bacteria 12596
202 Ga0111539_10545004 3300009094 Bacteria 1351
203 Ga0111539_10587451 3300009094 Bacteria 1297
204 Ga0111539_11310769 3300009094 Bacteria 840
205 Ga0105245_10021000 3300009098 Bacteria 5727
206 Ga0105245_11082949 3300009098 Bacteria 847
207 Ga0105245_11984183 3300009098 Bacteria 635
208 Ga0105247_10523632 3300009101 Bacteria 867
209 Ga0114129_10309298 3300009147 Bacteria 2104
210 Ga0105243_10000270 3300009148 Bacteria 58296
211 Ga0105243_10339933 3300009148 Bacteria 1375
212 Ga0105243_10372863 3300009148 Bacteria 1317
213 Ga0105243_12156537 3300009148 Unclassified 593
214 Ga0105243_12294739 3300009148 Bacteria 577
215 Ga0105241_10008801 3300009174 Bacteria 7417
216 Ga0105241_10520682 3300009174 Bacteria 1063
217 Ga0105241_12474639 3300009174 Unclassified 519
218 Ga0105242_10002903 3300009176 Bacteria 13405
219 Ga0105248_11835320 3300009177 Bacteria 688
220 Ga0105248_13199241 3300009177 Bacteria 521
221 Ga0105237_10740579 3300009545 Bacteria 989
222 Ga0105237_10760416 3300009545 Bacteria 975
223 Ga0105237_10948048 3300009545 Bacteria 867
224 Ga0105237_10966070 3300009545 Bacteria 859
225 Ga0105237_11389126 3300009545 Bacteria 708
226 Ga0105237_11604233 3300009545 Bacteria 658
227 Ga0105238_10019782 3300009551 Bacteria 6854
228 Ga0105238_10143973 3300009551 Bacteria 2360
229 Ga0105238_10427061 3300009551 Bacteria 1320
230 Ga0105238_11231234 3300009551 Bacteria 773
231 Ga0105249_10008723 3300009553 Bacteria 8841
232 Ga0105249_10330527 3300009553 Bacteria 1538
233 Ga0105239_10068719 3300010375 Bacteria 3893
234 Ga0105239_10084215 3300010375 Bacteria 3502
235 Ga0105239_10115743 3300010375 Bacteria 2974
236 Ga0105239_10320559 3300010375 Bacteria 1747
237 Ga0105239_11685950 3300010375 Bacteria 734
238 Ga0105239_12044287 3300010375 Unclassified 665
239 Ga0105246_10084077 3300011119 Bacteria 2276
240 Ga0105246_10629625 3300011119 Bacteria 931
241 Ga0105246_10684058 3300011119 Bacteria 897
242 Ga0105246_11017415 3300011119 Bacteria 751
243 Ga0105246_11934330 3300011119 Bacteria 567
244 Ga0157373_10644536 3300013100 Unclassified 773
245 Ga0157371_10575164 3300013102 Bacteria 836
246 Ga0157370_10612536 3300013104 Bacteria 996
247 Ga0157369_10013414 3300013105 Bacteria 9265
248 Ga0157369_10091038 3300013105 Bacteria 3256
249 Ga0157369_10802807 3300013105 Bacteria 967
250 Ga0157374_10974492 3300013296 Bacteria 867
251 Ga0157374_12361782 3300013296 Bacteria 559
252 Ga0157378_10002191 3300013297 Bacteria 17332
253 Ga0157378_13055904 3300013297 Unclassified 519
254 Ga0163162_11489448 3300013306 Bacteria 771
255 Ga0157372_10001764 3300013307 Bacteria 23462
256 Ga0157372_10288672 3300013307 Bacteria 1908
257 Ga0157372_10499453 3300013307 Bacteria 1419
258 Ga0157375_10253297 3300013308 Bacteria 1921
259 Ga0157375_10948887 3300013308 Unclassified 1002
260 Ga0157375_13079545 3300013308 Bacteria 556
261 Ga0163163_10800312 3300014325 Bacteria 1006
262 Ga0163163_10839809 3300014325 Bacteria 982
263 Ga0157380_10091584 3300014326 Bacteria 2510
264 Ga0157380_10159449 3300014326 Bacteria 1959
265 Ga0157380_11760194 3300014326 Bacteria 678
266 Ga0182008_10048244 3300014497 Bacteria 2115
267 Ga0182008_10950239 3300014497 Bacteria 509
268 Ga0157377_10162483 3300014745 Bacteria 1390
269 Ga0157377_10317023 3300014745 Bacteria 1034
270 Ga0157377_11143061 3300014745 Bacteria 599
271 Ga0157379_11122711 3300014968 Bacteria 754
272 Ga0157379_12592906 3300014968 Bacteria 508
273 Ga0157376_10004669 3300014969 Bacteria 9550
274 Ga0157376_11309255 3300014969 Bacteria 755
275 Ga0157376_11633764 3300014969 Bacteria 679
276 Ga0182006_1040727 3300015261 Bacteria 1827
277 Ga0163161_10943030 3300017792 Bacteria 734
278 Ga0214542_1017188 3300021321 Bacteria 6655
279 Ga0214543_1003948 3300021327 Bacteria 28458
280 Ga0213875_10131227 3300021388 Bacteria 1171
281 Ga0209646_1031354 3300025246 Bacteria 712
282 Ga0209026_1000041 3300025250 Bacteria 275745
283 Ga0209148_1031932 3300025254 Bacteria 779
284 Ga0209759_1000183 3300025256 Bacteria 102218
285 Ga0209233_1005342 3300025261 Bacteria 4271
286 Ga0209758_1004876 3300025297 Bacteria 10795
287 Ga0207653_10081072 3300025885 Bacteria 1123
288 Ga0207692_10026369 3300025898 Bacteria 2726
289 Ga0207642_10001185 3300025899 Bacteria 8032
290 Ga0207710_10358700 3300025900 Bacteria 743
291 Ga0207688_10030369 3300025901 Bacteria 2979
292 Ga0207688_10302187 3300025901 Bacteria 979
293 Ga0207680_10080823 3300025903 Bacteria 2042
294 Ga0207647_10047477 3300025904 Bacteria 2671
295 Ga0207647_10160841 3300025904 Bacteria 1310
296 Ga0207685_10105872 3300025905 Bacteria 1211
297 Ga0207699_11117500 3300025906 Bacteria 583
298 Ga0207645_10274585 3300025907 Bacteria 1118
299 Ga0207643_10014574 3300025908 Bacteria 4273
300 Ga0207643_10505770 3300025908 Bacteria 772
301 Ga0207705_10273673 3300025909 Bacteria 1291
302 Ga0207654_10006726 3300025911 Bacteria 5779
303 Ga0207654_10114032 3300025911 Bacteria 1686
304 Ga0207654_11049961 3300025911 Bacteria 593
305 Ga0207695_10008332 3300025913 Bacteria 12989
306 Ga0207695_10215789 3300025913 Bacteria 1828
307 Ga0207695_11255702 3300025913 Bacteria 621
308 Ga0207671_10659856 3300025914 Bacteria 833
309 Ga0207671_10680167 3300025914 Bacteria 819
310 Ga0207693_10385519 3300025915 Bacteria 1096
311 Ga0207693_11332991 3300025915 Bacteria 536
312 Ga0207663_11212164 3300025916 Bacteria 608
313 Ga0207660_10001600 3300025917 Bacteria 15194
314 Ga0207662_10000047 3300025918 Bacteria 52763
315 Ga0207657_10138926 3300025919 Bacteria 1986
316 Ga0207649_10241999 3300025920 Bacteria 1296
317 Ga0207652_10430273 3300025921 Bacteria 1190
318 Ga0207681_10115942 3300025923 Bacteria 1956
319 Ga0207681_10174461 3300025923 Bacteria 1632
320 Ga0207694_10310615 3300025924 Bacteria 1299
321 Ga0207694_10381696 3300025924 Bacteria 1170
322 Ga0207694_10561020 3300025924 Unclassified 959
323 Ga0207694_10835868 3300025924 Bacteria 778
324 Ga0207650_11681615 3300025925 Bacteria 538
325 Ga0207659_10228536 3300025926 Bacteria 1499
326 Ga0207687_10000828 3300025927 Bacteria 20892
327 Ga0207700_10323324 3300025928 Bacteria 1337
328 Ga0207700_11913378 3300025928 Bacteria 519
329 Ga0207706_10378185 3300025933 Bacteria 1229
330 Ga0207706_10515587 3300025933 Bacteria 1031
331 Ga0207706_10804353 3300025933 Bacteria 798
332 Ga0207686_10002983 3300025934 Bacteria 9121
333 Ga0207709_10002565 3300025935 Bacteria 11317
334 Ga0207709_10396392 3300025935 Bacteria 1054
335 Ga0207670_10008080 3300025936 Bacteria 5918
336 Ga0207670_10052109 3300025936 Bacteria 2751
337 Ga0207670_10324639 3300025936 Bacteria 1212
338 Ga0207669_10104330 3300025937 Bacteria 1883
339 Ga0207669_11857795 3300025937 Unclassified 515
340 Ga0207704_10002010 3300025938 Bacteria 9124
341 Ga0207704_10341129 3300025938 Bacteria 1163
342 Ga0207665_11535924 3300025939 Bacteria 529
343 Ga0207665_11574273 3300025939 Bacteria 521
344 Ga0207691_10015973 3300025940 Bacteria 7132
345 Ga0207691_10691514 3300025940 Bacteria 860
346 Ga0207689_10000148 3300025942 Bacteria 60276
347 Ga0207689_10027064 3300025942 Bacteria 4800
348 Ga0207661_10331704 3300025944 Bacteria 1369
349 Ga0207667_10003186 3300025949 Bacteria 20272
350 Ga0207667_10014392 3300025949 Bacteria 9022
351 Ga0207667_10166216 3300025949 Bacteria 2268
352 Ga0207667_11267530 3300025949 Bacteria 714
353 Ga0207651_10220471 3300025960 Bacteria 1533
354 Ga0207651_11886749 3300025960 Unclassified 537
355 Ga0207712_10040868 3300025961 Bacteria 3185
356 Ga0207668_10132435 3300025972 Bacteria 1905
357 Ga0207668_11085287 3300025972 Bacteria 717
358 Ga0207668_11091065 3300025972 Bacteria 715
359 Ga0207668_11193757 3300025972 Bacteria 684
360 Ga0207640_10005304 3300025981 Bacteria 7019
361 Ga0207640_10908893 3300025981 Bacteria 769
362 Ga0207658_10994819 3300025986 Bacteria 765
363 Ga0207677_10023199 3300026023 Bacteria 3827
364 Ga0207703_10014274 3300026035 Bacteria 6196
365 Ga0207703_10201959 3300026035 Bacteria 1767
366 Ga0207639_10086796 3300026041 Bacteria 2492
367 Ga0207639_10209480 3300026041 Bacteria 1677
368 Ga0207639_10238033 3300026041 Bacteria 1581
369 Ga0207639_10577745 3300026041 Bacteria 1034
370 Ga0207678_10057430 3300026067 Bacteria 3349
371 Ga0207678_10692409 3300026067 Bacteria 897
372 Ga0207678_10757700 3300026067 Bacteria 856
373 Ga0207708_10000347 3300026075 Bacteria 36295
374 Ga0207708_10263449 3300026075 Bacteria 1392
375 Ga0207702_10071861 3300026078 Bacteria 2981
376 Ga0207641_10437256 3300026088 Bacteria 1262
377 Ga0207648_10000018 3300026089 Bacteria 148157
378 Ga0207648_10110478 3300026089 Bacteria 2413
379 Ga0207674_10168179 3300026116 Bacteria 2146
380 Ga0207674_10353933 3300026116 Bacteria 1420
381 Ga0207675_100000170 3300026118 Bacteria 58303
382 Ga0207675_100110040 3300026118 Bacteria 2600
383 Ga0207675_100172146 3300026118 Bacteria 2070
384 Ga0207683_10126474 3300026121 Bacteria 2297
385 Ga0207683_10734043 3300026121 Bacteria 916
386 Ga0207698_10284171 3300026142 Bacteria 1532
387 Ga0207698_10324569 3300026142 Bacteria 1443
388 Ga0209179_1011466 3300027512 Bacteria 1571
389 Ga0209813_10002104 3300027866 Bacteria 4531
390 Ga0209813_10023220 3300027866 Bacteria 1762
391 Ga0209813_10042564 3300027866 Bacteria 1388
392 Ga0209813_10102221 3300027866 Bacteria 977
393 Ga0209813_10501586 3300027866 Bacteria 504
394 Ga0207428_10183032 3300027907 Bacteria 1582
395 Ga0207428_10212157 3300027907 Bacteria 1454
396 Ga0268266_10659316 3300028379 Bacteria 1007
397 Ga0268265_10027798 3300028380 Bacteria 4041
398 Ga0268265_10107422 3300028380 Bacteria 2269
399 Ga0268265_10686776 3300028380 Bacteria 987
400 Ga0268264_10004786 3300028381 Bacteria 11488
401 Ga0268264_10018217 3300028381 Bacteria 5744
402 Ga0268264_10234602 3300028381 Bacteria 1696
403 Ga0268264_10305861 3300028381 Bacteria 1498
404 Ga0268264_12294716 3300028381 Unclassified 547
405 Ga0307515_10902665 3300028794 Bacteria 515
406 Ga0265760_10009010 3300031090 Bacteria 2851
407 Ga0307513_10022749 3300031456 Bacteria 7355
408 Ga0307513_10703233 3300031456 Bacteria 716
409 Ga0307408_100038393 3300031548 Bacteria 3379
410 Ga0307508_10281074 3300031616 Bacteria 1258
411 Ga0265314_10005708 3300031711 Bacteria 11164
412 Ga0265342_10093523 3300031712 Bacteria 1721
413 Ga0307516_10516895 3300031730 Bacteria 848
414 Ga0307405_10005509 3300031731 Bacteria 6113
415 Ga0307405_10751010 3300031731 Bacteria 813
416 Ga0307405_11640492 3300031731 Bacteria 568
417 Ga0307413_10000331 3300031824 Bacteria 14874
418 Ga0307410_10001187 3300031852 Bacteria 11524
419 Ga0307410_10858703 3300031852 Bacteria 775
420 Ga0307406_10151626 3300031901 Bacteria 1654
421 Ga0307407_10002906 3300031903 Bacteria 6852
422 Ga0307412_10009788 3300031911 Bacteria 5503
423 Ga0307412_10501169 3300031911 Bacteria 1011
424 Ga0307409_100004047 3300031995 Bacteria 8146
425 Ga0307409_101246282 3300031995 Bacteria 768
426 Ga0307416_100007308 3300032002 Bacteria 7007
427 Ga0307416_100070678 3300032002 Bacteria 2896
428 Ga0307416_100083706 3300032002 Bacteria 2708
429 Ga0307416_100136430 3300032002 Bacteria 2221
430 Ga0307416_103015848 3300032002 Bacteria 563
431 Ga0307414_10007282 3300032004 Bacteria 6215
432 Ga0307414_10535169 3300032004 Bacteria 1042
433 Ga0307411_10001587 3300032005 Bacteria 9431
434 Ga0307411_10933780 3300032005 Bacteria 773
435 Ga0307415_100002107 3300032126 Bacteria 9841
436 Ga0307415_100193294 3300032126 Bacteria 1608
437 Ga0307415_100630980 3300032126 Bacteria 958
438 Ga0307415_100642028 3300032126 Bacteria 950
439 Ga0307415_101140924 3300032126 Unclassified 732
440 Ga0373958_0130733 3300034819 Bacteria 614
441 Ga0373938_0095668 3300034957 Bacteria 740
442 Ga0373926_0403002 3300035083 Bacteria 540
443 Ga0373932_0277105 3300035112 Bacteria 619
444 Ga0373936_0079245 3300035113 Unclassified 1365
445 Ga0373939_0070120 3300035114 Bacteria 1139
446 Ga0373941_0115190 3300035115 Bacteria 952
447 Ga0373945_0145558 3300035116 Bacteria 958
448 Ga0373960_0050381 3300035121 Bacteria 1234
449 Ga0373943_0017758 3300035170 Bacteria 3258
450 Ga0373961_0077691 3300035241 Bacteria 1039
451 Ga0373961_0323807 3300035241 Bacteria 575
452 Ga0373962_0109997 3300035242 Bacteria 868
453 Ga0373931_0015187 3300035691 Bacteria 3774
454 Ga0373931_0125341 3300035691 Bacteria 1472
455 Ga0373935_0190749 3300035692 Bacteria 1411
456 Ga0373927_0041938 3300035695 Bacteria 2967
457 Ga0373927_0914262 3300035695 Bacteria 579
458 Ga0373947_0127279 3300035725 Bacteria 1623
459 Ga0373925_0121589 3300037068 Bacteria 2027
460 Ga0373925_0449402 3300037068 Bacteria 1055
461 Ga0395899_0488877 3300037312 Bacteria 800
462 Ga0395900_0295271 3300037418 Bacteria 1608
463 Ga0395900_0558823 3300037418 Bacteria 1088
464 Ga0395900_1738728 3300037418 Bacteria 534
465 Ga0395905_0058652 3300037471 Bacteria 3599
466 Ga0395905_1059692 3300037471 Bacteria 714
467 Ga0436364_0621060 3300037853 Bacteria 18950
468 Ga0436364_1195282 3300037853 Bacteria 714
469 Ga0395901_0109279 3300038443 Bacteria 2903
470 Ga0436365_1518675 3300039437 Bacteria 1796
471 Ga0436361_0651230 3300039447 Bacteria 663
472 Ga0436363_1340339 3300039450 Bacteria 986
473 Ga0451793_0549640 3300041452 Bacteria 1403
474 Ga0451797_1392329 3300041453 Bacteria 1098
475 Ga0451800_0429269 3300041459 Unclassified 569
476 Ga0451839_0783888 3300041496 Bacteria 605
477 Ga0451851_0528120 3300041507 Bacteria 610
478 Ga0439455_0007330 3300042012 Bacteria 2330
479 Ga0439434_0217307 3300042435 Bacteria 648
480 Ga0466972_0293744 3300044658 Bacteria 759
481 Ga0466960_0018930 3300044901 Bacteria 3025
482 Ga0451576_0497777 3300045051 Bacteria 1280
483 Ga0495617_045293 3300046452 Bacteria 1467
484 Ga0495603_0169658 3300046455 Bacteria 1264
485 Ga0495638_0084172 3300046460 Bacteria 1925
486 Ga0495638_0245281 3300046460 Bacteria 990
487 Ga0495580_0008152 3300046472 Bacteria 8345
488 Ga0495580_0435832 3300046472 Bacteria 880
489 Ga0495582_0099858 3300046473 Bacteria 1624
490 Ga0495582_0249284 3300046473 Bacteria 1018
491 Ga0495662_0671501 3300046476 Bacteria 505
492 Ga0495585_0095034 3300046492 Bacteria 1601
493 Ga0495596_0434217 3300046500 Bacteria 512
494 Ga0495606_0341431 3300046507 Bacteria 798
495 Ga0495610_0154947 3300046512 Bacteria 974
496 Ga0495616_0098178 3300046513 Bacteria 1377
497 Ga0495620_0051884 3300046515 Bacteria 1744
498 Ga0495620_0134279 3300046515 Bacteria 970
499 Ga0495631_0113488 3300046518 Bacteria 1165
500 Ga0495632_0079334 3300046519 Bacteria 1567
501 Ga0495632_0183883 3300046519 Bacteria 957
502 Ga0495637_0110950 3300046520 Bacteria 1063
503 Ga0495643_0101325 3300046522 Bacteria 1475
504 Ga0495648_0333335 3300046524 Bacteria 699
505 Ga0495663_0063422 3300046525 Bacteria 1165
506 Ga0495666_0043023 3300046526 Bacteria 2183
507 Ga0495665_0225572 3300046531 Bacteria 968
508 Ga0495621_0193622 3300046539 Bacteria 816
509 Ga0495597_0079795 3300046542 Bacteria 1401
510 Ga0495633_0483921 3300046558 Bacteria 558
511 Ga0495656_0019559 3300046615 Bacteria 2615
512 Ga0495656_0176980 3300046615 Bacteria 1046
513 Ga0495668_0328421 3300046616 Bacteria 839
514 Ga0495668_0823700 3300046616 Bacteria 514
515 Ga0495611_0406587 3300046648 Bacteria 622
516 Ga0495625_0846754 3300046660 Bacteria 528
517 Ga0495661_0308315 3300046665 Bacteria 790
518 Ga0495588_0076378 3300046674 Bacteria 1746
519 Ga0495647_0324553 3300046681 Unclassified 697
520 Ga0495658_0113201 3300046683 Bacteria 1633
521 Ga0495669_0102590 3300046684 Bacteria 1330
522 Ga0495613_0978424 3300046689 Bacteria 544
523 Ga0495670_0051802 3300046691 Bacteria 2054
524 Ga0495670_0058280 3300046691 Bacteria 1939
525 Ga0495671_0542310 3300046692 Bacteria 554
526 Ga0495649_0497008 3300046694 Bacteria 607
527 Ga0495660_0385499 3300046810 Bacteria 617
528 Ga0495581_0353453 3300047315 Bacteria 858
529 Ga0495676_0359302 3300047321 Bacteria 972
530 Ga0495685_301312 3300047447 Bacteria 504
531 Ga0495673_0049155 3300047469 Bacteria 1857
532 Ga0495673_0079413 3300047469 Bacteria 1362
533 Ga0495686_0576372 3300047472 Bacteria 585
534 Ga0495615_0151374 3300048090 Bacteria 691
535 Ga0496107_0418644 3300048910 Bacteria 996
536 Ga0496107_1008351 3300048910 Bacteria 604
537 Ga0496107_1157936 3300048910 Bacteria 557
538 Ga0496108_0497171 3300048911 Bacteria 1065
539 Ga0496110_0673174 3300048913 Bacteria 935
540 Ga0496111_0228644 3300048914 Bacteria 1382
541 Ga0496112_0069460 3300048915 Bacteria 3480
542 Ga0496113_0213365 3300048916 Bacteria 1537
543 Ga0496114_1190604 3300048917 Bacteria 648
544 Ga0496115_0105400 3300048918 Bacteria 2314
545 Ga0496117_0394801 3300048920 Bacteria 700
546 Ga0496118_0183137 3300048921 Bacteria 1263
547 Ga0496118_0211305 3300048921 Bacteria 1138
548 Ga0496119_0072404 3300048922 Bacteria 2014
549 Ga0496119_0177092 3300048922 Bacteria 1121
550 Ga0496121_0072096 3300048924 Bacteria 2774
551 Ga0496124_0128314 3300048927 Bacteria 2018
552 Ga0496124_0239933 3300048927 Bacteria 1349
553 Ga0496124_0336627 3300048927 Bacteria 1074
554 Ga0496125_0054114 3300048928 Bacteria 3283
555 Ga0496125_0214367 3300048928 Bacteria 1247
556 Ga0496126_1327170 3300048929 Bacteria 523
557 Ga0501040_0074659 3300049576 Bacteria 2343
558 Ga0501041_0136294 3300049577 Bacteria 1530
559 Ga0501042_0252003 3300049578 Bacteria 1274
560 Ga0501046_0308499 3300049580 Bacteria 1154
561 Ga0501067_0834037 3300049583 Bacteria 520
562 Ga0501072_0363414 3300049588 Bacteria 1149
563 Ga0501073_1212650 3300049589 Bacteria 518
564 Ga0501075_0812933 3300049591 Bacteria 711
565 Ga0501075_1266472 3300049591 Bacteria 559
566 Ga0501076_0436522 3300049592 Unclassified 1078
567 Ga0501076_0719126 3300049592 Bacteria 824
568 Ga0501077_0001429 3300049593 Bacteria 14339
569 Ga0501077_0855234 3300049593 Bacteria 585
570 Ga0501249_209234 3300049679 Bacteria 515
571 Ga0501079_0041926 3300049741 Bacteria 3534
572 Ga0501080_1353222 3300049742 Unclassified 609
573 Ga0501081_0065194 3300049743 Bacteria 2531
574 Ga0501081_0646113 3300049743 Bacteria 793
575 Ga0501268_108957 3300049765 Bacteria 602
576 Ga0501035_0239428 3300049822 Bacteria 1544
577 Ga0501045_0116181 3300049824 Bacteria 1985
578 nmdc:mga03683_202985_c1 3300050489 Bacteria 910
579 nmdc:mga03683_387159_c1 3300050489 Bacteria 666
580 nmdc:mga03683_458104_c1 3300050489 Unclassified 614
581 nmdc:mga03n38_151385_c1 3300050490 Bacteria 1167
582 nmdc:mga03n38_16618_c1 3300050490 Bacteria 2866
583 nmdc:mga03n38_169794_c1 3300050490 Unclassified 1110
584 nmdc:mga00v17_125099_c1 3300050491 Bacteria 1640
585 nmdc:mga00v17_148660_c1 3300050491 Bacteria 1504
586 nmdc:mga00v17_203290_c1 3300050491 Bacteria 1281
587 nmdc:mga00v17_561989_c1 3300050491 Bacteria 737
588 nmdc:mga0yw44_37075_c1 3300050492 Bacteria 2877
589 nmdc:mga0yw44_459752_c1 3300050492 Unclassified 863
590 nmdc:mga0yw44_612386_c1 3300050492 Bacteria 740
591 nmdc:mga0yw44_72202_c1 3300050492 Bacteria 2145
592 nmdc:mga0k408_169366_c1 3300050493 Bacteria 1302
593 nmdc:mga0k408_251348_c1 3300050493 Bacteria 1056
594 nmdc:mga06z11_15701_c1 3300050494 Bacteria 3387
595 nmdc:mga06z11_174779_c1 3300050494 Unclassified 1235
596 nmdc:mga06z11_222834_c1 3300050494 Unclassified 1103
597 nmdc:mga06z11_327174_c1 3300050494 Bacteria 915
598 nmdc:mga06z11_685942_c1 3300050494 Bacteria 624
599 nmdc:mga06z11_93053_c1 3300050494 Bacteria 1640
600 nmdc:mga06z11_948_c1 3300050494 Bacteria 10568
601 nmdc:mga04h51_2274_c1 3300050495 Bacteria 4531
602 nmdc:mga04h51_3214_c1 3300050495 Bacteria 3948
603 nmdc:mga04h51_39042_c1 3300050495 Bacteria 1540
604 nmdc:mga04h51_45230_c1 3300050495 Bacteria 1455
605 nmdc:mga04h51_534924_c1 3300050495 Bacteria 504
606 nmdc:mga07m45_26757_c1 3300050496 Bacteria 3171
607 nmdc:mga07m45_362196_c1 3300050496 Bacteria 842
608 nmdc:mga05p37_1425998_c1 3300050507 Bacteria 695
609 nmdc:mga05p37_1716262_c1 3300050507 Bacteria 611
610 nmdc:mga06r32_1282362_c1 3300050510 Bacteria 677
611 nmdc:mga08y16_341185_c1 3300050511 Bacteria 1540
612 nmdc:mga08y16_79567_c1 3300050511 Bacteria 3416
613 nmdc:mga0n895_1229855_c1 3300050512 Bacteria 722
614 nmdc:mga0n895_16556_c1 3300050512 Bacteria 6770
615 nmdc:mga0n895_63294_c1 3300050512 Bacteria 3658
616 nmdc:mga0rr50_4551_c1 3300050513 Bacteria 8161
617 nmdc:mga08x19_20440_c1 3300050514 Bacteria 4075
618 nmdc:mga08x19_4574_c1 3300050514 Bacteria 8211
619 nmdc:mga0a205_11310_c1 3300050515 Bacteria 8215
620 nmdc:mga0a205_284_c1 3300050515 Bacteria 37182
621 nmdc:mga0sz30_143088_c2 3300050516 Bacteria 749
622 nmdc:mga0sz30_549754_c1 3300050516 Bacteria 521
623 Ga0495601_0654609 3300053077 Bacteria 672
624 Ga0500610_0016833 3300053079 Bacteria 3497
625 Ga0495655_0079833 3300053083 Bacteria 933
626 Ga0500643_122587 3300053087 Bacteria 700
627 Ga0500651_0713750 3300053093 Bacteria 535
628 Ga0500566_0339599 3300053094 Bacteria 692
629 Ga0500594_0200151 3300053118 Bacteria 656
630 Ga0500658_0081485 3300053134 Bacteria 1385
631 Ga0500604_0352105 3300053151 Bacteria 511
632 Ga0500616_0039935 3300053153 Bacteria 2527
633 Ga0500645_188741 3300053730 Bacteria 559
634 Ga0500609_050394 3300053731 Bacteria 579
635 Ga0501084_0055877 3300054114 Bacteria 3303
636 Ga0501082_0145516 3300060353 Bacteria 2057
637 Ga0501082_1515379 3300060353 Bacteria 586
638 Ga0530510_0134932 3300061734 Bacteria 1817
639 Ga0530510_0563914 3300061734 Bacteria 865
640 2509108273 2508501122 Bacteria 6292184
641 2509115190 2508501123 Bacteria 6283661
642 2509142752 2508501127 Bacteria 7037543
643 2512530534 2512047086 Bacteria 6850303
644 2512932979 2512875016 Bacteria 6529530
645 2513611190 2513237090 Bacteria 7096802
646 2588519032 2588253730 Bacteria 6881675
647 2597811352 2597489875 Bacteria 7010078
648 2599939049 2599185301 Bacteria 6161860
649 2643986071 2643221595 Bacteria 6565519
650 2644153636 2643221627 Bacteria 6761570
651 2756677403 2756170246 Bacteria 7451806
652 2792748382 2791355123 Bacteria 8049106
653 2841737361 2841734538 Bacteria 6784580
654 2844009106 2844002411 Bacteria 7168230
655 2856322697 2856320880 Bacteria 7263508
656 2856346031 2856342000 Bacteria 7176905
657 2869165173 2869162929 Bacteria 6399702
658 2869285785 2869278585 Bacteria 7077053
659 2871471661 2871466892 Bacteria 6923287
660 2871498037 2871495908 Bacteria 6935695
661 2874128835 2874123672 Bacteria 7238285
662 2874141901 2874139085 Bacteria 7021506
663 2874175671 2874168670 Bacteria 8062617
664 2876364774 2876363079 Bacteria 6544991
665 2876376508 2876369609 Bacteria 6807521
666 2876384643 2876377896 Bacteria 6565995
667 2876396172 2876392853 Bacteria 6660880
668 2876817319 2876808645 Bacteria 8824342
669 2878739360 2878738818 Bacteria 7136951
670 2878762259 2878760144 Bacteria 6823465
671 2878769226 2878767105 Bacteria 6898628
672 2878789392 2878788777 Bacteria 6567085
673 2879117769 2879110137 Bacteria 8907982
674 2881149439 2881147464 Bacteria 7779814
675 2881166338 2881161766 Bacteria 7127907
676 2885307769 2885305155 Bacteria 7348390
677 2885313229 2885312484 Bacteria 6415165
678 2885328772 2885326080 Bacteria 7134805
679 2885336071 2885334103 Bacteria 7216818
680 2889018780 2889016732 Bacteria 6700763
681 2889791001 2889790730 Bacteria 5689708
682 2889915394 2889914905 Bacteria 5702301
683 2896384696 2896384573 Bacteria 7700774
684 2903449239 2903448605 Bacteria 7357801
685 2903522490 2903521522 Bacteria 6525694
686 2903528869 2903528002 Bacteria 6586099
687 2903542835 2903540706 Bacteria 7062119
688 2904662948 2904659560 Bacteria 6685615
689 2906379243 2906378014 Bacteria 6911440
690 2908745779 2908739725 Bacteria 8628932
691 2924726593 2924718760 Bacteria 6331356
692 2924776881 2924776078 Bacteria 7492003
693 2937825752 2937822353 Bacteria 7290551
694 2937840709 2937836603 Bacteria 6811263
695 2937855419 2937848649 Bacteria 6983481
696 2937883518 2937877337 Bacteria 7246526
697 2937973503 2937972304 Bacteria 7532020
698 2937996685 2937994558 Bacteria 7036190
699 2938015921 2938014810 Bacteria 6700592
700 2958041801 2958034702 Bacteria 6989922
701 2958050332 2958041894 Bacteria 13082850
702 2958073658 2958071322 Bacteria 6815895
703 2958090686 2958084443 Bacteria 7312792
704 2958100602 2958092219 Bacteria 6861151
705 2958103535 2958100919 Bacteria 6800575
706 2958148488 2958144490 Bacteria 6677056
707 2958167157 2958165035 Bacteria 6906348
708 2958175654 2958172287 Bacteria 6716688
709 2961117974 2961114664 Bacteria 6680456
710 2961165626 2961163497 Bacteria 6901077
711 2963646230 2963644680 Bacteria 6530403
712 2965020449 2965018300 Bacteria 6883036
713 2965120261 2965119406 Bacteria 6956431
714 2968016702 2968016561 Bacteria 7022047
715 2968085302 2968083720 Bacteria 7351627
716 2968114035 2968110612 Bacteria 6814636
717 2968123224 2968117919 Bacteria 6536078
718 2968174028 2968171901 Bacteria 6894245
719 2970470044 2970469710 Bacteria 6969209
720 2970527000 2970524798 Bacteria 6840927
721 2970557114 2970554993 Bacteria 6814252
722 2970600402 2970593180 Bacteria 7073582
723 2977871002 2977864932 Bacteria 7534097
724 2977928875 2977922695 Bacteria 6956781
725 2977988879 2977986579 Bacteria 6581278
726 2979712326 2979710463 Bacteria 6785254
727 2987661634 2987659509 Bacteria 6966464
728 2996353027 2996348954 Bacteria 7239054
729 3004190683 3004188549 Bacteria 6952365
730 3004211519 3004211236 Bacteria 7417683
731 3004224932 3004218560 Bacteria 7421728
732 3004279709 3004275668 Bacteria 7114440
733 3004290556 3004289098 Bacteria 6135450
734 3004336188 3004334049 Bacteria 8449246
735 637076059 637000159 Bacteria 7596297
736 8004636748 8004633249 Bacteria 6723080
737 8004645496 8004640170 Bacteria 6723001
738 Ga0307511_10021783
739 JGI24740J21852_10143765
740 JGI24739J22299_10010075
741 JGI24737J22298_10209159
742 JGI24735J21928_10034581
743 JGI24735J21928_10144021
744 JGI25157J39369_1002844
745 JGI25406J46586_10042112
746 JGI25404J52841_10006480
747 JGI25404J52841_10140927
748 Ga0070658_10075042
749 Ga0070676_10221905
750 Ga0070676_10486082
751 Ga0070676_10732052
752 Ga0070683_101720009
753 Ga0070690_100000696
754 Ga0070690_100714071
755 Ga0068869_100001460
756 Ga0068869_100224722
757 Ga0070666_10169352
758 Ga0070680_100000230
759 Ga0070680_101629324
760 Ga0070682_100920393
761 Ga0068868_100015723
762 Ga0068868_100509114
763 Ga0070660_100054680
764 Ga0070660_100917731
765 Ga0070689_100001581
766 Ga0070689_100028549
767 Ga0070689_100385654
768 Ga0070691_10001108
769 Ga0070691_10198998
770 Ga0070687_100005995
771 Ga0070661_100230272
772 Ga0070692_10669085
773 Ga0070668_100228985
774 Ga0070668_101538543
775 Ga0070669_100201389
776 Ga0070674_101038866
777 Ga0070673_100113525
778 Ga0070673_100200807
779 Ga0070673_102269997
780 Ga0070688_100090716
781 Ga0070688_100185656
782 Ga0070688_100354544
783 Ga0070659_100792183
784 Ga0070659_100862160
785 Ga0070659_102101717
786 Ga0070667_100512494
787 Ga0070667_100974183
788 Ga0070667_101430499
789 Ga0070703_10020485
790 Ga0070709_10290866
791 Ga0070709_11229271
792 Ga0070713_100027187
793 Ga0070710_10060241
794 Ga0070701_10000101
795 Ga0070711_100393164
796 Ga0070705_100000610
797 Ga0070705_100901387
798 Ga0070705_101017363
799 Ga0070700_100000280
800 Ga0070700_100566892
801 Ga0070700_101146057
802 Ga0070694_100001047
803 Ga0070708_100206340
804 Ga0070708_100637943
805 Ga0070708_100742635
806 Ga0070663_100562228
807 Ga0070678_100029184
808 Ga0070678_100435931
809 Ga0070662_100664840
810 Ga0070681_10499963
811 Ga0068867_100000225
812 Ga0070698_100526299
813 Ga0070679_100017000
814 Ga0070684_100406370
815 Ga0070684_100752142
816 Ga0068853_100126648
817 Ga0068853_100265727
818 Ga0068853_100639917
819 Ga0068853_100719935
820 Ga0068853_101585859
821 Ga0070672_100326520
822 Ga0070686_100002476
823 Ga0070686_100354594
824 Ga0070695_100000408
825 Ga0070696_100000061
826 Ga0070696_100004202
827 Ga0070696_100409935
828 Ga0070693_100000016
829 Ga0070665_100763821
830 Ga0070704_100000587
831 Ga0070704_100090161
832 Ga0068855_100018082
833 Ga0068855_100096405
834 Ga0068855_100345911
835 Ga0068855_100740775
836 Ga0068857_100258241
837 Ga0068857_101847193
838 Ga0068854_100008405
839 Ga0068854_100510551
840 Ga0068854_101278452
841 Ga0068856_100153708
842 Ga0068856_100817012
843 Ga0070702_100000017
844 Ga0068852_100043637
845 Ga0068852_100273617
846 Ga0068859_100000738
847 Ga0068859_100055291
848 Ga0068859_100512644
849 Ga0068859_100585798
850 Ga0068864_100258942
851 Ga0068866_10000586
852 Ga0068866_10035434
853 Ga0068861_100000309
854 Ga0068861_101702410
855 Ga0068870_10618947
856 Ga0068870_10750703
857 Ga0068863_100309766
858 Ga0068863_101059414
859 Ga0068863_102108907
860 Ga0068863_102290809
861 Ga0068858_100001011
862 Ga0068858_100190884
863 Ga0068858_101518695
864 Ga0068860_100005129
865 Ga0068860_100054093
866 Ga0068862_100007976
867 Ga0068862_100015096
868 Ga0068862_100501726
869 Ga0068862_100579796
870 Ga0081455_10024687
871 Ga0081538_10061134
872 Ga0081540_1000956
873 Ga0081540_1007782
874 Ga0081540_1037511
875 Ga0081539_10078485
876 Ga0070717_10543525
877 Ga0070717_11787827
878 Ga0075365_10003700
879 Ga0075365_10076578
880 Ga0075365_10091981
881 Ga0075365_10404529
882 Ga0075368_10052282
883 Ga0075368_10151502
884 Ga0075368_10171783
885 Ga0075363_100068278
886 Ga0075363_100104438
887 Ga0075363_100385056
888 Ga0075363_100833768
889 Ga0075364_10097462
890 Ga0075364_10161644
891 Ga0075364_10298360
892 Ga0075364_10360025
893 Ga0070712_100234134
894 Ga0075362_10154840
895 Ga0075362_10231633
896 Ga0075367_10007746
897 Ga0075367_10064786
898 Ga0075367_10120954
899 Ga0075367_10330131
900 Ga0075369_10042176
901 Ga0075369_10045465
902 Ga0075369_10306760
903 Ga0075366_10157477
904 Ga0075366_10276762
905 Ga0097621_100001304
906 Ga0075370_10025424
907 Ga0075370_10707287
908 Ga0075370_10891394
909 Ga0068871_100000848
910 Ga0068871_101086153
911 Ga0068871_101181718
912 Ga0068871_102079218
913 Ga0075428_100635454
914 Ga0075433_10004441
915 Ga0075433_10258978
916 Ga0075433_10726599
917 Ga0075434_100010768
918 Ga0075434_100088139
919 Ga0068865_100000576
920 Ga0068865_100832905
921 Ga0075436_100005555
922 Ga0075436_100026423
923 Ga0097620_100000738
924 Ga0097620_100055300
925 Ga0097620_100512645
926 Ga0097620_100585840
927 Ga0075435_100000241
928 Ga0075435_100527125
929 Ga0075435_101864818
930 Ga0099794_10015815
931 Ga0099795_10002927
932 Ga0099795_10110042
933 Ga0105240_10006636
934 Ga0105240_10069029
935 Ga0105240_10314225
936 Ga0105240_10918894
937 Ga0105240_11197429
938 Ga0111539_10009061
939 Ga0111539_10545004
940 Ga0111539_10587451
941 Ga0111539_11310769
942 Ga0105245_10021000
943 Ga0105245_11082949
944 Ga0105245_11984183
945 Ga0105247_10523632
946 Ga0114129_10309298
947 Ga0105243_10000270
948 Ga0105243_10339933
949 Ga0105243_10372863
950 Ga0105243_12156537
951 Ga0105243_12294739
952 Ga0105241_10008801
953 Ga0105241_10520682
954 Ga0105241_12474639
955 Ga0105242_10002903
956 Ga0105248_11835320
957 Ga0105248_13199241
958 Ga0105237_10740579
959 Ga0105237_10760416
960 Ga0105237_10948048
961 Ga0105237_10966070
962 Ga0105237_11389126
963 Ga0105237_11604233
964 Ga0105238_10019782
965 Ga0105238_10143973
966 Ga0105238_10427061
967 Ga0105238_11231234
968 Ga0105249_10008723
969 Ga0105249_10330527
970 Ga0105239_10068719
971 Ga0105239_10084215
972 Ga0105239_10115743
973 Ga0105239_10320559
974 Ga0105239_11685950
975 Ga0105239_12044287
976 Ga0105246_10084077
977 Ga0105246_10629625
978 Ga0105246_10684058
979 Ga0105246_11017415
980 Ga0105246_11934330
981 Ga0157373_10644536
982 Ga0157371_10575164
983 Ga0157370_10612536
984 Ga0157369_10013414
985 Ga0157369_10091038
986 Ga0157369_10802807
987 Ga0157374_10974492
988 Ga0157374_12361782
989 Ga0157378_10002191
990 Ga0157378_13055904
991 Ga0163162_11489448
992 Ga0157372_10001764
993 Ga0157372_10288672
994 Ga0157372_10499453
995 Ga0157375_10253297
996 Ga0157375_10948887
997 Ga0157375_13079545
998 Ga0163163_10800312
999 Ga0163163_10839809
1000 Ga0157380_10091584
1001 Ga0157380_10159449
1002 Ga0157380_11760194
1003 Ga0182008_10048244
1004 Ga0182008_10950239
1005 Ga0157377_10162483
1006 Ga0157377_10317023
1007 Ga0157377_11143061
1008 Ga0157379_11122711
1009 Ga0157379_12592906
1010 Ga0157376_10004669
1011 Ga0157376_11309255
1012 Ga0157376_11633764
1013 Ga0182006_1040727
1014 Ga0163161_10943030
1015 Ga0214542_1017188
1016 Ga0214543_1003948
1017 Ga0213875_10131227
1018 Ga0209646_1031354
1019 Ga0209026_1000041
1020 Ga0209148_1031932
1021 Ga0209759_1000183
1022 Ga0209233_1005342
1023 Ga0209758_1004876
1024 Ga0207653_10081072
1025 Ga0207692_10026369
1026 Ga0207642_10001185
1027 Ga0207710_10358700
1028 Ga0207688_10030369
1029 Ga0207688_10302187
1030 Ga0207680_10080823
1031 Ga0207647_10047477
1032 Ga0207647_10160841
1033 Ga0207685_10105872
1034 Ga0207699_11117500
1035 Ga0207645_10274585
1036 Ga0207643_10014574
1037 Ga0207643_10505770
1038 Ga0207705_10273673
1039 Ga0207654_10006726
1040 Ga0207654_10114032
1041 Ga0207654_11049961
1042 Ga0207695_10008332
1043 Ga0207695_10215789
1044 Ga0207695_11255702
1045 Ga0207671_10659856
1046 Ga0207671_10680167
1047 Ga0207693_10385519
1048 Ga0207693_11332991
1049 Ga0207663_11212164
1050 Ga0207660_10001600
1051 Ga0207662_10000047
1052 Ga0207657_10138926
1053 Ga0207649_10241999
1054 Ga0207652_10430273
1055 Ga0207681_10115942
1056 Ga0207681_10174461
1057 Ga0207694_10310615
1058 Ga0207694_10381696
1059 Ga0207694_10561020
1060 Ga0207694_10835868
1061 Ga0207650_11681615
1062 Ga0207659_10228536
1063 Ga0207687_10000828
1064 Ga0207700_10323324
1065 Ga0207700_11913378
1066 Ga0207706_10378185
1067 Ga0207706_10515587
1068 Ga0207706_10804353
1069 Ga0207686_10002983
1070 Ga0207709_10002565
1071 Ga0207709_10396392
1072 Ga0207670_10008080
1073 Ga0207670_10052109
1074 Ga0207670_10324639
1075 Ga0207669_10104330
1076 Ga0207669_11857795
1077 Ga0207704_10002010
1078 Ga0207704_10341129
1079 Ga0207665_11535924
1080 Ga0207665_11574273
1081 Ga0207691_10015973
1082 Ga0207691_10691514
1083 Ga0207689_10000148
1084 Ga0207689_10027064
1085 Ga0207661_10331704
1086 Ga0207667_10003186
1087 Ga0207667_10014392
1088 Ga0207667_10166216
1089 Ga0207667_11267530
1090 Ga0207651_10220471
1091 Ga0207651_11886749
1092 Ga0207712_10040868
1093 Ga0207668_10132435
1094 Ga0207668_11085287
1095 Ga0207668_11091065
1096 Ga0207668_11193757
1097 Ga0207640_10005304
1098 Ga0207640_10908893
1099 Ga0207658_10994819
1100 Ga0207677_10023199
1101 Ga0207703_10014274
1102 Ga0207703_10201959
1103 Ga0207639_10086796
1104 Ga0207639_10209480
1105 Ga0207639_10238033
1106 Ga0207639_10577745
1107 Ga0207678_10057430
1108 Ga0207678_10692409
1109 Ga0207678_10757700
1110 Ga0207708_10000347
1111 Ga0207708_10263449
1112 Ga0207702_10071861
1113 Ga0207641_10437256
1114 Ga0207648_10000018
1115 Ga0207648_10110478
1116 Ga0207674_10168179
1117 Ga0207674_10353933
1118 Ga0207675_100000170
1119 Ga0207675_100110040
1120 Ga0207675_100172146
1121 Ga0207683_10126474
1122 Ga0207683_10734043
1123 Ga0207698_10284171
1124 Ga0207698_10324569
1125 Ga0209179_1011466
1126 Ga0209813_10002104
1127 Ga0209813_10023220
1128 Ga0209813_10042564
1129 Ga0209813_10102221
1130 Ga0209813_10501586
1131 Ga0207428_10183032
1132 Ga0207428_10212157
1133 Ga0268266_10659316
1134 Ga0268265_10027798
1135 Ga0268265_10107422
1136 Ga0268265_10686776
1137 Ga0268264_10004786
1138 Ga0268264_10018217
1139 Ga0268264_10234602
1140 Ga0268264_10305861
1141 Ga0268264_12294716
1142 Ga0307515_10902665
1143 Ga0265760_10009010
1144 Ga0307513_10022749
1145 Ga0307513_10703233
1146 Ga0307408_100038393
1147 Ga0307508_10281074
1148 Ga0265314_10005708
1149 Ga0265342_10093523
1150 Ga0307516_10516895
1151 Ga0307405_10005509
1152 Ga0307405_10751010
1153 Ga0307405_11640492
1154 Ga0307413_10000331
1155 Ga0307410_10001187
1156 Ga0307410_10858703
1157 Ga0307406_10151626
1158 Ga0307407_10002906
1159 Ga0307412_10009788
1160 Ga0307412_10501169
1161 Ga0307409_100004047
1162 Ga0307409_101246282
1163 Ga0307416_100007308
1164 Ga0307416_100070678
1165 Ga0307416_100083706
1166 Ga0307416_100136430
1167 Ga0307416_103015848
1168 Ga0307414_10007282
1169 Ga0307414_10535169
1170 Ga0307411_10001587
1171 Ga0307411_10933780
1172 Ga0307415_100002107
1173 Ga0307415_100193294
1174 Ga0307415_100630980
1175 Ga0307415_100642028
1176 Ga0307415_101140924
1177 Ga0373958_0130733
1178 Ga0373938_0095668
1179 Ga0373926_0403002
1180 Ga0373932_0277105
1181 Ga0373936_0079245
1182 Ga0373939_0070120
1183 Ga0373941_0115190
1184 Ga0373945_0145558
1185 Ga0373960_0050381
1186 Ga0373943_0017758
1187 Ga0373961_0077691
1188 Ga0373961_0323807
1189 Ga0373962_0109997
1190 Ga0373931_0015187
1191 Ga0373931_0125341
1192 Ga0373935_0190749
1193 Ga0373927_0041938
1194 Ga0373927_0914262
1195 Ga0373947_0127279
1196 Ga0373925_0121589
1197 Ga0373925_0449402
1198 Ga0395899_0488877
1199 Ga0395900_0295271
1200 Ga0395900_0558823
1201 Ga0395900_1738728
1202 Ga0395905_0058652
1203 Ga0395905_1059692
1204 Ga0436364_0621060
1205 Ga0436364_1195282
1206 Ga0395901_0109279
1207 Ga0436365_1518675
1208 Ga0436361_0651230
1209 Ga0436363_1340339
1210 Ga0451793_0549640
1211 Ga0451797_1392329
1212 Ga0451800_0429269
1213 Ga0451839_0783888
1214 Ga0451851_0528120
1215 Ga0439455_0007330
1216 Ga0439434_0217307
1217 Ga0466972_0293744
1218 Ga0466960_0018930
1219 Ga0451576_0497777
1220 Ga0495617_045293
1221 Ga0495603_0169658
1222 Ga0495638_0084172
1223 Ga0495638_0245281
1224 Ga0495580_0008152
1225 Ga0495580_0435832
1226 Ga0495582_0099858
1227 Ga0495582_0249284
1228 Ga0495662_0671501
1229 Ga0495585_0095034
1230 Ga0495596_0434217
1231 Ga0495606_0341431
1232 Ga0495610_0154947
1233 Ga0495616_0098178
1234 Ga0495620_0051884
1235 Ga0495620_0134279
1236 Ga0495631_0113488
1237 Ga0495632_0079334
1238 Ga0495632_0183883
1239 Ga0495637_0110950
1240 Ga0495643_0101325
1241 Ga0495648_0333335
1242 Ga0495663_0063422
1243 Ga0495666_0043023
1244 Ga0495665_0225572
1245 Ga0495621_0193622
1246 Ga0495597_0079795
1247 Ga0495633_0483921
1248 Ga0495656_0019559
1249 Ga0495656_0176980
1250 Ga0495668_0328421
1251 Ga0495668_0823700
1252 Ga0495611_0406587
1253 Ga0495625_0846754
1254 Ga0495661_0308315
1255 Ga0495588_0076378
1256 Ga0495647_0324553
1257 Ga0495658_0113201
1258 Ga0495669_0102590
1259 Ga0495613_0978424
1260 Ga0495670_0051802
1261 Ga0495670_0058280
1262 Ga0495671_0542310
1263 Ga0495649_0497008
1264 Ga0495660_0385499
1265 Ga0495581_0353453
1266 Ga0495676_0359302
1267 Ga0495685_301312
1268 Ga0495673_0049155
1269 Ga0495673_0079413
1270 Ga0495686_0576372
1271 Ga0495615_0151374
1272 Ga0496107_0418644
1273 Ga0496107_1008351
1274 Ga0496107_1157936
1275 Ga0496108_0497171
1276 Ga0496110_0673174
1277 Ga0496111_0228644
1278 Ga0496112_0069460
1279 Ga0496113_0213365
1280 Ga0496114_1190604
1281 Ga0496115_0105400
1282 Ga0496117_0394801
1283 Ga0496118_0183137
1284 Ga0496118_0211305
1285 Ga0496119_0072404
1286 Ga0496119_0177092
1287 Ga0496121_0072096
1288 Ga0496124_0128314
1289 Ga0496124_0239933
1290 Ga0496124_0336627
1291 Ga0496125_0054114
1292 Ga0496125_0214367
1293 Ga0496126_1327170
1294 Ga0501040_0074659
1295 Ga0501041_0136294
1296 Ga0501042_0252003
1297 Ga0501046_0308499
1298 Ga0501067_0834037
1299 Ga0501072_0363414
1300 Ga0501073_1212650
1301 Ga0501075_0812933
1302 Ga0501075_1266472
1303 Ga0501076_0436522
1304 Ga0501076_0719126
1305 Ga0501077_0001429
1306 Ga0501077_0855234
1307 Ga0501249_209234
1308 Ga0501079_0041926
1309 Ga0501080_1353222
1310 Ga0501081_0065194
1311 Ga0501081_0646113
1312 Ga0501268_108957
1313 Ga0501035_0239428
1314 Ga0501045_0116181
1315 nmdc:mga03683_202985_c1
1316 nmdc:mga03683_387159_c1
1317 nmdc:mga03683_458104_c1
1318 nmdc:mga03n38_151385_c1
1319 nmdc:mga03n38_16618_c1
1320 nmdc:mga03n38_169794_c1
1321 nmdc:mga00v17_125099_c1
1322 nmdc:mga00v17_148660_c1
1323 nmdc:mga00v17_203290_c1
1324 nmdc:mga00v17_561989_c1
1325 nmdc:mga0yw44_37075_c1
1326 nmdc:mga0yw44_459752_c1
1327 nmdc:mga0yw44_612386_c1
1328 nmdc:mga0yw44_72202_c1
1329 nmdc:mga0k408_169366_c1
1330 nmdc:mga0k408_251348_c1
1331 nmdc:mga06z11_15701_c1
1332 nmdc:mga06z11_174779_c1
1333 nmdc:mga06z11_222834_c1
1334 nmdc:mga06z11_327174_c1
1335 nmdc:mga06z11_685942_c1
1336 nmdc:mga06z11_93053_c1
1337 nmdc:mga06z11_948_c1
1338 nmdc:mga04h51_2274_c1
1339 nmdc:mga04h51_3214_c1
1340 nmdc:mga04h51_39042_c1
1341 nmdc:mga04h51_45230_c1
1342 nmdc:mga04h51_534924_c1
1343 nmdc:mga07m45_26757_c1
1344 nmdc:mga07m45_362196_c1
1345 nmdc:mga05p37_1425998_c1
1346 nmdc:mga05p37_1716262_c1
1347 nmdc:mga06r32_1282362_c1
1348 nmdc:mga08y16_341185_c1
1349 nmdc:mga08y16_79567_c1
1350 nmdc:mga0n895_1229855_c1
1351 nmdc:mga0n895_16556_c1
1352 nmdc:mga0n895_63294_c1
1353 nmdc:mga0rr50_4551_c1
1354 nmdc:mga08x19_20440_c1
1355 nmdc:mga08x19_4574_c1
1356 nmdc:mga0a205_11310_c1
1357 nmdc:mga0a205_284_c1
1358 nmdc:mga0sz30_143088_c2
1359 nmdc:mga0sz30_549754_c1
1360 Ga0495601_0654609
1361 Ga0500610_0016833
1362 Ga0495655_0079833
1363 Ga0500643_122587
1364 Ga0500651_0713750
1365 Ga0500566_0339599
1366 Ga0500594_0200151
1367 Ga0500658_0081485
1368 Ga0500604_0352105
1369 Ga0500616_0039935
1370 Ga0500645_188741
1371 Ga0500609_050394
1372 Ga0501084_0055877
1373 Ga0501082_0145516
1374 Ga0501082_1515379
1375 Ga0530510_0134932
1376 Ga0530510_0563914
1377 2509108273
1378 2509115190
1379 2509142752
1380 2512530534
1381 2512932979
1382 2513611190
1383 2588519032
1384 2597811352
1385 2599939049
1386 2643986071
1387 2644153636
1388 2756677403
1389 2792748382
1390 2841737361
1391 2844009106
1392 2856322697
1393 2856346031
1394 2869165173
1395 2869285785
1396 2871471661
1397 2871498037
1398 2874128835
1399 2874141901
1400 2874175671
1401 2876364774
1402 2876376508
1403 2876384643
1404 2876396172
1405 2876817319
1406 2878739360
1407 2878762259
1408 2878769226
1409 2878789392
1410 2879117769
1411 2881149439
1412 2881166338
1413 2885307769
1414 2885313229
1415 2885328772
1416 2885336071
1417 2889018780
1418 2889791001
1419 2889915394
1420 2896384696
1421 2903449239
1422 2903522490
1423 2903528869
1424 2903542835
1425 2904662948
1426 2906379243
1427 2908745779
1428 2924726593
1429 2924776881
1430 2937825752
1431 2937840709
1432 2937855419
1433 2937883518
1434 2937973503
1435 2937996685
1436 2938015921
1437 2958041801
1438 2958050332
1439 2958073658
1440 2958090686
1441 2958100602
1442 2958103535
1443 2958148488
1444 2958167157
1445 2958175654
1446 2961117974
1447 2961165626
1448 2963646230
1449 2965020449
1450 2965120261
1451 2968016702
1452 2968085302
1453 2968114035
1454 2968123224
1455 2968174028
1456 2970470044
1457 2970527000
1458 2970557114
1459 2970600402
1460 2977871002
1461 2977928875
1462 2977988879
1463 2979712326
1464 2987661634
1465 2996353027
1466 3004190683
1467 3004211519
1468 3004224932
1469 3004279709
1470 3004290556
1471 3004336188
1472 637076059
1473 8004636748
1474 8004645496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01022

HTH_5

Bacterial regulatory protein, arsR family

56

87

0.93

PF13412

HTH_24

Winged helix-turn-helix DNA-binding

51

86

0.9

PF12840

HTH_20

Helix-turn-helix domain

49

87

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ghb-assembly2.cif.gz_D crystal structure of spx in complex with yjbh (oxidized) 0.9257 41 84
6gho-assembly1.cif.gz_B crystal structure of spx in complex with yjbh 0.9225 41 86
6ghb-assembly1.cif.gz_B crystal structure of spx in complex with yjbh (oxidized) 0.9219 41 85
1bi3-assembly1.cif.gz_A structure of apo-and holo-diphtheria toxin repressor 0.9117 43 86
4ija-assembly1.cif.gz_A structure of s. aureus methicillin resistance factor mecr2 0.9108 40 83
ID Description Score Start End Superfamily
af_Q4DZU8_467_618_3.30.230.130 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Cullin; Chain C, Domain 2 0.9678 41 83 3.30.230.130
2ev5A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9514 46 70 1.10.10.10
1bi2B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9477 46 71 1.10.10.10
3r61A01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9414 43 70 1.10.10.10
af_P9WKV1_40_102_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9373 41 73 1.10.10.10
ID Description Score Start End GO Terms
AF-A0A7W1MSV9-F1-model_v4 Winged helix-turn-helix transcriptional regulator 0.9901 4 99 GO:0003700
AF-A0A2P2EA55-F1-model_v4 HTH arsR-type domain-containing protein 0.9899 21 97 GO:0003700
AF-A0A534P4A4-F1-model_v4 Helix-turn-helix transcriptional regulator 0.989 17 99 GO:0003700
AF-A0A1Y6BE31-F1-model_v4 Transcriptional regulator, ArsR family 0.9876 4 99 GO:0003700
AF-A0A1G9R1Z8-F1-model_v4 DNA-binding transcriptional regulator, ArsR family 0.9848 3 99 GO:0003677
GO:0003700

Map