F478128

General Info

Members Datasets Scaffolds Average Seq Length
734 294 1468 87

Family's Representative Sequence

Representative Sequence 3300005844|Ga0068862_101074265|Ga0068862_1010742652
Length 88
Sequence MDFDQLLVQFFGTAEIAELSPEQLLAGTDRLRLQFGLERDGGRRFALWSLMYMLGVAPDLDVAFKDEEDREAARDFMDMIDSEMDEDE

Samples

Sample ID Description Type Environment
1 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
2 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
14 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
15 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
16 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
17 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
18 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
19 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
20 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
21 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
22 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
23 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
24 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
27 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
28 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
55 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
56 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
57 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
58 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
62 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
63 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
76 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
80 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
81 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
85 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
86 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
91 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300009978 Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
115 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
116 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
117 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
118 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
119 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
120 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
121 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
122 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
123 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
124 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
125 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
185 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
186 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
187 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
188 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
189 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
190 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
191 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
192 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
193 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
196 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
197 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
200 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
201 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
202 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
203 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
204 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
205 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
206 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
207 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
208 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
209 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
212 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
213 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
214 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
215 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
216 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
217 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
218 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
223 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
224 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
225 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
226 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
227 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
228 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
229 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
230 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
231 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
232 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
233 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
234 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
235 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
236 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
237 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
238 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
239 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
240 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
241 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
242 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
243 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
244 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
245 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
246 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
247 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
248 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
249 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
250 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
251 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
252 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
253 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
254 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
255 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
256 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
257 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
258 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
259 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
260 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
261 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
262 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
263 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
264 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
265 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
266 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
267 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
268 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
269 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
270 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
271 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
272 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
273 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
275 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
276 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
277 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
278 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
279 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
280 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
281 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
282 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
283 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
284 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
285 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
286 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
287 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
288 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
289 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
290 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
291 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
292 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
293 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
294 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.41
Nodule 0
Rhizoplane 1.5
Rhizosphere 93.32
Stem 0
Stem Tuber 0
Unclassified 10.49

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068862_101074265 3300005844 Bacteria 799
2 ARcpr5yngRDRAFT_c008208 3300000043 Bacteria 905
3 JGI24740J21852_10008955 3300001979 Bacteria 3951
4 JGI24739J22299_10000052 3300001989 Bacteria 32652
5 JGI24737J22298_10000746 3300001990 Bacteria 11487
6 JGI24737J22298_10002645 3300001990 Bacteria 6333
7 JGI24737J22298_10007187 3300001990 Bacteria 3767
8 JGI24743J22301_10029590 3300001991 Bacteria 1075
9 JGI24735J21928_10146605 3300002067 Bacteria 681
10 JGI24745J21846_1022662 3300002073 Bacteria 741
11 JGI24738J21930_10000194 3300002075 Bacteria 16008
12 JGI24738J21930_10043679 3300002075 Bacteria 911
13 JGI24035J26624_1033553 3300002126 Bacteria 564
14 JGI25406J46586_10114121 3300003203 Bacteria 798
15 rootL2_10041355 3300003322 Bacteria 1318
16 Ga0055537_1000161 3300003773 Bacteria 50226
17 Ga0055524_1000110 3300003775 Bacteria 99255
18 Ga0055531_10017164 3300003794 Bacteria 3071
19 Ga0055543_1004396 3300004625 Bacteria 3858
20 Ga0065165_1004868 3300005262 Bacteria 7968
21 Ga0065165_1036018 3300005262 Bacteria 1513
22 Ga0065704_10138772 3300005289 Bacteria 1540
23 Ga0065712_10004479 3300005290 Bacteria 3854
24 Ga0065712_10024387 3300005290 Unclassified 1496
25 Ga0065715_10050867 3300005293 Bacteria 1395
26 Ga0065707_10809762 3300005295 Unclassified 596
27 Ga0070658_10063760 3300005327 Bacteria 3005
28 Ga0070658_10110716 3300005327 Bacteria 2275
29 Ga0070658_10207610 3300005327 Bacteria 1654
30 Ga0070658_10459425 3300005327 Bacteria 1098
31 Ga0070658_10968735 3300005327 Bacteria 740
32 Ga0070676_10040331 3300005328 Bacteria 2703
33 Ga0070676_10249864 3300005328 Bacteria 1183
34 Ga0070683_100003407 3300005329 Bacteria 12894
35 Ga0070683_100078289 3300005329 Bacteria 3092
36 Ga0070683_100101483 3300005329 Bacteria 2709
37 Ga0070670_100014083 3300005331 Bacteria 6860
38 Ga0070670_100091958 3300005331 Plasmid 2609
39 Ga0070670_100128161 3300005331 Unclassified 2190
40 Ga0070670_100141207 3300005331 Bacteria 2083
41 Ga0070670_100248364 3300005331 Bacteria 1550
42 Ga0070670_101480609 3300005331 Bacteria 623
43 Ga0070670_102060561 3300005331 Unclassified 526
44 Ga0070677_10011419 3300005333 Bacteria 3063
45 Ga0070677_10304628 3300005333 Bacteria 811
46 Ga0068869_100006785 3300005334 Bacteria 7277
47 Ga0068869_100125259 3300005334 Bacteria 1969
48 Ga0068869_100132780 3300005334 Bacteria 1915
49 Ga0070666_10031092 3300005335 Bacteria 3523
50 Ga0070666_10078426 3300005335 Bacteria 2255
51 Ga0070666_10210931 3300005335 Bacteria 1368
52 Ga0070666_10285261 3300005335 Bacteria 1174
53 Ga0070666_10591786 3300005335 Bacteria 809
54 Ga0068868_100023459 3300005338 Bacteria 4670
55 Ga0068868_100054923 3300005338 Bacteria 3141
56 Ga0068868_100584626 3300005338 Bacteria 988
57 Ga0068868_100975670 3300005338 Bacteria 774
58 Ga0070660_100002954 3300005339 Bacteria 11693
59 Ga0070660_100160144 3300005339 Bacteria 1813
60 Ga0070660_100433594 3300005339 Bacteria 1089
61 Ga0070660_101002630 3300005339 Bacteria 706
62 Ga0070689_100303540 3300005340 Bacteria 1329
63 Ga0070687_100169255 3300005343 Bacteria 1299
64 Ga0070687_100770056 3300005343 Unclassified 679
65 Ga0070661_100000010 3300005344 Bacteria 175777
66 Ga0070661_100064463 3300005344 Bacteria 2692
67 Ga0070661_100352024 3300005344 Unclassified 1156
68 Ga0070661_100420589 3300005344 Bacteria 1059
69 Ga0070661_101709287 3300005344 Bacteria 533
70 Ga0070692_10005003 3300005345 Bacteria 5599
71 Ga0070668_100000054 3300005347 Bacteria 71694
72 Ga0070668_100007155 3300005347 Bacteria 8273
73 Ga0070668_100024405 3300005347 Bacteria 4581
74 Ga0070668_100525061 3300005347 Bacteria 1027
75 Ga0070668_100675291 3300005347 Bacteria 909
76 Ga0070669_100000629 3300005353 Bacteria 26123
77 Ga0070669_100000990 3300005353 Bacteria 20731
78 Ga0070669_100105504 3300005353 Bacteria 2132
79 Ga0070669_100312741 3300005353 Bacteria 1266
80 Ga0070669_100498797 3300005353 Bacteria 1009
81 Ga0070669_100911265 3300005353 Bacteria 751
82 Ga0070669_101308322 3300005353 Bacteria 628
83 Ga0070675_100014136 3300005354 Bacteria 6291
84 Ga0070675_100048011 3300005354 Bacteria 3499
85 Ga0070675_100085830 3300005354 Bacteria 2630
86 Ga0070675_100175512 3300005354 Bacteria 1850
87 Ga0070675_100187954 3300005354 Unclassified 1789
88 Ga0070675_100601558 3300005354 Bacteria 997
89 Ga0070671_100000229 3300005355 Bacteria 37462
90 Ga0070671_100000970 3300005355 Bacteria 21012
91 Ga0070671_100005880 3300005355 Bacteria 9775
92 Ga0070671_100024818 3300005355 Bacteria 4912
93 Ga0070671_100039976 3300005355 Bacteria 3894
94 Ga0070671_100579685 3300005355 Bacteria 969
95 Ga0070671_101608862 3300005355 Bacteria 576
96 Ga0070674_100083901 3300005356 Unclassified 2283
97 Ga0070673_100005956 3300005364 Bacteria 7881
98 Ga0070673_100035569 3300005364 Bacteria 3778
99 Ga0070673_100042797 3300005364 Bacteria 3494
100 Ga0070688_100683494 3300005365 Bacteria 793
101 Ga0070659_100001223 3300005366 Bacteria 18648
102 Ga0070659_100016281 3300005366 Bacteria 5581
103 Ga0070659_100020187 3300005366 Bacteria 5059
104 Ga0070659_100053957 3300005366 Plasmid 3165
105 Ga0070659_100097888 3300005366 Bacteria 2358
106 Ga0070659_100120481 3300005366 Bacteria 2124
107 Ga0070659_100224897 3300005366 Unclassified 1550
108 Ga0070667_100010025 3300005367 Bacteria 7850
109 Ga0070667_100100045 3300005367 Bacteria 2503
110 Ga0070667_100593046 3300005367 Bacteria 1020
111 Ga0070667_100619820 3300005367 Unclassified 998
112 Ga0070667_100712937 3300005367 Bacteria 929
113 Ga0070667_101094400 3300005367 Bacteria 745
114 Ga0070714_101281659 3300005435 Unclassified 715
115 Ga0070700_101154323 3300005441 Bacteria 645
116 Ga0070663_100675379 3300005455 Bacteria 876
117 Ga0070663_100720859 3300005455 Bacteria 849
118 Ga0070663_100727942 3300005455 Bacteria 845
119 Ga0070678_100008637 3300005456 Bacteria 6108
120 Ga0070678_100180319 3300005456 Bacteria 1728
121 Ga0070678_100188679 3300005456 Bacteria 1693
122 Ga0070678_101414869 3300005456 Bacteria 649
123 Ga0070662_100009194 3300005457 Bacteria 6452
124 Ga0070662_100021652 3300005457 Bacteria 4393
125 Ga0070662_100037207 3300005457 Bacteria 3449
126 Ga0070662_100039522 3300005457 Plasmid 3355
127 Ga0070662_100039968 3300005457 Bacteria 3338
128 Ga0070662_100046849 3300005457 Plasmid 3107
129 Ga0070662_100088288 3300005457 Bacteria 2323
130 Ga0070662_100625864 3300005457 Bacteria 907
131 Ga0070662_101312926 3300005457 Bacteria 623
132 Ga0070681_10230276 3300005458 Bacteria 1767
133 Ga0070681_10251742 3300005458 Bacteria 1679
134 Ga0070681_11341879 3300005458 Unclassified 638
135 Ga0068867_100008579 3300005459 Bacteria 7214
136 Ga0068867_100042149 3300005459 Bacteria 3337
137 Ga0070685_10266140 3300005466 Bacteria 1142
138 Ga0070706_101182514 3300005467 Unclassified 703
139 Ga0070684_100076644 3300005535 Bacteria 2951
140 Ga0070684_102118936 3300005535 Bacteria 531
141 Ga0068853_100003199 3300005539 Bacteria 12510
142 Ga0068853_100722219 3300005539 Bacteria 951
143 Ga0070672_100003277 3300005543 Bacteria 10478
144 Ga0070672_100024154 3300005543 Bacteria 4487
145 Ga0070672_100062725 3300005543 Bacteria 2934
146 Ga0070672_100087911 3300005543 Bacteria 2501
147 Ga0070672_100184762 3300005543 Bacteria 1738
148 Ga0070672_101552693 3300005543 Unclassified 593
149 Ga0070686_100220886 3300005544 Bacteria 1369
150 Ga0070695_100016774 3300005545 Bacteria 4437
151 Ga0070695_100290149 3300005545 Bacteria 1205
152 Ga0070695_101291409 3300005545 Bacteria 603
153 Ga0070696_100004335 3300005546 Bacteria 9460
154 Ga0070696_100478419 3300005546 Bacteria 987
155 Ga0070693_100056769 3300005547 Bacteria 2261
156 Ga0070665_100000075 3300005548 Bacteria 189496
157 Ga0070665_100000558 3300005548 Bacteria 51892
158 Ga0070665_100002264 3300005548 Bacteria 21390
159 Ga0070665_100011946 3300005548 Bacteria 8771
160 Ga0070665_100025330 3300005548 Bacteria 5977
161 Ga0070665_100268499 3300005548 Bacteria 1708
162 Ga0070665_100302935 3300005548 Bacteria 1601
163 Ga0070665_100429973 3300005548 Bacteria 1329
164 Ga0070665_100592991 3300005548 Unclassified 1121
165 Ga0070704_100129616 3300005549 Bacteria 1952
166 Ga0068855_100004733 3300005563 Bacteria 16622
167 Ga0068855_100039510 3300005563 Bacteria 5602
168 Ga0068855_100748215 3300005563 Bacteria 1042
169 Ga0070664_100002889 3300005564 Bacteria 13905
170 Ga0070664_100027076 3300005564 Bacteria 4763
171 Ga0070664_100043888 3300005564 Bacteria 3774
172 Ga0070664_100058441 3300005564 Bacteria 3280
173 Ga0070664_100175450 3300005564 Bacteria 1902
174 Ga0070664_100280301 3300005564 Unclassified 1503
175 Ga0070664_100371262 3300005564 Bacteria 1304
176 Ga0070664_100619188 3300005564 Bacteria 1005
177 Ga0068857_100001240 3300005577 Bacteria 19917
178 Ga0068857_100013505 3300005577 Bacteria 7115
179 Ga0068857_100107855 3300005577 Bacteria 2502
180 Ga0068854_100021242 3300005578 Bacteria 4403
181 Ga0068854_100229697 3300005578 Bacteria 1472
182 Ga0068854_100373564 3300005578 Bacteria 1173
183 Ga0068854_101935328 3300005578 Bacteria 542
184 Ga0068856_100006165 3300005614 Bacteria 11764
185 Ga0068852_100019422 3300005616 Bacteria 5379
186 Ga0068852_100196907 3300005616 Bacteria 1905
187 Ga0068852_100210893 3300005616 Bacteria 1843
188 Ga0068852_100303639 3300005616 Bacteria 1546
189 Ga0068859_100002593 3300005617 Bacteria 18395
190 Ga0068859_100057439 3300005617 Bacteria 3920
191 Ga0068864_100012308 3300005618 Bacteria 7071
192 Ga0068864_100016278 3300005618 Bacteria 6191
193 Ga0068864_100065140 3300005618 Bacteria 3161
194 Ga0068864_100139532 3300005618 Unclassified 2185
195 Ga0068866_10270059 3300005718 Bacteria 1049
196 Ga0068861_100216738 3300005719 Unclassified 1615
197 Ga0068861_101561588 3300005719 Bacteria 649
198 Ga0068851_10132331 3300005834 Bacteria 1350
199 Ga0068851_10262868 3300005834 Bacteria 982
200 Ga0068851_10518266 3300005834 Bacteria 717
201 Ga0068863_100000020 3300005841 Bacteria 198519
202 Ga0068863_100004204 3300005841 Bacteria 14218
203 Ga0068863_100054970 3300005841 Bacteria 3771
204 Ga0068863_100078579 3300005841 Plasmid 3125
205 Ga0068863_100232680 3300005841 Bacteria 1778
206 Ga0068863_100977787 3300005841 Bacteria 849
207 Ga0068858_100001846 3300005842 Bacteria 21586
208 Ga0068858_100275448 3300005842 Bacteria 1602
209 Ga0068858_100434779 3300005842 Bacteria 1263
210 Ga0068858_100798685 3300005842 Bacteria 921
211 Ga0068860_100012087 3300005843 Bacteria 8503
212 Ga0068860_100016032 3300005843 Bacteria 7308
213 Ga0068860_100019895 3300005843 Bacteria 6510
214 Ga0068860_100023977 3300005843 Bacteria 5898
215 Ga0068860_100038335 3300005843 Bacteria 4584
216 Ga0068860_100041509 3300005843 Bacteria 4394
217 Ga0068860_100083438 3300005843 Bacteria 3039
218 Ga0068860_100205529 3300005843 Bacteria 1909
219 Ga0068862_100005421 3300005844 Bacteria 10653
220 Ga0068862_100011970 3300005844 Bacteria 7165
221 Ga0068862_100078836 3300005844 Bacteria 2854
222 Ga0068862_100263328 3300005844 Bacteria 1574
223 Ga0068862_100279911 3300005844 Bacteria 1528
224 Ga0068862_100881753 3300005844 Unclassified 878
225 Ga0068862_101200831 3300005844 Bacteria 757
226 Ga0081539_10038301 3300005985 Bacteria 2843
227 Ga0075364_10501069 3300006051 Unclassified 830
228 Ga0070715_11032637 3300006163 Bacteria 514
229 Ga0070712_100025145 3300006175 Bacteria 3954
230 Ga0075362_10389251 3300006177 Unclassified 702
231 Ga0097621_100025488 3300006237 Bacteria 4628
232 Ga0097621_100159340 3300006237 Bacteria 1939
233 Ga0097621_100320699 3300006237 Bacteria 1372
234 Ga0075370_10733647 3300006353 Bacteria 601
235 Ga0068871_100048968 3300006358 Bacteria 3414
236 Ga0068871_100222339 3300006358 Bacteria 1636
237 Ga0068871_100558984 3300006358 Bacteria 1037
238 Ga0068871_101694940 3300006358 Bacteria 599
239 Ga0075431_100277613 3300006847 Bacteria 1697
240 Ga0075433_10347220 3300006852 Bacteria 1311
241 Ga0075434_100698641 3300006871 Bacteria 1032
242 Ga0075434_102474469 3300006871 Bacteria 521
243 Ga0097620_100002593 3300006931 Bacteria 18395
244 Ga0097620_100057442 3300006931 Bacteria 3920
245 Ga0075435_100121311 3300007076 Bacteria 2181
246 Ga0075435_101132352 3300007076 Bacteria 684
247 Ga0105251_10002779 3300009011 Bacteria 13307
248 Ga0105250_10140327 3300009092 Bacteria 1001
249 Ga0105240_10091803 3300009093 Bacteria 3709
250 Ga0105245_10000345 3300009098 Bacteria 43597
251 Ga0105245_10309709 3300009098 Bacteria 1552
252 Ga0105245_13123704 3300009098 Bacteria 513
253 Ga0105247_10106231 3300009101 Bacteria 1801
254 Ga0105243_10046192 3300009148 Bacteria 3424
255 Ga0105243_10286423 3300009148 Bacteria 1486
256 Ga0105241_10025393 3300009174 Bacteria 4402
257 Ga0105241_10197293 3300009174 Bacteria 1679
258 Ga0105241_11009883 3300009174 Bacteria 779
259 Ga0105242_10662197 3300009176 Bacteria 1017
260 Ga0105242_10811936 3300009176 Bacteria 927
261 Ga0105248_10003523 3300009177 Bacteria 17362
262 Ga0105248_10034150 3300009177 Bacteria 5686
263 Ga0105248_10112449 3300009177 Bacteria 3071
264 Ga0105248_10583498 3300009177 Bacteria 1261
265 Ga0105248_10763511 3300009177 Bacteria 1091
266 Ga0105237_11010603 3300009545 Bacteria 838
267 Ga0105238_10735576 3300009551 Bacteria 1000
268 Ga0105238_11256241 3300009551 Bacteria 766
269 Ga0105249_10041535 3300009553 Bacteria 4181
270 Ga0105249_10084812 3300009553 Plasmid 2950
271 Ga0105249_10088257 3300009553 Bacteria 2896
272 Ga0105249_10581901 3300009553 Bacteria 1173
273 Ga0105249_11795491 3300009553 Bacteria 686
274 Ga0105148_105103 3300009978 Bacteria 943
275 Ga0105239_10079543 3300010375 Bacteria 3607
276 Ga0105239_10159378 3300010375 Bacteria 2520
277 Ga0105239_11385264 3300010375 Bacteria 812
278 Ga0105246_10000032 3300011119 Bacteria 51397
279 Ga0105246_10035732 3300011119 Bacteria 3323
280 Ga0105246_10048301 3300011119 Bacteria 2909
281 Ga0105246_10699827 3300011119 Unclassified 888
282 Ga0105246_11268796 3300011119 Bacteria 681
283 Ga0157373_10021653 3300013100 Bacteria 4665
284 Ga0157373_10026255 3300013100 Bacteria 4209
285 Ga0157373_10035835 3300013100 Bacteria 3561
286 Ga0157373_10075154 3300013100 Bacteria 2384
287 Ga0157373_10851303 3300013100 Bacteria 674
288 Ga0157373_11301459 3300013100 Bacteria 550
289 Ga0157371_10010808 3300013102 Bacteria 7084
290 Ga0157371_10047354 3300013102 Bacteria 3057
291 Ga0157371_10083282 3300013102 Bacteria 2265
292 Ga0157371_10318103 3300013102 Bacteria 1129
293 Ga0157370_10568483 3300013104 Bacteria 1039
294 Ga0157370_10952296 3300013104 Bacteria 778
295 Ga0157369_10001571 3300013105 Bacteria 27954
296 Ga0157369_10017751 3300013105 Bacteria 7991
297 Ga0157369_10079776 3300013105 Bacteria 3505
298 Ga0157374_10919353 3300013296 Bacteria 893
299 Ga0157374_12003343 3300013296 Bacteria 605
300 Ga0157378_10006791 3300013297 Bacteria 9988
301 Ga0157378_11046793 3300013297 Bacteria 852
302 Ga0157378_12643022 3300013297 Bacteria 554
303 Ga0163162_10073415 3300013306 Bacteria 3477
304 Ga0163162_10151954 3300013306 Bacteria 2434
305 Ga0163162_10792136 3300013306 Unclassified 1066
306 Ga0157372_11034839 3300013307 Bacteria 951
307 Ga0157372_11707910 3300013307 Bacteria 724
308 Ga0157372_13013849 3300013307 Unclassified 538
309 Ga0157375_10060849 3300013308 Bacteria 3747
310 Ga0157375_10248062 3300013308 Bacteria 1941
311 Ga0157375_10333768 3300013308 Bacteria 1681
312 Ga0157375_10370023 3300013308 Bacteria 1599
313 Ga0163163_10012036 3300014325 Bacteria 7872
314 Ga0163163_10404176 3300014325 Bacteria 1424
315 Ga0157377_10005886 3300014745 Bacteria 5802
316 Ga0157377_10027305 3300014745 Bacteria 3064
317 Ga0157377_10504336 3300014745 Bacteria 846
318 Ga0157379_12301410 3300014968 Unclassified 537
319 Ga0157376_11673200 3300014969 Bacteria 671
320 Ga0163161_10106677 3300017792 Bacteria 2090
321 Ga0209565_1000030 3300025263 Bacteria 325058
322 Ga0209673_1002418 3300025273 Bacteria 13001
323 Ga0207673_1029257 3300025290 Bacteria 761
324 Ga0209564_1060832 3300025295 Bacteria 845
325 Ga0209758_1003050 3300025297 Bacteria 15942
326 Ga0209050_1007665 3300025298 Bacteria 5978
327 Ga0209256_1000046 3300025299 Bacteria 325040
328 Ga0209257_1001876 3300025304 Bacteria 22762
329 Ga0207697_10001478 3300025315 Bacteria 12838
330 Ga0207697_10306947 3300025315 Bacteria 704
331 Ga0207656_10091379 3300025321 Bacteria 1382
332 Ga0207656_10445996 3300025321 Bacteria 654
333 Ga0207713_1009744 3300025735 Bacteria 5380
334 Ga0207682_10014635 3300025893 Bacteria 3058
335 Ga0207682_10057329 3300025893 Bacteria 1624
336 Ga0207710_10141524 3300025900 Bacteria 1161
337 Ga0207688_10007449 3300025901 Bacteria 5952
338 Ga0207688_10051666 3300025901 Unclassified 2302
339 Ga0207680_10061034 3300025903 Bacteria 2298
340 Ga0207680_10099023 3300025903 Bacteria 1870
341 Ga0207680_10388208 3300025903 Bacteria 985
342 Ga0207680_10437999 3300025903 Bacteria 927
343 Ga0207647_10001551 3300025904 Bacteria 17676
344 Ga0207647_10001901 3300025904 Bacteria 16005
345 Ga0207647_10060622 3300025904 Unclassified 2312
346 Ga0207647_10237901 3300025904 Bacteria 1046
347 Ga0207647_10337677 3300025904 Bacteria 854
348 Ga0207645_10018418 3300025907 Bacteria 4593
349 Ga0207645_10113085 3300025907 Unclassified 1759
350 Ga0207643_10046516 3300025908 Bacteria 2453
351 Ga0207705_10123872 3300025909 Bacteria 1920
352 Ga0207705_10241421 3300025909 Bacteria 1376
353 Ga0207705_10557285 3300025909 Bacteria 891
354 Ga0207707_11520283 3300025912 Unclassified 530
355 Ga0207695_10325433 3300025913 Bacteria 1426
356 Ga0207671_10442737 3300025914 Bacteria 1034
357 Ga0207693_10124400 3300025915 Bacteria 2026
358 Ga0207662_10180349 3300025918 Bacteria 1359
359 Ga0207662_10859524 3300025918 Bacteria 641
360 Ga0207657_10003211 3300025919 Bacteria 17498
361 Ga0207657_10064075 3300025919 Bacteria 3139
362 Ga0207657_10234973 3300025919 Bacteria 1465
363 Ga0207657_10566609 3300025919 Bacteria 887
364 Ga0207657_10655424 3300025919 Bacteria 817
365 Ga0207649_10000165 3300025920 Bacteria 54047
366 Ga0207649_10193766 3300025920 Bacteria 1431
367 Ga0207649_10235024 3300025920 Bacteria 1313
368 Ga0207649_10270600 3300025920 Bacteria 1231
369 Ga0207681_10001272 3300025923 Bacteria 16283
370 Ga0207681_10002809 3300025923 Bacteria 11019
371 Ga0207681_10102760 3300025923 Bacteria 2064
372 Ga0207681_10103817 3300025923 Unclassified 2055
373 Ga0207681_10989450 3300025923 Unclassified 705
374 Ga0207650_10007589 3300025925 Bacteria 7394
375 Ga0207650_10037594 3300025925 Plasmid 3529
376 Ga0207650_10060888 3300025925 Bacteria 2817
377 Ga0207650_10107774 3300025925 Unclassified 2153
378 Ga0207650_10332219 3300025925 Bacteria 1247
379 Ga0207650_11440275 3300025925 Unclassified 586
380 Ga0207659_10053954 3300025926 Bacteria 2869
381 Ga0207659_10162434 3300025926 Bacteria 1755
382 Ga0207659_10610864 3300025926 Bacteria 930
383 Ga0207659_10648640 3300025926 Bacteria 902
384 Ga0207659_11079172 3300025926 Bacteria 691
385 Ga0207687_10020631 3300025927 Bacteria 4373
386 Ga0207687_10273095 3300025927 Bacteria 1352
387 Ga0207700_10594287 3300025928 Bacteria 985
388 Ga0207644_10000097 3300025931 Bacteria 63086
389 Ga0207644_10001415 3300025931 Bacteria 15455
390 Ga0207644_10004801 3300025931 Bacteria 8802
391 Ga0207644_10134429 3300025931 Bacteria 1897
392 Ga0207644_10669184 3300025931 Bacteria 865
393 Ga0207644_11784549 3300025931 Unclassified 515
394 Ga0207690_10049140 3300025932 Bacteria 2810
395 Ga0207690_10097353 3300025932 Bacteria 2093
396 Ga0207690_10149376 3300025932 Unclassified 1731
397 Ga0207690_10171434 3300025932 Unclassified 1626
398 Ga0207690_10321764 3300025932 Bacteria 1216
399 Ga0207690_10623062 3300025932 Unclassified 882
400 Ga0207706_10001111 3300025933 Bacteria 27391
401 Ga0207706_10005162 3300025933 Bacteria 12188
402 Ga0207706_10006709 3300025933 Bacteria 10640
403 Ga0207706_10007423 3300025933 Bacteria 10137
404 Ga0207706_10014954 3300025933 Bacteria 7027
405 Ga0207706_10019919 3300025933 Bacteria 6030
406 Ga0207706_10049080 3300025933 Bacteria 3731
407 Ga0207706_10116335 3300025933 Bacteria 2352
408 Ga0207706_10398832 3300025933 Bacteria 1193
409 Ga0207706_10456789 3300025933 Bacteria 1104
410 Ga0207706_10492203 3300025933 Bacteria 1059
411 Ga0207706_11691501 3300025933 Bacteria 510
412 Ga0207686_11681175 3300025934 Unclassified 525
413 Ga0207709_10255555 3300025935 Bacteria 1282
414 Ga0207670_10290055 3300025936 Bacteria 1278
415 Ga0207669_10074855 3300025937 Bacteria 2143
416 Ga0207669_10359131 3300025937 Bacteria 1128
417 Ga0207704_10028082 3300025938 Bacteria 3116
418 Ga0207691_10001971 3300025940 Bacteria 20065
419 Ga0207691_10020230 3300025940 Bacteria 6294
420 Ga0207691_10031693 3300025940 Bacteria 4932
421 Ga0207691_10182728 3300025940 Bacteria 1832
422 Ga0207691_10222391 3300025940 Unclassified 1637
423 Ga0207691_10259869 3300025940 Bacteria 1497
424 Ga0207711_10015561 3300025941 Bacteria 6314
425 Ga0207711_10017952 3300025941 Bacteria 5879
426 Ga0207711_10531027 3300025941 Bacteria 1097
427 Ga0207711_11207903 3300025941 Bacteria 698
428 Ga0207689_10001430 3300025942 Bacteria 22793
429 Ga0207689_10016369 3300025942 Bacteria 6280
430 Ga0207689_10247778 3300025942 Bacteria 1473
431 Ga0207689_10388459 3300025942 Bacteria 1163
432 Ga0207689_11349610 3300025942 Bacteria 598
433 Ga0207661_10055783 3300025944 Bacteria 3170
434 Ga0207661_10307862 3300025944 Bacteria 1421
435 Ga0207679_10014639 3300025945 Bacteria 5161
436 Ga0207679_10082578 3300025945 Bacteria 2461
437 Ga0207679_10157231 3300025945 Bacteria 1857
438 Ga0207679_10229829 3300025945 Bacteria 1565
439 Ga0207679_10375384 3300025945 Bacteria 1245
440 Ga0207679_10476327 3300025945 Bacteria 1111
441 Ga0207679_11154517 3300025945 Bacteria 711
442 Ga0207667_10025259 3300025949 Bacteria 6505
443 Ga0207667_11613140 3300025949 Bacteria 617
444 Ga0207651_10002607 3300025960 Bacteria 8617
445 Ga0207651_10213897 3300025960 Bacteria 1554
446 Ga0207712_10013057 3300025961 Bacteria 5322
447 Ga0207712_11388493 3300025961 Bacteria 628
448 Ga0207668_10000039 3300025972 Bacteria 110049
449 Ga0207668_10011187 3300025972 Bacteria 5447
450 Ga0207668_10011407 3300025972 Bacteria 5398
451 Ga0207668_10087472 3300025972 Bacteria 2279
452 Ga0207640_10003428 3300025981 Bacteria 8540
453 Ga0207640_10181583 3300025981 Bacteria 1578
454 Ga0207640_10555602 3300025981 Bacteria 965
455 Ga0207640_10586289 3300025981 Unclassified 942
456 Ga0207640_10872721 3300025981 Bacteria 784
457 Ga0207658_10070267 3300025986 Bacteria 2648
458 Ga0207658_10179262 3300025986 Bacteria 1752
459 Ga0207658_10181587 3300025986 Bacteria 1742
460 Ga0207677_10002862 3300026023 Bacteria 9105
461 Ga0207677_10770904 3300026023 Bacteria 859
462 Ga0207703_10003802 3300026035 Bacteria 12538
463 Ga0207703_10064569 3300026035 Bacteria 3005
464 Ga0207703_10064579 3300026035 Bacteria 3005
465 Ga0207703_11150833 3300026035 Bacteria 746
466 Ga0207639_10049423 3300026041 Bacteria 3189
467 Ga0207639_10134323 3300026041 Bacteria 2052
468 Ga0207639_10320110 3300026041 Bacteria 1377
469 Ga0207639_10899302 3300026041 Bacteria 827
470 Ga0207639_10935306 3300026041 Bacteria 811
471 Ga0207678_10585572 3300026067 Bacteria 977
472 Ga0207678_10942236 3300026067 Bacteria 764
473 Ga0207708_10491540 3300026075 Bacteria 1027
474 Ga0207702_10019331 3300026078 Bacteria 5637
475 Ga0207702_11301731 3300026078 Unclassified 721
476 Ga0207641_10000001 3300026088 Bacteria 1180841
477 Ga0207641_10005158 3300026088 Bacteria 11175
478 Ga0207641_11525720 3300026088 Bacteria 670
479 Ga0207648_10002771 3300026089 Bacteria 18597
480 Ga0207648_10021710 3300026089 Bacteria 5768
481 Ga0207648_11093760 3300026089 Unclassified 748
482 Ga0207676_10001828 3300026095 Bacteria 15589
483 Ga0207676_10307735 3300026095 Bacteria 1449
484 Ga0207676_10714726 3300026095 Bacteria 972
485 Ga0207674_10000338 3300026116 Bacteria 60092
486 Ga0207674_10002837 3300026116 Bacteria 21549
487 Ga0207674_10010854 3300026116 Bacteria 10268
488 Ga0207674_10060137 3300026116 Bacteria 3843
489 Ga0207674_10286344 3300026116 Bacteria 1596
490 Ga0207674_10358600 3300026116 Bacteria 1409
491 Ga0207674_12291296 3300026116 Bacteria 502
492 Ga0207675_100078146 3300026118 Bacteria 3100
493 Ga0207675_100768188 3300026118 Unclassified 976
494 Ga0207683_10022507 3300026121 Bacteria 5409
495 Ga0207683_10143015 3300026121 Unclassified 2156
496 Ga0207683_10247311 3300026121 Bacteria 1627
497 Ga0207683_10409558 3300026121 Bacteria 1248
498 Ga0207683_10787774 3300026121 Bacteria 882
499 Ga0207698_10337869 3300026142 Bacteria 1417
500 Ga0207698_10353623 3300026142 Bacteria 1389
501 Ga0207698_11439828 3300026142 Bacteria 704
502 Ga0207698_12091340 3300026142 Bacteria 580
503 Ga0268266_10000103 3300028379 Bacteria 179736
504 Ga0268266_10001483 3300028379 Bacteria 27834
505 Ga0268266_10001998 3300028379 Bacteria 22799
506 Ga0268266_10024699 3300028379 Bacteria 5114
507 Ga0268266_10096777 3300028379 Bacteria 2595
508 Ga0268266_10304302 3300028379 Bacteria 1488
509 Ga0268266_10453890 3300028379 Unclassified 1219
510 Ga0268266_10500655 3300028379 Bacteria 1160
511 Ga0268266_11128714 3300028379 Bacteria 758
512 Ga0268265_10003351 3300028380 Bacteria 11569
513 Ga0268265_10012599 3300028380 Bacteria 5733
514 Ga0268265_10037844 3300028380 Bacteria 3543
515 Ga0268265_10159431 3300028380 Bacteria 1914
516 Ga0268265_10161680 3300028380 Bacteria 1903
517 Ga0268265_10502869 3300028380 Bacteria 1142
518 Ga0268264_10004713 3300028381 Bacteria 11591
519 Ga0268264_10005624 3300028381 Bacteria 10616
520 Ga0268264_10012697 3300028381 Bacteria 6932
521 Ga0268264_10015899 3300028381 Bacteria 6163
522 Ga0268264_10020080 3300028381 Bacteria 5459
523 Ga0268264_10023541 3300028381 Bacteria 5021
524 Ga0268264_10774222 3300028381 Bacteria 957
525 Ga0265334_10301125 3300028573 Unclassified 549
526 Ga0307408_100092141 3300031548 Bacteria 2290
527 Ga0307408_100169978 3300031548 Bacteria 1740
528 Ga0307408_100656430 3300031548 Bacteria 938
529 Ga0307408_101533255 3300031548 Bacteria 631
530 Ga0307408_102437737 3300031548 Bacteria 508
531 Ga0307405_10033835 3300031731 Bacteria 3036
532 Ga0307405_10157264 3300031731 Bacteria 1605
533 Ga0307405_11482059 3300031731 Bacteria 595
534 Ga0307413_10017906 3300031824 Bacteria 3702
535 Ga0307413_10081655 3300031824 Bacteria 2073
536 Ga0307413_10085792 3300031824 Bacteria 2034
537 Ga0307413_10991327 3300031824 Bacteria 719
538 Ga0307413_12007694 3300031824 Unclassified 521
539 Ga0307410_10005146 3300031852 Bacteria 6881
540 Ga0307410_10196155 3300031852 Bacteria 1538
541 Ga0307406_10050620 3300031901 Bacteria 2634
542 Ga0307406_10145156 3300031901 Bacteria 1685
543 Ga0307407_10036075 3300031903 Bacteria 2721
544 Ga0307407_10037513 3300031903 Bacteria 2678
545 Ga0307412_10084845 3300031911 Bacteria 2200
546 Ga0307412_10562667 3300031911 Bacteria 959
547 Ga0307412_10577573 3300031911 Bacteria 948
548 Ga0307409_100001016 3300031995 Bacteria 13157
549 Ga0307409_100155196 3300031995 Bacteria 1993
550 Ga0307409_100348105 3300031995 Bacteria 1397
551 Ga0307409_101061569 3300031995 Bacteria 830
552 Ga0307409_101350397 3300031995 Bacteria 738
553 Ga0307416_100155106 3300032002 Bacteria 2107
554 Ga0307416_100215748 3300032002 Bacteria 1835
555 Ga0307416_100281253 3300032002 Bacteria 1640
556 Ga0307416_100999302 3300032002 Bacteria 939
557 Ga0307414_10008884 3300032004 Bacteria 5737
558 Ga0307414_10092301 3300032004 Bacteria 2253
559 Ga0307414_11072273 3300032004 Unclassified 743
560 Ga0307414_11553487 3300032004 Bacteria 616
561 Ga0307411_10149508 3300032005 Bacteria 1733
562 Ga0307411_10374254 3300032005 Unclassified 1169
563 Ga0307411_10752859 3300032005 Bacteria 853
564 Ga0307415_100019482 3300032126 Bacteria 4120
565 Ga0307415_100021905 3300032126 Bacteria 3936
566 Ga0307415_100287506 3300032126 Bacteria 1355
567 Ga0307415_100308835 3300032126 Bacteria 1313
568 Ga0307415_100358736 3300032126 Bacteria 1230
569 Ga0307415_100823175 3300032126 Bacteria 849
570 Ga0316583_10034430 3300032133 Bacteria 1797
571 Ga0373953_0256290 3300035117 Unclassified 761
572 Ga0373956_0019830 3300035119 Plasmid 2855
573 Ga0373943_0061206 3300035170 Unclassified 1881
574 Ga0373946_0019703 3300035171 Unclassified 2601
575 Ga0373955_0024315 3300035172 Plasmid 3097
576 Ga0373935_0008133 3300035692 Bacteria 6289
577 Ga0373935_0180617 3300035692 Unclassified 1449
578 Ga0373927_0065913 3300035695 Unclassified 2342
579 Ga0373933_0011384 3300035724 Unclassified 4901
580 Ga0373947_0009216 3300035725 Bacteria 5673
581 Ga0373937_0004283 3300036401 Bacteria 12089
582 Ga0373937_1588157 3300036401 Bacteria 601
583 Ga0316582_0275483 3300036647 Bacteria 1154
584 Ga0316584_0423342 3300036712 Bacteria 945
585 Ga0373925_0010640 3300037068 Bacteria 6673
586 Ga0395899_0003009 3300037312 Bacteria 13459
587 Ga0395899_0003335 3300037312 Bacteria 12732
588 Ga0395899_0133341 3300037312 Unclassified 1772
589 Ga0395899_0159599 3300037312 Bacteria 1594
590 Ga0395899_0235351 3300037312 Bacteria 1263
591 Ga0395899_0250414 3300037312 Bacteria 1216
592 Ga0395899_0370261 3300037312 Bacteria 954
593 Ga0395900_0000294 3300037418 Bacteria 75260
594 Ga0395900_0008356 3300037418 Bacteria 10653
595 Ga0395900_0027604 3300037418 Bacteria 5815
596 Ga0395900_0276239 3300037418 Unclassified 1673
597 Ga0395900_0676182 3300037418 Bacteria 967
598 Ga0395900_0741443 3300037418 Bacteria 913
599 Ga0395900_1041797 3300037418 Bacteria 737
600 Ga0395900_1367448 3300037418 Bacteria 621
601 Ga0395898_0001857 3300037466 Bacteria 27083
602 Ga0395898_0010487 3300037466 Bacteria 9686
603 Ga0395898_0060007 3300037466 Bacteria 3698
604 Ga0395898_0643353 3300037466 Bacteria 1003
605 Ga0395898_0853421 3300037466 Bacteria 850
606 Ga0395905_0000066 3300037471 Bacteria 183121
607 Ga0395905_0001429 3300037471 Bacteria 28769
608 Ga0395905_0018839 3300037471 Bacteria 6546
609 Ga0395905_0032912 3300037471 Bacteria 4874
610 Ga0395905_0051939 3300037471 Bacteria 3839
611 Ga0395905_0133941 3300037471 Unclassified 2331
612 Ga0395905_0197310 3300037471 Bacteria 1887
613 Ga0395905_0211182 3300037471 Unclassified 1818
614 Ga0395905_0253194 3300037471 Unclassified 1645
615 Ga0395905_0300222 3300037471 Bacteria 1493
616 Ga0395905_0770512 3300037471 Bacteria 865
617 Ga0395905_0891149 3300037471 Bacteria 793
618 Ga0395905_1374366 3300037471 Unclassified 610
619 Ga0316581_0101043 3300037588 Bacteria 888
620 Ga0395901_0085267 3300038443 Bacteria 3302
621 Ga0395901_0158945 3300038443 Bacteria 2373
622 Ga0395901_0190202 3300038443 Unclassified 2152
623 Ga0395901_0219397 3300038443 Bacteria 1988
624 Ga0395901_0356245 3300038443 Bacteria 1509
625 Ga0395901_0644847 3300038443 Bacteria 1063
626 Ga0395901_0795348 3300038443 Bacteria 935
627 Ga0395901_0880524 3300038443 Bacteria 878
628 Ga0395901_1404815 3300038443 Unclassified 656
629 Ga0395901_1587926 3300038443 Unclassified 608
630 Ga0395901_2097352 3300038443 Bacteria 510
631 Ga0439436_0023725 3300041404 Bacteria 1813
632 Ga0439436_0027133 3300041404 Bacteria 1677
633 Ga0439439_0015104 3300041406 Bacteria 1883
634 Ga0439461_0000015 3300041410 Bacteria 22241
635 Ga0439461_0008107 3300041410 Bacteria 1876
636 Ga0439466_0121362 3300041411 Bacteria 807
637 Ga0439465_0000240 3300041413 Bacteria 15013
638 Ga0439465_0150287 3300041413 Bacteria 831
639 Ga0439431_0000089 3300041997 Bacteria 14969
640 Ga0439431_0003542 3300041997 Bacteria 3443
641 Ga0439431_0142175 3300041997 Bacteria 678
642 Ga0439433_0099459 3300041999 Bacteria 721
643 Ga0439442_005119 3300042002 Bacteria 2624
644 Ga0439445_0007282 3300042004 Bacteria 2565
645 Ga0439445_0009800 3300042004 Bacteria 2260
646 Ga0439432_009129 3300042006 Bacteria 3463
647 Ga0439432_063656 3300042006 Bacteria 1133
648 Ga0439449_0147613 3300042007 Bacteria 877
649 Ga0439452_030061 3300042010 Bacteria 1343
650 Ga0439452_044505 3300042010 Bacteria 1035
651 Ga0439457_008820 3300042014 Bacteria 2366
652 Ga0439462_0003693 3300042015 Bacteria 3690
653 Ga0439462_0056802 3300042015 Bacteria 1056
654 Ga0450894_014400 3300042131 Bacteria 1042
655 Ga0450898_048223 3300042134 Unclassified 818
656 Ga0450905_034514 3300042142 Bacteria 789
657 Ga0450889_000314 3300042144 Bacteria 5388
658 Ga0439434_0000049 3300042435 Bacteria 29298
659 Ga0466958_0415662 3300045836 Unclassified 869
660 Ga0495627_212927 3300046453 Bacteria 531
661 Ga0495606_0003520 3300046507 Bacteria 16539
662 Ga0495616_0160099 3300046513 Bacteria 1013
663 Ga0495663_0028673 3300046525 Bacteria 1640
664 Ga0495663_0071315 3300046525 Bacteria 1106
665 Ga0495663_0264367 3300046525 Bacteria 613
666 Ga0495598_0290118 3300046537 Unclassified 616
667 Ga0495621_0336169 3300046539 Bacteria 631
668 Ga0495633_0001909 3300046558 Bacteria 15173
669 Ga0495668_0007205 3300046616 Bacteria 7145
670 Ga0495668_0095648 3300046616 Bacteria 1626
671 Ga0495634_0644896 3300046642 Unclassified 612
672 Ga0495625_0439542 3300046660 Bacteria 808
673 Ga0495625_0850141 3300046660 Bacteria 527
674 Ga0495661_0408494 3300046665 Bacteria 659
675 Ga0495623_0130005 3300046679 Unclassified 1508
676 Ga0495669_0000373 3300046684 Bacteria 22713
677 Ga0495669_0013403 3300046684 Bacteria 3492
678 Ga0495669_0025749 3300046684 Bacteria 2567
679 Ga0495669_0039664 3300046684 Bacteria 2085
680 Ga0495669_0180421 3300046684 Bacteria 1006
681 Ga0495670_0375655 3300046691 Unclassified 766
682 Ga0495677_0189532 3300047445 Unclassified 798
683 Ga0495677_0325060 3300047445 Bacteria 606
684 Ga0495685_062838 3300047447 Bacteria 1250
685 Ga0495681_0070093 3300047470 Bacteria 1591
686 Ga0495602_0038092 3300048088 Plasmid 4452
687 Ga0496100_1542235 3300048903 Bacteria 525
688 Ga0496101_0510151 3300048904 Bacteria 950
689 Ga0496101_0638964 3300048904 Unclassified 841
690 Ga0496102_1560297 3300048905 Bacteria 579
691 Ga0496103_0033095 3300048906 Bacteria 3158
692 Ga0496106_0049590 3300048909 Bacteria 3163
693 Ga0496109_0735937 3300048912 Bacteria 924
694 Ga0496110_0046956 3300048913 Bacteria 3779
695 Ga0496110_1286765 3300048913 Bacteria 640
696 Ga0496111_0003784 3300048914 Bacteria 9432
697 Ga0496112_1009028 3300048915 Bacteria 752
698 Ga0496116_0214574 3300048919 Bacteria 993
699 Ga0496117_0260074 3300048920 Bacteria 941
700 Ga0496118_0013499 3300048921 Bacteria 7719
701 Ga0496119_0133113 3300048922 Bacteria 1352
702 Ga0496120_0230058 3300048923 Bacteria 881
703 Ga0496122_0585114 3300048925 Bacteria 525
704 Ga0496124_0013962 3300048927 Bacteria 7800
705 Ga0496124_0183593 3300048927 Bacteria 1607
706 Ga0496125_0124366 3300048928 Bacteria 1831
707 Ga0496125_0152100 3300048928 Bacteria 1587
708 Ga0496125_0273659 3300048928 Bacteria 1050
709 Ga0496126_0076681 3300048929 Bacteria 2965
710 Ga0501047_0662314 3300049581 Bacteria 863
711 Ga0501068_0241992 3300049584 Unclassified 1149
712 Ga0501074_0008823 3300049590 Bacteria 7311
713 Ga0501209_275873 3300049656 Bacteria 527
714 Ga0501217_164878 3300049661 Unclassified 671
715 Ga0501223_060977 3300049663 Bacteria 737
716 Ga0501257_162796 3300049686 Bacteria 622
717 Ga0501234_043420 3300049707 Unclassified 739
718 Ga0501080_0010367 3300049742 Bacteria 8524
719 Ga0501083_1083078 3300049744 Unclassified 522
720 Ga0501241_002634 3300049758 Bacteria 3456
721 nmdc:mga00v17_885550_c1 3300050491 Unclassified 566
722 nmdc:mga06r32_541930_c1 3300050510 Bacteria 1138
723 nmdc:mga0n895_637104_c1 3300050512 Bacteria 1066
724 nmdc:mga0rr50_1077403_c1 3300050513 Bacteria 684
725 nmdc:mga0a205_101831_c1 3300050515 Bacteria 2771
726 Ga0495655_0043518 3300053083 Bacteria 1158
727 Ga0500566_0000788 3300053094 Bacteria 17996
728 Ga0500626_310712 3300053128 Bacteria 551
729 Ga0500658_0000410 3300053134 Bacteria 18563
730 Ga0500658_0001788 3300053134 Bacteria 8484
731 Ga0500658_0027062 3300053134 Bacteria 2214
732 Ga0500568_0005384 3300053139 Bacteria 6621
733 Ga0500604_0015876 3300053151 Bacteria 2068
734 Ga0500604_0092544 3300053151 Bacteria 989
735 Ga0068862_101074265
736 ARcpr5yngRDRAFT_c008208
737 JGI24740J21852_10008955
738 JGI24739J22299_10000052
739 JGI24737J22298_10000746
740 JGI24737J22298_10002645
741 JGI24737J22298_10007187
742 JGI24743J22301_10029590
743 JGI24735J21928_10146605
744 JGI24745J21846_1022662
745 JGI24738J21930_10000194
746 JGI24738J21930_10043679
747 JGI24035J26624_1033553
748 JGI25406J46586_10114121
749 rootL2_10041355
750 Ga0055537_1000161
751 Ga0055524_1000110
752 Ga0055531_10017164
753 Ga0055543_1004396
754 Ga0065165_1004868
755 Ga0065165_1036018
756 Ga0065704_10138772
757 Ga0065712_10004479
758 Ga0065712_10024387
759 Ga0065715_10050867
760 Ga0065707_10809762
761 Ga0070658_10063760
762 Ga0070658_10110716
763 Ga0070658_10207610
764 Ga0070658_10459425
765 Ga0070658_10968735
766 Ga0070676_10040331
767 Ga0070676_10249864
768 Ga0070683_100003407
769 Ga0070683_100078289
770 Ga0070683_100101483
771 Ga0070670_100014083
772 Ga0070670_100091958
773 Ga0070670_100128161
774 Ga0070670_100141207
775 Ga0070670_100248364
776 Ga0070670_101480609
777 Ga0070670_102060561
778 Ga0070677_10011419
779 Ga0070677_10304628
780 Ga0068869_100006785
781 Ga0068869_100125259
782 Ga0068869_100132780
783 Ga0070666_10031092
784 Ga0070666_10078426
785 Ga0070666_10210931
786 Ga0070666_10285261
787 Ga0070666_10591786
788 Ga0068868_100023459
789 Ga0068868_100054923
790 Ga0068868_100584626
791 Ga0068868_100975670
792 Ga0070660_100002954
793 Ga0070660_100160144
794 Ga0070660_100433594
795 Ga0070660_101002630
796 Ga0070689_100303540
797 Ga0070687_100169255
798 Ga0070687_100770056
799 Ga0070661_100000010
800 Ga0070661_100064463
801 Ga0070661_100352024
802 Ga0070661_100420589
803 Ga0070661_101709287
804 Ga0070692_10005003
805 Ga0070668_100000054
806 Ga0070668_100007155
807 Ga0070668_100024405
808 Ga0070668_100525061
809 Ga0070668_100675291
810 Ga0070669_100000629
811 Ga0070669_100000990
812 Ga0070669_100105504
813 Ga0070669_100312741
814 Ga0070669_100498797
815 Ga0070669_100911265
816 Ga0070669_101308322
817 Ga0070675_100014136
818 Ga0070675_100048011
819 Ga0070675_100085830
820 Ga0070675_100175512
821 Ga0070675_100187954
822 Ga0070675_100601558
823 Ga0070671_100000229
824 Ga0070671_100000970
825 Ga0070671_100005880
826 Ga0070671_100024818
827 Ga0070671_100039976
828 Ga0070671_100579685
829 Ga0070671_101608862
830 Ga0070674_100083901
831 Ga0070673_100005956
832 Ga0070673_100035569
833 Ga0070673_100042797
834 Ga0070688_100683494
835 Ga0070659_100001223
836 Ga0070659_100016281
837 Ga0070659_100020187
838 Ga0070659_100053957
839 Ga0070659_100097888
840 Ga0070659_100120481
841 Ga0070659_100224897
842 Ga0070667_100010025
843 Ga0070667_100100045
844 Ga0070667_100593046
845 Ga0070667_100619820
846 Ga0070667_100712937
847 Ga0070667_101094400
848 Ga0070714_101281659
849 Ga0070700_101154323
850 Ga0070663_100675379
851 Ga0070663_100720859
852 Ga0070663_100727942
853 Ga0070678_100008637
854 Ga0070678_100180319
855 Ga0070678_100188679
856 Ga0070678_101414869
857 Ga0070662_100009194
858 Ga0070662_100021652
859 Ga0070662_100037207
860 Ga0070662_100039522
861 Ga0070662_100039968
862 Ga0070662_100046849
863 Ga0070662_100088288
864 Ga0070662_100625864
865 Ga0070662_101312926
866 Ga0070681_10230276
867 Ga0070681_10251742
868 Ga0070681_11341879
869 Ga0068867_100008579
870 Ga0068867_100042149
871 Ga0070685_10266140
872 Ga0070706_101182514
873 Ga0070684_100076644
874 Ga0070684_102118936
875 Ga0068853_100003199
876 Ga0068853_100722219
877 Ga0070672_100003277
878 Ga0070672_100024154
879 Ga0070672_100062725
880 Ga0070672_100087911
881 Ga0070672_100184762
882 Ga0070672_101552693
883 Ga0070686_100220886
884 Ga0070695_100016774
885 Ga0070695_100290149
886 Ga0070695_101291409
887 Ga0070696_100004335
888 Ga0070696_100478419
889 Ga0070693_100056769
890 Ga0070665_100000075
891 Ga0070665_100000558
892 Ga0070665_100002264
893 Ga0070665_100011946
894 Ga0070665_100025330
895 Ga0070665_100268499
896 Ga0070665_100302935
897 Ga0070665_100429973
898 Ga0070665_100592991
899 Ga0070704_100129616
900 Ga0068855_100004733
901 Ga0068855_100039510
902 Ga0068855_100748215
903 Ga0070664_100002889
904 Ga0070664_100027076
905 Ga0070664_100043888
906 Ga0070664_100058441
907 Ga0070664_100175450
908 Ga0070664_100280301
909 Ga0070664_100371262
910 Ga0070664_100619188
911 Ga0068857_100001240
912 Ga0068857_100013505
913 Ga0068857_100107855
914 Ga0068854_100021242
915 Ga0068854_100229697
916 Ga0068854_100373564
917 Ga0068854_101935328
918 Ga0068856_100006165
919 Ga0068852_100019422
920 Ga0068852_100196907
921 Ga0068852_100210893
922 Ga0068852_100303639
923 Ga0068859_100002593
924 Ga0068859_100057439
925 Ga0068864_100012308
926 Ga0068864_100016278
927 Ga0068864_100065140
928 Ga0068864_100139532
929 Ga0068866_10270059
930 Ga0068861_100216738
931 Ga0068861_101561588
932 Ga0068851_10132331
933 Ga0068851_10262868
934 Ga0068851_10518266
935 Ga0068863_100000020
936 Ga0068863_100004204
937 Ga0068863_100054970
938 Ga0068863_100078579
939 Ga0068863_100232680
940 Ga0068863_100977787
941 Ga0068858_100001846
942 Ga0068858_100275448
943 Ga0068858_100434779
944 Ga0068858_100798685
945 Ga0068860_100012087
946 Ga0068860_100016032
947 Ga0068860_100019895
948 Ga0068860_100023977
949 Ga0068860_100038335
950 Ga0068860_100041509
951 Ga0068860_100083438
952 Ga0068860_100205529
953 Ga0068862_100005421
954 Ga0068862_100011970
955 Ga0068862_100078836
956 Ga0068862_100263328
957 Ga0068862_100279911
958 Ga0068862_100881753
959 Ga0068862_101200831
960 Ga0081539_10038301
961 Ga0075364_10501069
962 Ga0070715_11032637
963 Ga0070712_100025145
964 Ga0075362_10389251
965 Ga0097621_100025488
966 Ga0097621_100159340
967 Ga0097621_100320699
968 Ga0075370_10733647
969 Ga0068871_100048968
970 Ga0068871_100222339
971 Ga0068871_100558984
972 Ga0068871_101694940
973 Ga0075431_100277613
974 Ga0075433_10347220
975 Ga0075434_100698641
976 Ga0075434_102474469
977 Ga0097620_100002593
978 Ga0097620_100057442
979 Ga0075435_100121311
980 Ga0075435_101132352
981 Ga0105251_10002779
982 Ga0105250_10140327
983 Ga0105240_10091803
984 Ga0105245_10000345
985 Ga0105245_10309709
986 Ga0105245_13123704
987 Ga0105247_10106231
988 Ga0105243_10046192
989 Ga0105243_10286423
990 Ga0105241_10025393
991 Ga0105241_10197293
992 Ga0105241_11009883
993 Ga0105242_10662197
994 Ga0105242_10811936
995 Ga0105248_10003523
996 Ga0105248_10034150
997 Ga0105248_10112449
998 Ga0105248_10583498
999 Ga0105248_10763511
1000 Ga0105237_11010603
1001 Ga0105238_10735576
1002 Ga0105238_11256241
1003 Ga0105249_10041535
1004 Ga0105249_10084812
1005 Ga0105249_10088257
1006 Ga0105249_10581901
1007 Ga0105249_11795491
1008 Ga0105148_105103
1009 Ga0105239_10079543
1010 Ga0105239_10159378
1011 Ga0105239_11385264
1012 Ga0105246_10000032
1013 Ga0105246_10035732
1014 Ga0105246_10048301
1015 Ga0105246_10699827
1016 Ga0105246_11268796
1017 Ga0157373_10021653
1018 Ga0157373_10026255
1019 Ga0157373_10035835
1020 Ga0157373_10075154
1021 Ga0157373_10851303
1022 Ga0157373_11301459
1023 Ga0157371_10010808
1024 Ga0157371_10047354
1025 Ga0157371_10083282
1026 Ga0157371_10318103
1027 Ga0157370_10568483
1028 Ga0157370_10952296
1029 Ga0157369_10001571
1030 Ga0157369_10017751
1031 Ga0157369_10079776
1032 Ga0157374_10919353
1033 Ga0157374_12003343
1034 Ga0157378_10006791
1035 Ga0157378_11046793
1036 Ga0157378_12643022
1037 Ga0163162_10073415
1038 Ga0163162_10151954
1039 Ga0163162_10792136
1040 Ga0157372_11034839
1041 Ga0157372_11707910
1042 Ga0157372_13013849
1043 Ga0157375_10060849
1044 Ga0157375_10248062
1045 Ga0157375_10333768
1046 Ga0157375_10370023
1047 Ga0163163_10012036
1048 Ga0163163_10404176
1049 Ga0157377_10005886
1050 Ga0157377_10027305
1051 Ga0157377_10504336
1052 Ga0157379_12301410
1053 Ga0157376_11673200
1054 Ga0163161_10106677
1055 Ga0209565_1000030
1056 Ga0209673_1002418
1057 Ga0207673_1029257
1058 Ga0209564_1060832
1059 Ga0209758_1003050
1060 Ga0209050_1007665
1061 Ga0209256_1000046
1062 Ga0209257_1001876
1063 Ga0207697_10001478
1064 Ga0207697_10306947
1065 Ga0207656_10091379
1066 Ga0207656_10445996
1067 Ga0207713_1009744
1068 Ga0207682_10014635
1069 Ga0207682_10057329
1070 Ga0207710_10141524
1071 Ga0207688_10007449
1072 Ga0207688_10051666
1073 Ga0207680_10061034
1074 Ga0207680_10099023
1075 Ga0207680_10388208
1076 Ga0207680_10437999
1077 Ga0207647_10001551
1078 Ga0207647_10001901
1079 Ga0207647_10060622
1080 Ga0207647_10237901
1081 Ga0207647_10337677
1082 Ga0207645_10018418
1083 Ga0207645_10113085
1084 Ga0207643_10046516
1085 Ga0207705_10123872
1086 Ga0207705_10241421
1087 Ga0207705_10557285
1088 Ga0207707_11520283
1089 Ga0207695_10325433
1090 Ga0207671_10442737
1091 Ga0207693_10124400
1092 Ga0207662_10180349
1093 Ga0207662_10859524
1094 Ga0207657_10003211
1095 Ga0207657_10064075
1096 Ga0207657_10234973
1097 Ga0207657_10566609
1098 Ga0207657_10655424
1099 Ga0207649_10000165
1100 Ga0207649_10193766
1101 Ga0207649_10235024
1102 Ga0207649_10270600
1103 Ga0207681_10001272
1104 Ga0207681_10002809
1105 Ga0207681_10102760
1106 Ga0207681_10103817
1107 Ga0207681_10989450
1108 Ga0207650_10007589
1109 Ga0207650_10037594
1110 Ga0207650_10060888
1111 Ga0207650_10107774
1112 Ga0207650_10332219
1113 Ga0207650_11440275
1114 Ga0207659_10053954
1115 Ga0207659_10162434
1116 Ga0207659_10610864
1117 Ga0207659_10648640
1118 Ga0207659_11079172
1119 Ga0207687_10020631
1120 Ga0207687_10273095
1121 Ga0207700_10594287
1122 Ga0207644_10000097
1123 Ga0207644_10001415
1124 Ga0207644_10004801
1125 Ga0207644_10134429
1126 Ga0207644_10669184
1127 Ga0207644_11784549
1128 Ga0207690_10049140
1129 Ga0207690_10097353
1130 Ga0207690_10149376
1131 Ga0207690_10171434
1132 Ga0207690_10321764
1133 Ga0207690_10623062
1134 Ga0207706_10001111
1135 Ga0207706_10005162
1136 Ga0207706_10006709
1137 Ga0207706_10007423
1138 Ga0207706_10014954
1139 Ga0207706_10019919
1140 Ga0207706_10049080
1141 Ga0207706_10116335
1142 Ga0207706_10398832
1143 Ga0207706_10456789
1144 Ga0207706_10492203
1145 Ga0207706_11691501
1146 Ga0207686_11681175
1147 Ga0207709_10255555
1148 Ga0207670_10290055
1149 Ga0207669_10074855
1150 Ga0207669_10359131
1151 Ga0207704_10028082
1152 Ga0207691_10001971
1153 Ga0207691_10020230
1154 Ga0207691_10031693
1155 Ga0207691_10182728
1156 Ga0207691_10222391
1157 Ga0207691_10259869
1158 Ga0207711_10015561
1159 Ga0207711_10017952
1160 Ga0207711_10531027
1161 Ga0207711_11207903
1162 Ga0207689_10001430
1163 Ga0207689_10016369
1164 Ga0207689_10247778
1165 Ga0207689_10388459
1166 Ga0207689_11349610
1167 Ga0207661_10055783
1168 Ga0207661_10307862
1169 Ga0207679_10014639
1170 Ga0207679_10082578
1171 Ga0207679_10157231
1172 Ga0207679_10229829
1173 Ga0207679_10375384
1174 Ga0207679_10476327
1175 Ga0207679_11154517
1176 Ga0207667_10025259
1177 Ga0207667_11613140
1178 Ga0207651_10002607
1179 Ga0207651_10213897
1180 Ga0207712_10013057
1181 Ga0207712_11388493
1182 Ga0207668_10000039
1183 Ga0207668_10011187
1184 Ga0207668_10011407
1185 Ga0207668_10087472
1186 Ga0207640_10003428
1187 Ga0207640_10181583
1188 Ga0207640_10555602
1189 Ga0207640_10586289
1190 Ga0207640_10872721
1191 Ga0207658_10070267
1192 Ga0207658_10179262
1193 Ga0207658_10181587
1194 Ga0207677_10002862
1195 Ga0207677_10770904
1196 Ga0207703_10003802
1197 Ga0207703_10064569
1198 Ga0207703_10064579
1199 Ga0207703_11150833
1200 Ga0207639_10049423
1201 Ga0207639_10134323
1202 Ga0207639_10320110
1203 Ga0207639_10899302
1204 Ga0207639_10935306
1205 Ga0207678_10585572
1206 Ga0207678_10942236
1207 Ga0207708_10491540
1208 Ga0207702_10019331
1209 Ga0207702_11301731
1210 Ga0207641_10000001
1211 Ga0207641_10005158
1212 Ga0207641_11525720
1213 Ga0207648_10002771
1214 Ga0207648_10021710
1215 Ga0207648_11093760
1216 Ga0207676_10001828
1217 Ga0207676_10307735
1218 Ga0207676_10714726
1219 Ga0207674_10000338
1220 Ga0207674_10002837
1221 Ga0207674_10010854
1222 Ga0207674_10060137
1223 Ga0207674_10286344
1224 Ga0207674_10358600
1225 Ga0207674_12291296
1226 Ga0207675_100078146
1227 Ga0207675_100768188
1228 Ga0207683_10022507
1229 Ga0207683_10143015
1230 Ga0207683_10247311
1231 Ga0207683_10409558
1232 Ga0207683_10787774
1233 Ga0207698_10337869
1234 Ga0207698_10353623
1235 Ga0207698_11439828
1236 Ga0207698_12091340
1237 Ga0268266_10000103
1238 Ga0268266_10001483
1239 Ga0268266_10001998
1240 Ga0268266_10024699
1241 Ga0268266_10096777
1242 Ga0268266_10304302
1243 Ga0268266_10453890
1244 Ga0268266_10500655
1245 Ga0268266_11128714
1246 Ga0268265_10003351
1247 Ga0268265_10012599
1248 Ga0268265_10037844
1249 Ga0268265_10159431
1250 Ga0268265_10161680
1251 Ga0268265_10502869
1252 Ga0268264_10004713
1253 Ga0268264_10005624
1254 Ga0268264_10012697
1255 Ga0268264_10015899
1256 Ga0268264_10020080
1257 Ga0268264_10023541
1258 Ga0268264_10774222
1259 Ga0265334_10301125
1260 Ga0307408_100092141
1261 Ga0307408_100169978
1262 Ga0307408_100656430
1263 Ga0307408_101533255
1264 Ga0307408_102437737
1265 Ga0307405_10033835
1266 Ga0307405_10157264
1267 Ga0307405_11482059
1268 Ga0307413_10017906
1269 Ga0307413_10081655
1270 Ga0307413_10085792
1271 Ga0307413_10991327
1272 Ga0307413_12007694
1273 Ga0307410_10005146
1274 Ga0307410_10196155
1275 Ga0307406_10050620
1276 Ga0307406_10145156
1277 Ga0307407_10036075
1278 Ga0307407_10037513
1279 Ga0307412_10084845
1280 Ga0307412_10562667
1281 Ga0307412_10577573
1282 Ga0307409_100001016
1283 Ga0307409_100155196
1284 Ga0307409_100348105
1285 Ga0307409_101061569
1286 Ga0307409_101350397
1287 Ga0307416_100155106
1288 Ga0307416_100215748
1289 Ga0307416_100281253
1290 Ga0307416_100999302
1291 Ga0307414_10008884
1292 Ga0307414_10092301
1293 Ga0307414_11072273
1294 Ga0307414_11553487
1295 Ga0307411_10149508
1296 Ga0307411_10374254
1297 Ga0307411_10752859
1298 Ga0307415_100019482
1299 Ga0307415_100021905
1300 Ga0307415_100287506
1301 Ga0307415_100308835
1302 Ga0307415_100358736
1303 Ga0307415_100823175
1304 Ga0316583_10034430
1305 Ga0373953_0256290
1306 Ga0373956_0019830
1307 Ga0373943_0061206
1308 Ga0373946_0019703
1309 Ga0373955_0024315
1310 Ga0373935_0008133
1311 Ga0373935_0180617
1312 Ga0373927_0065913
1313 Ga0373933_0011384
1314 Ga0373947_0009216
1315 Ga0373937_0004283
1316 Ga0373937_1588157
1317 Ga0316582_0275483
1318 Ga0316584_0423342
1319 Ga0373925_0010640
1320 Ga0395899_0003009
1321 Ga0395899_0003335
1322 Ga0395899_0133341
1323 Ga0395899_0159599
1324 Ga0395899_0235351
1325 Ga0395899_0250414
1326 Ga0395899_0370261
1327 Ga0395900_0000294
1328 Ga0395900_0008356
1329 Ga0395900_0027604
1330 Ga0395900_0276239
1331 Ga0395900_0676182
1332 Ga0395900_0741443
1333 Ga0395900_1041797
1334 Ga0395900_1367448
1335 Ga0395898_0001857
1336 Ga0395898_0010487
1337 Ga0395898_0060007
1338 Ga0395898_0643353
1339 Ga0395898_0853421
1340 Ga0395905_0000066
1341 Ga0395905_0001429
1342 Ga0395905_0018839
1343 Ga0395905_0032912
1344 Ga0395905_0051939
1345 Ga0395905_0133941
1346 Ga0395905_0197310
1347 Ga0395905_0211182
1348 Ga0395905_0253194
1349 Ga0395905_0300222
1350 Ga0395905_0770512
1351 Ga0395905_0891149
1352 Ga0395905_1374366
1353 Ga0316581_0101043
1354 Ga0395901_0085267
1355 Ga0395901_0158945
1356 Ga0395901_0190202
1357 Ga0395901_0219397
1358 Ga0395901_0356245
1359 Ga0395901_0644847
1360 Ga0395901_0795348
1361 Ga0395901_0880524
1362 Ga0395901_1404815
1363 Ga0395901_1587926
1364 Ga0395901_2097352
1365 Ga0439436_0023725
1366 Ga0439436_0027133
1367 Ga0439439_0015104
1368 Ga0439461_0000015
1369 Ga0439461_0008107
1370 Ga0439466_0121362
1371 Ga0439465_0000240
1372 Ga0439465_0150287
1373 Ga0439431_0000089
1374 Ga0439431_0003542
1375 Ga0439431_0142175
1376 Ga0439433_0099459
1377 Ga0439442_005119
1378 Ga0439445_0007282
1379 Ga0439445_0009800
1380 Ga0439432_009129
1381 Ga0439432_063656
1382 Ga0439449_0147613
1383 Ga0439452_030061
1384 Ga0439452_044505
1385 Ga0439457_008820
1386 Ga0439462_0003693
1387 Ga0439462_0056802
1388 Ga0450894_014400
1389 Ga0450898_048223
1390 Ga0450905_034514
1391 Ga0450889_000314
1392 Ga0439434_0000049
1393 Ga0466958_0415662
1394 Ga0495627_212927
1395 Ga0495606_0003520
1396 Ga0495616_0160099
1397 Ga0495663_0028673
1398 Ga0495663_0071315
1399 Ga0495663_0264367
1400 Ga0495598_0290118
1401 Ga0495621_0336169
1402 Ga0495633_0001909
1403 Ga0495668_0007205
1404 Ga0495668_0095648
1405 Ga0495634_0644896
1406 Ga0495625_0439542
1407 Ga0495625_0850141
1408 Ga0495661_0408494
1409 Ga0495623_0130005
1410 Ga0495669_0000373
1411 Ga0495669_0013403
1412 Ga0495669_0025749
1413 Ga0495669_0039664
1414 Ga0495669_0180421
1415 Ga0495670_0375655
1416 Ga0495677_0189532
1417 Ga0495677_0325060
1418 Ga0495685_062838
1419 Ga0495681_0070093
1420 Ga0495602_0038092
1421 Ga0496100_1542235
1422 Ga0496101_0510151
1423 Ga0496101_0638964
1424 Ga0496102_1560297
1425 Ga0496103_0033095
1426 Ga0496106_0049590
1427 Ga0496109_0735937
1428 Ga0496110_0046956
1429 Ga0496110_1286765
1430 Ga0496111_0003784
1431 Ga0496112_1009028
1432 Ga0496116_0214574
1433 Ga0496117_0260074
1434 Ga0496118_0013499
1435 Ga0496119_0133113
1436 Ga0496120_0230058
1437 Ga0496122_0585114
1438 Ga0496124_0013962
1439 Ga0496124_0183593
1440 Ga0496125_0124366
1441 Ga0496125_0152100
1442 Ga0496125_0273659
1443 Ga0496126_0076681
1444 Ga0501047_0662314
1445 Ga0501068_0241992
1446 Ga0501074_0008823
1447 Ga0501209_275873
1448 Ga0501217_164878
1449 Ga0501223_060977
1450 Ga0501257_162796
1451 Ga0501234_043420
1452 Ga0501080_0010367
1453 Ga0501083_1083078
1454 Ga0501241_002634
1455 nmdc:mga00v17_885550_c1
1456 nmdc:mga06r32_541930_c1
1457 nmdc:mga0n895_637104_c1
1458 nmdc:mga0rr50_1077403_c1
1459 nmdc:mga0a205_101831_c1
1460 Ga0495655_0043518
1461 Ga0500566_0000788
1462 Ga0500626_310712
1463 Ga0500658_0000410
1464 Ga0500658_0001788
1465 Ga0500658_0027062
1466 Ga0500568_0005384
1467 Ga0500604_0015876
1468 Ga0500604_0092544

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
3osx-assembly1.cif.gz_A crystal structure of apical domain of insecticidal groel from xenorhapdus nematophila 0.7946 20 59
3m6c-assembly1.cif.gz_A crystal structure of mycobacterium tuberculosis groel1 apical domain 0.7865 20 59
6w2v-assembly1.cif.gz_A junction 23, dhr14-dhr18 0.4885 5 84
6w2v-assembly1.cif.gz_A junction 23, dhr14-dhr18 0.459 5 84
7kzr-assembly1.cif.gz_E structure of the human fanconi anaemia core-ube2t-id complex 0.4122 14 82
ID Description Score Start End Superfamily
af_R4GEQ6_587_710_1.10.1040.10 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9596 19 56 1.10.1040.10
af_Q9VI25_6_233_1.25.10.10 Mainly Alpha;Alpha Horseshoe;Leucine-rich Repeat Variant;Leucine-rich Repeat Variant 0.8229 20 57 1.25.10.10
af_A0A0P0W8U0_77_175_1.50.10.130 Mainly Alpha;Alpha/alpha barrel;Glycosyltransferase;Terpene synthase, N-terminal domain 0.7221 28 55 1.50.10.130
af_I1M5X0_311_433_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5888 28 81 1.25.40.10
af_Q54SX4_1_393_1.25.40.10 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Tetratricopeptide repeat domain 0.5714 2 55 1.25.40.10
ID Description Score Start End GO Terms
AF-A0A0A1WBG5-F1-model_v4 Uncharacterized protein 0.9827 1 83
AF-A0A326GCY1-F1-model_v4 HPr domain-containing protein 0.9802 19 85
AF-W0AL81-F1-model_v4 Uncharacterized protein 0.9798 1 83
AF-A0A2M7HHK6-F1-model_v4 deleted 0.9749 1 84
AF-A0A7W9BBT5-F1-model_v4 Uncharacterized protein 0.9738 1 83

Map