F478160

General Info

Members Datasets Scaffolds Average Seq Length
734 244 1468 150

Family's Representative Sequence

Representative Sequence 3300044706|Ga0466964_0235746|Ga0466964_0235746_345_869
Length 174
Sequence MSLDSDRVTAKDVARAMSRSYDDLEIGAVYRSRFGRTILDADNVWFTLLTLNTNPIHFDVEHAASTEWGRPLVDSTFTLALVTGLSVVDVSERAVNLGWREVKLTAPVFAGDTIRAETEVLAKRESRSRPGFGIVTVRTRGLNQRNEVVIEFERTVMLPLDAERRLEPDSTTRS

Samples

Sample ID Description Type Environment
1 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
10 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
11 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
12 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
13 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
14 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
15 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
25 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
26 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
36 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
40 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
41 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
42 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
43 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
44 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
45 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
46 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
47 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
50 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
51 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
52 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
53 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
54 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
59 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
60 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
61 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
62 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
63 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
64 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
66 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
97 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
98 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
99 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
100 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
101 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
102 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
103 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
104 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
105 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
106 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
109 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
110 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
111 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
112 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
113 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
114 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
115 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
116 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
117 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
118 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
119 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
120 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
121 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
122 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
123 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
127 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
128 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
129 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
130 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
131 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
132 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
133 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
134 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
135 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
136 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
137 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
138 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
139 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
140 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
148 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
149 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
150 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
151 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
152 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
153 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
157 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
158 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
159 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
160 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
161 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
162 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
165 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
166 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
167 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
168 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
171 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
172 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
173 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
174 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
175 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
176 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
177 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
178 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
179 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
180 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
181 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
182 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
183 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
184 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
185 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
186 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
187 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
188 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
189 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
190 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
194 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
197 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
200 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
201 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
202 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
203 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
204 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
205 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
206 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
207 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
208 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
209 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
210 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
211 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
212 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
213 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
214 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
215 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
216 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
217 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
218 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
219 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
220 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
221 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
222 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
223 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
224 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
225 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
226 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
227 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
228 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
229 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
230 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
231 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
232 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
233 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
234 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
235 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
236 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
237 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
238 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
239 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
240 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
241 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
242 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
243 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
244 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.23
Metatranscriptomes 1.77
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 7.08
Rhizosphere 91.83
Stem 0
Stem Tuber 0
Unclassified 7.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466964_0235746 3300044706 Bacteria 895
2 Ga0070658_10135083 3300005327 Bacteria 2057
3 Ga0070658_10206498 3300005327 Bacteria 1659
4 Ga0070658_10210449 3300005327 Bacteria 1642
5 Ga0070683_100007834 3300005329 Bacteria 9048
6 Ga0070683_100032507 3300005329 Bacteria 4751
7 Ga0070683_100034870 3300005329 Bacteria 4599
8 Ga0070683_100119713 3300005329 Bacteria 2486
9 Ga0070683_100271290 3300005329 Bacteria 1614
10 Ga0070683_100486174 3300005329 Bacteria 1179
11 Ga0070680_100004322 3300005336 Bacteria 10683
12 Ga0070680_100007831 3300005336 Bacteria 8145
13 Ga0070680_100034832 3300005336 Bacteria 4061
14 Ga0070680_100112342 3300005336 Bacteria 2269
15 Ga0070680_100558797 3300005336 Bacteria 981
16 Ga0070680_100570913 3300005336 Bacteria 970
17 Ga0070680_100806932 3300005336 Bacteria 809
18 Ga0070680_101433435 3300005336 Unclassified 598
19 Ga0070682_100028918 3300005337 Bacteria 3336
20 Ga0070682_100039720 3300005337 Bacteria 2892
21 Ga0070682_100110186 3300005337 Bacteria 1834
22 Ga0070660_100002737 3300005339 Bacteria 12115
23 Ga0070660_100008650 3300005339 Bacteria 7129
24 Ga0070660_100014803 3300005339 Bacteria 5628
25 Ga0070660_100021208 3300005339 Bacteria 4787
26 Ga0070660_100108071 3300005339 Bacteria 2211
27 Ga0070660_101615760 3300005339 Bacteria 552
28 Ga0070691_10436979 3300005341 Unclassified 745
29 Ga0070661_100098665 3300005344 Bacteria 2170
30 Ga0070661_100363628 3300005344 Unclassified 1138
31 Ga0070661_100781316 3300005344 Bacteria 782
32 Ga0070671_100473411 3300005355 Bacteria 1076
33 Ga0070659_100079960 3300005366 Bacteria 2609
34 Ga0070659_100116778 3300005366 Bacteria 2157
35 Ga0070659_100600612 3300005366 Unclassified 946
36 Ga0070659_100820076 3300005366 Bacteria 810
37 Ga0070709_10351248 3300005434 Bacteria 1089
38 Ga0070709_10391495 3300005434 Bacteria 1036
39 Ga0070709_10866161 3300005434 Bacteria 713
40 Ga0070714_100070418 3300005435 Bacteria 3023
41 Ga0070714_100080710 3300005435 Bacteria 2830
42 Ga0070714_100122611 3300005435 Bacteria 2313
43 Ga0070714_100278002 3300005435 Bacteria 1555
44 Ga0070714_100396497 3300005435 Bacteria 1304
45 Ga0070714_100779925 3300005435 Bacteria 925
46 Ga0070713_100020755 3300005436 Bacteria 5042
47 Ga0070713_101180149 3300005436 Bacteria 741
48 Ga0070711_100451763 3300005439 Bacteria 1052
49 Ga0070711_100679085 3300005439 Bacteria 866
50 Ga0070694_100524024 3300005444 Bacteria 946
51 Ga0070663_100645566 3300005455 Bacteria 895
52 Ga0070663_101415922 3300005455 Bacteria 616
53 Ga0070681_10017455 3300005458 Bacteria 7173
54 Ga0070681_10022404 3300005458 Bacteria 6343
55 Ga0070681_10041844 3300005458 Bacteria 4593
56 Ga0070681_10064712 3300005458 Bacteria 3626
57 Ga0070681_10079444 3300005458 Bacteria 3237
58 Ga0070681_10088339 3300005458 Bacteria 3051
59 Ga0070681_10124094 3300005458 Bacteria 2515
60 Ga0070681_10133093 3300005458 Bacteria 2418
61 Ga0070681_10197239 3300005458 Bacteria 1932
62 Ga0070681_10511835 3300005458 Bacteria 1114
63 Ga0070707_100205011 3300005468 Bacteria 1922
64 Ga0070698_100224193 3300005471 Unclassified 1813
65 Ga0070698_101000736 3300005471 Unclassified 783
66 Ga0070699_100632034 3300005518 Bacteria 977
67 Ga0070679_100007577 3300005530 Bacteria 10154
68 Ga0070679_100021157 3300005530 Bacteria 6346
69 Ga0070679_100078312 3300005530 Bacteria 3294
70 Ga0070679_100096032 3300005530 Bacteria 2952
71 Ga0070679_100115774 3300005530 Bacteria 2666
72 Ga0070679_100167583 3300005530 Bacteria 2170
73 Ga0070679_100215350 3300005530 Bacteria 1883
74 Ga0070679_100243235 3300005530 Bacteria 1757
75 Ga0070679_100380741 3300005530 Bacteria 1358
76 Ga0070679_100666696 3300005530 Bacteria 983
77 Ga0070684_100026363 3300005535 Bacteria 4895
78 Ga0070684_100043269 3300005535 Bacteria 3888
79 Ga0070684_100043973 3300005535 Bacteria 3860
80 Ga0070684_100200248 3300005535 Bacteria 1818
81 Ga0068853_100174615 3300005539 Bacteria 1946
82 Ga0068853_100432412 3300005539 Bacteria 1236
83 Ga0070686_100692924 3300005544 Bacteria 812
84 Ga0070695_101087897 3300005545 Bacteria 654
85 Ga0070693_100114035 3300005547 Bacteria 1667
86 Ga0070704_100614951 3300005549 Bacteria 956
87 Ga0068855_100053589 3300005563 Bacteria 4745
88 Ga0068855_100082115 3300005563 Bacteria 3735
89 Ga0068855_100154532 3300005563 Bacteria 2607
90 Ga0068855_100257749 3300005563 Bacteria 1944
91 Ga0068855_100319842 3300005563 Bacteria 1715
92 Ga0068855_100387402 3300005563 Bacteria 1534
93 Ga0070664_100084847 3300005564 Bacteria 2734
94 Ga0068857_100190853 3300005577 Bacteria 1866
95 Ga0068854_100626946 3300005578 Unclassified 921
96 Ga0068854_101444807 3300005578 Bacteria 623
97 Ga0068856_100205773 3300005614 Bacteria 1983
98 Ga0068856_100524503 3300005614 Bacteria 1206
99 Ga0070702_100164620 3300005615 Bacteria 1437
100 Ga0068852_100085427 3300005616 Bacteria 2811
101 Ga0068852_100507384 3300005616 Bacteria 1202
102 Ga0068852_101275939 3300005616 Bacteria 756
103 Ga0081455_10153812 3300005937 Bacteria 1771
104 Ga0081540_1001437 3300005983 Bacteria 20597
105 Ga0070717_10042554 3300006028 Bacteria 3704
106 Ga0070717_10051491 3300006028 Bacteria 3389
107 Ga0070717_10189716 3300006028 Bacteria 1795
108 Ga0070716_100073637 3300006173 Bacteria 2015
109 Ga0070712_100333918 3300006175 Bacteria 1236
110 Ga0070712_101465745 3300006175 Unclassified 596
111 Ga0068871_100441854 3300006358 Unclassified 1165
112 Ga0075434_100120407 3300006871 Bacteria 2639
113 Ga0075434_100615746 3300006871 Bacteria 1105
114 Ga0068865_100762004 3300006881 Bacteria 832
115 Ga0075435_100252786 3300007076 Bacteria 1500
116 Ga0099795_10187765 3300007788 Unclassified 866
117 Ga0105240_10094365 3300009093 Bacteria 3650
118 Ga0105240_10094850 3300009093 Bacteria 3639
119 Ga0105240_10387133 3300009093 Bacteria 1578
120 Ga0105240_10494682 3300009093 Bacteria 1361
121 Ga0105240_10575261 3300009093 Bacteria 1243
122 Ga0105241_10974373 3300009174 Bacteria 792
123 Ga0105242_10294270 3300009176 Bacteria 1479
124 Ga0105237_10089672 3300009545 Bacteria 3064
125 Ga0105237_10352693 3300009545 Bacteria 1476
126 Ga0105238_10025346 3300009551 Bacteria 6045
127 Ga0105238_10072795 3300009551 Bacteria 3431
128 Ga0105238_11275432 3300009551 Unclassified 760
129 Ga0105238_11426932 3300009551 Bacteria 720
130 Ga0105239_10579694 3300010375 Bacteria 1279
131 Ga0105239_10943751 3300010375 Bacteria 991
132 Ga0105239_11346205 3300010375 Bacteria 824
133 Ga0157373_10173665 3300013100 Bacteria 1516
134 Ga0157373_10420728 3300013100 Bacteria 959
135 Ga0157373_10572075 3300013100 Bacteria 821
136 Ga0157373_10609918 3300013100 Bacteria 795
137 Ga0157371_10409870 3300013102 Bacteria 992
138 Ga0157370_10011371 3300013104 Bacteria 9319
139 Ga0157370_10053323 3300013104 Bacteria 3857
140 Ga0157370_10220551 3300013104 Bacteria 1756
141 Ga0157370_10241583 3300013104 Bacteria 1671
142 Ga0157370_10453590 3300013104 Unclassified 1179
143 Ga0157370_11372124 3300013104 Bacteria 636
144 Ga0157369_10002593 3300013105 Bacteria 21619
145 Ga0157369_10006255 3300013105 Bacteria 13818
146 Ga0157369_10010168 3300013105 Bacteria 10738
147 Ga0157369_10105610 3300013105 Bacteria 2998
148 Ga0157369_10319560 3300013105 Bacteria 1614
149 Ga0157369_10338265 3300013105 Bacteria 1564
150 Ga0157369_10440635 3300013105 Bacteria 1349
151 Ga0157369_10940042 3300013105 Bacteria 886
152 Ga0157374_10352657 3300013296 Bacteria 1462
153 Ga0157374_10508769 3300013296 Bacteria 1209
154 Ga0163162_10413130 3300013306 Bacteria 1482
155 Ga0157372_10230491 3300013307 Bacteria 2147
156 Ga0157372_10250625 3300013307 Bacteria 2055
157 Ga0157372_10303686 3300013307 Bacteria 1857
158 Ga0157372_10325043 3300013307 Bacteria 1791
159 Ga0157372_10735821 3300013307 Bacteria 1147
160 Ga0157372_11907927 3300013307 Bacteria 683
161 Ga0182008_10032867 3300014497 Bacteria 2605
162 Ga0182008_10219316 3300014497 Unclassified 973
163 Ga0182008_10398173 3300014497 Unclassified 739
164 Ga0182008_10906798 3300014497 Bacteria 519
165 Ga0157377_10434968 3300014745 Bacteria 902
166 Ga0182006_1017300 3300015261 Bacteria 3065
167 Ga0182007_10312500 3300015262 Bacteria 580
168 Ga0206356_10185361 3300020070 Bacteria 848
169 Ga0206356_11545319 3300020070 Bacteria 1714
170 Ga0206356_11895991 3300020070 Bacteria 1435
171 Ga0206354_10165856 3300020081 Bacteria 1712
172 Ga0206354_10313809 3300020081 Bacteria 2044
173 Ga0206354_10821376 3300020081 Bacteria 690
174 Ga0206354_11083035 3300020081 Bacteria 3662
175 Ga0206353_10388633 3300020082 Bacteria 2351
176 Ga0206353_10493334 3300020082 Bacteria 1891
177 Ga0206353_10552674 3300020082 Bacteria 545
178 Ga0206353_11280332 3300020082 Bacteria 10221
179 Ga0206353_11965947 3300020082 Bacteria 8567
180 Ga0213876_10111509 3300021384 Bacteria 1452
181 Ga0224712_10356322 3300022467 Bacteria 692
182 Ga0207692_10174767 3300025898 Bacteria 1247
183 Ga0207647_10481093 3300025904 Unclassified 694
184 Ga0207699_10403066 3300025906 Bacteria 974
185 Ga0207705_10073327 3300025909 Bacteria 2483
186 Ga0207705_10130217 3300025909 Bacteria 1872
187 Ga0207705_10191441 3300025909 Bacteria 1547
188 Ga0207705_10396450 3300025909 Bacteria 1067
189 Ga0207707_10014872 3300025912 Bacteria 6777
190 Ga0207707_10025282 3300025912 Bacteria 5195
191 Ga0207707_10042631 3300025912 Bacteria 3959
192 Ga0207707_10078418 3300025912 Bacteria 2884
193 Ga0207707_10113747 3300025912 Bacteria 2365
194 Ga0207707_10147276 3300025912 Bacteria 2059
195 Ga0207707_10188368 3300025912 Bacteria 1800
196 Ga0207707_10274339 3300025912 Bacteria 1461
197 Ga0207707_10282352 3300025912 Bacteria 1438
198 Ga0207707_10628853 3300025912 Bacteria 906
199 Ga0207707_10701577 3300025912 Bacteria 849
200 Ga0207707_11035012 3300025912 Bacteria 672
201 Ga0207695_10145168 3300025913 Bacteria 2318
202 Ga0207695_10288297 3300025913 Bacteria 1534
203 Ga0207695_10296864 3300025913 Bacteria 1507
204 Ga0207695_10958483 3300025913 Bacteria 735
205 Ga0207671_10444108 3300025914 Bacteria 1033
206 Ga0207671_10663981 3300025914 Bacteria 830
207 Ga0207671_10694726 3300025914 Bacteria 809
208 Ga0207693_10584036 3300025915 Bacteria 870
209 Ga0207663_10382194 3300025916 Bacteria 1073
210 Ga0207660_10004237 3300025917 Bacteria 9346
211 Ga0207660_10037984 3300025917 Bacteria 3359
212 Ga0207660_10040055 3300025917 Bacteria 3278
213 Ga0207660_10094712 3300025917 Bacteria 2220
214 Ga0207660_10243410 3300025917 Bacteria 1418
215 Ga0207660_10478836 3300025917 Bacteria 1009
216 Ga0207660_10742560 3300025917 Unclassified 801
217 Ga0207660_11417178 3300025917 Bacteria 563
218 Ga0207657_10000720 3300025919 Bacteria 35112
219 Ga0207657_10000955 3300025919 Bacteria 30552
220 Ga0207657_10006946 3300025919 Bacteria 11665
221 Ga0207657_10007990 3300025919 Bacteria 10786
222 Ga0207657_10091383 3300025919 Bacteria 2538
223 Ga0207657_10179736 3300025919 Unclassified 1711
224 Ga0207657_10394895 3300025919 Bacteria 1088
225 Ga0207657_10424001 3300025919 Bacteria 1045
226 Ga0207657_11165994 3300025919 Bacteria 587
227 Ga0207649_10225204 3300025920 Bacteria 1338
228 Ga0207652_10016505 3300025921 Bacteria 6031
229 Ga0207652_10086457 3300025921 Bacteria 2749
230 Ga0207652_10139930 3300025921 Bacteria 2164
231 Ga0207652_10152469 3300025921 Bacteria 2070
232 Ga0207652_10247271 3300025921 Bacteria 1608
233 Ga0207652_10260939 3300025921 Bacteria 1563
234 Ga0207652_10305870 3300025921 Bacteria 1435
235 Ga0207652_10388838 3300025921 Bacteria 1259
236 Ga0207652_10425623 3300025921 Bacteria 1197
237 Ga0207652_10427452 3300025921 Bacteria 1194
238 Ga0207652_10611272 3300025921 Bacteria 977
239 Ga0207646_10001000 3300025922 Bacteria 36321
240 Ga0207646_10425292 3300025922 Bacteria 1199
241 Ga0207646_10676046 3300025922 Bacteria 924
242 Ga0207694_10626895 3300025924 Bacteria 905
243 Ga0207694_11007042 3300025924 Unclassified 705
244 Ga0207700_10001789 3300025928 Bacteria 12201
245 Ga0207664_10002169 3300025929 Bacteria 12917
246 Ga0207664_10045501 3300025929 Bacteria 3442
247 Ga0207664_10072920 3300025929 Bacteria 2769
248 Ga0207664_10083336 3300025929 Bacteria 2606
249 Ga0207664_10149933 3300025929 Bacteria 1980
250 Ga0207664_10225175 3300025929 Bacteria 1628
251 Ga0207664_10321485 3300025929 Bacteria 1365
252 Ga0207664_11227587 3300025929 Unclassified 668
253 Ga0207644_11117930 3300025931 Unclassified 662
254 Ga0207690_10075567 3300025932 Bacteria 2337
255 Ga0207690_10134066 3300025932 Bacteria 1816
256 Ga0207690_10338214 3300025932 Bacteria 1187
257 Ga0207690_10618152 3300025932 Bacteria 886
258 Ga0207665_10510221 3300025939 Bacteria 930
259 Ga0207711_10091712 3300025941 Bacteria 2672
260 Ga0207661_10023507 3300025944 Bacteria 4658
261 Ga0207661_10171110 3300025944 Bacteria 1891
262 Ga0207661_10516455 3300025944 Bacteria 1092
263 Ga0207661_11645028 3300025944 Bacteria 587
264 Ga0207667_10222274 3300025949 Bacteria 1935
265 Ga0207667_10251555 3300025949 Bacteria 1808
266 Ga0207667_10401090 3300025949 Bacteria 1396
267 Ga0207667_10950726 3300025949 Bacteria 849
268 Ga0207667_11285479 3300025949 Bacteria 709
269 Ga0207640_10249046 3300025981 Bacteria 1378
270 Ga0207640_11103980 3300025981 Bacteria 702
271 Ga0207677_10625668 3300026023 Bacteria 947
272 Ga0207639_10078569 3300026041 Bacteria 2605
273 Ga0207639_10225820 3300026041 Bacteria 1620
274 Ga0207639_10705629 3300026041 Bacteria 936
275 Ga0207639_10822666 3300026041 Bacteria 866
276 Ga0207702_10349528 3300026078 Bacteria 1414
277 Ga0207702_10453889 3300026078 Bacteria 1244
278 Ga0207674_10226882 3300026116 Bacteria 1816
279 Ga0207674_11272760 3300026116 Bacteria 705
280 Ga0207698_10368327 3300026142 Bacteria 1363
281 Ga0207698_11014847 3300026142 Bacteria 841
282 Ga0265334_10021483 3300028573 Bacteria 2635
283 Ga0265334_10117914 3300028573 Bacteria 950
284 Ga0265318_10285019 3300028577 Bacteria 603
285 Ga0265322_10154455 3300028654 Bacteria 656
286 Ga0265336_10040979 3300028666 Bacteria 1416
287 Ga0265336_10108407 3300028666 Bacteria 827
288 Ga0265338_10001662 3300028800 Bacteria 35477
289 Ga0265338_10002226 3300028800 Bacteria 29543
290 Ga0265338_10006836 3300028800 Bacteria 14374
291 Ga0265338_10008316 3300028800 Bacteria 12626
292 Ga0265338_10036549 3300028800 Bacteria 4697
293 Ga0265338_10896534 3300028800 Bacteria 604
294 Ga0265324_10040746 3300029957 Bacteria 1608
295 Ga0265324_10126306 3300029957 Unclassified 868
296 Ga0265328_10129440 3300031239 Unclassified 944
297 Ga0265320_10058039 3300031240 Bacteria 1854
298 Ga0265325_10166963 3300031241 Bacteria 1032
299 Ga0265325_10231476 3300031241 Bacteria 842
300 Ga0265339_10002685 3300031249 Bacteria 12646
301 Ga0265331_10016554 3300031250 Bacteria 3868
302 Ga0265327_10037138 3300031251 Bacteria 2670
303 Ga0265313_10024574 3300031595 Bacteria 3215
304 Ga0265313_10057604 3300031595 Bacteria 1833
305 Ga0307514_10186957 3300031649 Bacteria 1326
306 Ga0265314_10004238 3300031711 Bacteria 13444
307 Ga0265314_10078240 3300031711 Bacteria 2190
308 Ga0265342_10037223 3300031712 Bacteria 2968
309 Ga0265342_10269118 3300031712 Bacteria 905
310 Ga0265342_10448586 3300031712 Bacteria 662
311 Ga0373934_0244354 3300035086 Bacteria 742
312 Ga0373944_0037645 3300035089 Unclassified 1483
313 Ga0373936_0044645 3300035113 Bacteria 1783
314 Ga0373957_0314175 3300035120 Unclassified 666
315 Ga0373943_0009138 3300035170 Bacteria 4442
316 Ga0373943_0649011 3300035170 Bacteria 624
317 Ga0373946_0107068 3300035171 Unclassified 1261
318 Ga0373955_0166830 3300035172 Unclassified 1302
319 Ga0373955_0328362 3300035172 Bacteria 925
320 Ga0316574_0191584 3300035398 Bacteria 1315
321 Ga0373924_0181321 3300035410 Bacteria 927
322 Ga0373924_0214452 3300035410 Bacteria 850
323 Ga0373931_0291004 3300035691 Bacteria 1006
324 Ga0373935_0057816 3300035692 Bacteria 2475
325 Ga0373935_1507727 3300035692 Bacteria 503
326 Ga0373927_0132814 3300035695 Unclassified 1627
327 Ga0373933_0032033 3300035724 Bacteria 3054
328 Ga0373933_0884975 3300035724 Bacteria 588
329 Ga0373947_0046027 3300035725 Bacteria 2611
330 Ga0373937_0000190 3300036401 Bacteria 60066
331 Ga0373937_0159859 3300036401 Bacteria 2112
332 Ga0373925_0028769 3300037068 Bacteria 4073
333 Ga0395899_0046750 3300037312 Bacteria 3223
334 Ga0395899_0067359 3300037312 Bacteria 2627
335 Ga0395900_0024705 3300037418 Bacteria 6150
336 Ga0395900_0031531 3300037418 Bacteria 5448
337 Ga0395900_0093099 3300037418 Bacteria 3096
338 Ga0395900_0094234 3300037418 Bacteria 3075
339 Ga0395900_0233437 3300037418 Bacteria 1849
340 Ga0395900_0434568 3300037418 Bacteria 1271
341 Ga0395898_0006598 3300037466 Bacteria 12374
342 Ga0395898_0019301 3300037466 Bacteria 6940
343 Ga0395898_0238766 3300037466 Bacteria 1733
344 Ga0395898_0303013 3300037466 Bacteria 1524
345 Ga0395898_0389211 3300037466 Bacteria 1329
346 Ga0395898_0496706 3300037466 Bacteria 1160
347 Ga0395898_0712086 3300037466 Unclassified 946
348 Ga0395898_0766477 3300037466 Bacteria 906
349 Ga0395898_0915319 3300037466 Unclassified 815
350 Ga0395898_1113346 3300037466 Bacteria 723
351 Ga0395898_1123532 3300037466 Bacteria 719
352 Ga0395898_1130164 3300037466 Bacteria 716
353 Ga0395898_1708121 3300037466 Bacteria 552
354 Ga0395905_0060791 3300037471 Bacteria 3533
355 Ga0395905_0103717 3300037471 Bacteria 2670
356 Ga0395905_0110330 3300037471 Bacteria 2583
357 Ga0395905_0391902 3300037471 Bacteria 1283
358 Ga0436364_0875471 3300037853 Bacteria 2534
359 Ga0395901_0002302 3300038443 Bacteria 19465
360 Ga0395901_0015081 3300038443 Bacteria 7860
361 Ga0395901_0084990 3300038443 Bacteria 3307
362 Ga0395901_0129007 3300038443 Bacteria 2658
363 Ga0395901_0142897 3300038443 Bacteria 2515
364 Ga0395901_0208300 3300038443 Bacteria 2047
365 Ga0395901_0362595 3300038443 Bacteria 1494
366 Ga0242420_046554 3300038996 Bacteria 839
367 Ga0436365_0136550 3300039437 Bacteria 1031
368 Ga0436365_1856328 3300039437 Bacteria 1126
369 Ga0436360_0278534 3300039438 Bacteria 1463
370 Ga0436363_1348721 3300039450 Bacteria 792
371 Ga0436363_1400617 3300039450 Bacteria 4754
372 Ga0436362_0941157 3300039453 Bacteria 555
373 Ga0439448_0219924 3300042005 Bacteria 668
374 Ga0439459_0018949 3300042438 Bacteria 1299
375 Ga0466969_0010551 3300044656 Bacteria 4895
376 Ga0466969_0066414 3300044656 Bacteria 1741
377 Ga0466969_0183616 3300044656 Unclassified 957
378 Ga0466972_0467698 3300044658 Bacteria 593
379 Ga0466965_0019898 3300044683 Bacteria 3223
380 Ga0466965_0026307 3300044683 Bacteria 2821
381 Ga0466965_0075263 3300044683 Bacteria 1702
382 Ga0466965_0086555 3300044683 Unclassified 1590
383 Ga0466966_0007140 3300044684 Bacteria 7404
384 Ga0466966_0010902 3300044684 Bacteria 6035
385 Ga0466966_0030525 3300044684 Bacteria 3499
386 Ga0466966_0035884 3300044684 Bacteria 3202
387 Ga0466966_0200908 3300044684 Unclassified 1206
388 Ga0466966_0203818 3300044684 Unclassified 1196
389 Ga0466966_0220896 3300044684 Bacteria 1144
390 Ga0466961_0005623 3300044693 Bacteria 7919
391 Ga0466961_0008544 3300044693 Bacteria 6524
392 Ga0466961_0012723 3300044693 Bacteria 5388
393 Ga0466961_0015263 3300044693 Bacteria 4933
394 Ga0466961_0018241 3300044693 Bacteria 4511
395 Ga0466961_0083376 3300044693 Unclassified 2022
396 Ga0466961_0094140 3300044693 Bacteria 1890
397 Ga0466961_0264014 3300044693 Bacteria 1055
398 Ga0466963_0000389 3300044694 Bacteria 20047
399 Ga0466963_0000536 3300044694 Bacteria 17838
400 Ga0466963_0000646 3300044694 Bacteria 16751
401 Ga0466963_0000987 3300044694 Bacteria 14655
402 Ga0466963_0001204 3300044694 Bacteria 13617
403 Ga0466963_0009428 3300044694 Bacteria 5879
404 Ga0466963_0010406 3300044694 Bacteria 5630
405 Ga0466963_0022999 3300044694 Bacteria 3953
406 Ga0466963_0033569 3300044694 Bacteria 3333
407 Ga0466963_0035769 3300044694 Bacteria 3236
408 Ga0466963_0039599 3300044694 Bacteria 3087
409 Ga0466963_0045483 3300044694 Bacteria 2891
410 Ga0466963_0084258 3300044694 Unclassified 2156
411 Ga0466963_0189371 3300044694 Bacteria 1437
412 Ga0466963_0258659 3300044694 Unclassified 1222
413 Ga0466963_0449536 3300044694 Bacteria 909
414 Ga0466963_0879769 3300044694 Unclassified 631
415 Ga0466964_0005925 3300044706 Bacteria 4551
416 Ga0466964_0006306 3300044706 Bacteria 4416
417 Ga0466964_0010741 3300044706 Bacteria 3458
418 Ga0466964_0016463 3300044706 Bacteria 2824
419 Ga0466964_0036286 3300044706 Unclassified 1976
420 Ga0466964_0067086 3300044706 Bacteria 1507
421 Ga0466964_0092438 3300044706 Bacteria 1319
422 Ga0466964_0212361 3300044706 Bacteria 935
423 Ga0466964_0464442 3300044706 Bacteria 674
424 Ga0466971_0001797 3300044719 Bacteria 9099
425 Ga0466971_0003174 3300044719 Bacteria 7009
426 Ga0466971_0004890 3300044719 Bacteria 5793
427 Ga0466971_0008423 3300044719 Bacteria 4499
428 Ga0466971_0107427 3300044719 Bacteria 1286
429 Ga0466968_0003025 3300044735 Bacteria 6208
430 Ga0466968_0009757 3300044735 Bacteria 3703
431 Ga0466968_0010237 3300044735 Unclassified 3631
432 Ga0466968_0219322 3300044735 Unclassified 895
433 Ga0466968_0354428 3300044735 Bacteria 713
434 Ga0466968_0557156 3300044735 Bacteria 576
435 Ga0466970_0004839 3300044765 Bacteria 6644
436 Ga0466970_0048010 3300044765 Bacteria 2276
437 Ga0466970_0211809 3300044765 Unclassified 1080
438 Ga0466970_0491093 3300044765 Bacteria 706
439 Ga0466957_0000947 3300044842 Bacteria 14875
440 Ga0466957_0002364 3300044842 Bacteria 10124
441 Ga0466957_0002391 3300044842 Bacteria 10075
442 Ga0466957_0012995 3300044842 Bacteria 4824
443 Ga0466957_0013632 3300044842 Bacteria 4717
444 Ga0466957_0018104 3300044842 Bacteria 4132
445 Ga0466957_0038551 3300044842 Bacteria 2879
446 Ga0466957_0166372 3300044842 Bacteria 1434
447 Ga0466957_0277618 3300044842 Unclassified 1120
448 Ga0466957_0319215 3300044842 Bacteria 1048
449 Ga0466957_0441346 3300044842 Bacteria 896
450 Ga0466960_0008699 3300044901 Bacteria 4165
451 Ga0466960_0051086 3300044901 Bacteria 1996
452 Ga0466959_0000796 3300045049 Bacteria 18577
453 Ga0466959_0002167 3300045049 Bacteria 12476
454 Ga0466959_0008103 3300045049 Bacteria 7411
455 Ga0466959_0013386 3300045049 Bacteria 5947
456 Ga0466959_0019126 3300045049 Bacteria 5035
457 Ga0466959_0020545 3300045049 Bacteria 4867
458 Ga0466959_0031041 3300045049 Bacteria 3954
459 Ga0466959_0171170 3300045049 Unclassified 1523
460 Ga0466959_0174340 3300045049 Bacteria 1507
461 Ga0451576_2074978 3300045051 Bacteria 585
462 Ga0466958_0000599 3300045836 Bacteria 15371
463 Ga0466958_0001043 3300045836 Bacteria 12674
464 Ga0466958_0002334 3300045836 Bacteria 9479
465 Ga0466958_0004076 3300045836 Bacteria 7667
466 Ga0466958_0009390 3300045836 Bacteria 5450
467 Ga0466958_0010965 3300045836 Bacteria 5093
468 Ga0466958_0011716 3300045836 Bacteria 4947
469 Ga0466958_0023140 3300045836 Bacteria 3644
470 Ga0466958_0045953 3300045836 Bacteria 2634
471 Ga0466958_0089461 3300045836 Bacteria 1904
472 Ga0466958_0117350 3300045836 Bacteria 1664
473 Ga0466958_0240540 3300045836 Bacteria 1157
474 Ga0466958_0257285 3300045836 Unclassified 1117
475 Ga0466958_0397757 3300045836 Bacteria 889
476 Ga0466967_0000395 3300045976 Bacteria 20401
477 Ga0466967_0001125 3300045976 Bacteria 14868
478 Ga0466967_0001753 3300045976 Bacteria 12956
479 Ga0466967_0002130 3300045976 Bacteria 12131
480 Ga0466967_0002773 3300045976 Bacteria 11095
481 Ga0466967_0002845 3300045976 Bacteria 10989
482 Ga0466967_0003863 3300045976 Bacteria 9925
483 Ga0466967_0005312 3300045976 Bacteria 8895
484 Ga0466967_0011526 3300045976 Bacteria 6703
485 Ga0466967_0012287 3300045976 Bacteria 6541
486 Ga0466967_0016445 3300045976 Bacteria 5834
487 Ga0466967_0022345 3300045976 Bacteria 5158
488 Ga0466967_0027115 3300045976 Bacteria 4760
489 Ga0466967_0034000 3300045976 Bacteria 4321
490 Ga0466967_0036327 3300045976 Bacteria 4204
491 Ga0466967_0047088 3300045976 Bacteria 3758
492 Ga0466967_0048177 3300045976 Bacteria 3720
493 Ga0466967_0060464 3300045976 Bacteria 3357
494 Ga0466967_0063287 3300045976 Bacteria 3286
495 Ga0466967_0063632 3300045976 Bacteria 3278
496 Ga0466967_0068591 3300045976 Bacteria 3167
497 Ga0466967_0094219 3300045976 Bacteria 2726
498 Ga0466967_0138305 3300045976 Bacteria 2266
499 Ga0466967_0159282 3300045976 Bacteria 2117
500 Ga0466967_0170326 3300045976 Bacteria 2048
501 Ga0466967_0203975 3300045976 Bacteria 1873
502 Ga0466967_0277763 3300045976 Bacteria 1606
503 Ga0466967_0289025 3300045976 Bacteria 1574
504 Ga0466967_1176877 3300045976 Bacteria 764
505 Ga0466967_1195619 3300045976 Unclassified 757
506 Ga0466967_1319235 3300045976 Bacteria 719
507 Ga0466967_1328142 3300045976 Bacteria 716
508 Ga0495592_0000206 3300046454 Bacteria 50513
509 Ga0495592_0094507 3300046454 Bacteria 2140
510 Ga0495592_0376106 3300046454 Bacteria 905
511 Ga0495603_0077848 3300046455 Bacteria 1945
512 Ga0495629_0035063 3300046459 Bacteria 3547
513 Ga0495629_0040717 3300046459 Bacteria 3269
514 Ga0495629_0057556 3300046459 Bacteria 2718
515 Ga0495629_0362341 3300046459 Unclassified 988
516 Ga0495641_0019548 3300046461 Bacteria 3462
517 Ga0495641_0032718 3300046461 Bacteria 2473
518 Ga0495641_0095510 3300046461 Unclassified 1327
519 Ga0495651_0000053 3300046462 Bacteria 85191
520 Ga0495651_0031919 3300046462 Bacteria 4107
521 Ga0495651_0284378 3300046462 Bacteria 1116
522 Ga0495653_0010133 3300046463 Bacteria 7712
523 Ga0495653_0047410 3300046463 Bacteria 3323
524 Ga0495653_0051498 3300046463 Bacteria 3161
525 Ga0495653_0208985 3300046463 Bacteria 1319
526 Ga0495582_0316368 3300046473 Bacteria 898
527 Ga0495582_0374088 3300046473 Unclassified 821
528 Ga0495605_0056718 3300046474 Bacteria 1888
529 Ga0495664_0030198 3300046477 Bacteria 3174
530 Ga0495664_0288888 3300046477 Bacteria 990
531 Ga0495584_0553400 3300046491 Bacteria 586
532 Ga0495596_0067474 3300046500 Bacteria 1390
533 Ga0495608_0001922 3300046511 Bacteria 14905
534 Ga0495608_0002448 3300046511 Bacteria 13326
535 Ga0495608_0025739 3300046511 Bacteria 4017
536 Ga0495608_0331661 3300046511 Bacteria 938
537 Ga0495608_0755572 3300046511 Bacteria 576
538 Ga0495618_0003117 3300046514 Bacteria 10442
539 Ga0495628_0000047 3300046516 Bacteria 97852
540 Ga0495628_0032030 3300046516 Bacteria 4248
541 Ga0495628_0042540 3300046516 Bacteria 3623
542 Ga0495628_0216190 3300046516 Bacteria 1441
543 Ga0495628_0227221 3300046516 Bacteria 1400
544 Ga0495630_0091740 3300046517 Bacteria 2295
545 Ga0495630_0096274 3300046517 Bacteria 2238
546 Ga0495630_0143645 3300046517 Bacteria 1814
547 Ga0495644_0005238 3300046523 Bacteria 5070
548 Ga0495652_0000291 3300046529 Bacteria 59608
549 Ga0495652_0120717 3300046529 Bacteria 2091
550 Ga0495652_0254512 3300046529 Unclassified 1299
551 Ga0495665_0342979 3300046531 Bacteria 761
552 Ga0495640_0001210 3300046533 Bacteria 20182
553 Ga0495640_0047625 3300046533 Bacteria 2966
554 Ga0495640_0184872 3300046533 Bacteria 1327
555 Ga0495640_0246664 3300046533 Bacteria 1120
556 Ga0495640_0344747 3300046533 Unclassified 920
557 Ga0495586_0098154 3300046535 Bacteria 1624
558 Ga0495587_0000756 3300046536 Bacteria 21566
559 Ga0495587_0379113 3300046536 Bacteria 787
560 Ga0495645_0000302 3300046543 Bacteria 35690
561 Ga0495645_0031725 3300046543 Bacteria 3850
562 Ga0495645_0212401 3300046543 Bacteria 1306
563 Ga0495667_0006046 3300046559 Bacteria 8189
564 Ga0495667_0019331 3300046559 Bacteria 4597
565 Ga0495667_0028587 3300046559 Bacteria 3755
566 Ga0495667_0060064 3300046559 Bacteria 2494
567 Ga0495656_0003852 3300046615 Bacteria 5104
568 Ga0495634_0072730 3300046642 Bacteria 2261
569 Ga0495634_0075330 3300046642 Bacteria 2216
570 Ga0495634_0160802 3300046642 Bacteria 1416
571 Ga0495611_0029625 3300046648 Bacteria 2401
572 Ga0495635_0002779 3300046663 Bacteria 11999
573 Ga0495635_0008171 3300046663 Bacteria 7308
574 Ga0495635_0521423 3300046663 Bacteria 781
575 Ga0495635_1012730 3300046663 Bacteria 528
576 Ga0495661_0053493 3300046665 Bacteria 2428
577 Ga0495588_0025372 3300046674 Bacteria 2953
578 Ga0495657_0016979 3300046675 Bacteria 5291
579 Ga0495657_0027854 3300046675 Bacteria 3980
580 Ga0495657_0068851 3300046675 Bacteria 2317
581 Ga0495657_0157915 3300046675 Bacteria 1404
582 Ga0495599_0000063 3300046678 Bacteria 73690
583 Ga0495599_0082769 3300046678 Unclassified 2004
584 Ga0495599_0123388 3300046678 Bacteria 1610
585 Ga0495623_0000132 3300046679 Bacteria 45369
586 Ga0495623_0308072 3300046679 Bacteria 873
587 Ga0495646_0000560 3300046680 Bacteria 20144
588 Ga0495646_0126102 3300046680 Bacteria 1445
589 Ga0495646_0142829 3300046680 Bacteria 1337
590 Ga0495646_0520839 3300046680 Bacteria 609
591 Ga0495647_0478754 3300046681 Bacteria 578
592 Ga0495658_0012623 3300046683 Bacteria 4286
593 Ga0495613_0016285 3300046689 Bacteria 5540
594 Ga0495613_0137256 3300046689 Bacteria 1749
595 Ga0495613_0193218 3300046689 Bacteria 1438
596 Ga0495613_0225300 3300046689 Bacteria 1315
597 Ga0495613_0427562 3300046689 Bacteria 900
598 Ga0495613_0654653 3300046689 Bacteria 695
599 Ga0495624_0141217 3300046690 Bacteria 1475
600 Ga0495624_0373003 3300046690 Bacteria 858
601 Ga0495670_0037409 3300046691 Bacteria 2419
602 Ga0495600_0094858 3300046809 Bacteria 1945
603 Ga0495600_0114641 3300046809 Bacteria 1755
604 Ga0495600_0136123 3300046809 Bacteria 1596
605 Ga0495581_0081804 3300047315 Bacteria 1870
606 Ga0495581_0114935 3300047315 Bacteria 1565
607 Ga0495604_0000004 3300047317 Bacteria 456385
608 Ga0495604_0267489 3300047317 Bacteria 1159
609 Ga0495674_0001271 3300047319 Bacteria 24493
610 Ga0495674_0129177 3300047319 Bacteria 2130
611 Ga0495674_1017115 3300047319 Bacteria 634
612 Ga0495676_0083443 3300047321 Bacteria 2415
613 Ga0495676_0198533 3300047321 Bacteria 1395
614 Ga0495680_0001616 3300047322 Bacteria 23967
615 Ga0495680_0012878 3300047322 Bacteria 7329
616 Ga0495680_0032756 3300047322 Bacteria 4215
617 Ga0495680_0055468 3300047322 Bacteria 3074
618 Ga0495680_0062600 3300047322 Bacteria 2860
619 Ga0495680_0063361 3300047322 Bacteria 2839
620 Ga0495680_0220462 3300047322 Bacteria 1354
621 Ga0495675_0000075 3300047444 Bacteria 69347
622 Ga0495675_0259631 3300047444 Bacteria 1041
623 Ga0495675_0575119 3300047444 Bacteria 641
624 Ga0495675_0627403 3300047444 Bacteria 607
625 Ga0495679_201233 3300047446 Bacteria 524
626 Ga0495685_025396 3300047447 Bacteria 2038
627 Ga0495684_0018019 3300047471 Bacteria 5441
628 Ga0495684_0027348 3300047471 Bacteria 4379
629 Ga0495684_0083626 3300047471 Bacteria 2421
630 Ga0495602_0000524 3300048088 Bacteria 35765
631 Ga0495602_0063973 3300048088 Bacteria 3184
632 Ga0495602_0510892 3300048088 Unclassified 838
633 Ga0496100_1310325 3300048903 Bacteria 571
634 Ga0496101_0191657 3300048904 Bacteria 1578
635 Ga0496101_0352271 3300048904 Bacteria 1157
636 Ga0496101_0558280 3300048904 Bacteria 905
637 Ga0496102_0048878 3300048905 Bacteria 3847
638 Ga0496102_1711394 3300048905 Bacteria 547
639 Ga0496103_0051633 3300048906 Bacteria 2545
640 Ga0496103_0172765 3300048906 Bacteria 1388
641 Ga0496103_0403927 3300048906 Bacteria 878
642 Ga0496104_0135574 3300048907 Bacteria 2365
643 Ga0496104_0148113 3300048907 Bacteria 2254
644 Ga0496104_0179327 3300048907 Bacteria 2028
645 Ga0496104_0569726 3300048907 Bacteria 1043
646 Ga0496104_0897202 3300048907 Bacteria 791
647 Ga0496104_1082675 3300048907 Bacteria 705
648 Ga0496105_0005550 3300048908 Bacteria 9578
649 Ga0496105_0070166 3300048908 Bacteria 2896
650 Ga0496105_0073434 3300048908 Bacteria 2826
651 Ga0496106_0022205 3300048909 Bacteria 4713
652 Ga0496107_0004648 3300048910 Bacteria 9312
653 Ga0496107_1262545 3300048910 Bacteria 529
654 Ga0496108_0610387 3300048911 Unclassified 950
655 Ga0496109_0014835 3300048912 Bacteria 6780
656 Ga0496109_0020587 3300048912 Bacteria 5827
657 Ga0496109_0586192 3300048912 Bacteria 1051
658 Ga0496109_1131024 3300048912 Bacteria 720
659 Ga0496109_1709296 3300048912 Bacteria 563
660 Ga0496110_0013272 3300048913 Bacteria 6803
661 Ga0496110_0302492 3300048913 Bacteria 1457
662 Ga0496110_0375835 3300048913 Bacteria 1295
663 Ga0496110_0914181 3300048913 Bacteria 784
664 Ga0496110_1231809 3300048913 Archaea 657
665 Ga0496111_0021624 3300048914 Bacteria 4496
666 Ga0496111_0078907 3300048914 Bacteria 2401
667 Ga0496112_0001247 3300048915 Bacteria 19238
668 Ga0496112_0002913 3300048915 Bacteria 13932
669 Ga0496112_0040803 3300048915 Bacteria 4538
670 Ga0496112_0129597 3300048915 Bacteria 2493
671 Ga0496112_0193860 3300048915 Bacteria 1993
672 Ga0496112_0283866 3300048915 Bacteria 1602
673 Ga0496112_0300397 3300048915 Bacteria 1551
674 Ga0496112_0309386 3300048915 Bacteria 1525
675 Ga0496112_0800204 3300048915 Bacteria 867
676 Ga0496113_0036399 3300048916 Bacteria 3606
677 Ga0496113_0318612 3300048916 Bacteria 1246
678 Ga0496113_0484512 3300048916 Bacteria 993
679 Ga0496113_0759849 3300048916 Bacteria 771
680 Ga0496113_0932976 3300048916 Bacteria 686
681 Ga0496114_0325666 3300048917 Bacteria 1358
682 Ga0496114_0369586 3300048917 Bacteria 1269
683 Ga0496115_0048290 3300048918 Bacteria 3404
684 Ga0496115_0158585 3300048918 Bacteria 1869
685 Ga0501034_0050008 3300049571 Bacteria 4217
686 Ga0501043_0161143 3300049579 Bacteria 1753
687 Ga0501047_0029619 3300049581 Bacteria 5278
688 Ga0501047_0835616 3300049581 Bacteria 735
689 Ga0501067_0000403 3300049583 Bacteria 23610
690 Ga0501067_0134806 3300049583 Bacteria 1375
691 Ga0501067_0153624 3300049583 Bacteria 1282
692 Ga0501069_0034071 3300049585 Bacteria 2805
693 Ga0501069_0638108 3300049585 Bacteria 640
694 Ga0501069_0807209 3300049585 Bacteria 569
695 Ga0501070_0003902 3300049586 Bacteria 12865
696 Ga0501070_0004537 3300049586 Bacteria 11919
697 Ga0501072_0009358 3300049588 Bacteria 7448
698 Ga0501073_0280516 3300049589 Bacteria 1150
699 Ga0501074_0111891 3300049590 Bacteria 1953
700 Ga0501074_0371078 3300049590 Bacteria 1015
701 Ga0501074_0687067 3300049590 Bacteria 722
702 Ga0501079_0052892 3300049741 Bacteria 3133
703 Ga0501079_0284834 3300049741 Bacteria 1292
704 Ga0501079_0820787 3300049741 Bacteria 732
705 Ga0501080_0012183 3300049742 Bacteria 7878
706 Ga0501080_0100307 3300049742 Bacteria 2686
707 Ga0501080_0642645 3300049742 Bacteria 939
708 Ga0501083_0000684 3300049744 Bacteria 22083
709 Ga0501035_0336047 3300049822 Bacteria 1267
710 nmdc:mga05p37_2189999_c1 3300050507 Unclassified 514
711 nmdc:mga0n895_1195826_c1 3300050512 Unclassified 734
712 nmdc:mga0n895_564008_c1 3300050512 Bacteria 1144
713 nmdc:mga0rr50_2179_c1 3300050513 Bacteria 10969
714 nmdc:mga0rr50_278227_c1 3300050513 Bacteria 1396
715 Ga0495601_0001003 3300053077 Bacteria 15450
716 Ga0495601_0315447 3300053077 Bacteria 1018
717 Ga0495655_0054638 3300053083 Bacteria 1069
718 Ga0495595_0063080 3300053084 Unclassified 1739
719 Ga0495595_0086311 3300053084 Bacteria 1501
720 Ga0495595_0325777 3300053084 Bacteria 774
721 Ga0495619_0002217 3300053085 Bacteria 12867
722 Ga0495619_0015118 3300053085 Bacteria 4879
723 Ga0495619_0047658 3300053085 Bacteria 2822
724 Ga0495619_0100288 3300053085 Bacteria 1970
725 Ga0495619_0259058 3300053085 Unclassified 1205
726 Ga0500616_0014064 3300053153 Bacteria 4614
727 Ga0501084_0200645 3300054114 Bacteria 1683
728 Ga0501082_1064225 3300060353 Bacteria 707
729 Ga0466962_0000178 3300061719 Bacteria 26342
730 Ga0466962_0011490 3300061719 Bacteria 4263
731 Ga0466962_0028387 3300061719 Bacteria 2681
732 Ga0466962_0032266 3300061719 Bacteria 2507
733 Ga0466962_0035367 3300061719 Bacteria 2391
734 Ga0466962_0245712 3300061719 Unclassified 879
735 Ga0466964_0235746
736 Ga0070658_10135083
737 Ga0070658_10206498
738 Ga0070658_10210449
739 Ga0070683_100007834
740 Ga0070683_100032507
741 Ga0070683_100034870
742 Ga0070683_100119713
743 Ga0070683_100271290
744 Ga0070683_100486174
745 Ga0070680_100004322
746 Ga0070680_100007831
747 Ga0070680_100034832
748 Ga0070680_100112342
749 Ga0070680_100558797
750 Ga0070680_100570913
751 Ga0070680_100806932
752 Ga0070680_101433435
753 Ga0070682_100028918
754 Ga0070682_100039720
755 Ga0070682_100110186
756 Ga0070660_100002737
757 Ga0070660_100008650
758 Ga0070660_100014803
759 Ga0070660_100021208
760 Ga0070660_100108071
761 Ga0070660_101615760
762 Ga0070691_10436979
763 Ga0070661_100098665
764 Ga0070661_100363628
765 Ga0070661_100781316
766 Ga0070671_100473411
767 Ga0070659_100079960
768 Ga0070659_100116778
769 Ga0070659_100600612
770 Ga0070659_100820076
771 Ga0070709_10351248
772 Ga0070709_10391495
773 Ga0070709_10866161
774 Ga0070714_100070418
775 Ga0070714_100080710
776 Ga0070714_100122611
777 Ga0070714_100278002
778 Ga0070714_100396497
779 Ga0070714_100779925
780 Ga0070713_100020755
781 Ga0070713_101180149
782 Ga0070711_100451763
783 Ga0070711_100679085
784 Ga0070694_100524024
785 Ga0070663_100645566
786 Ga0070663_101415922
787 Ga0070681_10017455
788 Ga0070681_10022404
789 Ga0070681_10041844
790 Ga0070681_10064712
791 Ga0070681_10079444
792 Ga0070681_10088339
793 Ga0070681_10124094
794 Ga0070681_10133093
795 Ga0070681_10197239
796 Ga0070681_10511835
797 Ga0070707_100205011
798 Ga0070698_100224193
799 Ga0070698_101000736
800 Ga0070699_100632034
801 Ga0070679_100007577
802 Ga0070679_100021157
803 Ga0070679_100078312
804 Ga0070679_100096032
805 Ga0070679_100115774
806 Ga0070679_100167583
807 Ga0070679_100215350
808 Ga0070679_100243235
809 Ga0070679_100380741
810 Ga0070679_100666696
811 Ga0070684_100026363
812 Ga0070684_100043269
813 Ga0070684_100043973
814 Ga0070684_100200248
815 Ga0068853_100174615
816 Ga0068853_100432412
817 Ga0070686_100692924
818 Ga0070695_101087897
819 Ga0070693_100114035
820 Ga0070704_100614951
821 Ga0068855_100053589
822 Ga0068855_100082115
823 Ga0068855_100154532
824 Ga0068855_100257749
825 Ga0068855_100319842
826 Ga0068855_100387402
827 Ga0070664_100084847
828 Ga0068857_100190853
829 Ga0068854_100626946
830 Ga0068854_101444807
831 Ga0068856_100205773
832 Ga0068856_100524503
833 Ga0070702_100164620
834 Ga0068852_100085427
835 Ga0068852_100507384
836 Ga0068852_101275939
837 Ga0081455_10153812
838 Ga0081540_1001437
839 Ga0070717_10042554
840 Ga0070717_10051491
841 Ga0070717_10189716
842 Ga0070716_100073637
843 Ga0070712_100333918
844 Ga0070712_101465745
845 Ga0068871_100441854
846 Ga0075434_100120407
847 Ga0075434_100615746
848 Ga0068865_100762004
849 Ga0075435_100252786
850 Ga0099795_10187765
851 Ga0105240_10094365
852 Ga0105240_10094850
853 Ga0105240_10387133
854 Ga0105240_10494682
855 Ga0105240_10575261
856 Ga0105241_10974373
857 Ga0105242_10294270
858 Ga0105237_10089672
859 Ga0105237_10352693
860 Ga0105238_10025346
861 Ga0105238_10072795
862 Ga0105238_11275432
863 Ga0105238_11426932
864 Ga0105239_10579694
865 Ga0105239_10943751
866 Ga0105239_11346205
867 Ga0157373_10173665
868 Ga0157373_10420728
869 Ga0157373_10572075
870 Ga0157373_10609918
871 Ga0157371_10409870
872 Ga0157370_10011371
873 Ga0157370_10053323
874 Ga0157370_10220551
875 Ga0157370_10241583
876 Ga0157370_10453590
877 Ga0157370_11372124
878 Ga0157369_10002593
879 Ga0157369_10006255
880 Ga0157369_10010168
881 Ga0157369_10105610
882 Ga0157369_10319560
883 Ga0157369_10338265
884 Ga0157369_10440635
885 Ga0157369_10940042
886 Ga0157374_10352657
887 Ga0157374_10508769
888 Ga0163162_10413130
889 Ga0157372_10230491
890 Ga0157372_10250625
891 Ga0157372_10303686
892 Ga0157372_10325043
893 Ga0157372_10735821
894 Ga0157372_11907927
895 Ga0182008_10032867
896 Ga0182008_10219316
897 Ga0182008_10398173
898 Ga0182008_10906798
899 Ga0157377_10434968
900 Ga0182006_1017300
901 Ga0182007_10312500
902 Ga0206356_10185361
903 Ga0206356_11545319
904 Ga0206356_11895991
905 Ga0206354_10165856
906 Ga0206354_10313809
907 Ga0206354_10821376
908 Ga0206354_11083035
909 Ga0206353_10388633
910 Ga0206353_10493334
911 Ga0206353_10552674
912 Ga0206353_11280332
913 Ga0206353_11965947
914 Ga0213876_10111509
915 Ga0224712_10356322
916 Ga0207692_10174767
917 Ga0207647_10481093
918 Ga0207699_10403066
919 Ga0207705_10073327
920 Ga0207705_10130217
921 Ga0207705_10191441
922 Ga0207705_10396450
923 Ga0207707_10014872
924 Ga0207707_10025282
925 Ga0207707_10042631
926 Ga0207707_10078418
927 Ga0207707_10113747
928 Ga0207707_10147276
929 Ga0207707_10188368
930 Ga0207707_10274339
931 Ga0207707_10282352
932 Ga0207707_10628853
933 Ga0207707_10701577
934 Ga0207707_11035012
935 Ga0207695_10145168
936 Ga0207695_10288297
937 Ga0207695_10296864
938 Ga0207695_10958483
939 Ga0207671_10444108
940 Ga0207671_10663981
941 Ga0207671_10694726
942 Ga0207693_10584036
943 Ga0207663_10382194
944 Ga0207660_10004237
945 Ga0207660_10037984
946 Ga0207660_10040055
947 Ga0207660_10094712
948 Ga0207660_10243410
949 Ga0207660_10478836
950 Ga0207660_10742560
951 Ga0207660_11417178
952 Ga0207657_10000720
953 Ga0207657_10000955
954 Ga0207657_10006946
955 Ga0207657_10007990
956 Ga0207657_10091383
957 Ga0207657_10179736
958 Ga0207657_10394895
959 Ga0207657_10424001
960 Ga0207657_11165994
961 Ga0207649_10225204
962 Ga0207652_10016505
963 Ga0207652_10086457
964 Ga0207652_10139930
965 Ga0207652_10152469
966 Ga0207652_10247271
967 Ga0207652_10260939
968 Ga0207652_10305870
969 Ga0207652_10388838
970 Ga0207652_10425623
971 Ga0207652_10427452
972 Ga0207652_10611272
973 Ga0207646_10001000
974 Ga0207646_10425292
975 Ga0207646_10676046
976 Ga0207694_10626895
977 Ga0207694_11007042
978 Ga0207700_10001789
979 Ga0207664_10002169
980 Ga0207664_10045501
981 Ga0207664_10072920
982 Ga0207664_10083336
983 Ga0207664_10149933
984 Ga0207664_10225175
985 Ga0207664_10321485
986 Ga0207664_11227587
987 Ga0207644_11117930
988 Ga0207690_10075567
989 Ga0207690_10134066
990 Ga0207690_10338214
991 Ga0207690_10618152
992 Ga0207665_10510221
993 Ga0207711_10091712
994 Ga0207661_10023507
995 Ga0207661_10171110
996 Ga0207661_10516455
997 Ga0207661_11645028
998 Ga0207667_10222274
999 Ga0207667_10251555
1000 Ga0207667_10401090
1001 Ga0207667_10950726
1002 Ga0207667_11285479
1003 Ga0207640_10249046
1004 Ga0207640_11103980
1005 Ga0207677_10625668
1006 Ga0207639_10078569
1007 Ga0207639_10225820
1008 Ga0207639_10705629
1009 Ga0207639_10822666
1010 Ga0207702_10349528
1011 Ga0207702_10453889
1012 Ga0207674_10226882
1013 Ga0207674_11272760
1014 Ga0207698_10368327
1015 Ga0207698_11014847
1016 Ga0265334_10021483
1017 Ga0265334_10117914
1018 Ga0265318_10285019
1019 Ga0265322_10154455
1020 Ga0265336_10040979
1021 Ga0265336_10108407
1022 Ga0265338_10001662
1023 Ga0265338_10002226
1024 Ga0265338_10006836
1025 Ga0265338_10008316
1026 Ga0265338_10036549
1027 Ga0265338_10896534
1028 Ga0265324_10040746
1029 Ga0265324_10126306
1030 Ga0265328_10129440
1031 Ga0265320_10058039
1032 Ga0265325_10166963
1033 Ga0265325_10231476
1034 Ga0265339_10002685
1035 Ga0265331_10016554
1036 Ga0265327_10037138
1037 Ga0265313_10024574
1038 Ga0265313_10057604
1039 Ga0307514_10186957
1040 Ga0265314_10004238
1041 Ga0265314_10078240
1042 Ga0265342_10037223
1043 Ga0265342_10269118
1044 Ga0265342_10448586
1045 Ga0373934_0244354
1046 Ga0373944_0037645
1047 Ga0373936_0044645
1048 Ga0373957_0314175
1049 Ga0373943_0009138
1050 Ga0373943_0649011
1051 Ga0373946_0107068
1052 Ga0373955_0166830
1053 Ga0373955_0328362
1054 Ga0316574_0191584
1055 Ga0373924_0181321
1056 Ga0373924_0214452
1057 Ga0373931_0291004
1058 Ga0373935_0057816
1059 Ga0373935_1507727
1060 Ga0373927_0132814
1061 Ga0373933_0032033
1062 Ga0373933_0884975
1063 Ga0373947_0046027
1064 Ga0373937_0000190
1065 Ga0373937_0159859
1066 Ga0373925_0028769
1067 Ga0395899_0046750
1068 Ga0395899_0067359
1069 Ga0395900_0024705
1070 Ga0395900_0031531
1071 Ga0395900_0093099
1072 Ga0395900_0094234
1073 Ga0395900_0233437
1074 Ga0395900_0434568
1075 Ga0395898_0006598
1076 Ga0395898_0019301
1077 Ga0395898_0238766
1078 Ga0395898_0303013
1079 Ga0395898_0389211
1080 Ga0395898_0496706
1081 Ga0395898_0712086
1082 Ga0395898_0766477
1083 Ga0395898_0915319
1084 Ga0395898_1113346
1085 Ga0395898_1123532
1086 Ga0395898_1130164
1087 Ga0395898_1708121
1088 Ga0395905_0060791
1089 Ga0395905_0103717
1090 Ga0395905_0110330
1091 Ga0395905_0391902
1092 Ga0436364_0875471
1093 Ga0395901_0002302
1094 Ga0395901_0015081
1095 Ga0395901_0084990
1096 Ga0395901_0129007
1097 Ga0395901_0142897
1098 Ga0395901_0208300
1099 Ga0395901_0362595
1100 Ga0242420_046554
1101 Ga0436365_0136550
1102 Ga0436365_1856328
1103 Ga0436360_0278534
1104 Ga0436363_1348721
1105 Ga0436363_1400617
1106 Ga0436362_0941157
1107 Ga0439448_0219924
1108 Ga0439459_0018949
1109 Ga0466969_0010551
1110 Ga0466969_0066414
1111 Ga0466969_0183616
1112 Ga0466972_0467698
1113 Ga0466965_0019898
1114 Ga0466965_0026307
1115 Ga0466965_0075263
1116 Ga0466965_0086555
1117 Ga0466966_0007140
1118 Ga0466966_0010902
1119 Ga0466966_0030525
1120 Ga0466966_0035884
1121 Ga0466966_0200908
1122 Ga0466966_0203818
1123 Ga0466966_0220896
1124 Ga0466961_0005623
1125 Ga0466961_0008544
1126 Ga0466961_0012723
1127 Ga0466961_0015263
1128 Ga0466961_0018241
1129 Ga0466961_0083376
1130 Ga0466961_0094140
1131 Ga0466961_0264014
1132 Ga0466963_0000389
1133 Ga0466963_0000536
1134 Ga0466963_0000646
1135 Ga0466963_0000987
1136 Ga0466963_0001204
1137 Ga0466963_0009428
1138 Ga0466963_0010406
1139 Ga0466963_0022999
1140 Ga0466963_0033569
1141 Ga0466963_0035769
1142 Ga0466963_0039599
1143 Ga0466963_0045483
1144 Ga0466963_0084258
1145 Ga0466963_0189371
1146 Ga0466963_0258659
1147 Ga0466963_0449536
1148 Ga0466963_0879769
1149 Ga0466964_0005925
1150 Ga0466964_0006306
1151 Ga0466964_0010741
1152 Ga0466964_0016463
1153 Ga0466964_0036286
1154 Ga0466964_0067086
1155 Ga0466964_0092438
1156 Ga0466964_0212361
1157 Ga0466964_0464442
1158 Ga0466971_0001797
1159 Ga0466971_0003174
1160 Ga0466971_0004890
1161 Ga0466971_0008423
1162 Ga0466971_0107427
1163 Ga0466968_0003025
1164 Ga0466968_0009757
1165 Ga0466968_0010237
1166 Ga0466968_0219322
1167 Ga0466968_0354428
1168 Ga0466968_0557156
1169 Ga0466970_0004839
1170 Ga0466970_0048010
1171 Ga0466970_0211809
1172 Ga0466970_0491093
1173 Ga0466957_0000947
1174 Ga0466957_0002364
1175 Ga0466957_0002391
1176 Ga0466957_0012995
1177 Ga0466957_0013632
1178 Ga0466957_0018104
1179 Ga0466957_0038551
1180 Ga0466957_0166372
1181 Ga0466957_0277618
1182 Ga0466957_0319215
1183 Ga0466957_0441346
1184 Ga0466960_0008699
1185 Ga0466960_0051086
1186 Ga0466959_0000796
1187 Ga0466959_0002167
1188 Ga0466959_0008103
1189 Ga0466959_0013386
1190 Ga0466959_0019126
1191 Ga0466959_0020545
1192 Ga0466959_0031041
1193 Ga0466959_0171170
1194 Ga0466959_0174340
1195 Ga0451576_2074978
1196 Ga0466958_0000599
1197 Ga0466958_0001043
1198 Ga0466958_0002334
1199 Ga0466958_0004076
1200 Ga0466958_0009390
1201 Ga0466958_0010965
1202 Ga0466958_0011716
1203 Ga0466958_0023140
1204 Ga0466958_0045953
1205 Ga0466958_0089461
1206 Ga0466958_0117350
1207 Ga0466958_0240540
1208 Ga0466958_0257285
1209 Ga0466958_0397757
1210 Ga0466967_0000395
1211 Ga0466967_0001125
1212 Ga0466967_0001753
1213 Ga0466967_0002130
1214 Ga0466967_0002773
1215 Ga0466967_0002845
1216 Ga0466967_0003863
1217 Ga0466967_0005312
1218 Ga0466967_0011526
1219 Ga0466967_0012287
1220 Ga0466967_0016445
1221 Ga0466967_0022345
1222 Ga0466967_0027115
1223 Ga0466967_0034000
1224 Ga0466967_0036327
1225 Ga0466967_0047088
1226 Ga0466967_0048177
1227 Ga0466967_0060464
1228 Ga0466967_0063287
1229 Ga0466967_0063632
1230 Ga0466967_0068591
1231 Ga0466967_0094219
1232 Ga0466967_0138305
1233 Ga0466967_0159282
1234 Ga0466967_0170326
1235 Ga0466967_0203975
1236 Ga0466967_0277763
1237 Ga0466967_0289025
1238 Ga0466967_1176877
1239 Ga0466967_1195619
1240 Ga0466967_1319235
1241 Ga0466967_1328142
1242 Ga0495592_0000206
1243 Ga0495592_0094507
1244 Ga0495592_0376106
1245 Ga0495603_0077848
1246 Ga0495629_0035063
1247 Ga0495629_0040717
1248 Ga0495629_0057556
1249 Ga0495629_0362341
1250 Ga0495641_0019548
1251 Ga0495641_0032718
1252 Ga0495641_0095510
1253 Ga0495651_0000053
1254 Ga0495651_0031919
1255 Ga0495651_0284378
1256 Ga0495653_0010133
1257 Ga0495653_0047410
1258 Ga0495653_0051498
1259 Ga0495653_0208985
1260 Ga0495582_0316368
1261 Ga0495582_0374088
1262 Ga0495605_0056718
1263 Ga0495664_0030198
1264 Ga0495664_0288888
1265 Ga0495584_0553400
1266 Ga0495596_0067474
1267 Ga0495608_0001922
1268 Ga0495608_0002448
1269 Ga0495608_0025739
1270 Ga0495608_0331661
1271 Ga0495608_0755572
1272 Ga0495618_0003117
1273 Ga0495628_0000047
1274 Ga0495628_0032030
1275 Ga0495628_0042540
1276 Ga0495628_0216190
1277 Ga0495628_0227221
1278 Ga0495630_0091740
1279 Ga0495630_0096274
1280 Ga0495630_0143645
1281 Ga0495644_0005238
1282 Ga0495652_0000291
1283 Ga0495652_0120717
1284 Ga0495652_0254512
1285 Ga0495665_0342979
1286 Ga0495640_0001210
1287 Ga0495640_0047625
1288 Ga0495640_0184872
1289 Ga0495640_0246664
1290 Ga0495640_0344747
1291 Ga0495586_0098154
1292 Ga0495587_0000756
1293 Ga0495587_0379113
1294 Ga0495645_0000302
1295 Ga0495645_0031725
1296 Ga0495645_0212401
1297 Ga0495667_0006046
1298 Ga0495667_0019331
1299 Ga0495667_0028587
1300 Ga0495667_0060064
1301 Ga0495656_0003852
1302 Ga0495634_0072730
1303 Ga0495634_0075330
1304 Ga0495634_0160802
1305 Ga0495611_0029625
1306 Ga0495635_0002779
1307 Ga0495635_0008171
1308 Ga0495635_0521423
1309 Ga0495635_1012730
1310 Ga0495661_0053493
1311 Ga0495588_0025372
1312 Ga0495657_0016979
1313 Ga0495657_0027854
1314 Ga0495657_0068851
1315 Ga0495657_0157915
1316 Ga0495599_0000063
1317 Ga0495599_0082769
1318 Ga0495599_0123388
1319 Ga0495623_0000132
1320 Ga0495623_0308072
1321 Ga0495646_0000560
1322 Ga0495646_0126102
1323 Ga0495646_0142829
1324 Ga0495646_0520839
1325 Ga0495647_0478754
1326 Ga0495658_0012623
1327 Ga0495613_0016285
1328 Ga0495613_0137256
1329 Ga0495613_0193218
1330 Ga0495613_0225300
1331 Ga0495613_0427562
1332 Ga0495613_0654653
1333 Ga0495624_0141217
1334 Ga0495624_0373003
1335 Ga0495670_0037409
1336 Ga0495600_0094858
1337 Ga0495600_0114641
1338 Ga0495600_0136123
1339 Ga0495581_0081804
1340 Ga0495581_0114935
1341 Ga0495604_0000004
1342 Ga0495604_0267489
1343 Ga0495674_0001271
1344 Ga0495674_0129177
1345 Ga0495674_1017115
1346 Ga0495676_0083443
1347 Ga0495676_0198533
1348 Ga0495680_0001616
1349 Ga0495680_0012878
1350 Ga0495680_0032756
1351 Ga0495680_0055468
1352 Ga0495680_0062600
1353 Ga0495680_0063361
1354 Ga0495680_0220462
1355 Ga0495675_0000075
1356 Ga0495675_0259631
1357 Ga0495675_0575119
1358 Ga0495675_0627403
1359 Ga0495679_201233
1360 Ga0495685_025396
1361 Ga0495684_0018019
1362 Ga0495684_0027348
1363 Ga0495684_0083626
1364 Ga0495602_0000524
1365 Ga0495602_0063973
1366 Ga0495602_0510892
1367 Ga0496100_1310325
1368 Ga0496101_0191657
1369 Ga0496101_0352271
1370 Ga0496101_0558280
1371 Ga0496102_0048878
1372 Ga0496102_1711394
1373 Ga0496103_0051633
1374 Ga0496103_0172765
1375 Ga0496103_0403927
1376 Ga0496104_0135574
1377 Ga0496104_0148113
1378 Ga0496104_0179327
1379 Ga0496104_0569726
1380 Ga0496104_0897202
1381 Ga0496104_1082675
1382 Ga0496105_0005550
1383 Ga0496105_0070166
1384 Ga0496105_0073434
1385 Ga0496106_0022205
1386 Ga0496107_0004648
1387 Ga0496107_1262545
1388 Ga0496108_0610387
1389 Ga0496109_0014835
1390 Ga0496109_0020587
1391 Ga0496109_0586192
1392 Ga0496109_1131024
1393 Ga0496109_1709296
1394 Ga0496110_0013272
1395 Ga0496110_0302492
1396 Ga0496110_0375835
1397 Ga0496110_0914181
1398 Ga0496110_1231809
1399 Ga0496111_0021624
1400 Ga0496111_0078907
1401 Ga0496112_0001247
1402 Ga0496112_0002913
1403 Ga0496112_0040803
1404 Ga0496112_0129597
1405 Ga0496112_0193860
1406 Ga0496112_0283866
1407 Ga0496112_0300397
1408 Ga0496112_0309386
1409 Ga0496112_0800204
1410 Ga0496113_0036399
1411 Ga0496113_0318612
1412 Ga0496113_0484512
1413 Ga0496113_0759849
1414 Ga0496113_0932976
1415 Ga0496114_0325666
1416 Ga0496114_0369586
1417 Ga0496115_0048290
1418 Ga0496115_0158585
1419 Ga0501034_0050008
1420 Ga0501043_0161143
1421 Ga0501047_0029619
1422 Ga0501047_0835616
1423 Ga0501067_0000403
1424 Ga0501067_0134806
1425 Ga0501067_0153624
1426 Ga0501069_0034071
1427 Ga0501069_0638108
1428 Ga0501069_0807209
1429 Ga0501070_0003902
1430 Ga0501070_0004537
1431 Ga0501072_0009358
1432 Ga0501073_0280516
1433 Ga0501074_0111891
1434 Ga0501074_0371078
1435 Ga0501074_0687067
1436 Ga0501079_0052892
1437 Ga0501079_0284834
1438 Ga0501079_0820787
1439 Ga0501080_0012183
1440 Ga0501080_0100307
1441 Ga0501080_0642645
1442 Ga0501083_0000684
1443 Ga0501035_0336047
1444 nmdc:mga05p37_2189999_c1
1445 nmdc:mga0n895_1195826_c1
1446 nmdc:mga0n895_564008_c1
1447 nmdc:mga0rr50_2179_c1
1448 nmdc:mga0rr50_278227_c1
1449 Ga0495601_0001003
1450 Ga0495601_0315447
1451 Ga0495655_0054638
1452 Ga0495595_0063080
1453 Ga0495595_0086311
1454 Ga0495595_0325777
1455 Ga0495619_0002217
1456 Ga0495619_0015118
1457 Ga0495619_0047658
1458 Ga0495619_0100288
1459 Ga0495619_0259058
1460 Ga0500616_0014064
1461 Ga0501084_0200645
1462 Ga0501082_1064225
1463 Ga0466962_0000178
1464 Ga0466962_0011490
1465 Ga0466962_0028387
1466 Ga0466962_0032266
1467 Ga0466962_0035367
1468 Ga0466962_0245712

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01575

MaoC_dehydratas

MaoC like domain

23

141

0.92

PF13452

MaoC_dehydrat_N

N-terminal half of MaoC dehydratase

36

152

0.9

PF19315

MC_hydratase

Mesaconyl-CoA hydratase

4

172

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
4e3e-assembly1.cif.gz_A crystal structure of putative maoc domain protein dehydratase from chloroflexus aurantiacus j-10-fl 0.8788 2 145
4o3v-assembly1.cif.gz_A crystal structure of a virb8-like protein of type iv secretion system from rickettsia typhi 0.8781 98 143
7q1v-assembly1.cif.gz_D arches protomer (trimer of trwg/virb8peri) structure from the fully-assembled r388 type iv secretion system determined by cryo-em. 0.8693 98 143
7o41-assembly1.cif.gz_D-1 hexameric composite model of the inner membrane complex (imc) with the arches from the fully-assembled r388 type iv secretion system determined by cryo-em. 0.8693 98 143
8hgn-assembly1.cif.gz_A crystal structure of meac (mesaconyl-coa hydratase) 0.862 2 145
ID Description Score Start End Superfamily
af_I6Y9H2_24_180_3.10.129.10 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8852 2 145 3.10.129.10
4e3eB00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.867 2 145 3.10.129.10
3exzC00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8263 2 144 3.10.129.10
2bi0A01 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8217 2 144 3.10.129.10
4ffuI00 Alpha Beta;Roll;Thiol Ester Dehydrase; Chain A;Hotdog Thioesterase 0.8163 2 144 3.10.129.10
ID Description Score Start End GO Terms
AF-A0A2V9JGK8-F1-model_v4 Dehydratase 0.9372 50 150 GO:0016829
AF-A0A7K0Q0L1-F1-model_v4 MaoC family dehydratase 0.9344 49 148 GO:0016829
AF-A0A6M5J366-F1-model_v4 MaoC family dehydratase 0.9294 2 144 GO:0016829
AF-A0A4R4RX39-F1-model_v4 MaoC family dehydratase 0.9199 1 144 GO:0016829
AF-A0A1F4D0F2-F1-model_v4 Uncharacterized protein 0.9082 3 144 GO:0016829

Map