F478160
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 734 | 244 | 1468 | 150 |
Family's Representative Sequence
| Representative Sequence | 3300044706|Ga0466964_0235746|Ga0466964_0235746_345_869 |
| Length | 174 |
| Sequence | MSLDSDRVTAKDVARAMSRSYDDLEIGAVYRSRFGRTILDADNVWFTLLTLNTNPIHFDVEHAASTEWGRPLVDSTFTLALVTGLSVVDVSERAVNLGWREVKLTAPVFAGDTIRAETEVLAKRESRSRPGFGIVTVRTRGLNQRNEVVIEFERTVMLPLDAERRLEPDSTTRS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 2 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 3 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 4 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 5 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 8 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 12 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 14 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 16 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 18 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 20 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 24 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 33 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 35 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 36 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 37 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 40 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 41 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 42 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 43 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 44 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 45 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 46 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 47 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 48 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 52 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 53 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 54 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 55 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 56 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 57 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 59 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 61 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 62 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 63 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 64 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 65 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 66 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 67 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 68 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 69 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 97 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 98 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 99 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 100 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 101 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 102 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 103 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 104 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 105 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 106 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 107 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 108 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 109 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 110 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 111 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 112 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 113 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 114 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 115 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 116 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 117 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 118 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 119 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 120 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 121 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 122 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 123 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 124 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 125 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 126 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 127 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 128 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 129 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 130 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 131 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 132 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 133 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 134 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 135 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 136 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 137 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 138 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 139 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 140 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 141 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 142 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 143 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 144 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 145 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 146 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 147 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 148 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 149 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 150 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 151 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 152 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 153 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 154 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 155 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 156 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 206 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 207 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 208 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 209 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 210 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 211 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 212 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 213 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 214 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 215 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 216 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 217 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 218 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 219 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 220 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 221 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 222 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 223 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 226 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 227 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 230 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 233 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 234 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 236 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 237 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 242 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 243 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 244 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.23 |
| Metatranscriptomes | 1.77 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.14 |
| Nodule | 0 |
| Rhizoplane | 7.08 |
| Rhizosphere | 91.83 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 7.9 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466964_0235746 | 3300044706 | Bacteria | 895 |
| 2 | Ga0070658_10135083 | 3300005327 | Bacteria | 2057 |
| 3 | Ga0070658_10206498 | 3300005327 | Bacteria | 1659 |
| 4 | Ga0070658_10210449 | 3300005327 | Bacteria | 1642 |
| 5 | Ga0070683_100007834 | 3300005329 | Bacteria | 9048 |
| 6 | Ga0070683_100032507 | 3300005329 | Bacteria | 4751 |
| 7 | Ga0070683_100034870 | 3300005329 | Bacteria | 4599 |
| 8 | Ga0070683_100119713 | 3300005329 | Bacteria | 2486 |
| 9 | Ga0070683_100271290 | 3300005329 | Bacteria | 1614 |
| 10 | Ga0070683_100486174 | 3300005329 | Bacteria | 1179 |
| 11 | Ga0070680_100004322 | 3300005336 | Bacteria | 10683 |
| 12 | Ga0070680_100007831 | 3300005336 | Bacteria | 8145 |
| 13 | Ga0070680_100034832 | 3300005336 | Bacteria | 4061 |
| 14 | Ga0070680_100112342 | 3300005336 | Bacteria | 2269 |
| 15 | Ga0070680_100558797 | 3300005336 | Bacteria | 981 |
| 16 | Ga0070680_100570913 | 3300005336 | Bacteria | 970 |
| 17 | Ga0070680_100806932 | 3300005336 | Bacteria | 809 |
| 18 | Ga0070680_101433435 | 3300005336 | Unclassified | 598 |
| 19 | Ga0070682_100028918 | 3300005337 | Bacteria | 3336 |
| 20 | Ga0070682_100039720 | 3300005337 | Bacteria | 2892 |
| 21 | Ga0070682_100110186 | 3300005337 | Bacteria | 1834 |
| 22 | Ga0070660_100002737 | 3300005339 | Bacteria | 12115 |
| 23 | Ga0070660_100008650 | 3300005339 | Bacteria | 7129 |
| 24 | Ga0070660_100014803 | 3300005339 | Bacteria | 5628 |
| 25 | Ga0070660_100021208 | 3300005339 | Bacteria | 4787 |
| 26 | Ga0070660_100108071 | 3300005339 | Bacteria | 2211 |
| 27 | Ga0070660_101615760 | 3300005339 | Bacteria | 552 |
| 28 | Ga0070691_10436979 | 3300005341 | Unclassified | 745 |
| 29 | Ga0070661_100098665 | 3300005344 | Bacteria | 2170 |
| 30 | Ga0070661_100363628 | 3300005344 | Unclassified | 1138 |
| 31 | Ga0070661_100781316 | 3300005344 | Bacteria | 782 |
| 32 | Ga0070671_100473411 | 3300005355 | Bacteria | 1076 |
| 33 | Ga0070659_100079960 | 3300005366 | Bacteria | 2609 |
| 34 | Ga0070659_100116778 | 3300005366 | Bacteria | 2157 |
| 35 | Ga0070659_100600612 | 3300005366 | Unclassified | 946 |
| 36 | Ga0070659_100820076 | 3300005366 | Bacteria | 810 |
| 37 | Ga0070709_10351248 | 3300005434 | Bacteria | 1089 |
| 38 | Ga0070709_10391495 | 3300005434 | Bacteria | 1036 |
| 39 | Ga0070709_10866161 | 3300005434 | Bacteria | 713 |
| 40 | Ga0070714_100070418 | 3300005435 | Bacteria | 3023 |
| 41 | Ga0070714_100080710 | 3300005435 | Bacteria | 2830 |
| 42 | Ga0070714_100122611 | 3300005435 | Bacteria | 2313 |
| 43 | Ga0070714_100278002 | 3300005435 | Bacteria | 1555 |
| 44 | Ga0070714_100396497 | 3300005435 | Bacteria | 1304 |
| 45 | Ga0070714_100779925 | 3300005435 | Bacteria | 925 |
| 46 | Ga0070713_100020755 | 3300005436 | Bacteria | 5042 |
| 47 | Ga0070713_101180149 | 3300005436 | Bacteria | 741 |
| 48 | Ga0070711_100451763 | 3300005439 | Bacteria | 1052 |
| 49 | Ga0070711_100679085 | 3300005439 | Bacteria | 866 |
| 50 | Ga0070694_100524024 | 3300005444 | Bacteria | 946 |
| 51 | Ga0070663_100645566 | 3300005455 | Bacteria | 895 |
| 52 | Ga0070663_101415922 | 3300005455 | Bacteria | 616 |
| 53 | Ga0070681_10017455 | 3300005458 | Bacteria | 7173 |
| 54 | Ga0070681_10022404 | 3300005458 | Bacteria | 6343 |
| 55 | Ga0070681_10041844 | 3300005458 | Bacteria | 4593 |
| 56 | Ga0070681_10064712 | 3300005458 | Bacteria | 3626 |
| 57 | Ga0070681_10079444 | 3300005458 | Bacteria | 3237 |
| 58 | Ga0070681_10088339 | 3300005458 | Bacteria | 3051 |
| 59 | Ga0070681_10124094 | 3300005458 | Bacteria | 2515 |
| 60 | Ga0070681_10133093 | 3300005458 | Bacteria | 2418 |
| 61 | Ga0070681_10197239 | 3300005458 | Bacteria | 1932 |
| 62 | Ga0070681_10511835 | 3300005458 | Bacteria | 1114 |
| 63 | Ga0070707_100205011 | 3300005468 | Bacteria | 1922 |
| 64 | Ga0070698_100224193 | 3300005471 | Unclassified | 1813 |
| 65 | Ga0070698_101000736 | 3300005471 | Unclassified | 783 |
| 66 | Ga0070699_100632034 | 3300005518 | Bacteria | 977 |
| 67 | Ga0070679_100007577 | 3300005530 | Bacteria | 10154 |
| 68 | Ga0070679_100021157 | 3300005530 | Bacteria | 6346 |
| 69 | Ga0070679_100078312 | 3300005530 | Bacteria | 3294 |
| 70 | Ga0070679_100096032 | 3300005530 | Bacteria | 2952 |
| 71 | Ga0070679_100115774 | 3300005530 | Bacteria | 2666 |
| 72 | Ga0070679_100167583 | 3300005530 | Bacteria | 2170 |
| 73 | Ga0070679_100215350 | 3300005530 | Bacteria | 1883 |
| 74 | Ga0070679_100243235 | 3300005530 | Bacteria | 1757 |
| 75 | Ga0070679_100380741 | 3300005530 | Bacteria | 1358 |
| 76 | Ga0070679_100666696 | 3300005530 | Bacteria | 983 |
| 77 | Ga0070684_100026363 | 3300005535 | Bacteria | 4895 |
| 78 | Ga0070684_100043269 | 3300005535 | Bacteria | 3888 |
| 79 | Ga0070684_100043973 | 3300005535 | Bacteria | 3860 |
| 80 | Ga0070684_100200248 | 3300005535 | Bacteria | 1818 |
| 81 | Ga0068853_100174615 | 3300005539 | Bacteria | 1946 |
| 82 | Ga0068853_100432412 | 3300005539 | Bacteria | 1236 |
| 83 | Ga0070686_100692924 | 3300005544 | Bacteria | 812 |
| 84 | Ga0070695_101087897 | 3300005545 | Bacteria | 654 |
| 85 | Ga0070693_100114035 | 3300005547 | Bacteria | 1667 |
| 86 | Ga0070704_100614951 | 3300005549 | Bacteria | 956 |
| 87 | Ga0068855_100053589 | 3300005563 | Bacteria | 4745 |
| 88 | Ga0068855_100082115 | 3300005563 | Bacteria | 3735 |
| 89 | Ga0068855_100154532 | 3300005563 | Bacteria | 2607 |
| 90 | Ga0068855_100257749 | 3300005563 | Bacteria | 1944 |
| 91 | Ga0068855_100319842 | 3300005563 | Bacteria | 1715 |
| 92 | Ga0068855_100387402 | 3300005563 | Bacteria | 1534 |
| 93 | Ga0070664_100084847 | 3300005564 | Bacteria | 2734 |
| 94 | Ga0068857_100190853 | 3300005577 | Bacteria | 1866 |
| 95 | Ga0068854_100626946 | 3300005578 | Unclassified | 921 |
| 96 | Ga0068854_101444807 | 3300005578 | Bacteria | 623 |
| 97 | Ga0068856_100205773 | 3300005614 | Bacteria | 1983 |
| 98 | Ga0068856_100524503 | 3300005614 | Bacteria | 1206 |
| 99 | Ga0070702_100164620 | 3300005615 | Bacteria | 1437 |
| 100 | Ga0068852_100085427 | 3300005616 | Bacteria | 2811 |
| 101 | Ga0068852_100507384 | 3300005616 | Bacteria | 1202 |
| 102 | Ga0068852_101275939 | 3300005616 | Bacteria | 756 |
| 103 | Ga0081455_10153812 | 3300005937 | Bacteria | 1771 |
| 104 | Ga0081540_1001437 | 3300005983 | Bacteria | 20597 |
| 105 | Ga0070717_10042554 | 3300006028 | Bacteria | 3704 |
| 106 | Ga0070717_10051491 | 3300006028 | Bacteria | 3389 |
| 107 | Ga0070717_10189716 | 3300006028 | Bacteria | 1795 |
| 108 | Ga0070716_100073637 | 3300006173 | Bacteria | 2015 |
| 109 | Ga0070712_100333918 | 3300006175 | Bacteria | 1236 |
| 110 | Ga0070712_101465745 | 3300006175 | Unclassified | 596 |
| 111 | Ga0068871_100441854 | 3300006358 | Unclassified | 1165 |
| 112 | Ga0075434_100120407 | 3300006871 | Bacteria | 2639 |
| 113 | Ga0075434_100615746 | 3300006871 | Bacteria | 1105 |
| 114 | Ga0068865_100762004 | 3300006881 | Bacteria | 832 |
| 115 | Ga0075435_100252786 | 3300007076 | Bacteria | 1500 |
| 116 | Ga0099795_10187765 | 3300007788 | Unclassified | 866 |
| 117 | Ga0105240_10094365 | 3300009093 | Bacteria | 3650 |
| 118 | Ga0105240_10094850 | 3300009093 | Bacteria | 3639 |
| 119 | Ga0105240_10387133 | 3300009093 | Bacteria | 1578 |
| 120 | Ga0105240_10494682 | 3300009093 | Bacteria | 1361 |
| 121 | Ga0105240_10575261 | 3300009093 | Bacteria | 1243 |
| 122 | Ga0105241_10974373 | 3300009174 | Bacteria | 792 |
| 123 | Ga0105242_10294270 | 3300009176 | Bacteria | 1479 |
| 124 | Ga0105237_10089672 | 3300009545 | Bacteria | 3064 |
| 125 | Ga0105237_10352693 | 3300009545 | Bacteria | 1476 |
| 126 | Ga0105238_10025346 | 3300009551 | Bacteria | 6045 |
| 127 | Ga0105238_10072795 | 3300009551 | Bacteria | 3431 |
| 128 | Ga0105238_11275432 | 3300009551 | Unclassified | 760 |
| 129 | Ga0105238_11426932 | 3300009551 | Bacteria | 720 |
| 130 | Ga0105239_10579694 | 3300010375 | Bacteria | 1279 |
| 131 | Ga0105239_10943751 | 3300010375 | Bacteria | 991 |
| 132 | Ga0105239_11346205 | 3300010375 | Bacteria | 824 |
| 133 | Ga0157373_10173665 | 3300013100 | Bacteria | 1516 |
| 134 | Ga0157373_10420728 | 3300013100 | Bacteria | 959 |
| 135 | Ga0157373_10572075 | 3300013100 | Bacteria | 821 |
| 136 | Ga0157373_10609918 | 3300013100 | Bacteria | 795 |
| 137 | Ga0157371_10409870 | 3300013102 | Bacteria | 992 |
| 138 | Ga0157370_10011371 | 3300013104 | Bacteria | 9319 |
| 139 | Ga0157370_10053323 | 3300013104 | Bacteria | 3857 |
| 140 | Ga0157370_10220551 | 3300013104 | Bacteria | 1756 |
| 141 | Ga0157370_10241583 | 3300013104 | Bacteria | 1671 |
| 142 | Ga0157370_10453590 | 3300013104 | Unclassified | 1179 |
| 143 | Ga0157370_11372124 | 3300013104 | Bacteria | 636 |
| 144 | Ga0157369_10002593 | 3300013105 | Bacteria | 21619 |
| 145 | Ga0157369_10006255 | 3300013105 | Bacteria | 13818 |
| 146 | Ga0157369_10010168 | 3300013105 | Bacteria | 10738 |
| 147 | Ga0157369_10105610 | 3300013105 | Bacteria | 2998 |
| 148 | Ga0157369_10319560 | 3300013105 | Bacteria | 1614 |
| 149 | Ga0157369_10338265 | 3300013105 | Bacteria | 1564 |
| 150 | Ga0157369_10440635 | 3300013105 | Bacteria | 1349 |
| 151 | Ga0157369_10940042 | 3300013105 | Bacteria | 886 |
| 152 | Ga0157374_10352657 | 3300013296 | Bacteria | 1462 |
| 153 | Ga0157374_10508769 | 3300013296 | Bacteria | 1209 |
| 154 | Ga0163162_10413130 | 3300013306 | Bacteria | 1482 |
| 155 | Ga0157372_10230491 | 3300013307 | Bacteria | 2147 |
| 156 | Ga0157372_10250625 | 3300013307 | Bacteria | 2055 |
| 157 | Ga0157372_10303686 | 3300013307 | Bacteria | 1857 |
| 158 | Ga0157372_10325043 | 3300013307 | Bacteria | 1791 |
| 159 | Ga0157372_10735821 | 3300013307 | Bacteria | 1147 |
| 160 | Ga0157372_11907927 | 3300013307 | Bacteria | 683 |
| 161 | Ga0182008_10032867 | 3300014497 | Bacteria | 2605 |
| 162 | Ga0182008_10219316 | 3300014497 | Unclassified | 973 |
| 163 | Ga0182008_10398173 | 3300014497 | Unclassified | 739 |
| 164 | Ga0182008_10906798 | 3300014497 | Bacteria | 519 |
| 165 | Ga0157377_10434968 | 3300014745 | Bacteria | 902 |
| 166 | Ga0182006_1017300 | 3300015261 | Bacteria | 3065 |
| 167 | Ga0182007_10312500 | 3300015262 | Bacteria | 580 |
| 168 | Ga0206356_10185361 | 3300020070 | Bacteria | 848 |
| 169 | Ga0206356_11545319 | 3300020070 | Bacteria | 1714 |
| 170 | Ga0206356_11895991 | 3300020070 | Bacteria | 1435 |
| 171 | Ga0206354_10165856 | 3300020081 | Bacteria | 1712 |
| 172 | Ga0206354_10313809 | 3300020081 | Bacteria | 2044 |
| 173 | Ga0206354_10821376 | 3300020081 | Bacteria | 690 |
| 174 | Ga0206354_11083035 | 3300020081 | Bacteria | 3662 |
| 175 | Ga0206353_10388633 | 3300020082 | Bacteria | 2351 |
| 176 | Ga0206353_10493334 | 3300020082 | Bacteria | 1891 |
| 177 | Ga0206353_10552674 | 3300020082 | Bacteria | 545 |
| 178 | Ga0206353_11280332 | 3300020082 | Bacteria | 10221 |
| 179 | Ga0206353_11965947 | 3300020082 | Bacteria | 8567 |
| 180 | Ga0213876_10111509 | 3300021384 | Bacteria | 1452 |
| 181 | Ga0224712_10356322 | 3300022467 | Bacteria | 692 |
| 182 | Ga0207692_10174767 | 3300025898 | Bacteria | 1247 |
| 183 | Ga0207647_10481093 | 3300025904 | Unclassified | 694 |
| 184 | Ga0207699_10403066 | 3300025906 | Bacteria | 974 |
| 185 | Ga0207705_10073327 | 3300025909 | Bacteria | 2483 |
| 186 | Ga0207705_10130217 | 3300025909 | Bacteria | 1872 |
| 187 | Ga0207705_10191441 | 3300025909 | Bacteria | 1547 |
| 188 | Ga0207705_10396450 | 3300025909 | Bacteria | 1067 |
| 189 | Ga0207707_10014872 | 3300025912 | Bacteria | 6777 |
| 190 | Ga0207707_10025282 | 3300025912 | Bacteria | 5195 |
| 191 | Ga0207707_10042631 | 3300025912 | Bacteria | 3959 |
| 192 | Ga0207707_10078418 | 3300025912 | Bacteria | 2884 |
| 193 | Ga0207707_10113747 | 3300025912 | Bacteria | 2365 |
| 194 | Ga0207707_10147276 | 3300025912 | Bacteria | 2059 |
| 195 | Ga0207707_10188368 | 3300025912 | Bacteria | 1800 |
| 196 | Ga0207707_10274339 | 3300025912 | Bacteria | 1461 |
| 197 | Ga0207707_10282352 | 3300025912 | Bacteria | 1438 |
| 198 | Ga0207707_10628853 | 3300025912 | Bacteria | 906 |
| 199 | Ga0207707_10701577 | 3300025912 | Bacteria | 849 |
| 200 | Ga0207707_11035012 | 3300025912 | Bacteria | 672 |
| 201 | Ga0207695_10145168 | 3300025913 | Bacteria | 2318 |
| 202 | Ga0207695_10288297 | 3300025913 | Bacteria | 1534 |
| 203 | Ga0207695_10296864 | 3300025913 | Bacteria | 1507 |
| 204 | Ga0207695_10958483 | 3300025913 | Bacteria | 735 |
| 205 | Ga0207671_10444108 | 3300025914 | Bacteria | 1033 |
| 206 | Ga0207671_10663981 | 3300025914 | Bacteria | 830 |
| 207 | Ga0207671_10694726 | 3300025914 | Bacteria | 809 |
| 208 | Ga0207693_10584036 | 3300025915 | Bacteria | 870 |
| 209 | Ga0207663_10382194 | 3300025916 | Bacteria | 1073 |
| 210 | Ga0207660_10004237 | 3300025917 | Bacteria | 9346 |
| 211 | Ga0207660_10037984 | 3300025917 | Bacteria | 3359 |
| 212 | Ga0207660_10040055 | 3300025917 | Bacteria | 3278 |
| 213 | Ga0207660_10094712 | 3300025917 | Bacteria | 2220 |
| 214 | Ga0207660_10243410 | 3300025917 | Bacteria | 1418 |
| 215 | Ga0207660_10478836 | 3300025917 | Bacteria | 1009 |
| 216 | Ga0207660_10742560 | 3300025917 | Unclassified | 801 |
| 217 | Ga0207660_11417178 | 3300025917 | Bacteria | 563 |
| 218 | Ga0207657_10000720 | 3300025919 | Bacteria | 35112 |
| 219 | Ga0207657_10000955 | 3300025919 | Bacteria | 30552 |
| 220 | Ga0207657_10006946 | 3300025919 | Bacteria | 11665 |
| 221 | Ga0207657_10007990 | 3300025919 | Bacteria | 10786 |
| 222 | Ga0207657_10091383 | 3300025919 | Bacteria | 2538 |
| 223 | Ga0207657_10179736 | 3300025919 | Unclassified | 1711 |
| 224 | Ga0207657_10394895 | 3300025919 | Bacteria | 1088 |
| 225 | Ga0207657_10424001 | 3300025919 | Bacteria | 1045 |
| 226 | Ga0207657_11165994 | 3300025919 | Bacteria | 587 |
| 227 | Ga0207649_10225204 | 3300025920 | Bacteria | 1338 |
| 228 | Ga0207652_10016505 | 3300025921 | Bacteria | 6031 |
| 229 | Ga0207652_10086457 | 3300025921 | Bacteria | 2749 |
| 230 | Ga0207652_10139930 | 3300025921 | Bacteria | 2164 |
| 231 | Ga0207652_10152469 | 3300025921 | Bacteria | 2070 |
| 232 | Ga0207652_10247271 | 3300025921 | Bacteria | 1608 |
| 233 | Ga0207652_10260939 | 3300025921 | Bacteria | 1563 |
| 234 | Ga0207652_10305870 | 3300025921 | Bacteria | 1435 |
| 235 | Ga0207652_10388838 | 3300025921 | Bacteria | 1259 |
| 236 | Ga0207652_10425623 | 3300025921 | Bacteria | 1197 |
| 237 | Ga0207652_10427452 | 3300025921 | Bacteria | 1194 |
| 238 | Ga0207652_10611272 | 3300025921 | Bacteria | 977 |
| 239 | Ga0207646_10001000 | 3300025922 | Bacteria | 36321 |
| 240 | Ga0207646_10425292 | 3300025922 | Bacteria | 1199 |
| 241 | Ga0207646_10676046 | 3300025922 | Bacteria | 924 |
| 242 | Ga0207694_10626895 | 3300025924 | Bacteria | 905 |
| 243 | Ga0207694_11007042 | 3300025924 | Unclassified | 705 |
| 244 | Ga0207700_10001789 | 3300025928 | Bacteria | 12201 |
| 245 | Ga0207664_10002169 | 3300025929 | Bacteria | 12917 |
| 246 | Ga0207664_10045501 | 3300025929 | Bacteria | 3442 |
| 247 | Ga0207664_10072920 | 3300025929 | Bacteria | 2769 |
| 248 | Ga0207664_10083336 | 3300025929 | Bacteria | 2606 |
| 249 | Ga0207664_10149933 | 3300025929 | Bacteria | 1980 |
| 250 | Ga0207664_10225175 | 3300025929 | Bacteria | 1628 |
| 251 | Ga0207664_10321485 | 3300025929 | Bacteria | 1365 |
| 252 | Ga0207664_11227587 | 3300025929 | Unclassified | 668 |
| 253 | Ga0207644_11117930 | 3300025931 | Unclassified | 662 |
| 254 | Ga0207690_10075567 | 3300025932 | Bacteria | 2337 |
| 255 | Ga0207690_10134066 | 3300025932 | Bacteria | 1816 |
| 256 | Ga0207690_10338214 | 3300025932 | Bacteria | 1187 |
| 257 | Ga0207690_10618152 | 3300025932 | Bacteria | 886 |
| 258 | Ga0207665_10510221 | 3300025939 | Bacteria | 930 |
| 259 | Ga0207711_10091712 | 3300025941 | Bacteria | 2672 |
| 260 | Ga0207661_10023507 | 3300025944 | Bacteria | 4658 |
| 261 | Ga0207661_10171110 | 3300025944 | Bacteria | 1891 |
| 262 | Ga0207661_10516455 | 3300025944 | Bacteria | 1092 |
| 263 | Ga0207661_11645028 | 3300025944 | Bacteria | 587 |
| 264 | Ga0207667_10222274 | 3300025949 | Bacteria | 1935 |
| 265 | Ga0207667_10251555 | 3300025949 | Bacteria | 1808 |
| 266 | Ga0207667_10401090 | 3300025949 | Bacteria | 1396 |
| 267 | Ga0207667_10950726 | 3300025949 | Bacteria | 849 |
| 268 | Ga0207667_11285479 | 3300025949 | Bacteria | 709 |
| 269 | Ga0207640_10249046 | 3300025981 | Bacteria | 1378 |
| 270 | Ga0207640_11103980 | 3300025981 | Bacteria | 702 |
| 271 | Ga0207677_10625668 | 3300026023 | Bacteria | 947 |
| 272 | Ga0207639_10078569 | 3300026041 | Bacteria | 2605 |
| 273 | Ga0207639_10225820 | 3300026041 | Bacteria | 1620 |
| 274 | Ga0207639_10705629 | 3300026041 | Bacteria | 936 |
| 275 | Ga0207639_10822666 | 3300026041 | Bacteria | 866 |
| 276 | Ga0207702_10349528 | 3300026078 | Bacteria | 1414 |
| 277 | Ga0207702_10453889 | 3300026078 | Bacteria | 1244 |
| 278 | Ga0207674_10226882 | 3300026116 | Bacteria | 1816 |
| 279 | Ga0207674_11272760 | 3300026116 | Bacteria | 705 |
| 280 | Ga0207698_10368327 | 3300026142 | Bacteria | 1363 |
| 281 | Ga0207698_11014847 | 3300026142 | Bacteria | 841 |
| 282 | Ga0265334_10021483 | 3300028573 | Bacteria | 2635 |
| 283 | Ga0265334_10117914 | 3300028573 | Bacteria | 950 |
| 284 | Ga0265318_10285019 | 3300028577 | Bacteria | 603 |
| 285 | Ga0265322_10154455 | 3300028654 | Bacteria | 656 |
| 286 | Ga0265336_10040979 | 3300028666 | Bacteria | 1416 |
| 287 | Ga0265336_10108407 | 3300028666 | Bacteria | 827 |
| 288 | Ga0265338_10001662 | 3300028800 | Bacteria | 35477 |
| 289 | Ga0265338_10002226 | 3300028800 | Bacteria | 29543 |
| 290 | Ga0265338_10006836 | 3300028800 | Bacteria | 14374 |
| 291 | Ga0265338_10008316 | 3300028800 | Bacteria | 12626 |
| 292 | Ga0265338_10036549 | 3300028800 | Bacteria | 4697 |
| 293 | Ga0265338_10896534 | 3300028800 | Bacteria | 604 |
| 294 | Ga0265324_10040746 | 3300029957 | Bacteria | 1608 |
| 295 | Ga0265324_10126306 | 3300029957 | Unclassified | 868 |
| 296 | Ga0265328_10129440 | 3300031239 | Unclassified | 944 |
| 297 | Ga0265320_10058039 | 3300031240 | Bacteria | 1854 |
| 298 | Ga0265325_10166963 | 3300031241 | Bacteria | 1032 |
| 299 | Ga0265325_10231476 | 3300031241 | Bacteria | 842 |
| 300 | Ga0265339_10002685 | 3300031249 | Bacteria | 12646 |
| 301 | Ga0265331_10016554 | 3300031250 | Bacteria | 3868 |
| 302 | Ga0265327_10037138 | 3300031251 | Bacteria | 2670 |
| 303 | Ga0265313_10024574 | 3300031595 | Bacteria | 3215 |
| 304 | Ga0265313_10057604 | 3300031595 | Bacteria | 1833 |
| 305 | Ga0307514_10186957 | 3300031649 | Bacteria | 1326 |
| 306 | Ga0265314_10004238 | 3300031711 | Bacteria | 13444 |
| 307 | Ga0265314_10078240 | 3300031711 | Bacteria | 2190 |
| 308 | Ga0265342_10037223 | 3300031712 | Bacteria | 2968 |
| 309 | Ga0265342_10269118 | 3300031712 | Bacteria | 905 |
| 310 | Ga0265342_10448586 | 3300031712 | Bacteria | 662 |
| 311 | Ga0373934_0244354 | 3300035086 | Bacteria | 742 |
| 312 | Ga0373944_0037645 | 3300035089 | Unclassified | 1483 |
| 313 | Ga0373936_0044645 | 3300035113 | Bacteria | 1783 |
| 314 | Ga0373957_0314175 | 3300035120 | Unclassified | 666 |
| 315 | Ga0373943_0009138 | 3300035170 | Bacteria | 4442 |
| 316 | Ga0373943_0649011 | 3300035170 | Bacteria | 624 |
| 317 | Ga0373946_0107068 | 3300035171 | Unclassified | 1261 |
| 318 | Ga0373955_0166830 | 3300035172 | Unclassified | 1302 |
| 319 | Ga0373955_0328362 | 3300035172 | Bacteria | 925 |
| 320 | Ga0316574_0191584 | 3300035398 | Bacteria | 1315 |
| 321 | Ga0373924_0181321 | 3300035410 | Bacteria | 927 |
| 322 | Ga0373924_0214452 | 3300035410 | Bacteria | 850 |
| 323 | Ga0373931_0291004 | 3300035691 | Bacteria | 1006 |
| 324 | Ga0373935_0057816 | 3300035692 | Bacteria | 2475 |
| 325 | Ga0373935_1507727 | 3300035692 | Bacteria | 503 |
| 326 | Ga0373927_0132814 | 3300035695 | Unclassified | 1627 |
| 327 | Ga0373933_0032033 | 3300035724 | Bacteria | 3054 |
| 328 | Ga0373933_0884975 | 3300035724 | Bacteria | 588 |
| 329 | Ga0373947_0046027 | 3300035725 | Bacteria | 2611 |
| 330 | Ga0373937_0000190 | 3300036401 | Bacteria | 60066 |
| 331 | Ga0373937_0159859 | 3300036401 | Bacteria | 2112 |
| 332 | Ga0373925_0028769 | 3300037068 | Bacteria | 4073 |
| 333 | Ga0395899_0046750 | 3300037312 | Bacteria | 3223 |
| 334 | Ga0395899_0067359 | 3300037312 | Bacteria | 2627 |
| 335 | Ga0395900_0024705 | 3300037418 | Bacteria | 6150 |
| 336 | Ga0395900_0031531 | 3300037418 | Bacteria | 5448 |
| 337 | Ga0395900_0093099 | 3300037418 | Bacteria | 3096 |
| 338 | Ga0395900_0094234 | 3300037418 | Bacteria | 3075 |
| 339 | Ga0395900_0233437 | 3300037418 | Bacteria | 1849 |
| 340 | Ga0395900_0434568 | 3300037418 | Bacteria | 1271 |
| 341 | Ga0395898_0006598 | 3300037466 | Bacteria | 12374 |
| 342 | Ga0395898_0019301 | 3300037466 | Bacteria | 6940 |
| 343 | Ga0395898_0238766 | 3300037466 | Bacteria | 1733 |
| 344 | Ga0395898_0303013 | 3300037466 | Bacteria | 1524 |
| 345 | Ga0395898_0389211 | 3300037466 | Bacteria | 1329 |
| 346 | Ga0395898_0496706 | 3300037466 | Bacteria | 1160 |
| 347 | Ga0395898_0712086 | 3300037466 | Unclassified | 946 |
| 348 | Ga0395898_0766477 | 3300037466 | Bacteria | 906 |
| 349 | Ga0395898_0915319 | 3300037466 | Unclassified | 815 |
| 350 | Ga0395898_1113346 | 3300037466 | Bacteria | 723 |
| 351 | Ga0395898_1123532 | 3300037466 | Bacteria | 719 |
| 352 | Ga0395898_1130164 | 3300037466 | Bacteria | 716 |
| 353 | Ga0395898_1708121 | 3300037466 | Bacteria | 552 |
| 354 | Ga0395905_0060791 | 3300037471 | Bacteria | 3533 |
| 355 | Ga0395905_0103717 | 3300037471 | Bacteria | 2670 |
| 356 | Ga0395905_0110330 | 3300037471 | Bacteria | 2583 |
| 357 | Ga0395905_0391902 | 3300037471 | Bacteria | 1283 |
| 358 | Ga0436364_0875471 | 3300037853 | Bacteria | 2534 |
| 359 | Ga0395901_0002302 | 3300038443 | Bacteria | 19465 |
| 360 | Ga0395901_0015081 | 3300038443 | Bacteria | 7860 |
| 361 | Ga0395901_0084990 | 3300038443 | Bacteria | 3307 |
| 362 | Ga0395901_0129007 | 3300038443 | Bacteria | 2658 |
| 363 | Ga0395901_0142897 | 3300038443 | Bacteria | 2515 |
| 364 | Ga0395901_0208300 | 3300038443 | Bacteria | 2047 |
| 365 | Ga0395901_0362595 | 3300038443 | Bacteria | 1494 |
| 366 | Ga0242420_046554 | 3300038996 | Bacteria | 839 |
| 367 | Ga0436365_0136550 | 3300039437 | Bacteria | 1031 |
| 368 | Ga0436365_1856328 | 3300039437 | Bacteria | 1126 |
| 369 | Ga0436360_0278534 | 3300039438 | Bacteria | 1463 |
| 370 | Ga0436363_1348721 | 3300039450 | Bacteria | 792 |
| 371 | Ga0436363_1400617 | 3300039450 | Bacteria | 4754 |
| 372 | Ga0436362_0941157 | 3300039453 | Bacteria | 555 |
| 373 | Ga0439448_0219924 | 3300042005 | Bacteria | 668 |
| 374 | Ga0439459_0018949 | 3300042438 | Bacteria | 1299 |
| 375 | Ga0466969_0010551 | 3300044656 | Bacteria | 4895 |
| 376 | Ga0466969_0066414 | 3300044656 | Bacteria | 1741 |
| 377 | Ga0466969_0183616 | 3300044656 | Unclassified | 957 |
| 378 | Ga0466972_0467698 | 3300044658 | Bacteria | 593 |
| 379 | Ga0466965_0019898 | 3300044683 | Bacteria | 3223 |
| 380 | Ga0466965_0026307 | 3300044683 | Bacteria | 2821 |
| 381 | Ga0466965_0075263 | 3300044683 | Bacteria | 1702 |
| 382 | Ga0466965_0086555 | 3300044683 | Unclassified | 1590 |
| 383 | Ga0466966_0007140 | 3300044684 | Bacteria | 7404 |
| 384 | Ga0466966_0010902 | 3300044684 | Bacteria | 6035 |
| 385 | Ga0466966_0030525 | 3300044684 | Bacteria | 3499 |
| 386 | Ga0466966_0035884 | 3300044684 | Bacteria | 3202 |
| 387 | Ga0466966_0200908 | 3300044684 | Unclassified | 1206 |
| 388 | Ga0466966_0203818 | 3300044684 | Unclassified | 1196 |
| 389 | Ga0466966_0220896 | 3300044684 | Bacteria | 1144 |
| 390 | Ga0466961_0005623 | 3300044693 | Bacteria | 7919 |
| 391 | Ga0466961_0008544 | 3300044693 | Bacteria | 6524 |
| 392 | Ga0466961_0012723 | 3300044693 | Bacteria | 5388 |
| 393 | Ga0466961_0015263 | 3300044693 | Bacteria | 4933 |
| 394 | Ga0466961_0018241 | 3300044693 | Bacteria | 4511 |
| 395 | Ga0466961_0083376 | 3300044693 | Unclassified | 2022 |
| 396 | Ga0466961_0094140 | 3300044693 | Bacteria | 1890 |
| 397 | Ga0466961_0264014 | 3300044693 | Bacteria | 1055 |
| 398 | Ga0466963_0000389 | 3300044694 | Bacteria | 20047 |
| 399 | Ga0466963_0000536 | 3300044694 | Bacteria | 17838 |
| 400 | Ga0466963_0000646 | 3300044694 | Bacteria | 16751 |
| 401 | Ga0466963_0000987 | 3300044694 | Bacteria | 14655 |
| 402 | Ga0466963_0001204 | 3300044694 | Bacteria | 13617 |
| 403 | Ga0466963_0009428 | 3300044694 | Bacteria | 5879 |
| 404 | Ga0466963_0010406 | 3300044694 | Bacteria | 5630 |
| 405 | Ga0466963_0022999 | 3300044694 | Bacteria | 3953 |
| 406 | Ga0466963_0033569 | 3300044694 | Bacteria | 3333 |
| 407 | Ga0466963_0035769 | 3300044694 | Bacteria | 3236 |
| 408 | Ga0466963_0039599 | 3300044694 | Bacteria | 3087 |
| 409 | Ga0466963_0045483 | 3300044694 | Bacteria | 2891 |
| 410 | Ga0466963_0084258 | 3300044694 | Unclassified | 2156 |
| 411 | Ga0466963_0189371 | 3300044694 | Bacteria | 1437 |
| 412 | Ga0466963_0258659 | 3300044694 | Unclassified | 1222 |
| 413 | Ga0466963_0449536 | 3300044694 | Bacteria | 909 |
| 414 | Ga0466963_0879769 | 3300044694 | Unclassified | 631 |
| 415 | Ga0466964_0005925 | 3300044706 | Bacteria | 4551 |
| 416 | Ga0466964_0006306 | 3300044706 | Bacteria | 4416 |
| 417 | Ga0466964_0010741 | 3300044706 | Bacteria | 3458 |
| 418 | Ga0466964_0016463 | 3300044706 | Bacteria | 2824 |
| 419 | Ga0466964_0036286 | 3300044706 | Unclassified | 1976 |
| 420 | Ga0466964_0067086 | 3300044706 | Bacteria | 1507 |
| 421 | Ga0466964_0092438 | 3300044706 | Bacteria | 1319 |
| 422 | Ga0466964_0212361 | 3300044706 | Bacteria | 935 |
| 423 | Ga0466964_0464442 | 3300044706 | Bacteria | 674 |
| 424 | Ga0466971_0001797 | 3300044719 | Bacteria | 9099 |
| 425 | Ga0466971_0003174 | 3300044719 | Bacteria | 7009 |
| 426 | Ga0466971_0004890 | 3300044719 | Bacteria | 5793 |
| 427 | Ga0466971_0008423 | 3300044719 | Bacteria | 4499 |
| 428 | Ga0466971_0107427 | 3300044719 | Bacteria | 1286 |
| 429 | Ga0466968_0003025 | 3300044735 | Bacteria | 6208 |
| 430 | Ga0466968_0009757 | 3300044735 | Bacteria | 3703 |
| 431 | Ga0466968_0010237 | 3300044735 | Unclassified | 3631 |
| 432 | Ga0466968_0219322 | 3300044735 | Unclassified | 895 |
| 433 | Ga0466968_0354428 | 3300044735 | Bacteria | 713 |
| 434 | Ga0466968_0557156 | 3300044735 | Bacteria | 576 |
| 435 | Ga0466970_0004839 | 3300044765 | Bacteria | 6644 |
| 436 | Ga0466970_0048010 | 3300044765 | Bacteria | 2276 |
| 437 | Ga0466970_0211809 | 3300044765 | Unclassified | 1080 |
| 438 | Ga0466970_0491093 | 3300044765 | Bacteria | 706 |
| 439 | Ga0466957_0000947 | 3300044842 | Bacteria | 14875 |
| 440 | Ga0466957_0002364 | 3300044842 | Bacteria | 10124 |
| 441 | Ga0466957_0002391 | 3300044842 | Bacteria | 10075 |
| 442 | Ga0466957_0012995 | 3300044842 | Bacteria | 4824 |
| 443 | Ga0466957_0013632 | 3300044842 | Bacteria | 4717 |
| 444 | Ga0466957_0018104 | 3300044842 | Bacteria | 4132 |
| 445 | Ga0466957_0038551 | 3300044842 | Bacteria | 2879 |
| 446 | Ga0466957_0166372 | 3300044842 | Bacteria | 1434 |
| 447 | Ga0466957_0277618 | 3300044842 | Unclassified | 1120 |
| 448 | Ga0466957_0319215 | 3300044842 | Bacteria | 1048 |
| 449 | Ga0466957_0441346 | 3300044842 | Bacteria | 896 |
| 450 | Ga0466960_0008699 | 3300044901 | Bacteria | 4165 |
| 451 | Ga0466960_0051086 | 3300044901 | Bacteria | 1996 |
| 452 | Ga0466959_0000796 | 3300045049 | Bacteria | 18577 |
| 453 | Ga0466959_0002167 | 3300045049 | Bacteria | 12476 |
| 454 | Ga0466959_0008103 | 3300045049 | Bacteria | 7411 |
| 455 | Ga0466959_0013386 | 3300045049 | Bacteria | 5947 |
| 456 | Ga0466959_0019126 | 3300045049 | Bacteria | 5035 |
| 457 | Ga0466959_0020545 | 3300045049 | Bacteria | 4867 |
| 458 | Ga0466959_0031041 | 3300045049 | Bacteria | 3954 |
| 459 | Ga0466959_0171170 | 3300045049 | Unclassified | 1523 |
| 460 | Ga0466959_0174340 | 3300045049 | Bacteria | 1507 |
| 461 | Ga0451576_2074978 | 3300045051 | Bacteria | 585 |
| 462 | Ga0466958_0000599 | 3300045836 | Bacteria | 15371 |
| 463 | Ga0466958_0001043 | 3300045836 | Bacteria | 12674 |
| 464 | Ga0466958_0002334 | 3300045836 | Bacteria | 9479 |
| 465 | Ga0466958_0004076 | 3300045836 | Bacteria | 7667 |
| 466 | Ga0466958_0009390 | 3300045836 | Bacteria | 5450 |
| 467 | Ga0466958_0010965 | 3300045836 | Bacteria | 5093 |
| 468 | Ga0466958_0011716 | 3300045836 | Bacteria | 4947 |
| 469 | Ga0466958_0023140 | 3300045836 | Bacteria | 3644 |
| 470 | Ga0466958_0045953 | 3300045836 | Bacteria | 2634 |
| 471 | Ga0466958_0089461 | 3300045836 | Bacteria | 1904 |
| 472 | Ga0466958_0117350 | 3300045836 | Bacteria | 1664 |
| 473 | Ga0466958_0240540 | 3300045836 | Bacteria | 1157 |
| 474 | Ga0466958_0257285 | 3300045836 | Unclassified | 1117 |
| 475 | Ga0466958_0397757 | 3300045836 | Bacteria | 889 |
| 476 | Ga0466967_0000395 | 3300045976 | Bacteria | 20401 |
| 477 | Ga0466967_0001125 | 3300045976 | Bacteria | 14868 |
| 478 | Ga0466967_0001753 | 3300045976 | Bacteria | 12956 |
| 479 | Ga0466967_0002130 | 3300045976 | Bacteria | 12131 |
| 480 | Ga0466967_0002773 | 3300045976 | Bacteria | 11095 |
| 481 | Ga0466967_0002845 | 3300045976 | Bacteria | 10989 |
| 482 | Ga0466967_0003863 | 3300045976 | Bacteria | 9925 |
| 483 | Ga0466967_0005312 | 3300045976 | Bacteria | 8895 |
| 484 | Ga0466967_0011526 | 3300045976 | Bacteria | 6703 |
| 485 | Ga0466967_0012287 | 3300045976 | Bacteria | 6541 |
| 486 | Ga0466967_0016445 | 3300045976 | Bacteria | 5834 |
| 487 | Ga0466967_0022345 | 3300045976 | Bacteria | 5158 |
| 488 | Ga0466967_0027115 | 3300045976 | Bacteria | 4760 |
| 489 | Ga0466967_0034000 | 3300045976 | Bacteria | 4321 |
| 490 | Ga0466967_0036327 | 3300045976 | Bacteria | 4204 |
| 491 | Ga0466967_0047088 | 3300045976 | Bacteria | 3758 |
| 492 | Ga0466967_0048177 | 3300045976 | Bacteria | 3720 |
| 493 | Ga0466967_0060464 | 3300045976 | Bacteria | 3357 |
| 494 | Ga0466967_0063287 | 3300045976 | Bacteria | 3286 |
| 495 | Ga0466967_0063632 | 3300045976 | Bacteria | 3278 |
| 496 | Ga0466967_0068591 | 3300045976 | Bacteria | 3167 |
| 497 | Ga0466967_0094219 | 3300045976 | Bacteria | 2726 |
| 498 | Ga0466967_0138305 | 3300045976 | Bacteria | 2266 |
| 499 | Ga0466967_0159282 | 3300045976 | Bacteria | 2117 |
| 500 | Ga0466967_0170326 | 3300045976 | Bacteria | 2048 |
| 501 | Ga0466967_0203975 | 3300045976 | Bacteria | 1873 |
| 502 | Ga0466967_0277763 | 3300045976 | Bacteria | 1606 |
| 503 | Ga0466967_0289025 | 3300045976 | Bacteria | 1574 |
| 504 | Ga0466967_1176877 | 3300045976 | Bacteria | 764 |
| 505 | Ga0466967_1195619 | 3300045976 | Unclassified | 757 |
| 506 | Ga0466967_1319235 | 3300045976 | Bacteria | 719 |
| 507 | Ga0466967_1328142 | 3300045976 | Bacteria | 716 |
| 508 | Ga0495592_0000206 | 3300046454 | Bacteria | 50513 |
| 509 | Ga0495592_0094507 | 3300046454 | Bacteria | 2140 |
| 510 | Ga0495592_0376106 | 3300046454 | Bacteria | 905 |
| 511 | Ga0495603_0077848 | 3300046455 | Bacteria | 1945 |
| 512 | Ga0495629_0035063 | 3300046459 | Bacteria | 3547 |
| 513 | Ga0495629_0040717 | 3300046459 | Bacteria | 3269 |
| 514 | Ga0495629_0057556 | 3300046459 | Bacteria | 2718 |
| 515 | Ga0495629_0362341 | 3300046459 | Unclassified | 988 |
| 516 | Ga0495641_0019548 | 3300046461 | Bacteria | 3462 |
| 517 | Ga0495641_0032718 | 3300046461 | Bacteria | 2473 |
| 518 | Ga0495641_0095510 | 3300046461 | Unclassified | 1327 |
| 519 | Ga0495651_0000053 | 3300046462 | Bacteria | 85191 |
| 520 | Ga0495651_0031919 | 3300046462 | Bacteria | 4107 |
| 521 | Ga0495651_0284378 | 3300046462 | Bacteria | 1116 |
| 522 | Ga0495653_0010133 | 3300046463 | Bacteria | 7712 |
| 523 | Ga0495653_0047410 | 3300046463 | Bacteria | 3323 |
| 524 | Ga0495653_0051498 | 3300046463 | Bacteria | 3161 |
| 525 | Ga0495653_0208985 | 3300046463 | Bacteria | 1319 |
| 526 | Ga0495582_0316368 | 3300046473 | Bacteria | 898 |
| 527 | Ga0495582_0374088 | 3300046473 | Unclassified | 821 |
| 528 | Ga0495605_0056718 | 3300046474 | Bacteria | 1888 |
| 529 | Ga0495664_0030198 | 3300046477 | Bacteria | 3174 |
| 530 | Ga0495664_0288888 | 3300046477 | Bacteria | 990 |
| 531 | Ga0495584_0553400 | 3300046491 | Bacteria | 586 |
| 532 | Ga0495596_0067474 | 3300046500 | Bacteria | 1390 |
| 533 | Ga0495608_0001922 | 3300046511 | Bacteria | 14905 |
| 534 | Ga0495608_0002448 | 3300046511 | Bacteria | 13326 |
| 535 | Ga0495608_0025739 | 3300046511 | Bacteria | 4017 |
| 536 | Ga0495608_0331661 | 3300046511 | Bacteria | 938 |
| 537 | Ga0495608_0755572 | 3300046511 | Bacteria | 576 |
| 538 | Ga0495618_0003117 | 3300046514 | Bacteria | 10442 |
| 539 | Ga0495628_0000047 | 3300046516 | Bacteria | 97852 |
| 540 | Ga0495628_0032030 | 3300046516 | Bacteria | 4248 |
| 541 | Ga0495628_0042540 | 3300046516 | Bacteria | 3623 |
| 542 | Ga0495628_0216190 | 3300046516 | Bacteria | 1441 |
| 543 | Ga0495628_0227221 | 3300046516 | Bacteria | 1400 |
| 544 | Ga0495630_0091740 | 3300046517 | Bacteria | 2295 |
| 545 | Ga0495630_0096274 | 3300046517 | Bacteria | 2238 |
| 546 | Ga0495630_0143645 | 3300046517 | Bacteria | 1814 |
| 547 | Ga0495644_0005238 | 3300046523 | Bacteria | 5070 |
| 548 | Ga0495652_0000291 | 3300046529 | Bacteria | 59608 |
| 549 | Ga0495652_0120717 | 3300046529 | Bacteria | 2091 |
| 550 | Ga0495652_0254512 | 3300046529 | Unclassified | 1299 |
| 551 | Ga0495665_0342979 | 3300046531 | Bacteria | 761 |
| 552 | Ga0495640_0001210 | 3300046533 | Bacteria | 20182 |
| 553 | Ga0495640_0047625 | 3300046533 | Bacteria | 2966 |
| 554 | Ga0495640_0184872 | 3300046533 | Bacteria | 1327 |
| 555 | Ga0495640_0246664 | 3300046533 | Bacteria | 1120 |
| 556 | Ga0495640_0344747 | 3300046533 | Unclassified | 920 |
| 557 | Ga0495586_0098154 | 3300046535 | Bacteria | 1624 |
| 558 | Ga0495587_0000756 | 3300046536 | Bacteria | 21566 |
| 559 | Ga0495587_0379113 | 3300046536 | Bacteria | 787 |
| 560 | Ga0495645_0000302 | 3300046543 | Bacteria | 35690 |
| 561 | Ga0495645_0031725 | 3300046543 | Bacteria | 3850 |
| 562 | Ga0495645_0212401 | 3300046543 | Bacteria | 1306 |
| 563 | Ga0495667_0006046 | 3300046559 | Bacteria | 8189 |
| 564 | Ga0495667_0019331 | 3300046559 | Bacteria | 4597 |
| 565 | Ga0495667_0028587 | 3300046559 | Bacteria | 3755 |
| 566 | Ga0495667_0060064 | 3300046559 | Bacteria | 2494 |
| 567 | Ga0495656_0003852 | 3300046615 | Bacteria | 5104 |
| 568 | Ga0495634_0072730 | 3300046642 | Bacteria | 2261 |
| 569 | Ga0495634_0075330 | 3300046642 | Bacteria | 2216 |
| 570 | Ga0495634_0160802 | 3300046642 | Bacteria | 1416 |
| 571 | Ga0495611_0029625 | 3300046648 | Bacteria | 2401 |
| 572 | Ga0495635_0002779 | 3300046663 | Bacteria | 11999 |
| 573 | Ga0495635_0008171 | 3300046663 | Bacteria | 7308 |
| 574 | Ga0495635_0521423 | 3300046663 | Bacteria | 781 |
| 575 | Ga0495635_1012730 | 3300046663 | Bacteria | 528 |
| 576 | Ga0495661_0053493 | 3300046665 | Bacteria | 2428 |
| 577 | Ga0495588_0025372 | 3300046674 | Bacteria | 2953 |
| 578 | Ga0495657_0016979 | 3300046675 | Bacteria | 5291 |
| 579 | Ga0495657_0027854 | 3300046675 | Bacteria | 3980 |
| 580 | Ga0495657_0068851 | 3300046675 | Bacteria | 2317 |
| 581 | Ga0495657_0157915 | 3300046675 | Bacteria | 1404 |
| 582 | Ga0495599_0000063 | 3300046678 | Bacteria | 73690 |
| 583 | Ga0495599_0082769 | 3300046678 | Unclassified | 2004 |
| 584 | Ga0495599_0123388 | 3300046678 | Bacteria | 1610 |
| 585 | Ga0495623_0000132 | 3300046679 | Bacteria | 45369 |
| 586 | Ga0495623_0308072 | 3300046679 | Bacteria | 873 |
| 587 | Ga0495646_0000560 | 3300046680 | Bacteria | 20144 |
| 588 | Ga0495646_0126102 | 3300046680 | Bacteria | 1445 |
| 589 | Ga0495646_0142829 | 3300046680 | Bacteria | 1337 |
| 590 | Ga0495646_0520839 | 3300046680 | Bacteria | 609 |
| 591 | Ga0495647_0478754 | 3300046681 | Bacteria | 578 |
| 592 | Ga0495658_0012623 | 3300046683 | Bacteria | 4286 |
| 593 | Ga0495613_0016285 | 3300046689 | Bacteria | 5540 |
| 594 | Ga0495613_0137256 | 3300046689 | Bacteria | 1749 |
| 595 | Ga0495613_0193218 | 3300046689 | Bacteria | 1438 |
| 596 | Ga0495613_0225300 | 3300046689 | Bacteria | 1315 |
| 597 | Ga0495613_0427562 | 3300046689 | Bacteria | 900 |
| 598 | Ga0495613_0654653 | 3300046689 | Bacteria | 695 |
| 599 | Ga0495624_0141217 | 3300046690 | Bacteria | 1475 |
| 600 | Ga0495624_0373003 | 3300046690 | Bacteria | 858 |
| 601 | Ga0495670_0037409 | 3300046691 | Bacteria | 2419 |
| 602 | Ga0495600_0094858 | 3300046809 | Bacteria | 1945 |
| 603 | Ga0495600_0114641 | 3300046809 | Bacteria | 1755 |
| 604 | Ga0495600_0136123 | 3300046809 | Bacteria | 1596 |
| 605 | Ga0495581_0081804 | 3300047315 | Bacteria | 1870 |
| 606 | Ga0495581_0114935 | 3300047315 | Bacteria | 1565 |
| 607 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 608 | Ga0495604_0267489 | 3300047317 | Bacteria | 1159 |
| 609 | Ga0495674_0001271 | 3300047319 | Bacteria | 24493 |
| 610 | Ga0495674_0129177 | 3300047319 | Bacteria | 2130 |
| 611 | Ga0495674_1017115 | 3300047319 | Bacteria | 634 |
| 612 | Ga0495676_0083443 | 3300047321 | Bacteria | 2415 |
| 613 | Ga0495676_0198533 | 3300047321 | Bacteria | 1395 |
| 614 | Ga0495680_0001616 | 3300047322 | Bacteria | 23967 |
| 615 | Ga0495680_0012878 | 3300047322 | Bacteria | 7329 |
| 616 | Ga0495680_0032756 | 3300047322 | Bacteria | 4215 |
| 617 | Ga0495680_0055468 | 3300047322 | Bacteria | 3074 |
| 618 | Ga0495680_0062600 | 3300047322 | Bacteria | 2860 |
| 619 | Ga0495680_0063361 | 3300047322 | Bacteria | 2839 |
| 620 | Ga0495680_0220462 | 3300047322 | Bacteria | 1354 |
| 621 | Ga0495675_0000075 | 3300047444 | Bacteria | 69347 |
| 622 | Ga0495675_0259631 | 3300047444 | Bacteria | 1041 |
| 623 | Ga0495675_0575119 | 3300047444 | Bacteria | 641 |
| 624 | Ga0495675_0627403 | 3300047444 | Bacteria | 607 |
| 625 | Ga0495679_201233 | 3300047446 | Bacteria | 524 |
| 626 | Ga0495685_025396 | 3300047447 | Bacteria | 2038 |
| 627 | Ga0495684_0018019 | 3300047471 | Bacteria | 5441 |
| 628 | Ga0495684_0027348 | 3300047471 | Bacteria | 4379 |
| 629 | Ga0495684_0083626 | 3300047471 | Bacteria | 2421 |
| 630 | Ga0495602_0000524 | 3300048088 | Bacteria | 35765 |
| 631 | Ga0495602_0063973 | 3300048088 | Bacteria | 3184 |
| 632 | Ga0495602_0510892 | 3300048088 | Unclassified | 838 |
| 633 | Ga0496100_1310325 | 3300048903 | Bacteria | 571 |
| 634 | Ga0496101_0191657 | 3300048904 | Bacteria | 1578 |
| 635 | Ga0496101_0352271 | 3300048904 | Bacteria | 1157 |
| 636 | Ga0496101_0558280 | 3300048904 | Bacteria | 905 |
| 637 | Ga0496102_0048878 | 3300048905 | Bacteria | 3847 |
| 638 | Ga0496102_1711394 | 3300048905 | Bacteria | 547 |
| 639 | Ga0496103_0051633 | 3300048906 | Bacteria | 2545 |
| 640 | Ga0496103_0172765 | 3300048906 | Bacteria | 1388 |
| 641 | Ga0496103_0403927 | 3300048906 | Bacteria | 878 |
| 642 | Ga0496104_0135574 | 3300048907 | Bacteria | 2365 |
| 643 | Ga0496104_0148113 | 3300048907 | Bacteria | 2254 |
| 644 | Ga0496104_0179327 | 3300048907 | Bacteria | 2028 |
| 645 | Ga0496104_0569726 | 3300048907 | Bacteria | 1043 |
| 646 | Ga0496104_0897202 | 3300048907 | Bacteria | 791 |
| 647 | Ga0496104_1082675 | 3300048907 | Bacteria | 705 |
| 648 | Ga0496105_0005550 | 3300048908 | Bacteria | 9578 |
| 649 | Ga0496105_0070166 | 3300048908 | Bacteria | 2896 |
| 650 | Ga0496105_0073434 | 3300048908 | Bacteria | 2826 |
| 651 | Ga0496106_0022205 | 3300048909 | Bacteria | 4713 |
| 652 | Ga0496107_0004648 | 3300048910 | Bacteria | 9312 |
| 653 | Ga0496107_1262545 | 3300048910 | Bacteria | 529 |
| 654 | Ga0496108_0610387 | 3300048911 | Unclassified | 950 |
| 655 | Ga0496109_0014835 | 3300048912 | Bacteria | 6780 |
| 656 | Ga0496109_0020587 | 3300048912 | Bacteria | 5827 |
| 657 | Ga0496109_0586192 | 3300048912 | Bacteria | 1051 |
| 658 | Ga0496109_1131024 | 3300048912 | Bacteria | 720 |
| 659 | Ga0496109_1709296 | 3300048912 | Bacteria | 563 |
| 660 | Ga0496110_0013272 | 3300048913 | Bacteria | 6803 |
| 661 | Ga0496110_0302492 | 3300048913 | Bacteria | 1457 |
| 662 | Ga0496110_0375835 | 3300048913 | Bacteria | 1295 |
| 663 | Ga0496110_0914181 | 3300048913 | Bacteria | 784 |
| 664 | Ga0496110_1231809 | 3300048913 | Archaea | 657 |
| 665 | Ga0496111_0021624 | 3300048914 | Bacteria | 4496 |
| 666 | Ga0496111_0078907 | 3300048914 | Bacteria | 2401 |
| 667 | Ga0496112_0001247 | 3300048915 | Bacteria | 19238 |
| 668 | Ga0496112_0002913 | 3300048915 | Bacteria | 13932 |
| 669 | Ga0496112_0040803 | 3300048915 | Bacteria | 4538 |
| 670 | Ga0496112_0129597 | 3300048915 | Bacteria | 2493 |
| 671 | Ga0496112_0193860 | 3300048915 | Bacteria | 1993 |
| 672 | Ga0496112_0283866 | 3300048915 | Bacteria | 1602 |
| 673 | Ga0496112_0300397 | 3300048915 | Bacteria | 1551 |
| 674 | Ga0496112_0309386 | 3300048915 | Bacteria | 1525 |
| 675 | Ga0496112_0800204 | 3300048915 | Bacteria | 867 |
| 676 | Ga0496113_0036399 | 3300048916 | Bacteria | 3606 |
| 677 | Ga0496113_0318612 | 3300048916 | Bacteria | 1246 |
| 678 | Ga0496113_0484512 | 3300048916 | Bacteria | 993 |
| 679 | Ga0496113_0759849 | 3300048916 | Bacteria | 771 |
| 680 | Ga0496113_0932976 | 3300048916 | Bacteria | 686 |
| 681 | Ga0496114_0325666 | 3300048917 | Bacteria | 1358 |
| 682 | Ga0496114_0369586 | 3300048917 | Bacteria | 1269 |
| 683 | Ga0496115_0048290 | 3300048918 | Bacteria | 3404 |
| 684 | Ga0496115_0158585 | 3300048918 | Bacteria | 1869 |
| 685 | Ga0501034_0050008 | 3300049571 | Bacteria | 4217 |
| 686 | Ga0501043_0161143 | 3300049579 | Bacteria | 1753 |
| 687 | Ga0501047_0029619 | 3300049581 | Bacteria | 5278 |
| 688 | Ga0501047_0835616 | 3300049581 | Bacteria | 735 |
| 689 | Ga0501067_0000403 | 3300049583 | Bacteria | 23610 |
| 690 | Ga0501067_0134806 | 3300049583 | Bacteria | 1375 |
| 691 | Ga0501067_0153624 | 3300049583 | Bacteria | 1282 |
| 692 | Ga0501069_0034071 | 3300049585 | Bacteria | 2805 |
| 693 | Ga0501069_0638108 | 3300049585 | Bacteria | 640 |
| 694 | Ga0501069_0807209 | 3300049585 | Bacteria | 569 |
| 695 | Ga0501070_0003902 | 3300049586 | Bacteria | 12865 |
| 696 | Ga0501070_0004537 | 3300049586 | Bacteria | 11919 |
| 697 | Ga0501072_0009358 | 3300049588 | Bacteria | 7448 |
| 698 | Ga0501073_0280516 | 3300049589 | Bacteria | 1150 |
| 699 | Ga0501074_0111891 | 3300049590 | Bacteria | 1953 |
| 700 | Ga0501074_0371078 | 3300049590 | Bacteria | 1015 |
| 701 | Ga0501074_0687067 | 3300049590 | Bacteria | 722 |
| 702 | Ga0501079_0052892 | 3300049741 | Bacteria | 3133 |
| 703 | Ga0501079_0284834 | 3300049741 | Bacteria | 1292 |
| 704 | Ga0501079_0820787 | 3300049741 | Bacteria | 732 |
| 705 | Ga0501080_0012183 | 3300049742 | Bacteria | 7878 |
| 706 | Ga0501080_0100307 | 3300049742 | Bacteria | 2686 |
| 707 | Ga0501080_0642645 | 3300049742 | Bacteria | 939 |
| 708 | Ga0501083_0000684 | 3300049744 | Bacteria | 22083 |
| 709 | Ga0501035_0336047 | 3300049822 | Bacteria | 1267 |
| 710 | nmdc:mga05p37_2189999_c1 | 3300050507 | Unclassified | 514 |
| 711 | nmdc:mga0n895_1195826_c1 | 3300050512 | Unclassified | 734 |
| 712 | nmdc:mga0n895_564008_c1 | 3300050512 | Bacteria | 1144 |
| 713 | nmdc:mga0rr50_2179_c1 | 3300050513 | Bacteria | 10969 |
| 714 | nmdc:mga0rr50_278227_c1 | 3300050513 | Bacteria | 1396 |
| 715 | Ga0495601_0001003 | 3300053077 | Bacteria | 15450 |
| 716 | Ga0495601_0315447 | 3300053077 | Bacteria | 1018 |
| 717 | Ga0495655_0054638 | 3300053083 | Bacteria | 1069 |
| 718 | Ga0495595_0063080 | 3300053084 | Unclassified | 1739 |
| 719 | Ga0495595_0086311 | 3300053084 | Bacteria | 1501 |
| 720 | Ga0495595_0325777 | 3300053084 | Bacteria | 774 |
| 721 | Ga0495619_0002217 | 3300053085 | Bacteria | 12867 |
| 722 | Ga0495619_0015118 | 3300053085 | Bacteria | 4879 |
| 723 | Ga0495619_0047658 | 3300053085 | Bacteria | 2822 |
| 724 | Ga0495619_0100288 | 3300053085 | Bacteria | 1970 |
| 725 | Ga0495619_0259058 | 3300053085 | Unclassified | 1205 |
| 726 | Ga0500616_0014064 | 3300053153 | Bacteria | 4614 |
| 727 | Ga0501084_0200645 | 3300054114 | Bacteria | 1683 |
| 728 | Ga0501082_1064225 | 3300060353 | Bacteria | 707 |
| 729 | Ga0466962_0000178 | 3300061719 | Bacteria | 26342 |
| 730 | Ga0466962_0011490 | 3300061719 | Bacteria | 4263 |
| 731 | Ga0466962_0028387 | 3300061719 | Bacteria | 2681 |
| 732 | Ga0466962_0032266 | 3300061719 | Bacteria | 2507 |
| 733 | Ga0466962_0035367 | 3300061719 | Bacteria | 2391 |
| 734 | Ga0466962_0245712 | 3300061719 | Unclassified | 879 |
| 735 | Ga0466964_0235746 | |||
| 736 | Ga0070658_10135083 | |||
| 737 | Ga0070658_10206498 | |||
| 738 | Ga0070658_10210449 | |||
| 739 | Ga0070683_100007834 | |||
| 740 | Ga0070683_100032507 | |||
| 741 | Ga0070683_100034870 | |||
| 742 | Ga0070683_100119713 | |||
| 743 | Ga0070683_100271290 | |||
| 744 | Ga0070683_100486174 | |||
| 745 | Ga0070680_100004322 | |||
| 746 | Ga0070680_100007831 | |||
| 747 | Ga0070680_100034832 | |||
| 748 | Ga0070680_100112342 | |||
| 749 | Ga0070680_100558797 | |||
| 750 | Ga0070680_100570913 | |||
| 751 | Ga0070680_100806932 | |||
| 752 | Ga0070680_101433435 | |||
| 753 | Ga0070682_100028918 | |||
| 754 | Ga0070682_100039720 | |||
| 755 | Ga0070682_100110186 | |||
| 756 | Ga0070660_100002737 | |||
| 757 | Ga0070660_100008650 | |||
| 758 | Ga0070660_100014803 | |||
| 759 | Ga0070660_100021208 | |||
| 760 | Ga0070660_100108071 | |||
| 761 | Ga0070660_101615760 | |||
| 762 | Ga0070691_10436979 | |||
| 763 | Ga0070661_100098665 | |||
| 764 | Ga0070661_100363628 | |||
| 765 | Ga0070661_100781316 | |||
| 766 | Ga0070671_100473411 | |||
| 767 | Ga0070659_100079960 | |||
| 768 | Ga0070659_100116778 | |||
| 769 | Ga0070659_100600612 | |||
| 770 | Ga0070659_100820076 | |||
| 771 | Ga0070709_10351248 | |||
| 772 | Ga0070709_10391495 | |||
| 773 | Ga0070709_10866161 | |||
| 774 | Ga0070714_100070418 | |||
| 775 | Ga0070714_100080710 | |||
| 776 | Ga0070714_100122611 | |||
| 777 | Ga0070714_100278002 | |||
| 778 | Ga0070714_100396497 | |||
| 779 | Ga0070714_100779925 | |||
| 780 | Ga0070713_100020755 | |||
| 781 | Ga0070713_101180149 | |||
| 782 | Ga0070711_100451763 | |||
| 783 | Ga0070711_100679085 | |||
| 784 | Ga0070694_100524024 | |||
| 785 | Ga0070663_100645566 | |||
| 786 | Ga0070663_101415922 | |||
| 787 | Ga0070681_10017455 | |||
| 788 | Ga0070681_10022404 | |||
| 789 | Ga0070681_10041844 | |||
| 790 | Ga0070681_10064712 | |||
| 791 | Ga0070681_10079444 | |||
| 792 | Ga0070681_10088339 | |||
| 793 | Ga0070681_10124094 | |||
| 794 | Ga0070681_10133093 | |||
| 795 | Ga0070681_10197239 | |||
| 796 | Ga0070681_10511835 | |||
| 797 | Ga0070707_100205011 | |||
| 798 | Ga0070698_100224193 | |||
| 799 | Ga0070698_101000736 | |||
| 800 | Ga0070699_100632034 | |||
| 801 | Ga0070679_100007577 | |||
| 802 | Ga0070679_100021157 | |||
| 803 | Ga0070679_100078312 | |||
| 804 | Ga0070679_100096032 | |||
| 805 | Ga0070679_100115774 | |||
| 806 | Ga0070679_100167583 | |||
| 807 | Ga0070679_100215350 | |||
| 808 | Ga0070679_100243235 | |||
| 809 | Ga0070679_100380741 | |||
| 810 | Ga0070679_100666696 | |||
| 811 | Ga0070684_100026363 | |||
| 812 | Ga0070684_100043269 | |||
| 813 | Ga0070684_100043973 | |||
| 814 | Ga0070684_100200248 | |||
| 815 | Ga0068853_100174615 | |||
| 816 | Ga0068853_100432412 | |||
| 817 | Ga0070686_100692924 | |||
| 818 | Ga0070695_101087897 | |||
| 819 | Ga0070693_100114035 | |||
| 820 | Ga0070704_100614951 | |||
| 821 | Ga0068855_100053589 | |||
| 822 | Ga0068855_100082115 | |||
| 823 | Ga0068855_100154532 | |||
| 824 | Ga0068855_100257749 | |||
| 825 | Ga0068855_100319842 | |||
| 826 | Ga0068855_100387402 | |||
| 827 | Ga0070664_100084847 | |||
| 828 | Ga0068857_100190853 | |||
| 829 | Ga0068854_100626946 | |||
| 830 | Ga0068854_101444807 | |||
| 831 | Ga0068856_100205773 | |||
| 832 | Ga0068856_100524503 | |||
| 833 | Ga0070702_100164620 | |||
| 834 | Ga0068852_100085427 | |||
| 835 | Ga0068852_100507384 | |||
| 836 | Ga0068852_101275939 | |||
| 837 | Ga0081455_10153812 | |||
| 838 | Ga0081540_1001437 | |||
| 839 | Ga0070717_10042554 | |||
| 840 | Ga0070717_10051491 | |||
| 841 | Ga0070717_10189716 | |||
| 842 | Ga0070716_100073637 | |||
| 843 | Ga0070712_100333918 | |||
| 844 | Ga0070712_101465745 | |||
| 845 | Ga0068871_100441854 | |||
| 846 | Ga0075434_100120407 | |||
| 847 | Ga0075434_100615746 | |||
| 848 | Ga0068865_100762004 | |||
| 849 | Ga0075435_100252786 | |||
| 850 | Ga0099795_10187765 | |||
| 851 | Ga0105240_10094365 | |||
| 852 | Ga0105240_10094850 | |||
| 853 | Ga0105240_10387133 | |||
| 854 | Ga0105240_10494682 | |||
| 855 | Ga0105240_10575261 | |||
| 856 | Ga0105241_10974373 | |||
| 857 | Ga0105242_10294270 | |||
| 858 | Ga0105237_10089672 | |||
| 859 | Ga0105237_10352693 | |||
| 860 | Ga0105238_10025346 | |||
| 861 | Ga0105238_10072795 | |||
| 862 | Ga0105238_11275432 | |||
| 863 | Ga0105238_11426932 | |||
| 864 | Ga0105239_10579694 | |||
| 865 | Ga0105239_10943751 | |||
| 866 | Ga0105239_11346205 | |||
| 867 | Ga0157373_10173665 | |||
| 868 | Ga0157373_10420728 | |||
| 869 | Ga0157373_10572075 | |||
| 870 | Ga0157373_10609918 | |||
| 871 | Ga0157371_10409870 | |||
| 872 | Ga0157370_10011371 | |||
| 873 | Ga0157370_10053323 | |||
| 874 | Ga0157370_10220551 | |||
| 875 | Ga0157370_10241583 | |||
| 876 | Ga0157370_10453590 | |||
| 877 | Ga0157370_11372124 | |||
| 878 | Ga0157369_10002593 | |||
| 879 | Ga0157369_10006255 | |||
| 880 | Ga0157369_10010168 | |||
| 881 | Ga0157369_10105610 | |||
| 882 | Ga0157369_10319560 | |||
| 883 | Ga0157369_10338265 | |||
| 884 | Ga0157369_10440635 | |||
| 885 | Ga0157369_10940042 | |||
| 886 | Ga0157374_10352657 | |||
| 887 | Ga0157374_10508769 | |||
| 888 | Ga0163162_10413130 | |||
| 889 | Ga0157372_10230491 | |||
| 890 | Ga0157372_10250625 | |||
| 891 | Ga0157372_10303686 | |||
| 892 | Ga0157372_10325043 | |||
| 893 | Ga0157372_10735821 | |||
| 894 | Ga0157372_11907927 | |||
| 895 | Ga0182008_10032867 | |||
| 896 | Ga0182008_10219316 | |||
| 897 | Ga0182008_10398173 | |||
| 898 | Ga0182008_10906798 | |||
| 899 | Ga0157377_10434968 | |||
| 900 | Ga0182006_1017300 | |||
| 901 | Ga0182007_10312500 | |||
| 902 | Ga0206356_10185361 | |||
| 903 | Ga0206356_11545319 | |||
| 904 | Ga0206356_11895991 | |||
| 905 | Ga0206354_10165856 | |||
| 906 | Ga0206354_10313809 | |||
| 907 | Ga0206354_10821376 | |||
| 908 | Ga0206354_11083035 | |||
| 909 | Ga0206353_10388633 | |||
| 910 | Ga0206353_10493334 | |||
| 911 | Ga0206353_10552674 | |||
| 912 | Ga0206353_11280332 | |||
| 913 | Ga0206353_11965947 | |||
| 914 | Ga0213876_10111509 | |||
| 915 | Ga0224712_10356322 | |||
| 916 | Ga0207692_10174767 | |||
| 917 | Ga0207647_10481093 | |||
| 918 | Ga0207699_10403066 | |||
| 919 | Ga0207705_10073327 | |||
| 920 | Ga0207705_10130217 | |||
| 921 | Ga0207705_10191441 | |||
| 922 | Ga0207705_10396450 | |||
| 923 | Ga0207707_10014872 | |||
| 924 | Ga0207707_10025282 | |||
| 925 | Ga0207707_10042631 | |||
| 926 | Ga0207707_10078418 | |||
| 927 | Ga0207707_10113747 | |||
| 928 | Ga0207707_10147276 | |||
| 929 | Ga0207707_10188368 | |||
| 930 | Ga0207707_10274339 | |||
| 931 | Ga0207707_10282352 | |||
| 932 | Ga0207707_10628853 | |||
| 933 | Ga0207707_10701577 | |||
| 934 | Ga0207707_11035012 | |||
| 935 | Ga0207695_10145168 | |||
| 936 | Ga0207695_10288297 | |||
| 937 | Ga0207695_10296864 | |||
| 938 | Ga0207695_10958483 | |||
| 939 | Ga0207671_10444108 | |||
| 940 | Ga0207671_10663981 | |||
| 941 | Ga0207671_10694726 | |||
| 942 | Ga0207693_10584036 | |||
| 943 | Ga0207663_10382194 | |||
| 944 | Ga0207660_10004237 | |||
| 945 | Ga0207660_10037984 | |||
| 946 | Ga0207660_10040055 | |||
| 947 | Ga0207660_10094712 | |||
| 948 | Ga0207660_10243410 | |||
| 949 | Ga0207660_10478836 | |||
| 950 | Ga0207660_10742560 | |||
| 951 | Ga0207660_11417178 | |||
| 952 | Ga0207657_10000720 | |||
| 953 | Ga0207657_10000955 | |||
| 954 | Ga0207657_10006946 | |||
| 955 | Ga0207657_10007990 | |||
| 956 | Ga0207657_10091383 | |||
| 957 | Ga0207657_10179736 | |||
| 958 | Ga0207657_10394895 | |||
| 959 | Ga0207657_10424001 | |||
| 960 | Ga0207657_11165994 | |||
| 961 | Ga0207649_10225204 | |||
| 962 | Ga0207652_10016505 | |||
| 963 | Ga0207652_10086457 | |||
| 964 | Ga0207652_10139930 | |||
| 965 | Ga0207652_10152469 | |||
| 966 | Ga0207652_10247271 | |||
| 967 | Ga0207652_10260939 | |||
| 968 | Ga0207652_10305870 | |||
| 969 | Ga0207652_10388838 | |||
| 970 | Ga0207652_10425623 | |||
| 971 | Ga0207652_10427452 | |||
| 972 | Ga0207652_10611272 | |||
| 973 | Ga0207646_10001000 | |||
| 974 | Ga0207646_10425292 | |||
| 975 | Ga0207646_10676046 | |||
| 976 | Ga0207694_10626895 | |||
| 977 | Ga0207694_11007042 | |||
| 978 | Ga0207700_10001789 | |||
| 979 | Ga0207664_10002169 | |||
| 980 | Ga0207664_10045501 | |||
| 981 | Ga0207664_10072920 | |||
| 982 | Ga0207664_10083336 | |||
| 983 | Ga0207664_10149933 | |||
| 984 | Ga0207664_10225175 | |||
| 985 | Ga0207664_10321485 | |||
| 986 | Ga0207664_11227587 | |||
| 987 | Ga0207644_11117930 | |||
| 988 | Ga0207690_10075567 | |||
| 989 | Ga0207690_10134066 | |||
| 990 | Ga0207690_10338214 | |||
| 991 | Ga0207690_10618152 | |||
| 992 | Ga0207665_10510221 | |||
| 993 | Ga0207711_10091712 | |||
| 994 | Ga0207661_10023507 | |||
| 995 | Ga0207661_10171110 | |||
| 996 | Ga0207661_10516455 | |||
| 997 | Ga0207661_11645028 | |||
| 998 | Ga0207667_10222274 | |||
| 999 | Ga0207667_10251555 | |||
| 1000 | Ga0207667_10401090 | |||
| 1001 | Ga0207667_10950726 | |||
| 1002 | Ga0207667_11285479 | |||
| 1003 | Ga0207640_10249046 | |||
| 1004 | Ga0207640_11103980 | |||
| 1005 | Ga0207677_10625668 | |||
| 1006 | Ga0207639_10078569 | |||
| 1007 | Ga0207639_10225820 | |||
| 1008 | Ga0207639_10705629 | |||
| 1009 | Ga0207639_10822666 | |||
| 1010 | Ga0207702_10349528 | |||
| 1011 | Ga0207702_10453889 | |||
| 1012 | Ga0207674_10226882 | |||
| 1013 | Ga0207674_11272760 | |||
| 1014 | Ga0207698_10368327 | |||
| 1015 | Ga0207698_11014847 | |||
| 1016 | Ga0265334_10021483 | |||
| 1017 | Ga0265334_10117914 | |||
| 1018 | Ga0265318_10285019 | |||
| 1019 | Ga0265322_10154455 | |||
| 1020 | Ga0265336_10040979 | |||
| 1021 | Ga0265336_10108407 | |||
| 1022 | Ga0265338_10001662 | |||
| 1023 | Ga0265338_10002226 | |||
| 1024 | Ga0265338_10006836 | |||
| 1025 | Ga0265338_10008316 | |||
| 1026 | Ga0265338_10036549 | |||
| 1027 | Ga0265338_10896534 | |||
| 1028 | Ga0265324_10040746 | |||
| 1029 | Ga0265324_10126306 | |||
| 1030 | Ga0265328_10129440 | |||
| 1031 | Ga0265320_10058039 | |||
| 1032 | Ga0265325_10166963 | |||
| 1033 | Ga0265325_10231476 | |||
| 1034 | Ga0265339_10002685 | |||
| 1035 | Ga0265331_10016554 | |||
| 1036 | Ga0265327_10037138 | |||
| 1037 | Ga0265313_10024574 | |||
| 1038 | Ga0265313_10057604 | |||
| 1039 | Ga0307514_10186957 | |||
| 1040 | Ga0265314_10004238 | |||
| 1041 | Ga0265314_10078240 | |||
| 1042 | Ga0265342_10037223 | |||
| 1043 | Ga0265342_10269118 | |||
| 1044 | Ga0265342_10448586 | |||
| 1045 | Ga0373934_0244354 | |||
| 1046 | Ga0373944_0037645 | |||
| 1047 | Ga0373936_0044645 | |||
| 1048 | Ga0373957_0314175 | |||
| 1049 | Ga0373943_0009138 | |||
| 1050 | Ga0373943_0649011 | |||
| 1051 | Ga0373946_0107068 | |||
| 1052 | Ga0373955_0166830 | |||
| 1053 | Ga0373955_0328362 | |||
| 1054 | Ga0316574_0191584 | |||
| 1055 | Ga0373924_0181321 | |||
| 1056 | Ga0373924_0214452 | |||
| 1057 | Ga0373931_0291004 | |||
| 1058 | Ga0373935_0057816 | |||
| 1059 | Ga0373935_1507727 | |||
| 1060 | Ga0373927_0132814 | |||
| 1061 | Ga0373933_0032033 | |||
| 1062 | Ga0373933_0884975 | |||
| 1063 | Ga0373947_0046027 | |||
| 1064 | Ga0373937_0000190 | |||
| 1065 | Ga0373937_0159859 | |||
| 1066 | Ga0373925_0028769 | |||
| 1067 | Ga0395899_0046750 | |||
| 1068 | Ga0395899_0067359 | |||
| 1069 | Ga0395900_0024705 | |||
| 1070 | Ga0395900_0031531 | |||
| 1071 | Ga0395900_0093099 | |||
| 1072 | Ga0395900_0094234 | |||
| 1073 | Ga0395900_0233437 | |||
| 1074 | Ga0395900_0434568 | |||
| 1075 | Ga0395898_0006598 | |||
| 1076 | Ga0395898_0019301 | |||
| 1077 | Ga0395898_0238766 | |||
| 1078 | Ga0395898_0303013 | |||
| 1079 | Ga0395898_0389211 | |||
| 1080 | Ga0395898_0496706 | |||
| 1081 | Ga0395898_0712086 | |||
| 1082 | Ga0395898_0766477 | |||
| 1083 | Ga0395898_0915319 | |||
| 1084 | Ga0395898_1113346 | |||
| 1085 | Ga0395898_1123532 | |||
| 1086 | Ga0395898_1130164 | |||
| 1087 | Ga0395898_1708121 | |||
| 1088 | Ga0395905_0060791 | |||
| 1089 | Ga0395905_0103717 | |||
| 1090 | Ga0395905_0110330 | |||
| 1091 | Ga0395905_0391902 | |||
| 1092 | Ga0436364_0875471 | |||
| 1093 | Ga0395901_0002302 | |||
| 1094 | Ga0395901_0015081 | |||
| 1095 | Ga0395901_0084990 | |||
| 1096 | Ga0395901_0129007 | |||
| 1097 | Ga0395901_0142897 | |||
| 1098 | Ga0395901_0208300 | |||
| 1099 | Ga0395901_0362595 | |||
| 1100 | Ga0242420_046554 | |||
| 1101 | Ga0436365_0136550 | |||
| 1102 | Ga0436365_1856328 | |||
| 1103 | Ga0436360_0278534 | |||
| 1104 | Ga0436363_1348721 | |||
| 1105 | Ga0436363_1400617 | |||
| 1106 | Ga0436362_0941157 | |||
| 1107 | Ga0439448_0219924 | |||
| 1108 | Ga0439459_0018949 | |||
| 1109 | Ga0466969_0010551 | |||
| 1110 | Ga0466969_0066414 | |||
| 1111 | Ga0466969_0183616 | |||
| 1112 | Ga0466972_0467698 | |||
| 1113 | Ga0466965_0019898 | |||
| 1114 | Ga0466965_0026307 | |||
| 1115 | Ga0466965_0075263 | |||
| 1116 | Ga0466965_0086555 | |||
| 1117 | Ga0466966_0007140 | |||
| 1118 | Ga0466966_0010902 | |||
| 1119 | Ga0466966_0030525 | |||
| 1120 | Ga0466966_0035884 | |||
| 1121 | Ga0466966_0200908 | |||
| 1122 | Ga0466966_0203818 | |||
| 1123 | Ga0466966_0220896 | |||
| 1124 | Ga0466961_0005623 | |||
| 1125 | Ga0466961_0008544 | |||
| 1126 | Ga0466961_0012723 | |||
| 1127 | Ga0466961_0015263 | |||
| 1128 | Ga0466961_0018241 | |||
| 1129 | Ga0466961_0083376 | |||
| 1130 | Ga0466961_0094140 | |||
| 1131 | Ga0466961_0264014 | |||
| 1132 | Ga0466963_0000389 | |||
| 1133 | Ga0466963_0000536 | |||
| 1134 | Ga0466963_0000646 | |||
| 1135 | Ga0466963_0000987 | |||
| 1136 | Ga0466963_0001204 | |||
| 1137 | Ga0466963_0009428 | |||
| 1138 | Ga0466963_0010406 | |||
| 1139 | Ga0466963_0022999 | |||
| 1140 | Ga0466963_0033569 | |||
| 1141 | Ga0466963_0035769 | |||
| 1142 | Ga0466963_0039599 | |||
| 1143 | Ga0466963_0045483 | |||
| 1144 | Ga0466963_0084258 | |||
| 1145 | Ga0466963_0189371 | |||
| 1146 | Ga0466963_0258659 | |||
| 1147 | Ga0466963_0449536 | |||
| 1148 | Ga0466963_0879769 | |||
| 1149 | Ga0466964_0005925 | |||
| 1150 | Ga0466964_0006306 | |||
| 1151 | Ga0466964_0010741 | |||
| 1152 | Ga0466964_0016463 | |||
| 1153 | Ga0466964_0036286 | |||
| 1154 | Ga0466964_0067086 | |||
| 1155 | Ga0466964_0092438 | |||
| 1156 | Ga0466964_0212361 | |||
| 1157 | Ga0466964_0464442 | |||
| 1158 | Ga0466971_0001797 | |||
| 1159 | Ga0466971_0003174 | |||
| 1160 | Ga0466971_0004890 | |||
| 1161 | Ga0466971_0008423 | |||
| 1162 | Ga0466971_0107427 | |||
| 1163 | Ga0466968_0003025 | |||
| 1164 | Ga0466968_0009757 | |||
| 1165 | Ga0466968_0010237 | |||
| 1166 | Ga0466968_0219322 | |||
| 1167 | Ga0466968_0354428 | |||
| 1168 | Ga0466968_0557156 | |||
| 1169 | Ga0466970_0004839 | |||
| 1170 | Ga0466970_0048010 | |||
| 1171 | Ga0466970_0211809 | |||
| 1172 | Ga0466970_0491093 | |||
| 1173 | Ga0466957_0000947 | |||
| 1174 | Ga0466957_0002364 | |||
| 1175 | Ga0466957_0002391 | |||
| 1176 | Ga0466957_0012995 | |||
| 1177 | Ga0466957_0013632 | |||
| 1178 | Ga0466957_0018104 | |||
| 1179 | Ga0466957_0038551 | |||
| 1180 | Ga0466957_0166372 | |||
| 1181 | Ga0466957_0277618 | |||
| 1182 | Ga0466957_0319215 | |||
| 1183 | Ga0466957_0441346 | |||
| 1184 | Ga0466960_0008699 | |||
| 1185 | Ga0466960_0051086 | |||
| 1186 | Ga0466959_0000796 | |||
| 1187 | Ga0466959_0002167 | |||
| 1188 | Ga0466959_0008103 | |||
| 1189 | Ga0466959_0013386 | |||
| 1190 | Ga0466959_0019126 | |||
| 1191 | Ga0466959_0020545 | |||
| 1192 | Ga0466959_0031041 | |||
| 1193 | Ga0466959_0171170 | |||
| 1194 | Ga0466959_0174340 | |||
| 1195 | Ga0451576_2074978 | |||
| 1196 | Ga0466958_0000599 | |||
| 1197 | Ga0466958_0001043 | |||
| 1198 | Ga0466958_0002334 | |||
| 1199 | Ga0466958_0004076 | |||
| 1200 | Ga0466958_0009390 | |||
| 1201 | Ga0466958_0010965 | |||
| 1202 | Ga0466958_0011716 | |||
| 1203 | Ga0466958_0023140 | |||
| 1204 | Ga0466958_0045953 | |||
| 1205 | Ga0466958_0089461 | |||
| 1206 | Ga0466958_0117350 | |||
| 1207 | Ga0466958_0240540 | |||
| 1208 | Ga0466958_0257285 | |||
| 1209 | Ga0466958_0397757 | |||
| 1210 | Ga0466967_0000395 | |||
| 1211 | Ga0466967_0001125 | |||
| 1212 | Ga0466967_0001753 | |||
| 1213 | Ga0466967_0002130 | |||
| 1214 | Ga0466967_0002773 | |||
| 1215 | Ga0466967_0002845 | |||
| 1216 | Ga0466967_0003863 | |||
| 1217 | Ga0466967_0005312 | |||
| 1218 | Ga0466967_0011526 | |||
| 1219 | Ga0466967_0012287 | |||
| 1220 | Ga0466967_0016445 | |||
| 1221 | Ga0466967_0022345 | |||
| 1222 | Ga0466967_0027115 | |||
| 1223 | Ga0466967_0034000 | |||
| 1224 | Ga0466967_0036327 | |||
| 1225 | Ga0466967_0047088 | |||
| 1226 | Ga0466967_0048177 | |||
| 1227 | Ga0466967_0060464 | |||
| 1228 | Ga0466967_0063287 | |||
| 1229 | Ga0466967_0063632 | |||
| 1230 | Ga0466967_0068591 | |||
| 1231 | Ga0466967_0094219 | |||
| 1232 | Ga0466967_0138305 | |||
| 1233 | Ga0466967_0159282 | |||
| 1234 | Ga0466967_0170326 | |||
| 1235 | Ga0466967_0203975 | |||
| 1236 | Ga0466967_0277763 | |||
| 1237 | Ga0466967_0289025 | |||
| 1238 | Ga0466967_1176877 | |||
| 1239 | Ga0466967_1195619 | |||
| 1240 | Ga0466967_1319235 | |||
| 1241 | Ga0466967_1328142 | |||
| 1242 | Ga0495592_0000206 | |||
| 1243 | Ga0495592_0094507 | |||
| 1244 | Ga0495592_0376106 | |||
| 1245 | Ga0495603_0077848 | |||
| 1246 | Ga0495629_0035063 | |||
| 1247 | Ga0495629_0040717 | |||
| 1248 | Ga0495629_0057556 | |||
| 1249 | Ga0495629_0362341 | |||
| 1250 | Ga0495641_0019548 | |||
| 1251 | Ga0495641_0032718 | |||
| 1252 | Ga0495641_0095510 | |||
| 1253 | Ga0495651_0000053 | |||
| 1254 | Ga0495651_0031919 | |||
| 1255 | Ga0495651_0284378 | |||
| 1256 | Ga0495653_0010133 | |||
| 1257 | Ga0495653_0047410 | |||
| 1258 | Ga0495653_0051498 | |||
| 1259 | Ga0495653_0208985 | |||
| 1260 | Ga0495582_0316368 | |||
| 1261 | Ga0495582_0374088 | |||
| 1262 | Ga0495605_0056718 | |||
| 1263 | Ga0495664_0030198 | |||
| 1264 | Ga0495664_0288888 | |||
| 1265 | Ga0495584_0553400 | |||
| 1266 | Ga0495596_0067474 | |||
| 1267 | Ga0495608_0001922 | |||
| 1268 | Ga0495608_0002448 | |||
| 1269 | Ga0495608_0025739 | |||
| 1270 | Ga0495608_0331661 | |||
| 1271 | Ga0495608_0755572 | |||
| 1272 | Ga0495618_0003117 | |||
| 1273 | Ga0495628_0000047 | |||
| 1274 | Ga0495628_0032030 | |||
| 1275 | Ga0495628_0042540 | |||
| 1276 | Ga0495628_0216190 | |||
| 1277 | Ga0495628_0227221 | |||
| 1278 | Ga0495630_0091740 | |||
| 1279 | Ga0495630_0096274 | |||
| 1280 | Ga0495630_0143645 | |||
| 1281 | Ga0495644_0005238 | |||
| 1282 | Ga0495652_0000291 | |||
| 1283 | Ga0495652_0120717 | |||
| 1284 | Ga0495652_0254512 | |||
| 1285 | Ga0495665_0342979 | |||
| 1286 | Ga0495640_0001210 | |||
| 1287 | Ga0495640_0047625 | |||
| 1288 | Ga0495640_0184872 | |||
| 1289 | Ga0495640_0246664 | |||
| 1290 | Ga0495640_0344747 | |||
| 1291 | Ga0495586_0098154 | |||
| 1292 | Ga0495587_0000756 | |||
| 1293 | Ga0495587_0379113 | |||
| 1294 | Ga0495645_0000302 | |||
| 1295 | Ga0495645_0031725 | |||
| 1296 | Ga0495645_0212401 | |||
| 1297 | Ga0495667_0006046 | |||
| 1298 | Ga0495667_0019331 | |||
| 1299 | Ga0495667_0028587 | |||
| 1300 | Ga0495667_0060064 | |||
| 1301 | Ga0495656_0003852 | |||
| 1302 | Ga0495634_0072730 | |||
| 1303 | Ga0495634_0075330 | |||
| 1304 | Ga0495634_0160802 | |||
| 1305 | Ga0495611_0029625 | |||
| 1306 | Ga0495635_0002779 | |||
| 1307 | Ga0495635_0008171 | |||
| 1308 | Ga0495635_0521423 | |||
| 1309 | Ga0495635_1012730 | |||
| 1310 | Ga0495661_0053493 | |||
| 1311 | Ga0495588_0025372 | |||
| 1312 | Ga0495657_0016979 | |||
| 1313 | Ga0495657_0027854 | |||
| 1314 | Ga0495657_0068851 | |||
| 1315 | Ga0495657_0157915 | |||
| 1316 | Ga0495599_0000063 | |||
| 1317 | Ga0495599_0082769 | |||
| 1318 | Ga0495599_0123388 | |||
| 1319 | Ga0495623_0000132 | |||
| 1320 | Ga0495623_0308072 | |||
| 1321 | Ga0495646_0000560 | |||
| 1322 | Ga0495646_0126102 | |||
| 1323 | Ga0495646_0142829 | |||
| 1324 | Ga0495646_0520839 | |||
| 1325 | Ga0495647_0478754 | |||
| 1326 | Ga0495658_0012623 | |||
| 1327 | Ga0495613_0016285 | |||
| 1328 | Ga0495613_0137256 | |||
| 1329 | Ga0495613_0193218 | |||
| 1330 | Ga0495613_0225300 | |||
| 1331 | Ga0495613_0427562 | |||
| 1332 | Ga0495613_0654653 | |||
| 1333 | Ga0495624_0141217 | |||
| 1334 | Ga0495624_0373003 | |||
| 1335 | Ga0495670_0037409 | |||
| 1336 | Ga0495600_0094858 | |||
| 1337 | Ga0495600_0114641 | |||
| 1338 | Ga0495600_0136123 | |||
| 1339 | Ga0495581_0081804 | |||
| 1340 | Ga0495581_0114935 | |||
| 1341 | Ga0495604_0000004 | |||
| 1342 | Ga0495604_0267489 | |||
| 1343 | Ga0495674_0001271 | |||
| 1344 | Ga0495674_0129177 | |||
| 1345 | Ga0495674_1017115 | |||
| 1346 | Ga0495676_0083443 | |||
| 1347 | Ga0495676_0198533 | |||
| 1348 | Ga0495680_0001616 | |||
| 1349 | Ga0495680_0012878 | |||
| 1350 | Ga0495680_0032756 | |||
| 1351 | Ga0495680_0055468 | |||
| 1352 | Ga0495680_0062600 | |||
| 1353 | Ga0495680_0063361 | |||
| 1354 | Ga0495680_0220462 | |||
| 1355 | Ga0495675_0000075 | |||
| 1356 | Ga0495675_0259631 | |||
| 1357 | Ga0495675_0575119 | |||
| 1358 | Ga0495675_0627403 | |||
| 1359 | Ga0495679_201233 | |||
| 1360 | Ga0495685_025396 | |||
| 1361 | Ga0495684_0018019 | |||
| 1362 | Ga0495684_0027348 | |||
| 1363 | Ga0495684_0083626 | |||
| 1364 | Ga0495602_0000524 | |||
| 1365 | Ga0495602_0063973 | |||
| 1366 | Ga0495602_0510892 | |||
| 1367 | Ga0496100_1310325 | |||
| 1368 | Ga0496101_0191657 | |||
| 1369 | Ga0496101_0352271 | |||
| 1370 | Ga0496101_0558280 | |||
| 1371 | Ga0496102_0048878 | |||
| 1372 | Ga0496102_1711394 | |||
| 1373 | Ga0496103_0051633 | |||
| 1374 | Ga0496103_0172765 | |||
| 1375 | Ga0496103_0403927 | |||
| 1376 | Ga0496104_0135574 | |||
| 1377 | Ga0496104_0148113 | |||
| 1378 | Ga0496104_0179327 | |||
| 1379 | Ga0496104_0569726 | |||
| 1380 | Ga0496104_0897202 | |||
| 1381 | Ga0496104_1082675 | |||
| 1382 | Ga0496105_0005550 | |||
| 1383 | Ga0496105_0070166 | |||
| 1384 | Ga0496105_0073434 | |||
| 1385 | Ga0496106_0022205 | |||
| 1386 | Ga0496107_0004648 | |||
| 1387 | Ga0496107_1262545 | |||
| 1388 | Ga0496108_0610387 | |||
| 1389 | Ga0496109_0014835 | |||
| 1390 | Ga0496109_0020587 | |||
| 1391 | Ga0496109_0586192 | |||
| 1392 | Ga0496109_1131024 | |||
| 1393 | Ga0496109_1709296 | |||
| 1394 | Ga0496110_0013272 | |||
| 1395 | Ga0496110_0302492 | |||
| 1396 | Ga0496110_0375835 | |||
| 1397 | Ga0496110_0914181 | |||
| 1398 | Ga0496110_1231809 | |||
| 1399 | Ga0496111_0021624 | |||
| 1400 | Ga0496111_0078907 | |||
| 1401 | Ga0496112_0001247 | |||
| 1402 | Ga0496112_0002913 | |||
| 1403 | Ga0496112_0040803 | |||
| 1404 | Ga0496112_0129597 | |||
| 1405 | Ga0496112_0193860 | |||
| 1406 | Ga0496112_0283866 | |||
| 1407 | Ga0496112_0300397 | |||
| 1408 | Ga0496112_0309386 | |||
| 1409 | Ga0496112_0800204 | |||
| 1410 | Ga0496113_0036399 | |||
| 1411 | Ga0496113_0318612 | |||
| 1412 | Ga0496113_0484512 | |||
| 1413 | Ga0496113_0759849 | |||
| 1414 | Ga0496113_0932976 | |||
| 1415 | Ga0496114_0325666 | |||
| 1416 | Ga0496114_0369586 | |||
| 1417 | Ga0496115_0048290 | |||
| 1418 | Ga0496115_0158585 | |||
| 1419 | Ga0501034_0050008 | |||
| 1420 | Ga0501043_0161143 | |||
| 1421 | Ga0501047_0029619 | |||
| 1422 | Ga0501047_0835616 | |||
| 1423 | Ga0501067_0000403 | |||
| 1424 | Ga0501067_0134806 | |||
| 1425 | Ga0501067_0153624 | |||
| 1426 | Ga0501069_0034071 | |||
| 1427 | Ga0501069_0638108 | |||
| 1428 | Ga0501069_0807209 | |||
| 1429 | Ga0501070_0003902 | |||
| 1430 | Ga0501070_0004537 | |||
| 1431 | Ga0501072_0009358 | |||
| 1432 | Ga0501073_0280516 | |||
| 1433 | Ga0501074_0111891 | |||
| 1434 | Ga0501074_0371078 | |||
| 1435 | Ga0501074_0687067 | |||
| 1436 | Ga0501079_0052892 | |||
| 1437 | Ga0501079_0284834 | |||
| 1438 | Ga0501079_0820787 | |||
| 1439 | Ga0501080_0012183 | |||
| 1440 | Ga0501080_0100307 | |||
| 1441 | Ga0501080_0642645 | |||
| 1442 | Ga0501083_0000684 | |||
| 1443 | Ga0501035_0336047 | |||
| 1444 | nmdc:mga05p37_2189999_c1 | |||
| 1445 | nmdc:mga0n895_1195826_c1 | |||
| 1446 | nmdc:mga0n895_564008_c1 | |||
| 1447 | nmdc:mga0rr50_2179_c1 | |||
| 1448 | nmdc:mga0rr50_278227_c1 | |||
| 1449 | Ga0495601_0001003 | |||
| 1450 | Ga0495601_0315447 | |||
| 1451 | Ga0495655_0054638 | |||
| 1452 | Ga0495595_0063080 | |||
| 1453 | Ga0495595_0086311 | |||
| 1454 | Ga0495595_0325777 | |||
| 1455 | Ga0495619_0002217 | |||
| 1456 | Ga0495619_0015118 | |||
| 1457 | Ga0495619_0047658 | |||
| 1458 | Ga0495619_0100288 | |||
| 1459 | Ga0495619_0259058 | |||
| 1460 | Ga0500616_0014064 | |||
| 1461 | Ga0501084_0200645 | |||
| 1462 | Ga0501082_1064225 | |||
| 1463 | Ga0466962_0000178 | |||
| 1464 | Ga0466962_0011490 | |||
| 1465 | Ga0466962_0028387 | |||
| 1466 | Ga0466962_0032266 | |||
| 1467 | Ga0466962_0035367 | |||
| 1468 | Ga0466962_0245712 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4e3e-assembly1.cif.gz_A | crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl | 0.8788 | 2 | 145 |
| 4o3v-assembly1.cif.gz_A | crystal structure of a virb8-like protein of type iv secretion system from rickettsia typhi | 0.8781 | 98 | 143 |
| 7q1v-assembly1.cif.gz_D | arches protomer (trimer of trwg/virb8peri) structure from the fully-assembled r388 type iv secretion system determined by cryo-em. | 0.8693 | 98 | 143 |
| 7o41-assembly1.cif.gz_D-1 | hexameric composite model of the inner membrane complex (imc) with the arches from the fully-assembled r388 type iv secretion system determined by cryo-em. | 0.8693 | 98 | 143 |
| 8hgn-assembly1.cif.gz_A | crystal structure of meac (mesaconyl-coa hydratase) | 0.862 | 2 | 145 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_I6Y9H2_24_180_3.10.129.10 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8852 | 2 | 145 | 3.10.129.10 |
| 4e3eB00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.867 | 2 | 145 | 3.10.129.10 |
| 3exzC00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8263 | 2 | 144 | 3.10.129.10 |
| 2bi0A01 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8217 | 2 | 144 | 3.10.129.10 |
| 4ffuI00 | Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase | 0.8163 | 2 | 144 | 3.10.129.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9JGK8-F1-model_v4 | Dehydratase | 0.9372 | 50 | 150 |
GO:0016829
|
| AF-A0A7K0Q0L1-F1-model_v4 | MaoC family dehydratase | 0.9344 | 49 | 148 |
GO:0016829
|
| AF-A0A6M5J366-F1-model_v4 | MaoC family dehydratase | 0.9294 | 2 | 144 |
GO:0016829
|
| AF-A0A4R4RX39-F1-model_v4 | MaoC family dehydratase | 0.9199 | 1 | 144 |
GO:0016829
|
| AF-A0A1F4D0F2-F1-model_v4 | Uncharacterized protein | 0.9082 | 3 | 144 |
GO:0016829
|