F478185

General Info

Members Datasets Scaffolds Average Seq Length
735 367 1470 319

Family's Representative Sequence

Representative Sequence 3300005548|Ga0070665_100048788|Ga0070665_1000487885
Length 357
Sequence MGARPGGRKPSLSPLVWRRRLADDGPNNKHIGENAMVAALRIVLAATWLLSGVGAISAQDYPGKPVRVVVGFPAGGPTDAIARIVAQKLSDRLGQQFFVENIGGAGGNTAAGQVARMTPDGYAIMVVSTGFVVNPSLYAKVPYDPVKDFAPVTLVAVSPNVVVVNPQVPAKTLPELVQLIRDNPGKYGFAGPGIGSTPHLGGELFRLAFKLDLVHVPFTGAGPAIQATVGGHTPIAFTALPPALSAVQSGQLRALGVASSERAAGMPDVPTFAEQGVKDQDADTLTGIVAPAGTPKAIVDLLHREIAAIVTQPDVKERLTTLGFNAVANTPEQFGARIRLEMDKWAKVVRDAKLRIE

Samples

Sample ID Description Type Environment
1 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
29 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
30 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
31 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
32 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
49 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
61 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
62 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
63 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
64 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
65 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
66 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
67 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
68 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
69 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
77 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
78 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
85 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
86 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
87 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
90 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
91 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
111 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
112 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
123 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
124 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
187 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
188 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
189 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
190 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
191 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
194 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
195 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
196 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
197 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
201 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
202 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
205 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
206 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
207 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
208 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
209 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
210 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
211 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
212 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
213 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
214 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
215 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
216 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
217 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
222 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
223 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
225 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
226 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
229 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
230 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
231 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
232 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
233 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
234 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
235 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
236 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
237 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
238 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
239 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
240 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
241 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
242 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
243 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
244 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
245 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
246 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
247 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
248 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
249 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
250 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
251 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
252 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
255 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
256 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
257 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
258 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
259 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
260 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
261 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
262 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
263 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
264 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
265 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
266 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
267 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
268 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
269 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
270 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
271 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
272 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
273 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
274 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
275 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
276 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
277 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
278 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
279 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
280 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
281 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
282 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
283 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
284 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
285 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
286 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
287 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
288 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
289 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
290 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
291 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
292 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
293 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
294 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
295 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
296 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
297 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
298 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
299 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
300 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
302 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
304 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
305 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
306 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
307 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
308 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
310 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
311 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
312 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
313 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
314 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
315 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
316 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
317 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
318 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
319 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
320 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
321 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
323 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
324 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
325 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
326 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
327 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
328 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
329 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
330 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
331 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
332 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
333 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
334 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
335 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
336 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
337 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
338 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
339 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
340 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
341 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
342 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
343 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
344 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
345 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
346 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
347 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
348 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
349 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
350 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
352 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
353 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
354 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
355 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
356 2791355199
357 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
358 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
359 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
360 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
361 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
362 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
363 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
364 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
365 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
366 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
367 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 0
Isolates 1.63

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.31
Nodule 1.09
Rhizoplane 6.26
Rhizosphere 83.4
Stem 0
Stem Tuber 0
Unclassified 1.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070665_100048788 3300005548 Bacteria 4250
2 JGI25406J46586_10000956 3300003203 Bacteria 13581
3 JGI25406J46586_10011227 3300003203 Bacteria 3937
4 JGI25153J46596_10005018 3300003215 Bacteria 7011
5 rootL2_10146270 3300003322 Bacteria 2170
6 JGI25404J52841_10002071 3300003659 Bacteria 3718
7 Ga0065707_10120405 3300005295 Bacteria 2135
8 Ga0070676_10120062 3300005328 Bacteria 1649
9 Ga0070683_100041262 3300005329 Bacteria 4244
10 Ga0070683_100042789 3300005329 Bacteria 4172
11 Ga0070683_100290422 3300005329 Bacteria 1555
12 Ga0070690_100000394 3300005330 Bacteria 22197
13 Ga0070670_100003685 3300005331 Bacteria 12763
14 Ga0070670_100051032 3300005331 Bacteria 3553
15 Ga0068869_100000076 3300005334 Bacteria 44659
16 Ga0068869_100049368 3300005334 Bacteria 3045
17 Ga0068869_100060004 3300005334 Bacteria 2786
18 Ga0068869_100069430 3300005334 Bacteria 2605
19 Ga0070666_10083807 3300005335 Bacteria 2181
20 Ga0070680_100001687 3300005336 Bacteria 16185
21 Ga0070680_100178141 3300005336 Bacteria 1790
22 Ga0070682_100001495 3300005337 Bacteria 13106
23 Ga0068868_100000097 3300005338 Bacteria 54209
24 Ga0068868_100000170 3300005338 Bacteria 42921
25 Ga0068868_100065241 3300005338 Bacteria 2892
26 Ga0070689_100002286 3300005340 Bacteria 12468
27 Ga0070689_100195250 3300005340 Bacteria 1650
28 Ga0070691_10000921 3300005341 Bacteria 11944
29 Ga0070691_10111453 3300005341 Bacteria 1369
30 Ga0070687_100000081 3300005343 Bacteria 31225
31 Ga0070661_100176567 3300005344 Bacteria 1624
32 Ga0070692_10011524 3300005345 Bacteria 4063
33 Ga0070668_100342434 3300005347 Bacteria 1263
34 Ga0070675_100000495 3300005354 Bacteria 26992
35 Ga0070675_100377006 3300005354 Bacteria 1262
36 Ga0070671_100001098 3300005355 Bacteria 20069
37 Ga0070671_100062110 3300005355 Bacteria 3111
38 Ga0070671_100205394 3300005355 Bacteria 1671
39 Ga0070671_100237181 3300005355 Bacteria 1548
40 Ga0070674_100062739 3300005356 Bacteria 2598
41 Ga0070673_100000326 3300005364 Bacteria 25058
42 Ga0070673_100073071 3300005364 Bacteria 2760
43 Ga0070673_100094545 3300005364 Bacteria 2450
44 Ga0070673_100339035 3300005364 Bacteria 1332
45 Ga0070659_100108037 3300005366 Bacteria 2244
46 Ga0070667_100254179 3300005367 Bacteria 1572
47 Ga0070703_10006573 3300005406 Bacteria 3260
48 Ga0070709_10217996 3300005434 Bacteria 1359
49 Ga0070714_100016640 3300005435 Bacteria 5943
50 Ga0070714_100062403 3300005435 Bacteria 3203
51 Ga0070714_100110313 3300005435 Bacteria 2435
52 Ga0070714_100380948 3300005435 Bacteria 1330
53 Ga0070713_100027617 3300005436 Bacteria 4470
54 Ga0070713_100074974 3300005436 Bacteria 2868
55 Ga0070710_10030072 3300005437 Bacteria 2920
56 Ga0070701_10000252 3300005438 Bacteria 17313
57 Ga0070705_100002492 3300005440 Bacteria 9252
58 Ga0070700_100003588 3300005441 Bacteria 8018
59 Ga0070694_100001443 3300005444 Bacteria 13931
60 Ga0070694_100014554 3300005444 Bacteria 4925
61 Ga0070694_100098463 3300005444 Bacteria 2065
62 Ga0070708_100030005 3300005445 Bacteria 4696
63 Ga0070663_100003187 3300005455 Bacteria 9416
64 Ga0070663_100034058 3300005455 Bacteria 3524
65 Ga0070663_100047385 3300005455 Bacteria 3044
66 Ga0070678_100018246 3300005456 Bacteria 4546
67 Ga0070678_100066459 3300005456 Bacteria 2680
68 Ga0070678_100120482 3300005456 Bacteria 2068
69 Ga0070681_10000175 3300005458 Bacteria 48999
70 Ga0070681_10007808 3300005458 Bacteria 10464
71 Ga0070681_10120727 3300005458 Bacteria 2556
72 Ga0070681_10179988 3300005458 Bacteria 2035
73 Ga0068867_100000194 3300005459 Bacteria 40044
74 Ga0068867_100004288 3300005459 Bacteria 10037
75 Ga0068867_100064247 3300005459 Bacteria 2729
76 Ga0070685_10164689 3300005466 Bacteria 1416
77 Ga0070706_100032797 3300005467 Bacteria 4791
78 Ga0070707_100257076 3300005468 Bacteria 1699
79 Ga0070699_100093221 3300005518 Bacteria 2635
80 Ga0070699_100426746 3300005518 Bacteria 1200
81 Ga0070679_100024315 3300005530 Bacteria 5936
82 Ga0070679_100032212 3300005530 Bacteria 5183
83 Ga0070679_100063244 3300005530 Bacteria 3689
84 Ga0070679_100108728 3300005530 Bacteria 2759
85 Ga0070679_100171372 3300005530 Bacteria 2143
86 Ga0070684_100180756 3300005535 Bacteria 1918
87 Ga0070697_100004102 3300005536 Bacteria 11163
88 Ga0070697_100007933 3300005536 Bacteria 8274
89 Ga0068853_100021864 3300005539 Bacteria 5335
90 Ga0068853_100046209 3300005539 Bacteria 3733
91 Ga0068853_100377271 3300005539 Bacteria 1324
92 Ga0070672_100000192 3300005543 Bacteria 33740
93 Ga0070672_100090624 3300005543 Bacteria 2466
94 Ga0070686_100000732 3300005544 Bacteria 19074
95 Ga0070686_100018604 3300005544 Bacteria 4082
96 Ga0070695_100000206 3300005545 Bacteria 28716
97 Ga0070696_100001279 3300005546 Bacteria 16383
98 Ga0070693_100000241 3300005547 Bacteria 25659
99 Ga0070665_100040270 3300005548 Bacteria 4697
100 Ga0070665_100058336 3300005548 Bacteria 3870
101 Ga0070665_100112777 3300005548 Bacteria 2722
102 Ga0070665_100214647 3300005548 Bacteria 1925
103 Ga0070704_100000064 3300005549 Bacteria 34900
104 Ga0068855_100002228 3300005563 Bacteria 23968
105 Ga0068855_100005179 3300005563 Bacteria 15902
106 Ga0068855_100147727 3300005563 Bacteria 2674
107 Ga0068855_100196484 3300005563 Bacteria 2273
108 Ga0068855_100217652 3300005563 Bacteria 2143
109 Ga0070664_100021457 3300005564 Bacteria 5323
110 Ga0070664_100085052 3300005564 Bacteria 2731
111 Ga0070664_100112837 3300005564 Bacteria 2374
112 Ga0068857_100014739 3300005577 Bacteria 6820
113 Ga0068857_100157233 3300005577 Bacteria 2061
114 Ga0068857_100366142 3300005577 Bacteria 1337
115 Ga0068854_100002327 3300005578 Bacteria 11713
116 Ga0068856_100000363 3300005614 Bacteria 49777
117 Ga0068856_100042901 3300005614 Bacteria 4451
118 Ga0070702_100000002 3300005615 Bacteria 83999
119 Ga0070702_100094121 3300005615 Bacteria 1823
120 Ga0068852_100020070 3300005616 Bacteria 5307
121 Ga0068859_100000195 3300005617 Bacteria 59015
122 Ga0068859_100022345 3300005617 Bacteria 6342
123 Ga0068859_100022663 3300005617 Bacteria 6296
124 Ga0068864_100034481 3300005618 Bacteria 4305
125 Ga0068864_100098394 3300005618 Bacteria 2591
126 Ga0068866_10000037 3300005718 Bacteria 50738
127 Ga0068861_100000141 3300005719 Bacteria 36774
128 Ga0068861_100019237 3300005719 Bacteria 4879
129 Ga0068861_100061541 3300005719 Bacteria 2881
130 Ga0068861_100531245 3300005719 Bacteria 1068
131 Ga0068851_10010830 3300005834 Bacteria 4262
132 Ga0068851_10021072 3300005834 Bacteria 3162
133 Ga0068851_10050252 3300005834 Bacteria 2117
134 Ga0068863_100138030 3300005841 Bacteria 2329
135 Ga0068858_100004800 3300005842 Bacteria 13245
136 Ga0068858_100091114 3300005842 Bacteria 2838
137 Ga0068858_100223048 3300005842 Bacteria 1786
138 Ga0068858_100250258 3300005842 Bacteria 1683
139 Ga0068860_100001799 3300005843 Bacteria 22808
140 Ga0068860_100045230 3300005843 Bacteria 4197
141 Ga0068860_100073236 3300005843 Bacteria 3256
142 Ga0068860_100113532 3300005843 Bacteria 2590
143 Ga0068862_100002874 3300005844 Bacteria 15086
144 Ga0068862_100064625 3300005844 Bacteria 3150
145 Ga0068862_100101223 3300005844 Bacteria 2520
146 Ga0068862_100159162 3300005844 Bacteria 2015
147 Ga0068862_100282944 3300005844 Bacteria 1520
148 Ga0081455_10001783 3300005937 Bacteria 26011
149 Ga0081455_10009563 3300005937 Bacteria 9956
150 Ga0081455_10024587 3300005937 Bacteria 5575
151 Ga0081455_10032540 3300005937 Bacteria 4698
152 Ga0081455_10034176 3300005937 Bacteria 4558
153 Ga0081538_10008218 3300005981 Bacteria 8900
154 Ga0081538_10032835 3300005981 Bacteria 3467
155 Ga0081538_10092737 3300005981 Bacteria 1554
156 Ga0081540_1000629 3300005983 Bacteria 33549
157 Ga0081540_1001058 3300005983 Bacteria 24522
158 Ga0081540_1004779 3300005983 Bacteria 10215
159 Ga0081540_1030206 3300005983 Bacteria 3005
160 Ga0081539_10001182 3300005985 Bacteria 47183
161 Ga0081539_10008460 3300005985 Bacteria 8954
162 Ga0075365_10133269 3300006038 Bacteria 1720
163 Ga0075365_10181539 3300006038 Bacteria 1471
164 Ga0075368_10010325 3300006042 Bacteria 3374
165 Ga0075364_10042867 3300006051 Bacteria 2940
166 Ga0075364_10063536 3300006051 Bacteria 2423
167 Ga0070712_100059256 3300006175 Bacteria 2696
168 Ga0070712_100104202 3300006175 Bacteria 2104
169 Ga0075367_10153496 3300006178 Bacteria 1430
170 Ga0075367_10236730 3300006178 Bacteria 1143
171 Ga0097621_100000045 3300006237 Bacteria 65278
172 Ga0097621_100000670 3300006237 Bacteria 23992
173 Ga0097621_100007399 3300006237 Bacteria 7854
174 Ga0097621_100325106 3300006237 Bacteria 1363
175 Ga0097621_100364911 3300006237 Bacteria 1287
176 Ga0075370_10002843 3300006353 Bacteria 8125
177 Ga0075370_10009357 3300006353 Bacteria 5084
178 Ga0068871_100000263 3300006358 Bacteria 36133
179 Ga0068871_100000480 3300006358 Bacteria 27307
180 Ga0068871_100121319 3300006358 Bacteria 2208
181 Ga0068871_100281179 3300006358 Bacteria 1456
182 Ga0075428_100000047 3300006844 Bacteria 96882
183 Ga0075428_100005533 3300006844 Bacteria 14053
184 Ga0075428_100056353 3300006844 Bacteria 4305
185 Ga0075428_100079687 3300006844 Bacteria 3574
186 Ga0075430_100000263 3300006846 Bacteria 36938
187 Ga0075430_100044069 3300006846 Bacteria 3773
188 Ga0075431_100046922 3300006847 Bacteria 4454
189 Ga0075431_100319044 3300006847 Bacteria 1567
190 Ga0075431_100565524 3300006847 Bacteria 1123
191 Ga0075433_10209423 3300006852 Bacteria 1733
192 Ga0075434_100108173 3300006871 Bacteria 2791
193 Ga0075434_100211670 3300006871 Bacteria 1958
194 Ga0075434_100225888 3300006871 Bacteria 1892
195 Ga0075434_100367718 3300006871 Bacteria 1459
196 Ga0075429_100000047 3300006880 Bacteria 56773
197 Ga0075429_100044344 3300006880 Bacteria 3869
198 Ga0075429_100125896 3300006880 Bacteria 2241
199 Ga0075429_100252460 3300006880 Bacteria 1544
200 Ga0068865_100000176 3300006881 Bacteria 35497
201 Ga0068865_100014213 3300006881 Bacteria 5053
202 Ga0068865_100023335 3300006881 Bacteria 4050
203 Ga0068865_100153217 3300006881 Bacteria 1751
204 Ga0075436_100001103 3300006914 Bacteria 18234
205 Ga0075436_100051290 3300006914 Bacteria 2847
206 Ga0075436_100084112 3300006914 Bacteria 2208
207 Ga0097620_100000195 3300006931 Bacteria 59015
208 Ga0097620_100022345 3300006931 Bacteria 6342
209 Ga0097620_100022663 3300006931 Bacteria 6296
210 Ga0075435_100083609 3300007076 Bacteria 2625
211 Ga0099794_10023059 3300007265 Bacteria 2843
212 Ga0099795_10000930 3300007788 Bacteria 5937
213 Ga0099795_10008263 3300007788 Bacteria 2959
214 Ga0099795_10019881 3300007788 Bacteria 2179
215 Ga0105240_10014043 3300009093 Bacteria 10954
216 Ga0105240_10017864 3300009093 Bacteria 9542
217 Ga0105240_10146102 3300009093 Bacteria 2821
218 Ga0105240_10224801 3300009093 Bacteria 2185
219 Ga0111539_10053203 3300009094 Unclassified 4819
220 Ga0111539_10071015 3300009094 Bacteria 4109
221 Ga0111539_10074371 3300009094 Bacteria 4003
222 Ga0111539_10098340 3300009094 Bacteria 3437
223 Ga0111539_10107018 3300009094 Bacteria 3281
224 Ga0111539_10131820 3300009094 Bacteria 2927
225 Ga0111539_10139847 3300009094 Bacteria 2835
226 Ga0111539_10170459 3300009094 Bacteria 2543
227 Ga0111539_10267195 3300009094 Bacteria 1991
228 Ga0111539_10273832 3300009094 Bacteria 1965
229 Ga0111539_10475501 3300009094 Bacteria 1455
230 Ga0105245_10000306 3300009098 Bacteria 47026
231 Ga0105245_10063074 3300009098 Bacteria 3346
232 Ga0105245_10066312 3300009098 Bacteria 3267
233 Ga0105245_10099027 3300009098 Bacteria 2695
234 Ga0105247_10032953 3300009101 Bacteria 3148
235 Ga0114129_10000040 3300009147 Bacteria 107971
236 Ga0114129_10015184 3300009147 Bacteria 10961
237 Ga0114129_10222591 3300009147 Bacteria 2545
238 Ga0114129_10227346 3300009147 Bacteria 2514
239 Ga0114129_10274826 3300009147 Bacteria 2253
240 Ga0105243_10000035 3300009148 Bacteria 177598
241 Ga0105241_10009257 3300009174 Bacteria 7244
242 Ga0105241_10210722 3300009174 Bacteria 1628
243 Ga0105242_10000097 3300009176 Bacteria 61646
244 Ga0105242_10266853 3300009176 Bacteria 1549
245 Ga0105248_10008795 3300009177 Bacteria 11089
246 Ga0105248_10043456 3300009177 Bacteria 5038
247 Ga0105248_10399059 3300009177 Bacteria 1548
248 Ga0105237_10008632 3300009545 Bacteria 11016
249 Ga0105237_10149379 3300009545 Bacteria 2332
250 Ga0105238_10013209 3300009551 Bacteria 8333
251 Ga0105249_10000701 3300009553 Bacteria 30399
252 Ga0105249_10117184 3300009553 Bacteria 2526
253 Ga0105249_10239426 3300009553 Bacteria 1793
254 Ga0105249_10266407 3300009553 Bacteria 1705
255 Ga0105249_10382379 3300009553 Bacteria 1434
256 Ga0105239_10166549 3300010375 Bacteria 2465
257 Ga0105239_10445630 3300010375 Bacteria 1468
258 Ga0105246_10003975 3300011119 Bacteria 8963
259 Ga0157371_10166916 3300013102 Bacteria 1572
260 Ga0157370_10009437 3300013104 Bacteria 10426
261 Ga0157369_10016214 3300013105 Bacteria 8386
262 Ga0157369_10145697 3300013105 Bacteria 2504
263 Ga0157369_10361324 3300013105 Bacteria 1507
264 Ga0157374_10008938 3300013296 Bacteria 8584
265 Ga0157374_10038248 3300013296 Bacteria 4409
266 Ga0157374_10092871 3300013296 Bacteria 2880
267 Ga0157374_10107236 3300013296 Bacteria 2684
268 Ga0157378_10000457 3300013297 Bacteria 39013
269 Ga0157378_10001711 3300013297 Bacteria 19741
270 Ga0157378_10046613 3300013297 Bacteria 3852
271 Ga0157378_10092162 3300013297 Bacteria 2756
272 Ga0157378_10104122 3300013297 Bacteria 2594
273 Ga0163162_10005305 3300013306 Bacteria 12439
274 Ga0163162_10282635 3300013306 Bacteria 1791
275 Ga0163162_10317206 3300013306 Bacteria 1691
276 Ga0163162_10402697 3300013306 Bacteria 1501
277 Ga0157372_10126744 3300013307 Bacteria 2936
278 Ga0157375_10002389 3300013308 Bacteria 16243
279 Ga0157375_10068603 3300013308 Bacteria 3549
280 Ga0157375_10170666 3300013308 Bacteria 2323
281 Ga0157375_10176935 3300013308 Bacteria 2284
282 Ga0163163_10013283 3300014325 Bacteria 7533
283 Ga0157380_10022360 3300014326 Bacteria 4758
284 Ga0157377_10009203 3300014745 Bacteria 4837
285 Ga0157377_10193570 3300014745 Bacteria 1286
286 Ga0157376_10003192 3300014969 Bacteria 11271
287 Ga0157376_10003684 3300014969 Bacteria 10579
288 Ga0157376_10024861 3300014969 Bacteria 4710
289 Ga0157376_10302392 3300014969 Bacteria 1515
290 Ga0163161_10082175 3300017792 Bacteria 2373
291 Ga0209758_1013095 3300025297 Bacteria 4559
292 Ga0207697_10064456 3300025315 Bacteria 1528
293 Ga0207656_10033849 3300025321 Bacteria 2131
294 Ga0207692_10068486 3300025898 Bacteria 1861
295 Ga0207642_10012706 3300025899 Bacteria 3049
296 Ga0207642_10038767 3300025899 Bacteria 2065
297 Ga0207688_10026168 3300025901 Bacteria 3206
298 Ga0207688_10086669 3300025901 Bacteria 1794
299 Ga0207680_10129503 3300025903 Bacteria 1661
300 Ga0207699_10103996 3300025906 Bacteria 1807
301 Ga0207705_10108175 3300025909 Bacteria 2052
302 Ga0207684_10349609 3300025910 Bacteria 1272
303 Ga0207654_10022255 3300025911 Bacteria 3380
304 Ga0207707_10007364 3300025912 Bacteria 9583
305 Ga0207707_10007978 3300025912 Bacteria 9197
306 Ga0207707_10008173 3300025912 Bacteria 9078
307 Ga0207707_10259473 3300025912 Bacteria 1508
308 Ga0207695_10118915 3300025913 Bacteria 2613
309 Ga0207695_10426811 3300025913 Unclassified 1210
310 Ga0207671_10160847 3300025914 Bacteria 1739
311 Ga0207693_10001985 3300025915 Bacteria 17940
312 Ga0207663_10171776 3300025916 Bacteria 1540
313 Ga0207660_10000656 3300025917 Bacteria 23355
314 Ga0207660_10039486 3300025917 Bacteria 3300
315 Ga0207660_10210006 3300025917 Bacteria 1524
316 Ga0207662_10000006 3300025918 Bacteria 105457
317 Ga0207662_10171125 3300025918 Bacteria 1393
318 Ga0207657_10005499 3300025919 Bacteria 13230
319 Ga0207649_10011353 3300025920 Bacteria 4910
320 Ga0207649_10042730 3300025920 Bacteria 2766
321 Ga0207649_10044073 3300025920 Bacteria 2730
322 Ga0207649_10149141 3300025920 Bacteria 1609
323 Ga0207652_10025643 3300025921 Bacteria 4903
324 Ga0207652_10070217 3300025921 Bacteria 3042
325 Ga0207652_10124192 3300025921 Bacteria 2298
326 Ga0207646_10125091 3300025922 Bacteria 2311
327 Ga0207694_10135083 3300025924 Bacteria 1980
328 Ga0207694_10206050 3300025924 Bacteria 1601
329 Ga0207650_10001574 3300025925 Bacteria 16302
330 Ga0207659_10052289 3300025926 Bacteria 2909
331 Ga0207687_10001417 3300025927 Bacteria 16392
332 Ga0207687_10312769 3300025927 Bacteria 1269
333 Ga0207687_10321427 3300025927 Bacteria 1253
334 Ga0207700_10069484 3300025928 Bacteria 2703
335 Ga0207664_10054031 3300025929 Bacteria 3182
336 Ga0207664_10175231 3300025929 Bacteria 1838
337 Ga0207664_10390612 3300025929 Bacteria 1236
338 Ga0207644_10000552 3300025931 Bacteria 24298
339 Ga0207644_10065530 3300025931 Bacteria 2642
340 Ga0207644_10087463 3300025931 Bacteria 2316
341 Ga0207644_10104549 3300025931 Bacteria 2132
342 Ga0207644_10181401 3300025931 Bacteria 1650
343 Ga0207644_10342507 3300025931 Bacteria 1213
344 Ga0207706_10300189 3300025933 Bacteria 1399
345 Ga0207686_10273500 3300025934 Bacteria 1244
346 Ga0207709_10018448 3300025935 Bacteria 3909
347 Ga0207670_10003078 3300025936 Bacteria 8810
348 Ga0207669_10032805 3300025937 Bacteria 2922
349 Ga0207669_10060290 3300025937 Bacteria 2325
350 Ga0207669_10067465 3300025937 Bacteria 2230
351 Ga0207704_10002836 3300025938 Bacteria 7825
352 Ga0207704_10041937 3300025938 Bacteria 2689
353 Ga0207704_10176669 3300025938 Bacteria 1538
354 Ga0207704_10177464 3300025938 Bacteria 1535
355 Ga0207704_10232599 3300025938 Bacteria 1372
356 Ga0207691_10000110 3300025940 Bacteria 73418
357 Ga0207689_10000082 3300025942 Bacteria 76708
358 Ga0207689_10004587 3300025942 Bacteria 12506
359 Ga0207689_10007828 3300025942 Bacteria 9342
360 Ga0207689_10061459 3300025942 Bacteria 3089
361 Ga0207661_10066548 3300025944 Bacteria 2927
362 Ga0207661_10246010 3300025944 Bacteria 1588
363 Ga0207679_10066793 3300025945 Bacteria 2696
364 Ga0207679_10074502 3300025945 Bacteria 2572
365 Ga0207679_10151990 3300025945 Bacteria 1885
366 Ga0207679_10245160 3300025945 Bacteria 1520
367 Ga0207667_10005958 3300025949 Bacteria 14841
368 Ga0207667_10064669 3300025949 Bacteria 3817
369 Ga0207667_10188698 3300025949 Bacteria 2115
370 Ga0207651_10063654 3300025960 Bacteria 2577
371 Ga0207651_10164599 3300025960 Bacteria 1742
372 Ga0207651_10327321 3300025960 Bacteria 1283
373 Ga0207651_10450315 3300025960 Bacteria 1104
374 Ga0207712_10017209 3300025961 Bacteria 4692
375 Ga0207712_10215212 3300025961 Bacteria 1533
376 Ga0207668_10103696 3300025972 Bacteria 2118
377 Ga0207668_10217391 3300025972 Bacteria 1532
378 Ga0207640_10001319 3300025981 Bacteria 13458
379 Ga0207640_10031073 3300025981 Bacteria 3296
380 Ga0207658_10118451 3300025986 Bacteria 2107
381 Ga0207658_10135709 3300025986 Bacteria 1984
382 Ga0207677_10002884 3300026023 Bacteria 9075
383 Ga0207677_10079312 3300026023 Bacteria 2347
384 Ga0207677_10116282 3300026023 Bacteria 2002
385 Ga0207677_10245632 3300026023 Bacteria 1451
386 Ga0207677_10391133 3300026023 Bacteria 1176
387 Ga0207703_10013324 3300026035 Bacteria 6407
388 Ga0207703_10038067 3300026035 Bacteria 3836
389 Ga0207703_10352785 3300026035 Bacteria 1355
390 Ga0207639_10040700 3300026041 Bacteria 3470
391 Ga0207678_10019226 3300026067 Bacteria 5999
392 Ga0207678_10021905 3300026067 Bacteria 5602
393 Ga0207678_10141202 3300026067 Bacteria 2055
394 Ga0207678_10252394 3300026067 Bacteria 1511
395 Ga0207708_10000999 3300026075 Bacteria 21172
396 Ga0207708_10022458 3300026075 Bacteria 4764
397 Ga0207708_10177190 3300026075 Bacteria 1691
398 Ga0207702_10000854 3300026078 Bacteria 31830
399 Ga0207702_10041647 3300026078 Bacteria 3851
400 Ga0207702_10069273 3300026078 Bacteria 3033
401 Ga0207641_10231671 3300026088 Bacteria 1717
402 Ga0207641_10232892 3300026088 Bacteria 1713
403 Ga0207641_10356118 3300026088 Bacteria 1396
404 Ga0207648_10000300 3300026089 Bacteria 53912
405 Ga0207676_10074022 3300026095 Bacteria 2743
406 Ga0207676_10098424 3300026095 Bacteria 2418
407 Ga0207676_10188845 3300026095 Bacteria 1811
408 Ga0207674_10015222 3300026116 Bacteria 8462
409 Ga0207674_10135097 3300026116 Bacteria 2428
410 Ga0207674_10283700 3300026116 Bacteria 1604
411 Ga0207674_10302844 3300026116 Bacteria 1547
412 Ga0207675_100000064 3300026118 Bacteria 79279
413 Ga0207675_100024684 3300026118 Bacteria 5590
414 Ga0207675_100033797 3300026118 Bacteria 4765
415 Ga0207675_100134544 3300026118 Bacteria 2345
416 Ga0207683_10000419 3300026121 Bacteria 39170
417 Ga0207683_10019647 3300026121 Bacteria 5774
418 Ga0207683_10030308 3300026121 Bacteria 4687
419 Ga0207683_10037670 3300026121 Bacteria 4212
420 Ga0207683_10068442 3300026121 Bacteria 3134
421 Ga0207683_10094508 3300026121 Bacteria 2664
422 Ga0209588_1029394 3300027671 Bacteria 1753
423 Ga0209998_10007839 3300027717 Bacteria 2217
424 Ga0207428_10001680 3300027907 Bacteria 22860
425 Ga0207428_10033934 3300027907 Bacteria 4186
426 Ga0207428_10039119 3300027907 Bacteria 3850
427 Ga0207428_10118977 3300027907 Bacteria 2027
428 Ga0207428_10248812 3300027907 Bacteria 1326
429 Ga0207428_10345331 3300027907 Bacteria 1096
430 Ga0268266_10000857 3300028379 Bacteria 39606
431 Ga0268266_10002192 3300028379 Bacteria 21357
432 Ga0268266_10021495 3300028379 Bacteria 5497
433 Ga0268266_10042032 3300028379 Bacteria 3903
434 Ga0268266_10420027 3300028379 Bacteria 1267
435 Ga0268265_10003138 3300028380 Bacteria 12049
436 Ga0268265_10068618 3300028380 Bacteria 2750
437 Ga0268265_10169629 3300028380 Bacteria 1863
438 Ga0268265_10193157 3300028380 Bacteria 1760
439 Ga0268265_10355236 3300028380 Bacteria 1339
440 Ga0268264_10000790 3300028381 Bacteria 34440
441 Ga0307517_10000419 3300028786 Bacteria 72682
442 Ga0307515_10003270 3300028794 Bacteria 34266
443 Ga0307515_10178708 3300028794 Bacteria 2082
444 Ga0265325_10000337 3300031241 Bacteria 33222
445 Ga0265340_10007828 3300031247 Bacteria 5796
446 Ga0265316_10084488 3300031344 Bacteria 2431
447 Ga0307509_10055602 3300031507 Bacteria 4205
448 Ga0307408_100014222 3300031548 Bacteria 5285
449 Ga0265313_10075993 3300031595 Bacteria 1536
450 Ga0307508_10081091 3300031616 Bacteria 2826
451 Ga0307508_10305033 3300031616 Bacteria 1185
452 Ga0265314_10003384 3300031711 Bacteria 15458
453 Ga0265342_10043808 3300031712 Bacteria 2699
454 Ga0307516_10295549 3300031730 Bacteria 1297
455 Ga0307410_10077542 3300031852 Bacteria 2323
456 Ga0307406_10006143 3300031901 Bacteria 6604
457 Ga0307412_10144763 3300031911 Bacteria 1745
458 Ga0307412_10250551 3300031911 Bacteria 1375
459 Ga0307409_100081395 3300031995 Bacteria 2617
460 Ga0307409_100112079 3300031995 Bacteria 2290
461 Ga0307416_100067207 3300032002 Bacteria 2955
462 Ga0307416_100289456 3300032002 Bacteria 1621
463 Ga0307416_100697749 3300032002 Bacteria 1104
464 Ga0307415_100049578 3300032126 Bacteria 2840
465 Ga0307510_10016788 3300033180 Bacteria 8638
466 Ga0373948_0013196 3300034817 Bacteria 1488
467 Ga0373950_0009465 3300034818 Bacteria 1557
468 Ga0373926_0000560 3300035083 Bacteria 10025
469 Ga0373928_0005813 3300035084 Bacteria 2359
470 Ga0373928_0032101 3300035084 Bacteria 1169
471 Ga0373951_0021188 3300035091 Bacteria 1492
472 Ga0373932_0009947 3300035112 Bacteria 2294
473 Ga0373939_0013542 3300035114 Bacteria 2101
474 Ga0373941_0004116 3300035115 Bacteria 3337
475 Ga0373945_0004874 3300035116 Bacteria 4274
476 Ga0373954_0024519 3300035118 Bacteria 2751
477 Ga0373955_0061455 3300035172 Bacteria 2075
478 Ga0373942_0005939 3300035207 Bacteria 2822
479 Ga0373961_0002043 3300035241 Bacteria 5395
480 Ga0373931_0000939 3300035691 Bacteria 12256
481 Ga0373931_0020058 3300035691 Bacteria 3342
482 Ga0373931_0081957 3300035691 Unclassified 1782
483 Ga0373935_0008314 3300035692 Bacteria 6207
484 Ga0373927_0034203 3300035695 Bacteria 3306
485 Ga0373927_0058578 3300035695 Bacteria 2491
486 Ga0373927_0162843 3300035695 Bacteria 1462
487 Ga0373947_0026445 3300035725 Bacteria 3391
488 Ga0373937_0274155 3300036401 Bacteria 1592
489 Ga0373925_0271764 3300037068 Bacteria 1364
490 Ga0395900_0353656 3300037418 Bacteria 1442
491 Ga0395905_0087966 3300037471 Bacteria 2912
492 Ga0395905_0100129 3300037471 Bacteria 2721
493 Ga0436364_0859034 3300037853 Bacteria 7160
494 Ga0451853_2302322 3300041512 Bacteria 1224
495 Ga0439441_015355 3300042001 Bacteria 1353
496 Ga0439434_0053846 3300042435 Bacteria 1251
497 Ga0439460_0005651 3300042461 Bacteria 3079
498 Ga0466971_0131462 3300044719 Bacteria 1162
499 Ga0466957_0145937 3300044842 Bacteria 1527
500 Ga0451576_0078666 3300045051 Bacteria 3431
501 Ga0451576_0139893 3300045051 Bacteria 2524
502 Ga0466958_0154338 3300045836 Bacteria 1449
503 Ga0495617_014463 3300046452 Bacteria 2682
504 Ga0495603_0004044 3300046455 Bacteria 8731
505 Ga0495603_0048878 3300046455 Bacteria 2518
506 Ga0495603_0106326 3300046455 Bacteria 1637
507 Ga0495590_0053282 3300046457 Bacteria 1413
508 Ga0495590_0105206 3300046457 Bacteria 1004
509 Ga0495629_0054633 3300046459 Bacteria 2793
510 Ga0495629_0491278 3300046459 Bacteria 828
511 Ga0495638_0005571 3300046460 Bacteria 9306
512 Ga0495638_0078142 3300046460 Bacteria 2014
513 Ga0495638_0079202 3300046460 Bacteria 1998
514 Ga0495638_0169623 3300046460 Bacteria 1253
515 Ga0495641_0099431 3300046461 Bacteria 1298
516 Ga0495650_0059085 3300046471 Bacteria 1545
517 Ga0495582_0238806 3300046473 Bacteria 1041
518 Ga0495605_0073731 3300046474 Bacteria 1607
519 Ga0495662_0026110 3300046476 Bacteria 2821
520 Ga0495584_0189040 3300046491 Bacteria 1046
521 Ga0495585_0131581 3300046492 Bacteria 1316
522 Ga0495596_0020504 3300046500 Bacteria 2705
523 Ga0495610_0014351 3300046512 Bacteria 4656
524 Ga0495631_0037020 3300046518 Bacteria 2175
525 Ga0495632_0201400 3300046519 Bacteria 906
526 Ga0495644_0042714 3300046523 Bacteria 1707
527 Ga0495665_0058052 3300046531 Bacteria 2043
528 Ga0495665_0267975 3300046531 Bacteria 877
529 Ga0495640_0011120 3300046533 Bacteria 6929
530 Ga0495586_0002842 3300046535 Bacteria 9345
531 Ga0495598_0035946 3300046537 Bacteria 1421
532 Ga0495609_0040320 3300046538 Bacteria 2101
533 Ga0495609_0044872 3300046538 Bacteria 1982
534 Ga0495621_0070241 3300046539 Bacteria 1289
535 Ga0495633_0122900 3300046558 Bacteria 1202
536 Ga0495656_0000056 3300046615 Bacteria 53530
537 Ga0495656_0005420 3300046615 Bacteria 4404
538 Ga0495656_0034683 3300046615 Bacteria 2068
539 Ga0495656_0085885 3300046615 Bacteria 1430
540 Ga0495668_0041474 3300046616 Bacteria 2563
541 Ga0495625_0122346 3300046660 Bacteria 1769
542 Ga0495625_0189355 3300046660 Bacteria 1364
543 Ga0495635_0174256 3300046663 Bacteria 1463
544 Ga0495588_0117705 3300046674 Bacteria 1400
545 Ga0495647_0004322 3300046681 Bacteria 4604
546 Ga0495669_0013998 3300046684 Bacteria 3426
547 Ga0495624_0007338 3300046690 Bacteria 7741
548 Ga0495624_0075556 3300046690 Bacteria 2092
549 Ga0495670_0091367 3300046691 Bacteria 1558
550 Ga0495649_0113701 3300046694 Bacteria 1434
551 Ga0495581_0036671 3300047315 Bacteria 2837
552 Ga0495604_0076749 3300047317 Bacteria 2513
553 Ga0495672_0011004 3300047320 Bacteria 6410
554 Ga0495672_0024635 3300047320 Bacteria 3872
555 Ga0495676_0146428 3300047321 Bacteria 1686
556 Ga0495676_0163392 3300047321 Bacteria 1573
557 Ga0495676_0203618 3300047321 Bacteria 1374
558 Ga0495677_0089396 3300047445 Bacteria 1160
559 Ga0495673_0068567 3300047469 Bacteria 1498
560 Ga0495681_0104797 3300047470 Bacteria 1232
561 Ga0495686_0245700 3300047472 Bacteria 1007
562 Ga0496100_0005062 3300048903 Bacteria 7055
563 Ga0496100_0019205 3300048903 Bacteria 4072
564 Ga0496100_0021590 3300048903 Bacteria 3881
565 Ga0496100_0091655 3300048903 Unclassified 2075
566 Ga0496100_0169433 3300048903 Bacteria 1571
567 Ga0496100_0228675 3300048903 Bacteria 1368
568 Ga0496100_0440349 3300048903 Bacteria 998
569 Ga0496101_0001243 3300048904 Bacteria 15238
570 Ga0496101_0030007 3300048904 Bacteria 3807
571 Ga0496101_0364836 3300048904 Unclassified 1136
572 Ga0496102_0006629 3300048905 Bacteria 9896
573 Ga0496102_0286343 3300048905 Bacteria 1553
574 Ga0496102_0559848 3300048905 Bacteria 1066
575 Ga0496103_0014429 3300048906 Bacteria 4690
576 Ga0496104_0033893 3300048907 Bacteria 4759
577 Ga0496104_0240138 3300048907 Bacteria 1724
578 Ga0496104_0351335 3300048907 Bacteria 1387
579 Ga0496105_0056231 3300048908 Bacteria 3247
580 Ga0496106_0123971 3300048909 Unclassified 2022
581 Ga0496106_0151525 3300048909 Bacteria 1830
582 Ga0496106_0181506 3300048909 Bacteria 1671
583 Ga0496107_0011866 3300048910 Bacteria 6087
584 Ga0496107_0053758 3300048910 Bacteria 2905
585 Ga0496107_0162786 3300048910 Bacteria 1654
586 Ga0496108_0002322 3300048911 Bacteria 15222
587 Ga0496108_0006355 3300048911 Bacteria 9579
588 Ga0496108_0088493 3300048911 Bacteria 2631
589 Ga0496109_0020567 3300048912 Bacteria 5829
590 Ga0496109_0036380 3300048912 Bacteria 4443
591 Ga0496109_0063084 3300048912 Bacteria 3389
592 Ga0496109_0148294 3300048912 Bacteria 2196
593 Ga0496109_0379695 3300048912 Unclassified 1335
594 Ga0496110_0013135 3300048913 Bacteria 6838
595 Ga0496110_0022825 3300048913 Bacteria 5316
596 Ga0496110_0042386 3300048913 Bacteria 3972
597 Ga0496111_0017151 3300048914 Bacteria 5001
598 Ga0496111_0053794 3300048914 Bacteria 2909
599 Ga0496112_0332464 3300048915 Bacteria 1463
600 Ga0496113_0022844 3300048916 Bacteria 4430
601 Ga0496114_0038512 3300048917 Unclassified 3956
602 Ga0496114_0051795 3300048917 Bacteria 3418
603 Ga0496114_0058015 3300048917 Bacteria 3232
604 Ga0496114_0096421 3300048917 Bacteria 2518
605 Ga0496114_0114098 3300048917 Bacteria 2317
606 Ga0496114_0173705 3300048917 Bacteria 1879
607 Ga0496115_0013323 3300048918 Bacteria 6219
608 Ga0496116_0157216 3300048919 Bacteria 1253
609 Ga0496119_0035291 3300048922 Bacteria 3279
610 Ga0496121_0050553 3300048924 Bacteria 3510
611 Ga0496121_0107123 3300048924 Bacteria 2141
612 Ga0496121_0169911 3300048924 Bacteria 1585
613 Ga0496121_0221515 3300048924 Bacteria 1332
614 Ga0496124_0128200 3300048927 Bacteria 2019
615 Ga0496124_0319598 3300048927 Bacteria 1112
616 Ga0496125_0007603 3300048928 Bacteria 11505
617 Ga0496125_0031085 3300048928 Bacteria 4765
618 Ga0496126_0060101 3300048929 Bacteria 3420
619 Ga0496126_0074054 3300048929 Bacteria 3025
620 Ga0496126_0102972 3300048929 Bacteria 2495
621 Ga0496126_0136677 3300048929 Bacteria 2113
622 Ga0495682_0104632 3300049460 Bacteria 1015
623 Ga0501033_0113042 3300049570 Bacteria 1975
624 Ga0501036_0152346 3300049572 Bacteria 1950
625 Ga0501037_0024707 3300049573 Bacteria 4443
626 Ga0501039_0005840 3300049575 Bacteria 9323
627 Ga0501040_0252906 3300049576 Bacteria 1257
628 Ga0501041_0000955 3300049577 Bacteria 15715
629 Ga0501042_0069740 3300049578 Bacteria 2514
630 Ga0501042_0100416 3300049578 Bacteria 2081
631 Ga0501043_0055115 3300049579 Bacteria 3123
632 Ga0501046_0048928 3300049580 Bacteria 3346
633 Ga0501046_0238821 3300049580 Bacteria 1341
634 Ga0501048_0062748 3300049582 Bacteria 2630
635 Ga0501067_0042841 3300049583 Bacteria 2514
636 Ga0501068_0274061 3300049584 Bacteria 1077
637 Ga0501071_0120860 3300049587 Bacteria 1941
638 Ga0501074_0060798 3300049590 Bacteria 2722
639 Ga0501075_0012705 3300049591 Bacteria 5991
640 Ga0501075_0185295 3300049591 Bacteria 1588
641 Ga0501076_0003374 3300049592 Bacteria 11210
642 Ga0501076_0032190 3300049592 Bacteria 4093
643 Ga0501076_0305240 3300049592 Bacteria 1305
644 Ga0501077_0144428 3300049593 Bacteria 1509
645 Ga0501077_0149339 3300049593 Bacteria 1483
646 Ga0501077_0163124 3300049593 Bacteria 1415
647 Ga0501079_0001745 3300049741 Bacteria 15502
648 Ga0501080_0019837 3300049742 Bacteria 6224
649 Ga0501080_0258873 3300049742 Bacteria 1586
650 Ga0501081_0001006 3300049743 Bacteria 16815
651 Ga0501083_0288255 3300049744 Bacteria 1068
652 Ga0501035_0084828 3300049822 Bacteria 2793
653 Ga0501035_0143209 3300049822 Bacteria 2077
654 Ga0501044_0028343 3300049823 Bacteria 5911
655 nmdc:mga03n38_248438_c1 3300050490 Bacteria 939
656 nmdc:mga03n38_479_c1 3300050490 Bacteria 9992
657 nmdc:mga00v17_135123_c1 3300050491 Bacteria 1578
658 nmdc:mga00v17_161409_c1 3300050491 Bacteria 1443
659 nmdc:mga0yw44_10625_c1 3300050492 Bacteria 4713
660 nmdc:mga0yw44_146021_c1 3300050492 Bacteria 1540
661 nmdc:mga0yw44_65810_c1 3300050492 Bacteria 2235
662 nmdc:mga0k408_102787_c1 3300050493 Bacteria 1686
663 nmdc:mga0k408_148935_c1 3300050493 Bacteria 1393
664 nmdc:mga0k408_20164_c1 3300050493 Bacteria 3731
665 nmdc:mga06z11_100261_c1 3300050494 Bacteria 1588
666 nmdc:mga07m45_3751_c1 3300050496 Bacteria 7350
667 nmdc:mga05p37_132821_c1 3300050507 Bacteria 3054
668 nmdc:mga05p37_184134_c1 3300050507 Bacteria 2540
669 nmdc:mga05p37_471273_c1 3300050507 Bacteria 1449
670 nmdc:mga05p37_548_c1 3300050507 Bacteria 41310
671 nmdc:mga09592_153157_c1 3300050508 Bacteria 1989
672 nmdc:mga09592_79436_c1 3300050508 Bacteria 2793
673 nmdc:mga09592_97131_c1 3300050508 Bacteria 2521
674 nmdc:mga0qj67_129_c1 3300050509 Bacteria 50064
675 nmdc:mga0qj67_395949_c1 3300050509 Bacteria 1115
676 nmdc:mga0qj67_613672_c1 3300050509 Bacteria 869
677 nmdc:mga0qj67_87584_c1 3300050509 Bacteria 2499
678 nmdc:mga06r32_234951_c1 3300050510 Bacteria 1821
679 nmdc:mga06r32_25300_c1 3300050510 Bacteria 5522
680 nmdc:mga06r32_25937_c1 3300050510 Bacteria 5458
681 nmdc:mga06r32_2762_c1 3300050510 Bacteria 15703
682 nmdc:mga08y16_321252_c1 3300050511 Bacteria 1594
683 nmdc:mga08y16_4082_c1 3300050511 Bacteria 15245
684 nmdc:mga08y16_58844_c1 3300050511 Unclassified 4015
685 nmdc:mga08y16_68943_c1 3300050511 Bacteria 3687
686 nmdc:mga08y16_82255_c1 3300050511 Bacteria 3357
687 nmdc:mga08y16_89904_c1 3300050511 Bacteria 3200
688 nmdc:mga0n895_437140_c1 3300050512 Bacteria 1322
689 nmdc:mga0n895_468701_c1 3300050512 Bacteria 1271
690 nmdc:mga0n895_69090_c1 3300050512 Bacteria 3499
691 nmdc:mga0rr50_123611_c1 3300050513 Bacteria 2063
692 nmdc:mga0rr50_151766_c1 3300050513 Bacteria 1873
693 nmdc:mga0rr50_174916_c2 3300050513 Bacteria 1082
694 nmdc:mga0rr50_65822_c1 3300050513 Bacteria 2746
695 nmdc:mga08x19_14983_c1 3300050514 Bacteria 4708
696 nmdc:mga08x19_258127_c1 3300050514 Bacteria 1204
697 nmdc:mga08x19_438_c1 3300050514 Bacteria 28587
698 nmdc:mga08x19_88560_c1 3300050514 Bacteria 2040
699 nmdc:mga0a205_109230_c1 3300050515 Bacteria 2664
700 Ga0500651_0076952 3300053093 Bacteria 2071
701 Ga0500566_0005914 3300053094 Bacteria 7276
702 Ga0500641_0005264 3300053096 Bacteria 4583
703 Ga0500554_000836 3300053102 Bacteria 6056
704 Ga0500595_000131 3300053119 Bacteria 49217
705 Ga0500595_001346 3300053119 Bacteria 13271
706 Ga0500595_016245 3300053119 Bacteria 2777
707 Ga0500577_0083580 3300053142 Bacteria 1278
708 Ga0500588_0013925 3300053146 Bacteria 2027
709 Ga0500589_128972 3300053147 Bacteria 1059
710 Ga0500627_0079810 3300053158 Bacteria 1457
711 Ga0500634_0067578 3300053161 Bacteria 1879
712 Ga0500638_082867 3300053162 Bacteria 1520
713 Ga0500637_0000086 3300053178 Bacteria 33336
714 Ga0500645_028522 3300053730 Bacteria 1689
715 Ga0501084_0148885 3300054114 Bacteria 1972
716 Ga0500661_000107 3300055283 Bacteria 13423
717 Ga0501082_0007825 3300060353 Bacteria 9225
718 Ga0501082_0221566 3300060353 Bacteria 1646
719 Ga0530510_0029057 3300061734 Bacteria 3967
720 Ga0530510_0092427 3300061734 Bacteria 2208
721 Ga0530510_0123156 3300061734 Bacteria 1905
722 Ga0530510_0126216 3300061734 Bacteria 1881
723 2513692144 2513237101 Bacteria 7952346
724 2793083329
725 2874607624 2874604998 Bacteria 7834745
726 2876812997 2876808645 Bacteria 8824342
727 2879115362 2879110137 Bacteria 8907982
728 2889040257 2889033259 Bacteria 9099371
729 2922368158 2922361189 Bacteria 7436256
730 2922388371 2922386360 Bacteria 7017218
731 2939632455 2939631187 Bacteria 6118131
732 8006970751 8006964411 Bacteria 8966052
733 8006985599 8006984368 Bacteria 9651211
734 8007000152 8006994254 Bacteria 8309700
735 8056674215 8056673599 Bacteria 7871253
736 Ga0070665_100048788
737 JGI25406J46586_10000956
738 JGI25406J46586_10011227
739 JGI25153J46596_10005018
740 rootL2_10146270
741 JGI25404J52841_10002071
742 Ga0065707_10120405
743 Ga0070676_10120062
744 Ga0070683_100041262
745 Ga0070683_100042789
746 Ga0070683_100290422
747 Ga0070690_100000394
748 Ga0070670_100003685
749 Ga0070670_100051032
750 Ga0068869_100000076
751 Ga0068869_100049368
752 Ga0068869_100060004
753 Ga0068869_100069430
754 Ga0070666_10083807
755 Ga0070680_100001687
756 Ga0070680_100178141
757 Ga0070682_100001495
758 Ga0068868_100000097
759 Ga0068868_100000170
760 Ga0068868_100065241
761 Ga0070689_100002286
762 Ga0070689_100195250
763 Ga0070691_10000921
764 Ga0070691_10111453
765 Ga0070687_100000081
766 Ga0070661_100176567
767 Ga0070692_10011524
768 Ga0070668_100342434
769 Ga0070675_100000495
770 Ga0070675_100377006
771 Ga0070671_100001098
772 Ga0070671_100062110
773 Ga0070671_100205394
774 Ga0070671_100237181
775 Ga0070674_100062739
776 Ga0070673_100000326
777 Ga0070673_100073071
778 Ga0070673_100094545
779 Ga0070673_100339035
780 Ga0070659_100108037
781 Ga0070667_100254179
782 Ga0070703_10006573
783 Ga0070709_10217996
784 Ga0070714_100016640
785 Ga0070714_100062403
786 Ga0070714_100110313
787 Ga0070714_100380948
788 Ga0070713_100027617
789 Ga0070713_100074974
790 Ga0070710_10030072
791 Ga0070701_10000252
792 Ga0070705_100002492
793 Ga0070700_100003588
794 Ga0070694_100001443
795 Ga0070694_100014554
796 Ga0070694_100098463
797 Ga0070708_100030005
798 Ga0070663_100003187
799 Ga0070663_100034058
800 Ga0070663_100047385
801 Ga0070678_100018246
802 Ga0070678_100066459
803 Ga0070678_100120482
804 Ga0070681_10000175
805 Ga0070681_10007808
806 Ga0070681_10120727
807 Ga0070681_10179988
808 Ga0068867_100000194
809 Ga0068867_100004288
810 Ga0068867_100064247
811 Ga0070685_10164689
812 Ga0070706_100032797
813 Ga0070707_100257076
814 Ga0070699_100093221
815 Ga0070699_100426746
816 Ga0070679_100024315
817 Ga0070679_100032212
818 Ga0070679_100063244
819 Ga0070679_100108728
820 Ga0070679_100171372
821 Ga0070684_100180756
822 Ga0070697_100004102
823 Ga0070697_100007933
824 Ga0068853_100021864
825 Ga0068853_100046209
826 Ga0068853_100377271
827 Ga0070672_100000192
828 Ga0070672_100090624
829 Ga0070686_100000732
830 Ga0070686_100018604
831 Ga0070695_100000206
832 Ga0070696_100001279
833 Ga0070693_100000241
834 Ga0070665_100040270
835 Ga0070665_100058336
836 Ga0070665_100112777
837 Ga0070665_100214647
838 Ga0070704_100000064
839 Ga0068855_100002228
840 Ga0068855_100005179
841 Ga0068855_100147727
842 Ga0068855_100196484
843 Ga0068855_100217652
844 Ga0070664_100021457
845 Ga0070664_100085052
846 Ga0070664_100112837
847 Ga0068857_100014739
848 Ga0068857_100157233
849 Ga0068857_100366142
850 Ga0068854_100002327
851 Ga0068856_100000363
852 Ga0068856_100042901
853 Ga0070702_100000002
854 Ga0070702_100094121
855 Ga0068852_100020070
856 Ga0068859_100000195
857 Ga0068859_100022345
858 Ga0068859_100022663
859 Ga0068864_100034481
860 Ga0068864_100098394
861 Ga0068866_10000037
862 Ga0068861_100000141
863 Ga0068861_100019237
864 Ga0068861_100061541
865 Ga0068861_100531245
866 Ga0068851_10010830
867 Ga0068851_10021072
868 Ga0068851_10050252
869 Ga0068863_100138030
870 Ga0068858_100004800
871 Ga0068858_100091114
872 Ga0068858_100223048
873 Ga0068858_100250258
874 Ga0068860_100001799
875 Ga0068860_100045230
876 Ga0068860_100073236
877 Ga0068860_100113532
878 Ga0068862_100002874
879 Ga0068862_100064625
880 Ga0068862_100101223
881 Ga0068862_100159162
882 Ga0068862_100282944
883 Ga0081455_10001783
884 Ga0081455_10009563
885 Ga0081455_10024587
886 Ga0081455_10032540
887 Ga0081455_10034176
888 Ga0081538_10008218
889 Ga0081538_10032835
890 Ga0081538_10092737
891 Ga0081540_1000629
892 Ga0081540_1001058
893 Ga0081540_1004779
894 Ga0081540_1030206
895 Ga0081539_10001182
896 Ga0081539_10008460
897 Ga0075365_10133269
898 Ga0075365_10181539
899 Ga0075368_10010325
900 Ga0075364_10042867
901 Ga0075364_10063536
902 Ga0070712_100059256
903 Ga0070712_100104202
904 Ga0075367_10153496
905 Ga0075367_10236730
906 Ga0097621_100000045
907 Ga0097621_100000670
908 Ga0097621_100007399
909 Ga0097621_100325106
910 Ga0097621_100364911
911 Ga0075370_10002843
912 Ga0075370_10009357
913 Ga0068871_100000263
914 Ga0068871_100000480
915 Ga0068871_100121319
916 Ga0068871_100281179
917 Ga0075428_100000047
918 Ga0075428_100005533
919 Ga0075428_100056353
920 Ga0075428_100079687
921 Ga0075430_100000263
922 Ga0075430_100044069
923 Ga0075431_100046922
924 Ga0075431_100319044
925 Ga0075431_100565524
926 Ga0075433_10209423
927 Ga0075434_100108173
928 Ga0075434_100211670
929 Ga0075434_100225888
930 Ga0075434_100367718
931 Ga0075429_100000047
932 Ga0075429_100044344
933 Ga0075429_100125896
934 Ga0075429_100252460
935 Ga0068865_100000176
936 Ga0068865_100014213
937 Ga0068865_100023335
938 Ga0068865_100153217
939 Ga0075436_100001103
940 Ga0075436_100051290
941 Ga0075436_100084112
942 Ga0097620_100000195
943 Ga0097620_100022345
944 Ga0097620_100022663
945 Ga0075435_100083609
946 Ga0099794_10023059
947 Ga0099795_10000930
948 Ga0099795_10008263
949 Ga0099795_10019881
950 Ga0105240_10014043
951 Ga0105240_10017864
952 Ga0105240_10146102
953 Ga0105240_10224801
954 Ga0111539_10053203
955 Ga0111539_10071015
956 Ga0111539_10074371
957 Ga0111539_10098340
958 Ga0111539_10107018
959 Ga0111539_10131820
960 Ga0111539_10139847
961 Ga0111539_10170459
962 Ga0111539_10267195
963 Ga0111539_10273832
964 Ga0111539_10475501
965 Ga0105245_10000306
966 Ga0105245_10063074
967 Ga0105245_10066312
968 Ga0105245_10099027
969 Ga0105247_10032953
970 Ga0114129_10000040
971 Ga0114129_10015184
972 Ga0114129_10222591
973 Ga0114129_10227346
974 Ga0114129_10274826
975 Ga0105243_10000035
976 Ga0105241_10009257
977 Ga0105241_10210722
978 Ga0105242_10000097
979 Ga0105242_10266853
980 Ga0105248_10008795
981 Ga0105248_10043456
982 Ga0105248_10399059
983 Ga0105237_10008632
984 Ga0105237_10149379
985 Ga0105238_10013209
986 Ga0105249_10000701
987 Ga0105249_10117184
988 Ga0105249_10239426
989 Ga0105249_10266407
990 Ga0105249_10382379
991 Ga0105239_10166549
992 Ga0105239_10445630
993 Ga0105246_10003975
994 Ga0157371_10166916
995 Ga0157370_10009437
996 Ga0157369_10016214
997 Ga0157369_10145697
998 Ga0157369_10361324
999 Ga0157374_10008938
1000 Ga0157374_10038248
1001 Ga0157374_10092871
1002 Ga0157374_10107236
1003 Ga0157378_10000457
1004 Ga0157378_10001711
1005 Ga0157378_10046613
1006 Ga0157378_10092162
1007 Ga0157378_10104122
1008 Ga0163162_10005305
1009 Ga0163162_10282635
1010 Ga0163162_10317206
1011 Ga0163162_10402697
1012 Ga0157372_10126744
1013 Ga0157375_10002389
1014 Ga0157375_10068603
1015 Ga0157375_10170666
1016 Ga0157375_10176935
1017 Ga0163163_10013283
1018 Ga0157380_10022360
1019 Ga0157377_10009203
1020 Ga0157377_10193570
1021 Ga0157376_10003192
1022 Ga0157376_10003684
1023 Ga0157376_10024861
1024 Ga0157376_10302392
1025 Ga0163161_10082175
1026 Ga0209758_1013095
1027 Ga0207697_10064456
1028 Ga0207656_10033849
1029 Ga0207692_10068486
1030 Ga0207642_10012706
1031 Ga0207642_10038767
1032 Ga0207688_10026168
1033 Ga0207688_10086669
1034 Ga0207680_10129503
1035 Ga0207699_10103996
1036 Ga0207705_10108175
1037 Ga0207684_10349609
1038 Ga0207654_10022255
1039 Ga0207707_10007364
1040 Ga0207707_10007978
1041 Ga0207707_10008173
1042 Ga0207707_10259473
1043 Ga0207695_10118915
1044 Ga0207695_10426811
1045 Ga0207671_10160847
1046 Ga0207693_10001985
1047 Ga0207663_10171776
1048 Ga0207660_10000656
1049 Ga0207660_10039486
1050 Ga0207660_10210006
1051 Ga0207662_10000006
1052 Ga0207662_10171125
1053 Ga0207657_10005499
1054 Ga0207649_10011353
1055 Ga0207649_10042730
1056 Ga0207649_10044073
1057 Ga0207649_10149141
1058 Ga0207652_10025643
1059 Ga0207652_10070217
1060 Ga0207652_10124192
1061 Ga0207646_10125091
1062 Ga0207694_10135083
1063 Ga0207694_10206050
1064 Ga0207650_10001574
1065 Ga0207659_10052289
1066 Ga0207687_10001417
1067 Ga0207687_10312769
1068 Ga0207687_10321427
1069 Ga0207700_10069484
1070 Ga0207664_10054031
1071 Ga0207664_10175231
1072 Ga0207664_10390612
1073 Ga0207644_10000552
1074 Ga0207644_10065530
1075 Ga0207644_10087463
1076 Ga0207644_10104549
1077 Ga0207644_10181401
1078 Ga0207644_10342507
1079 Ga0207706_10300189
1080 Ga0207686_10273500
1081 Ga0207709_10018448
1082 Ga0207670_10003078
1083 Ga0207669_10032805
1084 Ga0207669_10060290
1085 Ga0207669_10067465
1086 Ga0207704_10002836
1087 Ga0207704_10041937
1088 Ga0207704_10176669
1089 Ga0207704_10177464
1090 Ga0207704_10232599
1091 Ga0207691_10000110
1092 Ga0207689_10000082
1093 Ga0207689_10004587
1094 Ga0207689_10007828
1095 Ga0207689_10061459
1096 Ga0207661_10066548
1097 Ga0207661_10246010
1098 Ga0207679_10066793
1099 Ga0207679_10074502
1100 Ga0207679_10151990
1101 Ga0207679_10245160
1102 Ga0207667_10005958
1103 Ga0207667_10064669
1104 Ga0207667_10188698
1105 Ga0207651_10063654
1106 Ga0207651_10164599
1107 Ga0207651_10327321
1108 Ga0207651_10450315
1109 Ga0207712_10017209
1110 Ga0207712_10215212
1111 Ga0207668_10103696
1112 Ga0207668_10217391
1113 Ga0207640_10001319
1114 Ga0207640_10031073
1115 Ga0207658_10118451
1116 Ga0207658_10135709
1117 Ga0207677_10002884
1118 Ga0207677_10079312
1119 Ga0207677_10116282
1120 Ga0207677_10245632
1121 Ga0207677_10391133
1122 Ga0207703_10013324
1123 Ga0207703_10038067
1124 Ga0207703_10352785
1125 Ga0207639_10040700
1126 Ga0207678_10019226
1127 Ga0207678_10021905
1128 Ga0207678_10141202
1129 Ga0207678_10252394
1130 Ga0207708_10000999
1131 Ga0207708_10022458
1132 Ga0207708_10177190
1133 Ga0207702_10000854
1134 Ga0207702_10041647
1135 Ga0207702_10069273
1136 Ga0207641_10231671
1137 Ga0207641_10232892
1138 Ga0207641_10356118
1139 Ga0207648_10000300
1140 Ga0207676_10074022
1141 Ga0207676_10098424
1142 Ga0207676_10188845
1143 Ga0207674_10015222
1144 Ga0207674_10135097
1145 Ga0207674_10283700
1146 Ga0207674_10302844
1147 Ga0207675_100000064
1148 Ga0207675_100024684
1149 Ga0207675_100033797
1150 Ga0207675_100134544
1151 Ga0207683_10000419
1152 Ga0207683_10019647
1153 Ga0207683_10030308
1154 Ga0207683_10037670
1155 Ga0207683_10068442
1156 Ga0207683_10094508
1157 Ga0209588_1029394
1158 Ga0209998_10007839
1159 Ga0207428_10001680
1160 Ga0207428_10033934
1161 Ga0207428_10039119
1162 Ga0207428_10118977
1163 Ga0207428_10248812
1164 Ga0207428_10345331
1165 Ga0268266_10000857
1166 Ga0268266_10002192
1167 Ga0268266_10021495
1168 Ga0268266_10042032
1169 Ga0268266_10420027
1170 Ga0268265_10003138
1171 Ga0268265_10068618
1172 Ga0268265_10169629
1173 Ga0268265_10193157
1174 Ga0268265_10355236
1175 Ga0268264_10000790
1176 Ga0307517_10000419
1177 Ga0307515_10003270
1178 Ga0307515_10178708
1179 Ga0265325_10000337
1180 Ga0265340_10007828
1181 Ga0265316_10084488
1182 Ga0307509_10055602
1183 Ga0307408_100014222
1184 Ga0265313_10075993
1185 Ga0307508_10081091
1186 Ga0307508_10305033
1187 Ga0265314_10003384
1188 Ga0265342_10043808
1189 Ga0307516_10295549
1190 Ga0307410_10077542
1191 Ga0307406_10006143
1192 Ga0307412_10144763
1193 Ga0307412_10250551
1194 Ga0307409_100081395
1195 Ga0307409_100112079
1196 Ga0307416_100067207
1197 Ga0307416_100289456
1198 Ga0307416_100697749
1199 Ga0307415_100049578
1200 Ga0307510_10016788
1201 Ga0373948_0013196
1202 Ga0373950_0009465
1203 Ga0373926_0000560
1204 Ga0373928_0005813
1205 Ga0373928_0032101
1206 Ga0373951_0021188
1207 Ga0373932_0009947
1208 Ga0373939_0013542
1209 Ga0373941_0004116
1210 Ga0373945_0004874
1211 Ga0373954_0024519
1212 Ga0373955_0061455
1213 Ga0373942_0005939
1214 Ga0373961_0002043
1215 Ga0373931_0000939
1216 Ga0373931_0020058
1217 Ga0373931_0081957
1218 Ga0373935_0008314
1219 Ga0373927_0034203
1220 Ga0373927_0058578
1221 Ga0373927_0162843
1222 Ga0373947_0026445
1223 Ga0373937_0274155
1224 Ga0373925_0271764
1225 Ga0395900_0353656
1226 Ga0395905_0087966
1227 Ga0395905_0100129
1228 Ga0436364_0859034
1229 Ga0451853_2302322
1230 Ga0439441_015355
1231 Ga0439434_0053846
1232 Ga0439460_0005651
1233 Ga0466971_0131462
1234 Ga0466957_0145937
1235 Ga0451576_0078666
1236 Ga0451576_0139893
1237 Ga0466958_0154338
1238 Ga0495617_014463
1239 Ga0495603_0004044
1240 Ga0495603_0048878
1241 Ga0495603_0106326
1242 Ga0495590_0053282
1243 Ga0495590_0105206
1244 Ga0495629_0054633
1245 Ga0495629_0491278
1246 Ga0495638_0005571
1247 Ga0495638_0078142
1248 Ga0495638_0079202
1249 Ga0495638_0169623
1250 Ga0495641_0099431
1251 Ga0495650_0059085
1252 Ga0495582_0238806
1253 Ga0495605_0073731
1254 Ga0495662_0026110
1255 Ga0495584_0189040
1256 Ga0495585_0131581
1257 Ga0495596_0020504
1258 Ga0495610_0014351
1259 Ga0495631_0037020
1260 Ga0495632_0201400
1261 Ga0495644_0042714
1262 Ga0495665_0058052
1263 Ga0495665_0267975
1264 Ga0495640_0011120
1265 Ga0495586_0002842
1266 Ga0495598_0035946
1267 Ga0495609_0040320
1268 Ga0495609_0044872
1269 Ga0495621_0070241
1270 Ga0495633_0122900
1271 Ga0495656_0000056
1272 Ga0495656_0005420
1273 Ga0495656_0034683
1274 Ga0495656_0085885
1275 Ga0495668_0041474
1276 Ga0495625_0122346
1277 Ga0495625_0189355
1278 Ga0495635_0174256
1279 Ga0495588_0117705
1280 Ga0495647_0004322
1281 Ga0495669_0013998
1282 Ga0495624_0007338
1283 Ga0495624_0075556
1284 Ga0495670_0091367
1285 Ga0495649_0113701
1286 Ga0495581_0036671
1287 Ga0495604_0076749
1288 Ga0495672_0011004
1289 Ga0495672_0024635
1290 Ga0495676_0146428
1291 Ga0495676_0163392
1292 Ga0495676_0203618
1293 Ga0495677_0089396
1294 Ga0495673_0068567
1295 Ga0495681_0104797
1296 Ga0495686_0245700
1297 Ga0496100_0005062
1298 Ga0496100_0019205
1299 Ga0496100_0021590
1300 Ga0496100_0091655
1301 Ga0496100_0169433
1302 Ga0496100_0228675
1303 Ga0496100_0440349
1304 Ga0496101_0001243
1305 Ga0496101_0030007
1306 Ga0496101_0364836
1307 Ga0496102_0006629
1308 Ga0496102_0286343
1309 Ga0496102_0559848
1310 Ga0496103_0014429
1311 Ga0496104_0033893
1312 Ga0496104_0240138
1313 Ga0496104_0351335
1314 Ga0496105_0056231
1315 Ga0496106_0123971
1316 Ga0496106_0151525
1317 Ga0496106_0181506
1318 Ga0496107_0011866
1319 Ga0496107_0053758
1320 Ga0496107_0162786
1321 Ga0496108_0002322
1322 Ga0496108_0006355
1323 Ga0496108_0088493
1324 Ga0496109_0020567
1325 Ga0496109_0036380
1326 Ga0496109_0063084
1327 Ga0496109_0148294
1328 Ga0496109_0379695
1329 Ga0496110_0013135
1330 Ga0496110_0022825
1331 Ga0496110_0042386
1332 Ga0496111_0017151
1333 Ga0496111_0053794
1334 Ga0496112_0332464
1335 Ga0496113_0022844
1336 Ga0496114_0038512
1337 Ga0496114_0051795
1338 Ga0496114_0058015
1339 Ga0496114_0096421
1340 Ga0496114_0114098
1341 Ga0496114_0173705
1342 Ga0496115_0013323
1343 Ga0496116_0157216
1344 Ga0496119_0035291
1345 Ga0496121_0050553
1346 Ga0496121_0107123
1347 Ga0496121_0169911
1348 Ga0496121_0221515
1349 Ga0496124_0128200
1350 Ga0496124_0319598
1351 Ga0496125_0007603
1352 Ga0496125_0031085
1353 Ga0496126_0060101
1354 Ga0496126_0074054
1355 Ga0496126_0102972
1356 Ga0496126_0136677
1357 Ga0495682_0104632
1358 Ga0501033_0113042
1359 Ga0501036_0152346
1360 Ga0501037_0024707
1361 Ga0501039_0005840
1362 Ga0501040_0252906
1363 Ga0501041_0000955
1364 Ga0501042_0069740
1365 Ga0501042_0100416
1366 Ga0501043_0055115
1367 Ga0501046_0048928
1368 Ga0501046_0238821
1369 Ga0501048_0062748
1370 Ga0501067_0042841
1371 Ga0501068_0274061
1372 Ga0501071_0120860
1373 Ga0501074_0060798
1374 Ga0501075_0012705
1375 Ga0501075_0185295
1376 Ga0501076_0003374
1377 Ga0501076_0032190
1378 Ga0501076_0305240
1379 Ga0501077_0144428
1380 Ga0501077_0149339
1381 Ga0501077_0163124
1382 Ga0501079_0001745
1383 Ga0501080_0019837
1384 Ga0501080_0258873
1385 Ga0501081_0001006
1386 Ga0501083_0288255
1387 Ga0501035_0084828
1388 Ga0501035_0143209
1389 Ga0501044_0028343
1390 nmdc:mga03n38_248438_c1
1391 nmdc:mga03n38_479_c1
1392 nmdc:mga00v17_135123_c1
1393 nmdc:mga00v17_161409_c1
1394 nmdc:mga0yw44_10625_c1
1395 nmdc:mga0yw44_146021_c1
1396 nmdc:mga0yw44_65810_c1
1397 nmdc:mga0k408_102787_c1
1398 nmdc:mga0k408_148935_c1
1399 nmdc:mga0k408_20164_c1
1400 nmdc:mga06z11_100261_c1
1401 nmdc:mga07m45_3751_c1
1402 nmdc:mga05p37_132821_c1
1403 nmdc:mga05p37_184134_c1
1404 nmdc:mga05p37_471273_c1
1405 nmdc:mga05p37_548_c1
1406 nmdc:mga09592_153157_c1
1407 nmdc:mga09592_79436_c1
1408 nmdc:mga09592_97131_c1
1409 nmdc:mga0qj67_129_c1
1410 nmdc:mga0qj67_395949_c1
1411 nmdc:mga0qj67_613672_c1
1412 nmdc:mga0qj67_87584_c1
1413 nmdc:mga06r32_234951_c1
1414 nmdc:mga06r32_25300_c1
1415 nmdc:mga06r32_25937_c1
1416 nmdc:mga06r32_2762_c1
1417 nmdc:mga08y16_321252_c1
1418 nmdc:mga08y16_4082_c1
1419 nmdc:mga08y16_58844_c1
1420 nmdc:mga08y16_68943_c1
1421 nmdc:mga08y16_82255_c1
1422 nmdc:mga08y16_89904_c1
1423 nmdc:mga0n895_437140_c1
1424 nmdc:mga0n895_468701_c1
1425 nmdc:mga0n895_69090_c1
1426 nmdc:mga0rr50_123611_c1
1427 nmdc:mga0rr50_151766_c1
1428 nmdc:mga0rr50_174916_c2
1429 nmdc:mga0rr50_65822_c1
1430 nmdc:mga08x19_14983_c1
1431 nmdc:mga08x19_258127_c1
1432 nmdc:mga08x19_438_c1
1433 nmdc:mga08x19_88560_c1
1434 nmdc:mga0a205_109230_c1
1435 Ga0500651_0076952
1436 Ga0500566_0005914
1437 Ga0500641_0005264
1438 Ga0500554_000836
1439 Ga0500595_000131
1440 Ga0500595_001346
1441 Ga0500595_016245
1442 Ga0500577_0083580
1443 Ga0500588_0013925
1444 Ga0500589_128972
1445 Ga0500627_0079810
1446 Ga0500634_0067578
1447 Ga0500638_082867
1448 Ga0500637_0000086
1449 Ga0500645_028522
1450 Ga0501084_0148885
1451 Ga0500661_000107
1452 Ga0501082_0007825
1453 Ga0501082_0221566
1454 Ga0530510_0029057
1455 Ga0530510_0092427
1456 Ga0530510_0123156
1457 Ga0530510_0126216
1458 2513692144
1459 2793083329
1460 2874607624
1461 2876812997
1462 2879115362
1463 2889040257
1464 2922368158
1465 2922388371
1466 2939632455
1467 8006970751
1468 8006985599
1469 8007000152
1470 8056674215

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

81

354

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9722 25 320
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9644 25 321
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.962 29 321
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9595 25 320
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9519 25 321
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9537 123 241 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9425 123 241 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9384 25 321 3.40.190.150
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9362 124 241 3.40.190.10
2qpqB01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9353 25 321 3.40.190.150
ID Description Score Start End GO Terms
AF-A0A5C8CF86-F1-model_v4 deleted 0.9777 36 321
AF-A0A1F4DZ02-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9753 17 321
AF-A0A317HMB4-F1-model_v4 deleted 0.9752 17 209
AF-A0A1J5PQ67-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.9751 62 314
AF-A0A7W0X4R0-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.974 17 321

Map