F478194

General Info

Members Datasets Scaffolds Average Seq Length
735 258 1470 181

Family's Representative Sequence

Representative Sequence 3300009147|Ga0114129_10077682|Ga0114129_100776822
Length 203
Sequence LEAQRRLISSGTGYDRDVTGGAAPILLVSMPQMMDPNFARTVVLLCDYTEEGAFGLVVNRPMNEPAWQMVKTEPPIRVDPDLKLWMGGPVDTQRTWVLMTEAQGPDEEQREICPGVLLSVSHELTLQLLQTPPSSRARVLVGYAGWGPGQLDKELAASAWLTTTVDPKLIFGVPPEEMWEAAIRRLGADPSAFQTSSGTSGVH

Samples

Sample ID Description Type Environment
1 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
25 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
26 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
27 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
28 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
32 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
71 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
72 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
80 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
81 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
82 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
83 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
88 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
89 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
92 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
99 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
100 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
101 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
102 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
103 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
108 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
109 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
158 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
162 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
163 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
164 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
165 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
166 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
167 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
168 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
169 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
170 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
171 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
172 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
173 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
174 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
175 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
176 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
177 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
178 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
179 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
180 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
181 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
182 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
183 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
184 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
185 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
186 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
187 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
188 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
189 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
190 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
191 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
192 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
193 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
194 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
195 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
196 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
197 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
198 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
199 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
200 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
201 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
202 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
203 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
204 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
205 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
206 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
207 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
208 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
211 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
212 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
218 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
219 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
220 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
221 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
226 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
227 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
228 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
229 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
230 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
231 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
232 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
233 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
234 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
235 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
236 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
237 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
238 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
239 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
240 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
241 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
242 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
243 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
244 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
245 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
246 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
247 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
248 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
249 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
250 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
251 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
252 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
253 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
254 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
255 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
256 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
257 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
258 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.5
Rhizosphere 98.37
Stem 0
Stem Tuber 0
Unclassified 16.73

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0114129_10077682 3300009147 Bacteria 4617
2 MBSR1b_contig_9913106 2162886012 Bacteria 1373
3 JGI24743J22301_10085011 3300001991 Bacteria 671
4 JGI24034J26672_10058865 3300002239 Bacteria 671
5 JGI25406J46586_10016631 3300003203 Bacteria 3062
6 Ga0065714_10077083 3300005288 Bacteria 2724
7 Ga0065704_10003679 3300005289 Bacteria 4780
8 Ga0065704_10167513 3300005289 Unclassified 1313
9 Ga0065712_10015093 3300005290 Bacteria 2524
10 Ga0065712_10068368 3300005290 Bacteria 11252
11 Ga0065712_10160855 3300005290 Bacteria 1303
12 Ga0065712_10212556 3300005290 Bacteria 1068
13 Ga0065712_10357639 3300005290 Bacteria 777
14 Ga0065715_10120057 3300005293 Bacteria 2269
15 Ga0065715_10179602 3300005293 Bacteria 1486
16 Ga0065715_10209219 3300005293 Bacteria 1322
17 Ga0065715_10385264 3300005293 Bacteria 901
18 Ga0065707_10184930 3300005295 Unclassified 1395
19 Ga0070676_10002766 3300005328 Bacteria 9061
20 Ga0070676_10051431 3300005328 Bacteria 2419
21 Ga0070676_10060604 3300005328 Bacteria 2248
22 Ga0070683_100193571 3300005329 Bacteria 1931
23 Ga0070690_100009110 3300005330 Bacteria 5742
24 Ga0070690_100089681 3300005330 Bacteria 2023
25 Ga0070670_100004027 3300005331 Bacteria 12269
26 Ga0070670_100039750 3300005331 Bacteria 4045
27 Ga0070670_100183663 3300005331 Bacteria 1816
28 Ga0070670_100255837 3300005331 Bacteria 1526
29 Ga0070670_100267449 3300005331 Bacteria 1491
30 Ga0070670_100674573 3300005331 Bacteria 928
31 Ga0070677_10044626 3300005333 Bacteria 1765
32 Ga0070677_10066064 3300005333 Bacteria 1507
33 Ga0070677_10094564 3300005333 Unclassified 1306
34 Ga0070677_10267409 3300005333 Unclassified 856
35 Ga0068869_100006349 3300005334 Bacteria 7489
36 Ga0068869_100351978 3300005334 Bacteria 1201
37 Ga0070666_10117021 3300005335 Bacteria 1846
38 Ga0070666_10185788 3300005335 Bacteria 1459
39 Ga0070680_100063829 3300005336 Bacteria 3017
40 Ga0070682_100905537 3300005337 Unclassified 725
41 Ga0068868_100234581 3300005338 Bacteria 1540
42 Ga0068868_100455684 3300005338 Unclassified 1113
43 Ga0070660_100443102 3300005339 Bacteria 1077
44 Ga0070660_100574737 3300005339 Bacteria 941
45 Ga0070689_100008978 3300005340 Bacteria 7075
46 Ga0070689_100114581 3300005340 Bacteria 2148
47 Ga0070689_100115461 3300005340 Bacteria 2140
48 Ga0070687_100028939 3300005343 Bacteria 2692
49 Ga0070687_100060665 3300005343 Bacteria 1996
50 Ga0070687_100132440 3300005343 Bacteria 1441
51 Ga0070687_100152159 3300005343 Bacteria 1359
52 Ga0070661_100269250 3300005344 Bacteria 1319
53 Ga0070661_100326002 3300005344 Bacteria 1200
54 Ga0070692_10030785 3300005345 Bacteria 2685
55 Ga0070692_10285393 3300005345 Bacteria 1002
56 Ga0070668_100050753 3300005347 Bacteria 3195
57 Ga0070668_100740980 3300005347 Unclassified 869
58 Ga0070669_100000856 3300005353 Bacteria 22099
59 Ga0070669_100092809 3300005353 Bacteria 2266
60 Ga0070669_100095542 3300005353 Bacteria 2235
61 Ga0070669_100100409 3300005353 Bacteria 2182
62 Ga0070669_100372739 3300005353 Bacteria 1163
63 Ga0070675_100006124 3300005354 Bacteria 9225
64 Ga0070675_100009223 3300005354 Bacteria 7664
65 Ga0070675_100010779 3300005354 Bacteria 7148
66 Ga0070675_100016465 3300005354 Bacteria 5870
67 Ga0070675_100016542 3300005354 Bacteria 5856
68 Ga0070675_100045930 3300005354 Unclassified 3576
69 Ga0070675_100060842 3300005354 Bacteria 3118
70 Ga0070675_100129535 3300005354 Unclassified 2149
71 Ga0070675_100655515 3300005354 Unclassified 954
72 Ga0070675_100661522 3300005354 Bacteria 950
73 Ga0070675_101019262 3300005354 Bacteria 760
74 Ga0070671_100070429 3300005355 Bacteria 2917
75 Ga0070671_100102911 3300005355 Unclassified 2396
76 Ga0070671_100277115 3300005355 Bacteria 1426
77 Ga0070671_100309181 3300005355 Bacteria 1346
78 Ga0070671_100374089 3300005355 Unclassified 1217
79 Ga0070674_100020412 3300005356 Bacteria 4233
80 Ga0070674_100185643 3300005356 Bacteria 1596
81 Ga0070674_100208357 3300005356 Bacteria 1514
82 Ga0070674_100299771 3300005356 Bacteria 1281
83 Ga0070674_100673241 3300005356 Archaea 882
84 Ga0070674_101404735 3300005356 Unclassified 625
85 Ga0070673_100001539 3300005364 Bacteria 13573
86 Ga0070673_100007032 3300005364 Bacteria 7379
87 Ga0070673_100047942 3300005364 Bacteria 3327
88 Ga0070673_100111044 3300005364 Bacteria 2274
89 Ga0070673_100111244 3300005364 Bacteria 2272
90 Ga0070673_100118106 3300005364 Bacteria 2208
91 Ga0070673_100119140 3300005364 Bacteria 2199
92 Ga0070673_100403239 3300005364 Bacteria 1223
93 Ga0070673_100462087 3300005364 Bacteria 1143
94 Ga0070673_100505344 3300005364 Unclassified 1094
95 Ga0070673_100530025 3300005364 Bacteria 1068
96 Ga0070688_100029063 3300005365 Bacteria 3307
97 Ga0070688_100086860 3300005365 Bacteria 2036
98 Ga0070688_100128053 3300005365 Unclassified 1709
99 Ga0070688_100146990 3300005365 Bacteria 1607
100 Ga0070688_100220891 3300005365 Bacteria 1335
101 Ga0070688_100782495 3300005365 Bacteria 745
102 Ga0070667_100189606 3300005367 Bacteria 1821
103 Ga0070667_100204269 3300005367 Bacteria 1754
104 Ga0070667_100293646 3300005367 Bacteria 1462
105 Ga0070667_100358639 3300005367 Unclassified 1321
106 Ga0070667_100775108 3300005367 Bacteria 890
107 Ga0070703_10040960 3300005406 Unclassified 1442
108 Ga0070713_100038069 3300005436 Bacteria 3894
109 Ga0070701_10005923 3300005438 Bacteria 5104
110 Ga0070701_10007456 3300005438 Bacteria 4676
111 Ga0070705_100000945 3300005440 Bacteria 16268
112 Ga0070705_100027873 3300005440 Bacteria 3088
113 Ga0070705_100241307 3300005440 Bacteria 1263
114 Ga0070705_100270743 3300005440 Unclassified 1203
115 Ga0070700_100000977 3300005441 Bacteria 14091
116 Ga0070700_100143410 3300005441 Unclassified 1626
117 Ga0070700_101082730 3300005441 Unclassified 663
118 Ga0070700_101180789 3300005441 Bacteria 638
119 Ga0070694_100035140 3300005444 Bacteria 3311
120 Ga0070694_100175151 3300005444 Bacteria 1583
121 Ga0070708_100115916 3300005445 Bacteria 2467
122 Ga0070663_100039698 3300005455 Bacteria 3291
123 Ga0070663_100401729 3300005455 Bacteria 1120
124 Ga0070663_100634097 3300005455 Bacteria 902
125 Ga0070678_100294825 3300005456 Bacteria 1376
126 Ga0070662_100196338 3300005457 Bacteria 1599
127 Ga0070662_100360990 3300005457 Bacteria 1192
128 Ga0070662_100452346 3300005457 Unclassified 1066
129 Ga0070681_10043296 3300005458 Bacteria 4510
130 Ga0070681_10853644 3300005458 Unclassified 828
131 Ga0070681_11194955 3300005458 Unclassified 682
132 Ga0068867_100000312 3300005459 Bacteria 32121
133 Ga0068867_100516570 3300005459 Unclassified 1029
134 Ga0070685_10030207 3300005466 Bacteria 3017
135 Ga0070685_10089364 3300005466 Bacteria 1862
136 Ga0070685_10307209 3300005466 Bacteria 1071
137 Ga0070706_100315504 3300005467 Bacteria 1458
138 Ga0070706_100512310 3300005467 Bacteria 1116
139 Ga0070707_100231631 3300005468 Bacteria 1798
140 Ga0070707_100525830 3300005468 Bacteria 1145
141 Ga0070707_100587380 3300005468 Bacteria 1076
142 Ga0070707_100662945 3300005468 Bacteria 1006
143 Ga0070698_100011081 3300005471 Bacteria 9580
144 Ga0070698_100172562 3300005471 Bacteria 2103
145 Ga0070698_100277534 3300005471 Bacteria 1607
146 Ga0070699_100000339 3300005518 Bacteria 45340
147 Ga0070699_100008740 3300005518 Bacteria 8776
148 Ga0070699_100025804 3300005518 Bacteria 5065
149 Ga0070679_100103251 3300005530 Bacteria 2837
150 Ga0070679_100631573 3300005530 Unclassified 1014
151 Ga0070684_100220182 3300005535 Bacteria 1732
152 Ga0070684_100834934 3300005535 Bacteria 862
153 Ga0070684_100981861 3300005535 Bacteria 792
154 Ga0070697_100013470 3300005536 Bacteria 6416
155 Ga0070697_100091454 3300005536 Bacteria 2516
156 Ga0068853_100543440 3300005539 Bacteria 1100
157 Ga0068853_101407719 3300005539 Unclassified 674
158 Ga0070672_100022480 3300005543 Bacteria 4633
159 Ga0070672_100023573 3300005543 Bacteria 4539
160 Ga0070672_100030019 3300005543 Bacteria 4081
161 Ga0070672_100050762 3300005543 Bacteria 3233
162 Ga0070672_100063477 3300005543 Bacteria 2917
163 Ga0070672_100110086 3300005543 Bacteria 2244
164 Ga0070672_100134291 3300005543 Unclassified 2037
165 Ga0070672_100193989 3300005543 Bacteria 1697
166 Ga0070672_100232531 3300005543 Unclassified 1549
167 Ga0070672_100598663 3300005543 Unclassified 960
168 Ga0070672_101192300 3300005543 Bacteria 678
169 Ga0070686_100035832 3300005544 Bacteria 3067
170 Ga0070686_100123930 3300005544 Bacteria 1778
171 Ga0070686_100161764 3300005544 Bacteria 1577
172 Ga0070686_100425017 3300005544 Unclassified 1016
173 Ga0070686_100505915 3300005544 Bacteria 938
174 Ga0070695_100000104 3300005545 Bacteria 37120
175 Ga0070695_100101906 3300005545 Bacteria 1935
176 Ga0070695_100278104 3300005545 Bacteria 1229
177 Ga0070695_100320995 3300005545 Bacteria 1151
178 Ga0070696_100001243 3300005546 Bacteria 16558
179 Ga0070696_100181782 3300005546 Bacteria 1560
180 Ga0070696_100341504 3300005546 Unclassified 1157
181 Ga0070696_100467189 3300005546 Unclassified 998
182 Ga0070696_100477520 3300005546 Unclassified 988
183 Ga0070693_100223816 3300005547 Bacteria 1234
184 Ga0070665_100669826 3300005548 Bacteria 1051
185 Ga0070704_100000217 3300005549 Bacteria 24097
186 Ga0070704_100020395 3300005549 Bacteria 4273
187 Ga0070704_100023689 3300005549 Bacteria 4016
188 Ga0070704_100085017 3300005549 Bacteria 2340
189 Ga0070704_100098422 3300005549 Bacteria 2198
190 Ga0070704_100127544 3300005549 Bacteria 1966
191 Ga0070704_100184223 3300005549 Bacteria 1673
192 Ga0070704_100270044 3300005549 Bacteria 1405
193 Ga0070704_100651057 3300005549 Bacteria 930
194 Ga0070704_100687396 3300005549 Bacteria 906
195 Ga0070704_101089742 3300005549 Bacteria 725
196 Ga0070664_100017353 3300005564 Bacteria 5911
197 Ga0070664_100057405 3300005564 Bacteria 3309
198 Ga0070664_100062719 3300005564 Bacteria 3169
199 Ga0070664_100133795 3300005564 Bacteria 2179
200 Ga0070664_100262247 3300005564 Bacteria 1555
201 Ga0070664_100281671 3300005564 Bacteria 1499
202 Ga0068857_100004013 3300005577 Bacteria 12394
203 Ga0068857_100072112 3300005577 Bacteria 3078
204 Ga0068857_100100626 3300005577 Bacteria 2593
205 Ga0068854_100040365 3300005578 Bacteria 3293
206 Ga0068854_100530341 3300005578 Unclassified 996
207 Ga0070702_100024090 3300005615 Bacteria 3242
208 Ga0070702_100314244 3300005615 Unclassified 1089
209 Ga0070702_100417424 3300005615 Bacteria 965
210 Ga0070702_100563349 3300005615 Bacteria 848
211 Ga0068859_100059548 3300005617 Bacteria 3847
212 Ga0068859_100069456 3300005617 Bacteria 3558
213 Ga0068859_100179925 3300005617 Bacteria 2197
214 Ga0068859_100319797 3300005617 Bacteria 1646
215 Ga0068859_100355519 3300005617 Bacteria 1560
216 Ga0068859_100563066 3300005617 Bacteria 1234
217 Ga0068859_100861154 3300005617 Bacteria 992
218 Ga0068864_100018478 3300005618 Bacteria 5825
219 Ga0068864_100076415 3300005618 Bacteria 2926
220 Ga0068864_100125455 3300005618 Unclassified 2300
221 Ga0068864_100647439 3300005618 Bacteria 1029
222 Ga0068864_100675968 3300005618 Bacteria 1007
223 Ga0068866_10025977 3300005718 Bacteria 2760
224 Ga0068861_100001127 3300005719 Bacteria 16585
225 Ga0068861_100055766 3300005719 Bacteria 3015
226 Ga0068861_100154308 3300005719 Bacteria 1887
227 Ga0068861_100338209 3300005719 Bacteria 1316
228 Ga0068861_100371761 3300005719 Bacteria 1260
229 Ga0068861_101024271 3300005719 Bacteria 789
230 Ga0068851_10064133 3300005834 Bacteria 1888
231 Ga0068851_10425909 3300005834 Archaea 784
232 Ga0068851_10656882 3300005834 Bacteria 642
233 Ga0068870_10001501 3300005840 Bacteria 9458
234 Ga0068870_10012640 3300005840 Bacteria 3949
235 Ga0068870_10040605 3300005840 Bacteria 2413
236 Ga0068870_10176770 3300005840 Archaea 1278
237 Ga0068870_10281380 3300005840 Bacteria 1043
238 Ga0068870_10368086 3300005840 Bacteria 927
239 Ga0068863_100278962 3300005841 Unclassified 1619
240 Ga0068863_100316939 3300005841 Bacteria 1514
241 Ga0068863_100322718 3300005841 Unclassified 1500
242 Ga0068858_100051848 3300005842 Bacteria 3796
243 Ga0068858_100253267 3300005842 Bacteria 1673
244 Ga0068860_100008638 3300005843 Bacteria 10152
245 Ga0068860_100029651 3300005843 Bacteria 5264
246 Ga0068860_100542702 3300005843 Unclassified 1164
247 Ga0068862_100001227 3300005844 Bacteria 24174
248 Ga0068862_100041188 3300005844 Bacteria 3930
249 Ga0081455_10203175 3300005937 Bacteria 1482
250 Ga0081539_10000013 3300005985 Bacteria 432395
251 Ga0070717_10971524 3300006028 Bacteria 773
252 Ga0075432_10047471 3300006058 Bacteria 1509
253 Ga0097621_100048626 3300006237 Bacteria 3442
254 Ga0097621_100305038 3300006237 Bacteria 1407
255 Ga0097621_100491385 3300006237 Unclassified 1111
256 Ga0097621_100649716 3300006237 Unclassified 968
257 Ga0097621_100665019 3300006237 Bacteria 957
258 Ga0097621_100809924 3300006237 Unclassified 868
259 Ga0068871_100318454 3300006358 Unclassified 1369
260 Ga0068871_100346334 3300006358 Bacteria 1313
261 Ga0068871_100597763 3300006358 Bacteria 1003
262 Ga0075428_100000570 3300006844 Bacteria 37577
263 Ga0075428_100015357 3300006844 Bacteria 8491
264 Ga0075428_100025275 3300006844 Bacteria 6572
265 Ga0075428_100040426 3300006844 Bacteria 5130
266 Ga0075428_100046092 3300006844 Bacteria 4790
267 Ga0075428_100155848 3300006844 Bacteria 2481
268 Ga0075428_100172852 3300006844 Bacteria 2341
269 Ga0075428_100265227 3300006844 Bacteria 1849
270 Ga0075430_100005382 3300006846 Bacteria 10807
271 Ga0075430_100039162 3300006846 Bacteria 4014
272 Ga0075430_100055916 3300006846 Bacteria 3318
273 Ga0075430_100180438 3300006846 Bacteria 1756
274 Ga0075430_100200848 3300006846 Bacteria 1655
275 Ga0075430_100366293 3300006846 Bacteria 1190
276 Ga0075431_100012264 3300006847 Bacteria 8650
277 Ga0075431_100015457 3300006847 Bacteria 7734
278 Ga0075431_100069444 3300006847 Bacteria 3635
279 Ga0075433_10007769 3300006852 Bacteria 8521
280 Ga0075433_10424071 3300006852 Bacteria 1173
281 Ga0075434_100001528 3300006871 Bacteria 19561
282 Ga0075434_100009607 3300006871 Bacteria 9031
283 Ga0075434_100047751 3300006871 Bacteria 4247
284 Ga0075434_100116204 3300006871 Bacteria 2689
285 Ga0075434_100196608 3300006871 Bacteria 2036
286 Ga0075434_100769720 3300006871 Unclassified 979
287 Ga0075429_100022282 3300006880 Bacteria 5495
288 Ga0075429_100026648 3300006880 Bacteria 5020
289 Ga0075429_100360042 3300006880 Unclassified 1274
290 Ga0075429_100469439 3300006880 Bacteria 1102
291 Ga0068865_100005000 3300006881 Bacteria 8018
292 Ga0068865_100173264 3300006881 Bacteria 1656
293 Ga0068865_100415993 3300006881 Bacteria 1104
294 Ga0068865_100687364 3300006881 Unclassified 873
295 Ga0075436_100550137 3300006914 Unclassified 847
296 Ga0097620_100059551 3300006931 Bacteria 3847
297 Ga0097620_100069459 3300006931 Bacteria 3558
298 Ga0097620_100179927 3300006931 Bacteria 2197
299 Ga0097620_100319797 3300006931 Bacteria 1646
300 Ga0097620_100355521 3300006931 Bacteria 1560
301 Ga0097620_100563117 3300006931 Bacteria 1234
302 Ga0097620_100860973 3300006931 Bacteria 992
303 Ga0075435_100009946 3300007076 Bacteria 6927
304 Ga0075435_100156880 3300007076 Bacteria 1915
305 Ga0075435_100245991 3300007076 Unclassified 1522
306 Ga0075435_100304781 3300007076 Bacteria 1362
307 Ga0111539_10007596 3300009094 Bacteria 13854
308 Ga0111539_10010710 3300009094 Bacteria 11543
309 Ga0111539_10043789 3300009094 Bacteria 5365
310 Ga0111539_10071662 3300009094 Bacteria 4088
311 Ga0111539_10084121 3300009094 Bacteria 3741
312 Ga0111539_10110719 3300009094 Bacteria 3222
313 Ga0111539_10341016 3300009094 Bacteria 1744
314 Ga0111539_10368776 3300009094 Bacteria 1671
315 Ga0105245_11377573 3300009098 Bacteria 755
316 Ga0105247_10779106 3300009101 Unclassified 728
317 Ga0114129_10004372 3300009147 Bacteria 19935
318 Ga0114129_10009398 3300009147 Bacteria 13936
319 Ga0114129_10017973 3300009147 Bacteria 10067
320 Ga0114129_10023257 3300009147 Bacteria 8790
321 Ga0114129_10027518 3300009147 Bacteria 8049
322 Ga0114129_10050854 3300009147 Bacteria 5819
323 Ga0114129_10237659 3300009147 Bacteria 2450
324 Ga0114129_10280468 3300009147 Bacteria 2226
325 Ga0114129_10879675 3300009147 Bacteria 1137
326 Ga0114129_11028816 3300009147 Bacteria 1035
327 Ga0114129_11196685 3300009147 Unclassified 947
328 Ga0105243_10002420 3300009148 Bacteria 15632
329 Ga0105242_10044763 3300009176 Bacteria 3585
330 Ga0105242_10279824 3300009176 Bacteria 1515
331 Ga0105242_11604220 3300009176 Unclassified 684
332 Ga0105248_10013726 3300009177 Bacteria 8918
333 Ga0105248_11764429 3300009177 Bacteria 702
334 Ga0105238_10015878 3300009551 Bacteria 7619
335 Ga0105238_10397257 3300009551 Bacteria 1371
336 Ga0105249_10017012 3300009553 Bacteria 6451
337 Ga0105249_10291118 3300009553 Bacteria 1634
338 Ga0105246_10177028 3300011119 Bacteria 1639
339 Ga0105246_10331348 3300011119 Unclassified 1241
340 Ga0105246_10680171 3300011119 Bacteria 899
341 Ga0157374_10235306 3300013296 Bacteria 1800
342 Ga0157374_10354285 3300013296 Bacteria 1459
343 Ga0157374_10729725 3300013296 Bacteria 1005
344 Ga0163162_10396687 3300013306 Bacteria 1512
345 Ga0157372_11963038 3300013307 Bacteria 673
346 Ga0157375_10023606 3300013308 Bacteria 5677
347 Ga0157375_10046601 3300013308 Bacteria 4229
348 Ga0157375_10177671 3300013308 Bacteria 2279
349 Ga0157375_10574860 3300013308 Unclassified 1287
350 Ga0157375_10678906 3300013308 Bacteria 1185
351 Ga0157375_12435532 3300013308 Bacteria 625
352 Ga0163163_10028714 3300014325 Bacteria 5346
353 Ga0163163_11544031 3300014325 Unclassified 725
354 Ga0157380_10008263 3300014326 Bacteria 7416
355 Ga0157380_10018259 3300014326 Bacteria 5204
356 Ga0157380_10224904 3300014326 Bacteria 1681
357 Ga0157380_10474533 3300014326 Bacteria 1208
358 Ga0157380_10497412 3300014326 Bacteria 1183
359 Ga0157380_10561559 3300014326 Unclassified 1122
360 Ga0157380_11029729 3300014326 Bacteria 858
361 Ga0157380_11753204 3300014326 Bacteria 679
362 Ga0157377_10024174 3300014745 Bacteria 3228
363 Ga0157377_10033788 3300014745 Bacteria 2794
364 Ga0157377_10134172 3300014745 Bacteria 1515
365 Ga0157377_10391525 3300014745 Bacteria 944
366 Ga0163161_10638144 3300017792 Bacteria 881
367 Ga0207697_10001808 3300025315 Bacteria 11460
368 Ga0207656_10048937 3300025321 Bacteria 1821
369 Ga0207653_10266521 3300025885 Bacteria 659
370 Ga0207682_10005061 3300025893 Bacteria 5405
371 Ga0207682_10058912 3300025893 Bacteria 1604
372 Ga0207682_10066182 3300025893 Bacteria 1522
373 Ga0207682_10072234 3300025893 Bacteria 1464
374 Ga0207642_10053891 3300025899 Bacteria 1832
375 Ga0207642_10089635 3300025899 Bacteria 1516
376 Ga0207642_10202207 3300025899 Bacteria 1098
377 Ga0207642_10411344 3300025899 Unclassified 812
378 Ga0207688_10113003 3300025901 Bacteria 1578
379 Ga0207688_10129121 3300025901 Bacteria 1480
380 Ga0207688_10313937 3300025901 Bacteria 960
381 Ga0207680_10380769 3300025903 Bacteria 995
382 Ga0207645_10013007 3300025907 Bacteria 5624
383 Ga0207645_10037246 3300025907 Bacteria 3121
384 Ga0207645_10224030 3300025907 Unclassified 1240
385 Ga0207643_10009312 3300025908 Bacteria 5279
386 Ga0207643_10009474 3300025908 Bacteria 5231
387 Ga0207643_10072892 3300025908 Bacteria 1978
388 Ga0207643_10115174 3300025908 Unclassified 1587
389 Ga0207684_10423079 3300025910 Bacteria 1144
390 Ga0207684_10591485 3300025910 Unclassified 948
391 Ga0207707_10079120 3300025912 Bacteria 2870
392 Ga0207660_10091840 3300025917 Bacteria 2252
393 Ga0207660_11064610 3300025917 Unclassified 659
394 Ga0207662_10014839 3300025918 Bacteria 4376
395 Ga0207662_10024586 3300025918 Bacteria 3466
396 Ga0207646_10153588 3300025922 Bacteria 2076
397 Ga0207646_10273905 3300025922 Bacteria 1526
398 Ga0207646_10643796 3300025922 Unclassified 950
399 Ga0207681_10002459 3300025923 Bacteria 11748
400 Ga0207681_10026215 3300025923 Bacteria 3757
401 Ga0207681_10043193 3300025923 Bacteria 3016
402 Ga0207681_10154969 3300025923 Bacteria 1721
403 Ga0207681_10223690 3300025923 Bacteria 1457
404 Ga0207681_10321733 3300025923 Bacteria 1230
405 Ga0207694_10018849 3300025924 Bacteria 5216
406 Ga0207694_10483944 3300025924 Bacteria 1035
407 Ga0207650_10032299 3300025925 Bacteria 3786
408 Ga0207650_10189280 3300025925 Bacteria 1643
409 Ga0207650_10204839 3300025925 Bacteria 1582
410 Ga0207659_10000766 3300025926 Bacteria 19078
411 Ga0207659_10009883 3300025926 Bacteria 5971
412 Ga0207659_10010778 3300025926 Bacteria 5752
413 Ga0207659_10017976 3300025926 Bacteria 4627
414 Ga0207659_10028780 3300025926 Bacteria 3779
415 Ga0207659_10098799 3300025926 Unclassified 2196
416 Ga0207659_10175242 3300025926 Bacteria 1695
417 Ga0207659_10801668 3300025926 Bacteria 809
418 Ga0207700_10029368 3300025928 Bacteria 3879
419 Ga0207644_10292925 3300025931 Unclassified 1309
420 Ga0207644_10599175 3300025931 Unclassified 915
421 Ga0207690_10096869 3300025932 Bacteria 2098
422 Ga0207706_10188127 3300025933 Bacteria 1813
423 Ga0207706_10197538 3300025933 Bacteria 1764
424 Ga0207686_10007488 3300025934 Bacteria 5876
425 Ga0207709_10003721 3300025935 Bacteria 8983
426 Ga0207670_10002540 3300025936 Bacteria 9583
427 Ga0207670_10031467 3300025936 Bacteria 3401
428 Ga0207670_10116401 3300025936 Bacteria 1935
429 Ga0207670_10166911 3300025936 Bacteria 1647
430 Ga0207670_10711390 3300025936 Unclassified 832
431 Ga0207669_10113707 3300025937 Bacteria 1820
432 Ga0207669_10190910 3300025937 Unclassified 1478
433 Ga0207669_10368025 3300025937 Bacteria 1116
434 Ga0207704_10002691 3300025938 Bacteria 8018
435 Ga0207704_10015938 3300025938 Bacteria 3846
436 Ga0207704_10305485 3300025938 Bacteria 1221
437 Ga0207704_10381608 3300025938 Bacteria 1106
438 Ga0207704_10898456 3300025938 Unclassified 745
439 Ga0207691_10013664 3300025940 Bacteria 7757
440 Ga0207691_10027070 3300025940 Bacteria 5381
441 Ga0207691_10044274 3300025940 Bacteria 4097
442 Ga0207691_10046349 3300025940 Bacteria 3995
443 Ga0207691_10048693 3300025940 Bacteria 3884
444 Ga0207691_10081783 3300025940 Bacteria 2902
445 Ga0207691_10112117 3300025940 Unclassified 2424
446 Ga0207691_10166175 3300025940 Bacteria 1934
447 Ga0207691_10253425 3300025940 Bacteria 1519
448 Ga0207691_10258999 3300025940 Unclassified 1500
449 Ga0207691_10383924 3300025940 Bacteria 1199
450 Ga0207691_10507419 3300025940 Unclassified 1024
451 Ga0207711_10713683 3300025941 Bacteria 935
452 Ga0207689_10001135 3300025942 Bacteria 25679
453 Ga0207689_10185907 3300025942 Unclassified 1714
454 Ga0207689_10248474 3300025942 Unclassified 1471
455 Ga0207661_10243578 3300025944 Bacteria 1596
456 Ga0207679_10100782 3300025945 Bacteria 2258
457 Ga0207679_10125380 3300025945 Bacteria 2051
458 Ga0207679_10172297 3300025945 Bacteria 1783
459 Ga0207679_10179147 3300025945 Unclassified 1752
460 Ga0207679_10187658 3300025945 Bacteria 1716
461 Ga0207679_10367095 3300025945 Bacteria 1259
462 Ga0207651_10012584 3300025960 Bacteria 4797
463 Ga0207651_10052364 3300025960 Bacteria 2783
464 Ga0207651_10078554 3300025960 Bacteria 2367
465 Ga0207651_10093568 3300025960 Bacteria 2207
466 Ga0207651_10113184 3300025960 Bacteria 2041
467 Ga0207651_10244617 3300025960 Bacteria 1464
468 Ga0207651_10468911 3300025960 Bacteria 1083
469 Ga0207651_10606269 3300025960 Unclassified 957
470 Ga0207651_10684833 3300025960 Unclassified 902
471 Ga0207651_10942837 3300025960 Unclassified 770
472 Ga0207712_10113985 3300025961 Bacteria 2033
473 Ga0207668_10041212 3300025972 Bacteria 3120
474 Ga0207668_10094131 3300025972 Bacteria 2209
475 Ga0207668_10516513 3300025972 Unclassified 1030
476 Ga0207640_10168935 3300025981 Unclassified 1627
477 Ga0207658_10043210 3300025986 Bacteria 3275
478 Ga0207658_10234738 3300025986 Bacteria 1550
479 Ga0207658_10713639 3300025986 Unclassified 907
480 Ga0207677_10062460 3300026023 Bacteria 2584
481 Ga0207703_10072522 3300026035 Bacteria 2847
482 Ga0207703_10187785 3300026035 Bacteria 1828
483 Ga0207703_10495129 3300026035 Unclassified 1147
484 Ga0207639_10206018 3300026041 Bacteria 1690
485 Ga0207639_10486116 3300026041 Bacteria 1126
486 Ga0207678_10210082 3300026067 Bacteria 1665
487 Ga0207678_10250346 3300026067 Bacteria 1517
488 Ga0207708_10022010 3300026075 Bacteria 4812
489 Ga0207708_10044652 3300026075 Bacteria 3377
490 Ga0207708_10155559 3300026075 Unclassified 1803
491 Ga0207708_10383524 3300026075 Bacteria 1159
492 Ga0207708_11106721 3300026075 Bacteria 691
493 Ga0207641_10033573 3300026088 Bacteria 4263
494 Ga0207641_10181582 3300026088 Bacteria 1928
495 Ga0207648_10000093 3300026089 Bacteria 84666
496 Ga0207648_10003592 3300026089 Bacteria 16219
497 Ga0207648_10216313 3300026089 Unclassified 1702
498 Ga0207648_10345705 3300026089 Bacteria 1340
499 Ga0207648_10568600 3300026089 Unclassified 1043
500 Ga0207676_10034967 3300026095 Bacteria 3808
501 Ga0207676_10100531 3300026095 Bacteria 2396
502 Ga0207676_10303136 3300026095 Bacteria 1459
503 Ga0207676_10745011 3300026095 Bacteria 952
504 Ga0207674_10007168 3300026116 Bacteria 13022
505 Ga0207674_10108291 3300026116 Bacteria 2755
506 Ga0207675_100033399 3300026118 Bacteria 4794
507 Ga0207675_100075397 3300026118 Bacteria 3157
508 Ga0207675_100191815 3300026118 Bacteria 1960
509 Ga0207675_100633110 3300026118 Bacteria 1075
510 Ga0207675_100912887 3300026118 Bacteria 895
511 Ga0207675_101662482 3300026118 Unclassified 659
512 Ga0207683_10172498 3300026121 Bacteria 1959
513 Ga0207683_10404175 3300026121 Bacteria 1257
514 Ga0207683_10487331 3300026121 Bacteria 1138
515 Ga0209974_10038199 3300027876 Bacteria 1595
516 Ga0207428_10000353 3300027907 Bacteria 59325
517 Ga0207428_10002666 3300027907 Bacteria 17778
518 Ga0207428_10008712 3300027907 Bacteria 9154
519 Ga0207428_10056559 3300027907 Bacteria 3117
520 Ga0207428_10085974 3300027907 Bacteria 2448
521 Ga0207428_10333331 3300027907 Unclassified 1119
522 Ga0268265_10000540 3300028380 Bacteria 38471
523 Ga0268265_10158289 3300028380 Bacteria 1920
524 Ga0268265_10158490 3300028380 Bacteria 1919
525 Ga0268265_10182153 3300028380 Bacteria 1806
526 Ga0268265_10218781 3300028380 Bacteria 1665
527 Ga0268265_11890102 3300028380 Bacteria 604
528 Ga0268264_10005852 3300028381 Bacteria 10415
529 Ga0268264_10049134 3300028381 Bacteria 3509
530 Ga0268264_10155550 3300028381 Bacteria 2054
531 Ga0307408_100009598 3300031548 Bacteria 6383
532 Ga0307408_100265674 3300031548 Unclassified 1422
533 Ga0307405_10032982 3300031731 Bacteria 3067
534 Ga0307405_10102500 3300031731 Bacteria 1922
535 Ga0307405_10169335 3300031731 Unclassified 1556
536 Ga0307413_10010459 3300031824 Bacteria 4502
537 Ga0307413_10546225 3300031824 Unclassified 939
538 Ga0307410_10004079 3300031852 Bacteria 7473
539 Ga0307410_10105845 3300031852 Bacteria 2026
540 Ga0307410_10452909 3300031852 Bacteria 1047
541 Ga0307406_10170963 3300031901 Bacteria 1572
542 Ga0307407_10010453 3300031903 Bacteria 4378
543 Ga0307407_10043160 3300031903 Bacteria 2533
544 Ga0307412_10034555 3300031911 Bacteria 3222
545 Ga0307409_100025157 3300031995 Bacteria 4169
546 Ga0307409_100289298 3300031995 Unclassified 1519
547 Ga0307409_100450553 3300031995 Bacteria 1242
548 Ga0307409_100519901 3300031995 Bacteria 1162
549 Ga0307416_100840240 3300032002 Bacteria 1016
550 Ga0307416_101023469 3300032002 Bacteria 929
551 Ga0307416_101217344 3300032002 Bacteria 859
552 Ga0307414_10099674 3300032004 Bacteria 2183
553 Ga0307414_10115507 3300032004 Bacteria 2053
554 Ga0307414_10330050 3300032004 Bacteria 1302
555 Ga0307414_11012080 3300032004 Bacteria 765
556 Ga0307411_10023817 3300032005 Bacteria 3636
557 Ga0307411_10128286 3300032005 Bacteria 1849
558 Ga0307411_10365819 3300032005 Unclassified 1181
559 Ga0307411_10434781 3300032005 Bacteria 1093
560 Ga0307411_10675155 3300032005 Bacteria 897
561 Ga0307415_100078333 3300032126 Bacteria 2350
562 Ga0373958_0035253 3300034819 Unclassified 1001
563 Ga0373939_0036869 3300035114 Bacteria 1449
564 Ga0373931_0390864 3300035691 Unclassified 879
565 Ga0373931_0481488 3300035691 Unclassified 798
566 Ga0373933_0161534 3300035724 Unclassified 1423
567 Ga0373947_0126668 3300035725 Bacteria 1627
568 Ga0373937_0014514 3300036401 Bacteria 6956
569 Ga0373925_0602476 3300037068 Unclassified 905
570 Ga0373925_0941218 3300037068 Bacteria 712
571 Ga0439453_0001252 3300041408 Bacteria 3209
572 Ga0451802_2050140 3300041460 Bacteria 790
573 Ga0451853_2965389 3300041512 Bacteria 624
574 Ga0439435_0004408 3300042436 Bacteria 3030
575 Ga0439435_0032646 3300042436 Bacteria 1421
576 Ga0439435_0126710 3300042436 Unclassified 804
577 Ga0439444_0074847 3300042437 Bacteria 731
578 Ga0439464_0031879 3300042439 Bacteria 1480
579 Ga0451577_0191282 3300042876 Bacteria 1846
580 Ga0451577_0680593 3300042876 Unclassified 932
581 Ga0453683_0785001 3300044673 Bacteria 627
582 Ga0453684_1586196 3300044712 Bacteria 672
583 Ga0451576_0024380 3300045051 Bacteria 6534
584 Ga0451576_0025910 3300045051 Bacteria 6315
585 Ga0451576_0082118 3300045051 Bacteria 3352
586 Ga0451576_1507905 3300045051 Unclassified 698
587 Ga0451576_2001795 3300045051 Bacteria 597
588 Ga0495580_0112771 3300046472 Unclassified 1888
589 Ga0495580_0134438 3300046472 Bacteria 1715
590 Ga0495582_0134024 3300046473 Unclassified 1401
591 Ga0495639_0169738 3300046475 Unclassified 1059
592 Ga0495584_0150871 3300046491 Bacteria 1181
593 Ga0495594_0007305 3300046499 Bacteria 5683
594 Ga0495643_0003587 3300046522 Bacteria 11278
595 Ga0495642_0041505 3300046528 Bacteria 1871
596 Ga0495598_0061833 3300046537 Bacteria 1157
597 Ga0495621_0017079 3300046539 Bacteria 2339
598 Ga0495621_0053184 3300046539 Bacteria 1453
599 Ga0495621_0058569 3300046539 Bacteria 1394
600 Ga0495621_0061039 3300046539 Bacteria 1369
601 Ga0495621_0112569 3300046539 Bacteria 1045
602 Ga0495633_0478172 3300046558 Bacteria 562
603 Ga0495656_0043036 3300046615 Bacteria 1894
604 Ga0495659_0017899 3300046664 Bacteria 2355
605 Ga0495659_0054538 3300046664 Bacteria 1462
606 Ga0495659_0060001 3300046664 Bacteria 1402
607 Ga0495588_0006047 3300046674 Bacteria 5429
608 Ga0495647_0243628 3300046681 Bacteria 799
609 Ga0495647_0258079 3300046681 Unclassified 777
610 Ga0495647_0264004 3300046681 Unclassified 769
611 Ga0495658_0170759 3300046683 Unclassified 1346
612 Ga0495658_0194225 3300046683 Bacteria 1263
613 Ga0495658_0406081 3300046683 Unclassified 869
614 Ga0495669_0011498 3300046684 Bacteria 3759
615 Ga0495669_0077340 3300046684 Bacteria 1524
616 Ga0495670_0115135 3300046691 Bacteria 1394
617 Ga0495636_0028250 3300047318 Bacteria 2287
618 Ga0495636_0167790 3300047318 Bacteria 991
619 Ga0495676_0182716 3300047321 Unclassified 1469
620 Ga0495684_0291784 3300047471 Bacteria 1174
621 Ga0496100_0946609 3300048903 Bacteria 677
622 Ga0496102_0174756 3300048905 Bacteria 2022
623 Ga0496106_0143900 3300048909 Bacteria 1877
624 Ga0496106_0205850 3300048909 Bacteria 1567
625 Ga0496108_0073411 3300048911 Bacteria 2888
626 Ga0496109_0545862 3300048912 Bacteria 1093
627 Ga0496110_0496583 3300048913 Bacteria 1111
628 Ga0496111_0672710 3300048914 Bacteria 754
629 Ga0496111_1080138 3300048914 Bacteria 573
630 Ga0496113_0022244 3300048916 Unclassified 4482
631 Ga0501298_006371 3300049521 Bacteria 1929
632 Ga0501031_0059223 3300049568 Bacteria 2496
633 Ga0501036_0055209 3300049572 Bacteria 3365
634 Ga0501036_0380683 3300049572 Unclassified 1178
635 Ga0501036_0979615 3300049572 Unclassified 692
636 Ga0501037_0086995 3300049573 Bacteria 2262
637 Ga0501038_0219274 3300049574 Bacteria 1518
638 Ga0501039_0019431 3300049575 Bacteria 5209
639 Ga0501040_0034792 3300049576 Bacteria 3413
640 Ga0501040_0131051 3300049576 Unclassified 1763
641 Ga0501040_0254105 3300049576 Bacteria 1254
642 Ga0501041_0025618 3300049577 Bacteria 3545
643 Ga0501041_0082868 3300049577 Bacteria 1976
644 Ga0501042_0010210 3300049578 Bacteria 6284
645 Ga0501042_0016825 3300049578 Bacteria 5030
646 Ga0501042_0245221 3300049578 Unclassified 1293
647 Ga0501046_0078844 3300049580 Bacteria 2547
648 Ga0501046_0126176 3300049580 Bacteria 1944
649 Ga0501048_0025527 3300049582 Bacteria 4306
650 Ga0501068_0281948 3300049584 Unclassified 1062
651 Ga0501071_0283581 3300049587 Unclassified 1254
652 Ga0501072_0017172 3300049588 Bacteria 5561
653 Ga0501072_0368461 3300049588 Bacteria 1140
654 Ga0501073_0158967 3300049589 Bacteria 1566
655 Ga0501075_0024850 3300049591 Bacteria 4398
656 Ga0501075_0030308 3300049591 Bacteria 4007
657 Ga0501076_0092616 3300049592 Bacteria 2431
658 Ga0501076_0097618 3300049592 Bacteria 2367
659 Ga0501076_0374752 3300049592 Unclassified 1170
660 Ga0501233_062773 3300049668 Bacteria 926
661 Ga0501249_010599 3300049679 Bacteria 1930
662 Ga0501257_122268 3300049686 Bacteria 698
663 Ga0501225_0039531 3300049705 Unclassified 1300
664 Ga0501079_0004797 3300049741 Bacteria 10026
665 Ga0501079_0087534 3300049741 Bacteria 2411
666 Ga0501079_0293054 3300049741 Unclassified 1273
667 Ga0501080_0040502 3300049742 Bacteria 4345
668 Ga0501083_0333560 3300049744 Unclassified 986
669 Ga0501044_1100860 3300049823 Unclassified 664
670 Ga0501045_0023372 3300049824 Bacteria 4430
671 Ga0501045_0067519 3300049824 Bacteria 2626
672 Ga0501045_0600695 3300049824 Unclassified 815
673 nmdc:mga05p37_10132_c1 3300050507 Bacteria 11189
674 nmdc:mga05p37_136578_c1 3300050507 Bacteria 3006
675 nmdc:mga05p37_177428_c1 3300050507 Bacteria 2595
676 nmdc:mga05p37_237238_c1 3300050507 Bacteria 2194
677 nmdc:mga05p37_2882_c1 3300050507 Bacteria 19961
678 nmdc:mga05p37_356_c1 3300050507 Bacteria 23869
679 nmdc:mga05p37_379783_c1 3300050507 Bacteria 1656
680 nmdc:mga05p37_428453_c1 3300050507 Bacteria 1537
681 nmdc:mga05p37_5523_c1 3300050507 Bacteria 14848
682 nmdc:mga05p37_6973_c1 3300050507 Bacteria 13317
683 nmdc:mga05p37_700834_c1 3300050507 Bacteria 1125
684 nmdc:mga05p37_715910_c1 3300050507 Bacteria 1109
685 nmdc:mga09592_124510_c1 3300050508 Bacteria 2215
686 nmdc:mga09592_241850_c1 3300050508 Bacteria 1564
687 nmdc:mga09592_32618_c1 3300050508 Bacteria 4342
688 nmdc:mga09592_42033_c1 3300050508 Bacteria 2029
689 nmdc:mga09592_632573_c1 3300050508 Unclassified 915
690 nmdc:mga0qj67_106263_c1 3300050509 Bacteria 2265
691 nmdc:mga0qj67_13404_c1 3300050509 Bacteria 6184
692 nmdc:mga0qj67_154622_c1 3300050509 Bacteria 1861
693 nmdc:mga0qj67_22892_c1 3300050509 Bacteria 4801
694 nmdc:mga0qj67_455770_c1 3300050509 Bacteria 1030
695 nmdc:mga0qj67_577019_c1 3300050509 Unclassified 901
696 nmdc:mga06r32_28828_c1 3300050510 Bacteria 5197
697 nmdc:mga06r32_62244_c1 3300050510 Bacteria 3595
698 nmdc:mga08y16_10692_c1 3300050511 Bacteria 9631
699 nmdc:mga08y16_1938_c1 3300050511 Bacteria 21118
700 nmdc:mga08y16_206618_c1 3300050511 Unclassified 2034
701 nmdc:mga08y16_289995_c1 3300050511 Bacteria 1687
702 nmdc:mga08y16_55462_c1 3300050511 Bacteria 4141
703 nmdc:mga08y16_78749_c1 3300050511 Bacteria 3436
704 nmdc:mga08y16_79168_c1 3300050511 Bacteria 3425
705 nmdc:mga08y16_81531_c1 3300050511 Bacteria 3373
706 nmdc:mga0n895_110016_c1 3300050512 Bacteria 2771
707 nmdc:mga0n895_123490_c1 3300050512 Bacteria 2611
708 nmdc:mga0n895_13230_c1 3300050512 Bacteria 7436
709 nmdc:mga0n895_180887_c1 3300050512 Unclassified 2140
710 nmdc:mga0n895_194427_c1 3300050512 Bacteria 2060
711 nmdc:mga0n895_199_c1 3300050512 Bacteria 37333
712 nmdc:mga0n895_347334_c1 3300050512 Bacteria 1503
713 nmdc:mga0n895_403925_c1 3300050512 Bacteria 1382
714 nmdc:mga0n895_689776_c1 3300050512 Bacteria 1018
715 nmdc:mga0rr50_216798_c1 3300050513 Bacteria 1579
716 nmdc:mga0rr50_433388_c1 3300050513 Bacteria 1113
717 nmdc:mga0rr50_6684_c1 3300050513 Bacteria 5093
718 nmdc:mga0rr50_87547_c1 3300050513 Bacteria 2418
719 nmdc:mga0a205_24175_c1 3300050515 Bacteria 4246
720 nmdc:mga0a205_2522_c1 3300050515 Bacteria 16133
721 nmdc:mga0a205_314507_c1 3300050515 Bacteria 1438
722 nmdc:mga0a205_6512_c1 3300050515 Bacteria 10559
723 nmdc:mga0a205_7767_c1 3300050515 Bacteria 9738
724 Ga0501084_0408606 3300054114 Bacteria 1147
725 Ga0590071_000363 3300059421 Bacteria 13371
726 Ga0590071_000532 3300059421 Bacteria 11132
727 Ga0590074_053220 3300059423 Bacteria 743
728 Ga0590075_000314 3300059424 Bacteria 13494
729 Ga0590075_000664 3300059424 Bacteria 9153
730 Ga0590075_003235 3300059424 Bacteria 3882
731 Ga0590077_000177 3300059426 Bacteria 17986
732 Ga0590077_000287 3300059426 Bacteria 14286
733 Ga0590077_015556 3300059426 Bacteria 1592
734 Ga0501082_0189099 3300060353 Bacteria 1791
735 Ga0530510_0001943 3300061734 Bacteria 14142
736 Ga0114129_10077682
737 MBSR1b_contig_9913106
738 JGI24743J22301_10085011
739 JGI24034J26672_10058865
740 JGI25406J46586_10016631
741 Ga0065714_10077083
742 Ga0065704_10003679
743 Ga0065704_10167513
744 Ga0065712_10015093
745 Ga0065712_10068368
746 Ga0065712_10160855
747 Ga0065712_10212556
748 Ga0065712_10357639
749 Ga0065715_10120057
750 Ga0065715_10179602
751 Ga0065715_10209219
752 Ga0065715_10385264
753 Ga0065707_10184930
754 Ga0070676_10002766
755 Ga0070676_10051431
756 Ga0070676_10060604
757 Ga0070683_100193571
758 Ga0070690_100009110
759 Ga0070690_100089681
760 Ga0070670_100004027
761 Ga0070670_100039750
762 Ga0070670_100183663
763 Ga0070670_100255837
764 Ga0070670_100267449
765 Ga0070670_100674573
766 Ga0070677_10044626
767 Ga0070677_10066064
768 Ga0070677_10094564
769 Ga0070677_10267409
770 Ga0068869_100006349
771 Ga0068869_100351978
772 Ga0070666_10117021
773 Ga0070666_10185788
774 Ga0070680_100063829
775 Ga0070682_100905537
776 Ga0068868_100234581
777 Ga0068868_100455684
778 Ga0070660_100443102
779 Ga0070660_100574737
780 Ga0070689_100008978
781 Ga0070689_100114581
782 Ga0070689_100115461
783 Ga0070687_100028939
784 Ga0070687_100060665
785 Ga0070687_100132440
786 Ga0070687_100152159
787 Ga0070661_100269250
788 Ga0070661_100326002
789 Ga0070692_10030785
790 Ga0070692_10285393
791 Ga0070668_100050753
792 Ga0070668_100740980
793 Ga0070669_100000856
794 Ga0070669_100092809
795 Ga0070669_100095542
796 Ga0070669_100100409
797 Ga0070669_100372739
798 Ga0070675_100006124
799 Ga0070675_100009223
800 Ga0070675_100010779
801 Ga0070675_100016465
802 Ga0070675_100016542
803 Ga0070675_100045930
804 Ga0070675_100060842
805 Ga0070675_100129535
806 Ga0070675_100655515
807 Ga0070675_100661522
808 Ga0070675_101019262
809 Ga0070671_100070429
810 Ga0070671_100102911
811 Ga0070671_100277115
812 Ga0070671_100309181
813 Ga0070671_100374089
814 Ga0070674_100020412
815 Ga0070674_100185643
816 Ga0070674_100208357
817 Ga0070674_100299771
818 Ga0070674_100673241
819 Ga0070674_101404735
820 Ga0070673_100001539
821 Ga0070673_100007032
822 Ga0070673_100047942
823 Ga0070673_100111044
824 Ga0070673_100111244
825 Ga0070673_100118106
826 Ga0070673_100119140
827 Ga0070673_100403239
828 Ga0070673_100462087
829 Ga0070673_100505344
830 Ga0070673_100530025
831 Ga0070688_100029063
832 Ga0070688_100086860
833 Ga0070688_100128053
834 Ga0070688_100146990
835 Ga0070688_100220891
836 Ga0070688_100782495
837 Ga0070667_100189606
838 Ga0070667_100204269
839 Ga0070667_100293646
840 Ga0070667_100358639
841 Ga0070667_100775108
842 Ga0070703_10040960
843 Ga0070713_100038069
844 Ga0070701_10005923
845 Ga0070701_10007456
846 Ga0070705_100000945
847 Ga0070705_100027873
848 Ga0070705_100241307
849 Ga0070705_100270743
850 Ga0070700_100000977
851 Ga0070700_100143410
852 Ga0070700_101082730
853 Ga0070700_101180789
854 Ga0070694_100035140
855 Ga0070694_100175151
856 Ga0070708_100115916
857 Ga0070663_100039698
858 Ga0070663_100401729
859 Ga0070663_100634097
860 Ga0070678_100294825
861 Ga0070662_100196338
862 Ga0070662_100360990
863 Ga0070662_100452346
864 Ga0070681_10043296
865 Ga0070681_10853644
866 Ga0070681_11194955
867 Ga0068867_100000312
868 Ga0068867_100516570
869 Ga0070685_10030207
870 Ga0070685_10089364
871 Ga0070685_10307209
872 Ga0070706_100315504
873 Ga0070706_100512310
874 Ga0070707_100231631
875 Ga0070707_100525830
876 Ga0070707_100587380
877 Ga0070707_100662945
878 Ga0070698_100011081
879 Ga0070698_100172562
880 Ga0070698_100277534
881 Ga0070699_100000339
882 Ga0070699_100008740
883 Ga0070699_100025804
884 Ga0070679_100103251
885 Ga0070679_100631573
886 Ga0070684_100220182
887 Ga0070684_100834934
888 Ga0070684_100981861
889 Ga0070697_100013470
890 Ga0070697_100091454
891 Ga0068853_100543440
892 Ga0068853_101407719
893 Ga0070672_100022480
894 Ga0070672_100023573
895 Ga0070672_100030019
896 Ga0070672_100050762
897 Ga0070672_100063477
898 Ga0070672_100110086
899 Ga0070672_100134291
900 Ga0070672_100193989
901 Ga0070672_100232531
902 Ga0070672_100598663
903 Ga0070672_101192300
904 Ga0070686_100035832
905 Ga0070686_100123930
906 Ga0070686_100161764
907 Ga0070686_100425017
908 Ga0070686_100505915
909 Ga0070695_100000104
910 Ga0070695_100101906
911 Ga0070695_100278104
912 Ga0070695_100320995
913 Ga0070696_100001243
914 Ga0070696_100181782
915 Ga0070696_100341504
916 Ga0070696_100467189
917 Ga0070696_100477520
918 Ga0070693_100223816
919 Ga0070665_100669826
920 Ga0070704_100000217
921 Ga0070704_100020395
922 Ga0070704_100023689
923 Ga0070704_100085017
924 Ga0070704_100098422
925 Ga0070704_100127544
926 Ga0070704_100184223
927 Ga0070704_100270044
928 Ga0070704_100651057
929 Ga0070704_100687396
930 Ga0070704_101089742
931 Ga0070664_100017353
932 Ga0070664_100057405
933 Ga0070664_100062719
934 Ga0070664_100133795
935 Ga0070664_100262247
936 Ga0070664_100281671
937 Ga0068857_100004013
938 Ga0068857_100072112
939 Ga0068857_100100626
940 Ga0068854_100040365
941 Ga0068854_100530341
942 Ga0070702_100024090
943 Ga0070702_100314244
944 Ga0070702_100417424
945 Ga0070702_100563349
946 Ga0068859_100059548
947 Ga0068859_100069456
948 Ga0068859_100179925
949 Ga0068859_100319797
950 Ga0068859_100355519
951 Ga0068859_100563066
952 Ga0068859_100861154
953 Ga0068864_100018478
954 Ga0068864_100076415
955 Ga0068864_100125455
956 Ga0068864_100647439
957 Ga0068864_100675968
958 Ga0068866_10025977
959 Ga0068861_100001127
960 Ga0068861_100055766
961 Ga0068861_100154308
962 Ga0068861_100338209
963 Ga0068861_100371761
964 Ga0068861_101024271
965 Ga0068851_10064133
966 Ga0068851_10425909
967 Ga0068851_10656882
968 Ga0068870_10001501
969 Ga0068870_10012640
970 Ga0068870_10040605
971 Ga0068870_10176770
972 Ga0068870_10281380
973 Ga0068870_10368086
974 Ga0068863_100278962
975 Ga0068863_100316939
976 Ga0068863_100322718
977 Ga0068858_100051848
978 Ga0068858_100253267
979 Ga0068860_100008638
980 Ga0068860_100029651
981 Ga0068860_100542702
982 Ga0068862_100001227
983 Ga0068862_100041188
984 Ga0081455_10203175
985 Ga0081539_10000013
986 Ga0070717_10971524
987 Ga0075432_10047471
988 Ga0097621_100048626
989 Ga0097621_100305038
990 Ga0097621_100491385
991 Ga0097621_100649716
992 Ga0097621_100665019
993 Ga0097621_100809924
994 Ga0068871_100318454
995 Ga0068871_100346334
996 Ga0068871_100597763
997 Ga0075428_100000570
998 Ga0075428_100015357
999 Ga0075428_100025275
1000 Ga0075428_100040426
1001 Ga0075428_100046092
1002 Ga0075428_100155848
1003 Ga0075428_100172852
1004 Ga0075428_100265227
1005 Ga0075430_100005382
1006 Ga0075430_100039162
1007 Ga0075430_100055916
1008 Ga0075430_100180438
1009 Ga0075430_100200848
1010 Ga0075430_100366293
1011 Ga0075431_100012264
1012 Ga0075431_100015457
1013 Ga0075431_100069444
1014 Ga0075433_10007769
1015 Ga0075433_10424071
1016 Ga0075434_100001528
1017 Ga0075434_100009607
1018 Ga0075434_100047751
1019 Ga0075434_100116204
1020 Ga0075434_100196608
1021 Ga0075434_100769720
1022 Ga0075429_100022282
1023 Ga0075429_100026648
1024 Ga0075429_100360042
1025 Ga0075429_100469439
1026 Ga0068865_100005000
1027 Ga0068865_100173264
1028 Ga0068865_100415993
1029 Ga0068865_100687364
1030 Ga0075436_100550137
1031 Ga0097620_100059551
1032 Ga0097620_100069459
1033 Ga0097620_100179927
1034 Ga0097620_100319797
1035 Ga0097620_100355521
1036 Ga0097620_100563117
1037 Ga0097620_100860973
1038 Ga0075435_100009946
1039 Ga0075435_100156880
1040 Ga0075435_100245991
1041 Ga0075435_100304781
1042 Ga0111539_10007596
1043 Ga0111539_10010710
1044 Ga0111539_10043789
1045 Ga0111539_10071662
1046 Ga0111539_10084121
1047 Ga0111539_10110719
1048 Ga0111539_10341016
1049 Ga0111539_10368776
1050 Ga0105245_11377573
1051 Ga0105247_10779106
1052 Ga0114129_10004372
1053 Ga0114129_10009398
1054 Ga0114129_10017973
1055 Ga0114129_10023257
1056 Ga0114129_10027518
1057 Ga0114129_10050854
1058 Ga0114129_10237659
1059 Ga0114129_10280468
1060 Ga0114129_10879675
1061 Ga0114129_11028816
1062 Ga0114129_11196685
1063 Ga0105243_10002420
1064 Ga0105242_10044763
1065 Ga0105242_10279824
1066 Ga0105242_11604220
1067 Ga0105248_10013726
1068 Ga0105248_11764429
1069 Ga0105238_10015878
1070 Ga0105238_10397257
1071 Ga0105249_10017012
1072 Ga0105249_10291118
1073 Ga0105246_10177028
1074 Ga0105246_10331348
1075 Ga0105246_10680171
1076 Ga0157374_10235306
1077 Ga0157374_10354285
1078 Ga0157374_10729725
1079 Ga0163162_10396687
1080 Ga0157372_11963038
1081 Ga0157375_10023606
1082 Ga0157375_10046601
1083 Ga0157375_10177671
1084 Ga0157375_10574860
1085 Ga0157375_10678906
1086 Ga0157375_12435532
1087 Ga0163163_10028714
1088 Ga0163163_11544031
1089 Ga0157380_10008263
1090 Ga0157380_10018259
1091 Ga0157380_10224904
1092 Ga0157380_10474533
1093 Ga0157380_10497412
1094 Ga0157380_10561559
1095 Ga0157380_11029729
1096 Ga0157380_11753204
1097 Ga0157377_10024174
1098 Ga0157377_10033788
1099 Ga0157377_10134172
1100 Ga0157377_10391525
1101 Ga0163161_10638144
1102 Ga0207697_10001808
1103 Ga0207656_10048937
1104 Ga0207653_10266521
1105 Ga0207682_10005061
1106 Ga0207682_10058912
1107 Ga0207682_10066182
1108 Ga0207682_10072234
1109 Ga0207642_10053891
1110 Ga0207642_10089635
1111 Ga0207642_10202207
1112 Ga0207642_10411344
1113 Ga0207688_10113003
1114 Ga0207688_10129121
1115 Ga0207688_10313937
1116 Ga0207680_10380769
1117 Ga0207645_10013007
1118 Ga0207645_10037246
1119 Ga0207645_10224030
1120 Ga0207643_10009312
1121 Ga0207643_10009474
1122 Ga0207643_10072892
1123 Ga0207643_10115174
1124 Ga0207684_10423079
1125 Ga0207684_10591485
1126 Ga0207707_10079120
1127 Ga0207660_10091840
1128 Ga0207660_11064610
1129 Ga0207662_10014839
1130 Ga0207662_10024586
1131 Ga0207646_10153588
1132 Ga0207646_10273905
1133 Ga0207646_10643796
1134 Ga0207681_10002459
1135 Ga0207681_10026215
1136 Ga0207681_10043193
1137 Ga0207681_10154969
1138 Ga0207681_10223690
1139 Ga0207681_10321733
1140 Ga0207694_10018849
1141 Ga0207694_10483944
1142 Ga0207650_10032299
1143 Ga0207650_10189280
1144 Ga0207650_10204839
1145 Ga0207659_10000766
1146 Ga0207659_10009883
1147 Ga0207659_10010778
1148 Ga0207659_10017976
1149 Ga0207659_10028780
1150 Ga0207659_10098799
1151 Ga0207659_10175242
1152 Ga0207659_10801668
1153 Ga0207700_10029368
1154 Ga0207644_10292925
1155 Ga0207644_10599175
1156 Ga0207690_10096869
1157 Ga0207706_10188127
1158 Ga0207706_10197538
1159 Ga0207686_10007488
1160 Ga0207709_10003721
1161 Ga0207670_10002540
1162 Ga0207670_10031467
1163 Ga0207670_10116401
1164 Ga0207670_10166911
1165 Ga0207670_10711390
1166 Ga0207669_10113707
1167 Ga0207669_10190910
1168 Ga0207669_10368025
1169 Ga0207704_10002691
1170 Ga0207704_10015938
1171 Ga0207704_10305485
1172 Ga0207704_10381608
1173 Ga0207704_10898456
1174 Ga0207691_10013664
1175 Ga0207691_10027070
1176 Ga0207691_10044274
1177 Ga0207691_10046349
1178 Ga0207691_10048693
1179 Ga0207691_10081783
1180 Ga0207691_10112117
1181 Ga0207691_10166175
1182 Ga0207691_10253425
1183 Ga0207691_10258999
1184 Ga0207691_10383924
1185 Ga0207691_10507419
1186 Ga0207711_10713683
1187 Ga0207689_10001135
1188 Ga0207689_10185907
1189 Ga0207689_10248474
1190 Ga0207661_10243578
1191 Ga0207679_10100782
1192 Ga0207679_10125380
1193 Ga0207679_10172297
1194 Ga0207679_10179147
1195 Ga0207679_10187658
1196 Ga0207679_10367095
1197 Ga0207651_10012584
1198 Ga0207651_10052364
1199 Ga0207651_10078554
1200 Ga0207651_10093568
1201 Ga0207651_10113184
1202 Ga0207651_10244617
1203 Ga0207651_10468911
1204 Ga0207651_10606269
1205 Ga0207651_10684833
1206 Ga0207651_10942837
1207 Ga0207712_10113985
1208 Ga0207668_10041212
1209 Ga0207668_10094131
1210 Ga0207668_10516513
1211 Ga0207640_10168935
1212 Ga0207658_10043210
1213 Ga0207658_10234738
1214 Ga0207658_10713639
1215 Ga0207677_10062460
1216 Ga0207703_10072522
1217 Ga0207703_10187785
1218 Ga0207703_10495129
1219 Ga0207639_10206018
1220 Ga0207639_10486116
1221 Ga0207678_10210082
1222 Ga0207678_10250346
1223 Ga0207708_10022010
1224 Ga0207708_10044652
1225 Ga0207708_10155559
1226 Ga0207708_10383524
1227 Ga0207708_11106721
1228 Ga0207641_10033573
1229 Ga0207641_10181582
1230 Ga0207648_10000093
1231 Ga0207648_10003592
1232 Ga0207648_10216313
1233 Ga0207648_10345705
1234 Ga0207648_10568600
1235 Ga0207676_10034967
1236 Ga0207676_10100531
1237 Ga0207676_10303136
1238 Ga0207676_10745011
1239 Ga0207674_10007168
1240 Ga0207674_10108291
1241 Ga0207675_100033399
1242 Ga0207675_100075397
1243 Ga0207675_100191815
1244 Ga0207675_100633110
1245 Ga0207675_100912887
1246 Ga0207675_101662482
1247 Ga0207683_10172498
1248 Ga0207683_10404175
1249 Ga0207683_10487331
1250 Ga0209974_10038199
1251 Ga0207428_10000353
1252 Ga0207428_10002666
1253 Ga0207428_10008712
1254 Ga0207428_10056559
1255 Ga0207428_10085974
1256 Ga0207428_10333331
1257 Ga0268265_10000540
1258 Ga0268265_10158289
1259 Ga0268265_10158490
1260 Ga0268265_10182153
1261 Ga0268265_10218781
1262 Ga0268265_11890102
1263 Ga0268264_10005852
1264 Ga0268264_10049134
1265 Ga0268264_10155550
1266 Ga0307408_100009598
1267 Ga0307408_100265674
1268 Ga0307405_10032982
1269 Ga0307405_10102500
1270 Ga0307405_10169335
1271 Ga0307413_10010459
1272 Ga0307413_10546225
1273 Ga0307410_10004079
1274 Ga0307410_10105845
1275 Ga0307410_10452909
1276 Ga0307406_10170963
1277 Ga0307407_10010453
1278 Ga0307407_10043160
1279 Ga0307412_10034555
1280 Ga0307409_100025157
1281 Ga0307409_100289298
1282 Ga0307409_100450553
1283 Ga0307409_100519901
1284 Ga0307416_100840240
1285 Ga0307416_101023469
1286 Ga0307416_101217344
1287 Ga0307414_10099674
1288 Ga0307414_10115507
1289 Ga0307414_10330050
1290 Ga0307414_11012080
1291 Ga0307411_10023817
1292 Ga0307411_10128286
1293 Ga0307411_10365819
1294 Ga0307411_10434781
1295 Ga0307411_10675155
1296 Ga0307415_100078333
1297 Ga0373958_0035253
1298 Ga0373939_0036869
1299 Ga0373931_0390864
1300 Ga0373931_0481488
1301 Ga0373933_0161534
1302 Ga0373947_0126668
1303 Ga0373937_0014514
1304 Ga0373925_0602476
1305 Ga0373925_0941218
1306 Ga0439453_0001252
1307 Ga0451802_2050140
1308 Ga0451853_2965389
1309 Ga0439435_0004408
1310 Ga0439435_0032646
1311 Ga0439435_0126710
1312 Ga0439444_0074847
1313 Ga0439464_0031879
1314 Ga0451577_0191282
1315 Ga0451577_0680593
1316 Ga0453683_0785001
1317 Ga0453684_1586196
1318 Ga0451576_0024380
1319 Ga0451576_0025910
1320 Ga0451576_0082118
1321 Ga0451576_1507905
1322 Ga0451576_2001795
1323 Ga0495580_0112771
1324 Ga0495580_0134438
1325 Ga0495582_0134024
1326 Ga0495639_0169738
1327 Ga0495584_0150871
1328 Ga0495594_0007305
1329 Ga0495643_0003587
1330 Ga0495642_0041505
1331 Ga0495598_0061833
1332 Ga0495621_0017079
1333 Ga0495621_0053184
1334 Ga0495621_0058569
1335 Ga0495621_0061039
1336 Ga0495621_0112569
1337 Ga0495633_0478172
1338 Ga0495656_0043036
1339 Ga0495659_0017899
1340 Ga0495659_0054538
1341 Ga0495659_0060001
1342 Ga0495588_0006047
1343 Ga0495647_0243628
1344 Ga0495647_0258079
1345 Ga0495647_0264004
1346 Ga0495658_0170759
1347 Ga0495658_0194225
1348 Ga0495658_0406081
1349 Ga0495669_0011498
1350 Ga0495669_0077340
1351 Ga0495670_0115135
1352 Ga0495636_0028250
1353 Ga0495636_0167790
1354 Ga0495676_0182716
1355 Ga0495684_0291784
1356 Ga0496100_0946609
1357 Ga0496102_0174756
1358 Ga0496106_0143900
1359 Ga0496106_0205850
1360 Ga0496108_0073411
1361 Ga0496109_0545862
1362 Ga0496110_0496583
1363 Ga0496111_0672710
1364 Ga0496111_1080138
1365 Ga0496113_0022244
1366 Ga0501298_006371
1367 Ga0501031_0059223
1368 Ga0501036_0055209
1369 Ga0501036_0380683
1370 Ga0501036_0979615
1371 Ga0501037_0086995
1372 Ga0501038_0219274
1373 Ga0501039_0019431
1374 Ga0501040_0034792
1375 Ga0501040_0131051
1376 Ga0501040_0254105
1377 Ga0501041_0025618
1378 Ga0501041_0082868
1379 Ga0501042_0010210
1380 Ga0501042_0016825
1381 Ga0501042_0245221
1382 Ga0501046_0078844
1383 Ga0501046_0126176
1384 Ga0501048_0025527
1385 Ga0501068_0281948
1386 Ga0501071_0283581
1387 Ga0501072_0017172
1388 Ga0501072_0368461
1389 Ga0501073_0158967
1390 Ga0501075_0024850
1391 Ga0501075_0030308
1392 Ga0501076_0092616
1393 Ga0501076_0097618
1394 Ga0501076_0374752
1395 Ga0501233_062773
1396 Ga0501249_010599
1397 Ga0501257_122268
1398 Ga0501225_0039531
1399 Ga0501079_0004797
1400 Ga0501079_0087534
1401 Ga0501079_0293054
1402 Ga0501080_0040502
1403 Ga0501083_0333560
1404 Ga0501044_1100860
1405 Ga0501045_0023372
1406 Ga0501045_0067519
1407 Ga0501045_0600695
1408 nmdc:mga05p37_10132_c1
1409 nmdc:mga05p37_136578_c1
1410 nmdc:mga05p37_177428_c1
1411 nmdc:mga05p37_237238_c1
1412 nmdc:mga05p37_2882_c1
1413 nmdc:mga05p37_356_c1
1414 nmdc:mga05p37_379783_c1
1415 nmdc:mga05p37_428453_c1
1416 nmdc:mga05p37_5523_c1
1417 nmdc:mga05p37_6973_c1
1418 nmdc:mga05p37_700834_c1
1419 nmdc:mga05p37_715910_c1
1420 nmdc:mga09592_124510_c1
1421 nmdc:mga09592_241850_c1
1422 nmdc:mga09592_32618_c1
1423 nmdc:mga09592_42033_c1
1424 nmdc:mga09592_632573_c1
1425 nmdc:mga0qj67_106263_c1
1426 nmdc:mga0qj67_13404_c1
1427 nmdc:mga0qj67_154622_c1
1428 nmdc:mga0qj67_22892_c1
1429 nmdc:mga0qj67_455770_c1
1430 nmdc:mga0qj67_577019_c1
1431 nmdc:mga06r32_28828_c1
1432 nmdc:mga06r32_62244_c1
1433 nmdc:mga08y16_10692_c1
1434 nmdc:mga08y16_1938_c1
1435 nmdc:mga08y16_206618_c1
1436 nmdc:mga08y16_289995_c1
1437 nmdc:mga08y16_55462_c1
1438 nmdc:mga08y16_78749_c1
1439 nmdc:mga08y16_79168_c1
1440 nmdc:mga08y16_81531_c1
1441 nmdc:mga0n895_110016_c1
1442 nmdc:mga0n895_123490_c1
1443 nmdc:mga0n895_13230_c1
1444 nmdc:mga0n895_180887_c1
1445 nmdc:mga0n895_194427_c1
1446 nmdc:mga0n895_199_c1
1447 nmdc:mga0n895_347334_c1
1448 nmdc:mga0n895_403925_c1
1449 nmdc:mga0n895_689776_c1
1450 nmdc:mga0rr50_216798_c1
1451 nmdc:mga0rr50_433388_c1
1452 nmdc:mga0rr50_6684_c1
1453 nmdc:mga0rr50_87547_c1
1454 nmdc:mga0a205_24175_c1
1455 nmdc:mga0a205_2522_c1
1456 nmdc:mga0a205_314507_c1
1457 nmdc:mga0a205_6512_c1
1458 nmdc:mga0a205_7767_c1
1459 Ga0501084_0408606
1460 Ga0590071_000363
1461 Ga0590071_000532
1462 Ga0590074_053220
1463 Ga0590075_000314
1464 Ga0590075_000664
1465 Ga0590075_003235
1466 Ga0590077_000177
1467 Ga0590077_000287
1468 Ga0590077_015556
1469 Ga0501082_0189099
1470 Ga0530510_0001943

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02622

DUF179

Uncharacterized ACR, COG1678

31

187

0.93

Map