F478122

General Info

Members Datasets Scaffolds Average Seq Length
734 337 1468 79

Family's Representative Sequence

Representative Sequence 3300005438|Ga0070701_11237876|Ga0070701_112378761
Length 92
Sequence LSRRRCGRWTLRAPVADFVIRIPRVSVAVSEAELTEILVNAGEHVEEGTPIYVIATEKVEQEIEAGASGTVQWTGQVGTTYDIGAEIGVITS

Samples

Sample ID Description Type Environment
1 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
10 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
14 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
48 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
88 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
89 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
91 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
92 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
93 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
94 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
99 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
113 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
114 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
115 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
129 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
130 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
131 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
132 3300025223 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
195 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
196 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
197 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
198 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
199 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
200 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
201 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
202 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
203 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
204 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
205 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
206 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
207 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
210 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
211 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
212 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
213 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
214 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
215 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
216 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
217 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
218 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
219 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
220 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
223 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
224 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
225 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
226 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
227 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
228 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
229 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
230 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
231 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
232 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
233 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
234 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
235 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
236 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
237 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
238 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
239 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
240 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
241 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
242 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
243 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
244 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
245 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
248 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
249 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
250 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
251 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
252 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
253 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
254 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
255 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
256 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
257 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
258 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
259 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
260 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
261 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
262 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
263 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
264 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
265 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
266 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
267 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
268 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
269 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
270 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
271 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
272 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
273 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
274 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
275 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
276 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
277 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
278 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
279 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
280 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
281 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
282 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
283 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
284 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
285 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
286 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
287 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
288 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
289 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
290 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
291 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
292 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
293 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
294 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
295 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
296 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
297 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
298 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
299 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
300 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
301 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
302 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
303 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
304 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
305 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
306 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
307 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
308 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
309 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
310 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
311 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
313 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
314 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
315 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
316 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
317 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
318 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
319 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
320 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
321 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
322 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
323 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
324 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
325 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
326 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
327 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
328 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
329 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
330 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
331 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
332 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
333 2508501039 Frankia saprophytica CN3 Isolate Nodule
334 2684623035 Frankia sp. NRRL B-16219 Isolate Rhizosphere
335 2687453737 Frankia sp. BMG5.36 Isolate Nodule
336 2687453743 Frankia colletiae Cc1.17 Isolate Nodule
337 2895880812 Frankia sp. BMG5.11 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 0
Isolates 1.09

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.49
Nodule 0.54
Rhizoplane 9.81
Rhizosphere 76.84
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070701_11237876 3300005438 Bacteria 531
2 JGI24746J21847_1003844 3300001977 Bacteria 2372
3 JGI24747J21853_1040525 3300001978 Bacteria 551
4 JGI24739J22299_10142746 3300001989 Bacteria 709
5 JGI24739J22299_10167850 3300001989 Bacteria 647
6 JGI24737J22298_10067153 3300001990 Bacteria 1073
7 JGI24743J22301_10069859 3300001991 Bacteria 732
8 JGI24750J21931_1010568 3300002070 Bacteria 1204
9 JGI24750J21931_1014002 3300002070 Bacteria 1076
10 JGI24745J21846_1003575 3300002073 Bacteria 1634
11 JGI24738J21930_10102929 3300002075 Bacteria 610
12 JGI24749J21850_1006529 3300002076 Bacteria 1625
13 JGI24744J21845_10004148 3300002077 Bacteria 2987
14 JGI24034J26672_10005717 3300002239 Bacteria 1787
15 JGI24742J22300_10000982 3300002244 Bacteria 4370
16 JGI24751J29686_10022339 3300002459 Bacteria 1313
17 Ga0070676_10003809 3300005328 Bacteria 7914
18 Ga0070676_10111686 3300005328 Bacteria 1703
19 Ga0070683_100949319 3300005329 Bacteria 825
20 Ga0070690_100143236 3300005330 Bacteria 1624
21 Ga0070677_10293857 3300005333 Bacteria 823
22 Ga0068869_100352668 3300005334 Bacteria 1200
23 Ga0068869_101691055 3300005334 Bacteria 565
24 Ga0070666_10027962 3300005335 Bacteria 3698
25 Ga0070666_10138787 3300005335 Bacteria 1693
26 Ga0070680_101358935 3300005336 Bacteria 615
27 Ga0070682_100004846 3300005337 Bacteria 7474
28 Ga0070682_100008532 3300005337 Bacteria 5787
29 Ga0070682_100114231 3300005337 Bacteria 1804
30 Ga0070682_100202482 3300005337 Bacteria 1401
31 Ga0070682_102003385 3300005337 Bacteria 509
32 Ga0068868_100006571 3300005338 Bacteria 8238
33 Ga0068868_100050862 3300005338 Bacteria 3256
34 Ga0068868_100225213 3300005338 Bacteria 1571
35 Ga0070660_100308245 3300005339 Bacteria 1299
36 Ga0070689_100017358 3300005340 Bacteria 5284
37 Ga0070689_100695098 3300005340 Bacteria 888
38 Ga0070689_102047397 3300005340 Bacteria 524
39 Ga0070691_10011557 3300005341 Bacteria 4033
40 Ga0070691_11014694 3300005341 Bacteria 518
41 Ga0070687_100053109 3300005343 Bacteria 2106
42 Ga0070687_100553947 3300005343 Bacteria 783
43 Ga0070661_100944430 3300005344 Bacteria 713
44 Ga0070668_100017633 3300005347 Bacteria 5353
45 Ga0070668_100461139 3300005347 Bacteria 1094
46 Ga0070668_100755082 3300005347 Bacteria 861
47 Ga0070669_100121698 3300005353 Bacteria 1992
48 Ga0070669_100803285 3300005353 Bacteria 800
49 Ga0070669_101106707 3300005353 Bacteria 682
50 Ga0070675_100050003 3300005354 Bacteria 3432
51 Ga0070675_100215175 3300005354 Bacteria 1672
52 Ga0070671_100007747 3300005355 Bacteria 8580
53 Ga0070671_100817756 3300005355 Bacteria 812
54 Ga0070674_100000125 3300005356 Bacteria 35199
55 Ga0070674_100618146 3300005356 Bacteria 918
56 Ga0070674_101103215 3300005356 Bacteria 701
57 Ga0070673_100462271 3300005364 Bacteria 1143
58 Ga0070688_100015022 3300005365 Bacteria 4396
59 Ga0070688_100017298 3300005365 Bacteria 4136
60 Ga0070688_100383610 3300005365 Bacteria 1036
61 Ga0070659_100491028 3300005366 Bacteria 1046
62 Ga0070659_101600805 3300005366 Bacteria 581
63 Ga0070667_100000056 3300005367 Bacteria 150952
64 Ga0070667_100001317 3300005367 Bacteria 22315
65 Ga0070667_100008096 3300005367 Bacteria 8717
66 Ga0070667_100516773 3300005367 Bacteria 1096
67 Ga0070667_101841691 3300005367 Bacteria 570
68 Ga0070703_10618581 3300005406 Bacteria 502
69 Ga0070709_10038393 3300005434 Bacteria 2932
70 Ga0070709_10131988 3300005434 Bacteria 1706
71 Ga0070714_100033072 3300005435 Bacteria 4321
72 Ga0070714_100417176 3300005435 Bacteria 1271
73 Ga0070713_100021734 3300005436 Bacteria 4943
74 Ga0070710_10000890 3300005437 Bacteria 14275
75 Ga0070710_10360544 3300005437 Bacteria 965
76 Ga0070701_10002203 3300005438 Bacteria 7440
77 Ga0070701_10079012 3300005438 Bacteria 1777
78 Ga0070711_100000244 3300005439 Bacteria 27954
79 Ga0070711_100002056 3300005439 Bacteria 11342
80 Ga0070711_101140039 3300005439 Bacteria 673
81 Ga0070705_100003441 3300005440 Bacteria 7762
82 Ga0070705_100803031 3300005440 Bacteria 749
83 Ga0070700_100038052 3300005441 Bacteria 2930
84 Ga0070700_100042260 3300005441 Bacteria 2798
85 Ga0070694_100012110 3300005444 Bacteria 5357
86 Ga0070694_101882304 3300005444 Bacteria 511
87 Ga0070708_100474824 3300005445 Bacteria 1180
88 Ga0070663_100006113 3300005455 Bacteria 7204
89 Ga0070663_100038377 3300005455 Bacteria 3341
90 Ga0070678_100001944 3300005456 Bacteria 11148
91 Ga0070678_100087424 3300005456 Bacteria 2380
92 Ga0070662_100004850 3300005457 Bacteria 8530
93 Ga0070662_100732064 3300005457 Bacteria 838
94 Ga0070681_11110476 3300005458 Bacteria 712
95 Ga0068867_100002467 3300005459 Bacteria 13007
96 Ga0068867_100222207 3300005459 Bacteria 1523
97 Ga0070685_10027360 3300005466 Bacteria 3151
98 Ga0070685_10156666 3300005466 Bacteria 1448
99 Ga0070679_100254143 3300005530 Bacteria 1713
100 Ga0070684_100899269 3300005535 Bacteria 829
101 Ga0068853_100998417 3300005539 Bacteria 806
102 Ga0070672_100171461 3300005543 Bacteria 1805
103 Ga0070672_100597421 3300005543 Bacteria 961
104 Ga0070686_100119173 3300005544 Bacteria 1810
105 Ga0070695_100046005 3300005545 Bacteria 2784
106 Ga0070695_100237823 3300005545 Bacteria 1320
107 Ga0070696_100004673 3300005546 Bacteria 9147
108 Ga0070693_100044051 3300005547 Bacteria 2523
109 Ga0070693_100051890 3300005547 Bacteria 2350
110 Ga0070693_100356719 3300005547 Bacteria 1002
111 Ga0070665_100002065 3300005548 Bacteria 22532
112 Ga0070665_100018546 3300005548 Bacteria 6973
113 Ga0070665_100125228 3300005548 Bacteria 2572
114 Ga0070665_100132369 3300005548 Bacteria 2496
115 Ga0070704_100044657 3300005549 Bacteria 3081
116 Ga0068855_100202858 3300005563 Bacteria 2232
117 Ga0068855_101754197 3300005563 Bacteria 632
118 Ga0068854_100000659 3300005578 Bacteria 20556
119 Ga0068854_100059346 3300005578 Bacteria 2764
120 Ga0068854_100168774 3300005578 Bacteria 1701
121 Ga0068856_100821730 3300005614 Bacteria 949
122 Ga0070702_100091209 3300005615 Bacteria 1848
123 Ga0068852_100029304 3300005616 Bacteria 4520
124 Ga0068852_100636864 3300005616 Bacteria 1073
125 Ga0068852_100808859 3300005616 Bacteria 952
126 Ga0068859_100000801 3300005617 Bacteria 31888
127 Ga0068859_100001161 3300005617 Bacteria 26914
128 Ga0068859_103058062 3300005617 Bacteria 510
129 Ga0068864_100058296 3300005618 Bacteria 3337
130 Ga0068864_101413687 3300005618 Bacteria 698
131 Ga0068866_10003532 3300005718 Bacteria 6402
132 Ga0068866_10009379 3300005718 Bacteria 4153
133 Ga0068861_100002743 3300005719 Bacteria 11538
134 Ga0068861_100802914 3300005719 Bacteria 883
135 Ga0068861_101001818 3300005719 Bacteria 797
136 Ga0068861_101870850 3300005719 Bacteria 596
137 Ga0068861_102321736 3300005719 Bacteria 538
138 Ga0068870_11356155 3300005840 Bacteria 520
139 Ga0068863_100001477 3300005841 Bacteria 23298
140 Ga0068863_100008103 3300005841 Bacteria 10254
141 Ga0068858_100005735 3300005842 Bacteria 12134
142 Ga0068858_100065066 3300005842 Bacteria 3374
143 Ga0068860_100000092 3300005843 Bacteria 150190
144 Ga0068860_100000743 3300005843 Bacteria 37175
145 Ga0068860_100127206 3300005843 Bacteria 2442
146 Ga0068860_100432761 3300005843 Bacteria 1306
147 Ga0068862_100000035 3300005844 Bacteria 174953
148 Ga0068862_100001026 3300005844 Bacteria 26891
149 Ga0068862_100270806 3300005844 Bacteria 1553
150 Ga0068862_100580203 3300005844 Bacteria 1074
151 Ga0068862_102291687 3300005844 Bacteria 552
152 Ga0081455_10057421 3300005937 Bacteria 3298
153 Ga0081455_10345322 3300005937 Bacteria 1052
154 Ga0081538_10093999 3300005981 Bacteria 1537
155 Ga0075365_10018897 3300006038 Bacteria 4244
156 Ga0075368_10168052 3300006042 Bacteria 921
157 Ga0075368_10528402 3300006042 Bacteria 528
158 Ga0075363_100001319 3300006048 Bacteria 9277
159 Ga0075363_100003961 3300006048 Bacteria 6399
160 Ga0075363_100005296 3300006048 Bacteria 5725
161 Ga0075363_100017527 3300006048 Bacteria 3553
162 Ga0075363_100060736 3300006048 Bacteria 2036
163 Ga0075363_100464694 3300006048 Bacteria 749
164 Ga0075363_100514708 3300006048 Bacteria 712
165 Ga0075364_10002016 3300006051 Bacteria 11320
166 Ga0075364_10164966 3300006051 Bacteria 1496
167 Ga0070715_10007687 3300006163 Bacteria 3723
168 Ga0070715_10039854 3300006163 Bacteria 1960
169 Ga0070715_10200384 3300006163 Bacteria 1014
170 Ga0070716_100001677 3300006173 Bacteria 9996
171 Ga0070716_100014528 3300006173 Bacteria 4034
172 Ga0070716_100021378 3300006173 Bacteria 3409
173 Ga0070712_100002977 3300006175 Bacteria 10484
174 Ga0070712_100135898 3300006175 Bacteria 1869
175 Ga0075367_10112952 3300006178 Bacteria 1669
176 Ga0075369_10011236 3300006186 Bacteria 3520
177 Ga0075369_10026716 3300006186 Bacteria 2408
178 Ga0075369_10031671 3300006186 Bacteria 2234
179 Ga0075369_10454059 3300006186 Bacteria 607
180 Ga0097621_100039034 3300006237 Bacteria 3812
181 Ga0097621_100852837 3300006237 Bacteria 846
182 Ga0075370_10007593 3300006353 Bacteria 5530
183 Ga0075370_10129248 3300006353 Bacteria 1473
184 Ga0075370_10520229 3300006353 Bacteria 719
185 Ga0068871_100049221 3300006358 Bacteria 3406
186 Ga0075428_100017974 3300006844 Bacteria 7813
187 Ga0075430_100018968 3300006846 Bacteria 5852
188 Ga0075430_100063237 3300006846 Bacteria 3109
189 Ga0075431_100026875 3300006847 Bacteria 5904
190 Ga0068865_100003557 3300006881 Bacteria 9354
191 Ga0068865_100946340 3300006881 Bacteria 751
192 Ga0075436_100773281 3300006914 Bacteria 714
193 Ga0097620_100000801 3300006931 Bacteria 31888
194 Ga0097620_100001161 3300006931 Bacteria 26914
195 Ga0097620_103058010 3300006931 Bacteria 510
196 Ga0099795_10227932 3300007788 Bacteria 795
197 Ga0099795_10293691 3300007788 Bacteria 713
198 Ga0105250_10062397 3300009092 Bacteria 1499
199 Ga0105240_10209469 3300009093 Bacteria 2279
200 Ga0105240_10701408 3300009093 Bacteria 1105
201 Ga0111539_10665372 3300009094 Bacteria 1212
202 Ga0111539_13363862 3300009094 Bacteria 514
203 Ga0105245_10004088 3300009098 Bacteria 12951
204 Ga0105245_10266341 3300009098 Bacteria 1669
205 Ga0105245_10477959 3300009098 Bacteria 1259
206 Ga0105247_10000062 3300009101 Bacteria 126437
207 Ga0105247_10000806 3300009101 Bacteria 23917
208 Ga0105247_10107295 3300009101 Bacteria 1793
209 Ga0114129_10046799 3300009147 Bacteria 6078
210 Ga0114129_10691953 3300009147 Bacteria 1311
211 Ga0105243_10003563 3300009148 Bacteria 12569
212 Ga0105243_10018727 3300009148 Bacteria 5245
213 Ga0105241_10057026 3300009174 Bacteria 2995
214 Ga0105241_11621191 3300009174 Bacteria 626
215 Ga0105241_12045680 3300009174 Bacteria 565
216 Ga0105241_12233381 3300009174 Bacteria 543
217 Ga0105242_10007246 3300009176 Bacteria 8550
218 Ga0105242_10099489 3300009176 Bacteria 2461
219 Ga0105242_11233799 3300009176 Bacteria 768
220 Ga0105248_10000036 3300009177 Bacteria 187421
221 Ga0105248_10000634 3300009177 Bacteria 39924
222 Ga0105248_10553936 3300009177 Bacteria 1297
223 Ga0105248_10754286 3300009177 Bacteria 1098
224 Ga0105248_10767147 3300009177 Bacteria 1088
225 Ga0105237_10111323 3300009545 Bacteria 2730
226 Ga0105237_10129714 3300009545 Bacteria 2516
227 Ga0105237_10701180 3300009545 Bacteria 1019
228 Ga0105238_10222721 3300009551 Bacteria 1863
229 Ga0105238_11123542 3300009551 Bacteria 809
230 Ga0105249_10000046 3300009553 Bacteria 176363
231 Ga0105249_10001173 3300009553 Bacteria 23210
232 Ga0105249_10049221 3300009553 Bacteria 3843
233 Ga0105249_11959758 3300009553 Bacteria 658
234 Ga0099796_10085731 3300010159 Bacteria 1163
235 Ga0099796_10127969 3300010159 Bacteria 982
236 Ga0105239_10003767 3300010375 Bacteria 18446
237 Ga0105239_10111843 3300010375 Bacteria 3028
238 Ga0105239_10591824 3300010375 Bacteria 1265
239 Ga0105239_12893421 3300010375 Bacteria 560
240 Ga0105246_10058357 3300011119 Bacteria 2673
241 Ga0105246_10963103 3300011119 Bacteria 770
242 Ga0105246_11025176 3300011119 Bacteria 749
243 Ga0105246_12254920 3300011119 Bacteria 531
244 Ga0157373_10522362 3300013100 Bacteria 859
245 Ga0157369_10497233 3300013105 Bacteria 1262
246 Ga0157374_10059129 3300013296 Bacteria 3583
247 Ga0157378_10004246 3300013297 Bacteria 12635
248 Ga0157378_10271142 3300013297 Bacteria 1632
249 Ga0163162_10024496 3300013306 Bacteria 5956
250 Ga0163162_10154319 3300013306 Bacteria 2415
251 Ga0163162_10419971 3300013306 Bacteria 1470
252 Ga0163162_10529598 3300013306 Bacteria 1307
253 Ga0163162_10678895 3300013306 Bacteria 1153
254 Ga0163162_10819523 3300013306 Bacteria 1047
255 Ga0163162_11571371 3300013306 Bacteria 750
256 Ga0163162_13154370 3300013306 Bacteria 529
257 Ga0157372_10001604 3300013307 Bacteria 24551
258 Ga0157372_10473707 3300013307 Bacteria 1460
259 Ga0157372_10519610 3300013307 Bacteria 1388
260 Ga0157375_10000618 3300013308 Bacteria 31552
261 Ga0157375_10780559 3300013308 Bacteria 1105
262 Ga0157375_13141042 3300013308 Bacteria 551
263 Ga0157375_13165848 3300013308 Bacteria 549
264 Ga0163163_10010547 3300014325 Bacteria 8316
265 Ga0163163_10012529 3300014325 Bacteria 7732
266 Ga0163163_10694615 3300014325 Bacteria 1081
267 Ga0163163_10719066 3300014325 Bacteria 1062
268 Ga0157380_10000392 3300014326 Bacteria 26452
269 Ga0157380_10144014 3300014326 Bacteria 2051
270 Ga0157377_10001431 3300014745 Bacteria 10293
271 Ga0157379_10028061 3300014968 Bacteria 5010
272 Ga0157379_10075352 3300014968 Bacteria 3021
273 Ga0157376_10117550 3300014969 Bacteria 2351
274 Ga0157376_10723711 3300014969 Bacteria 1002
275 Ga0163161_10016460 3300017792 Bacteria 5162
276 Ga0163161_10070881 3300017792 Bacteria 2549
277 Ga0163161_10218509 3300017792 Bacteria 1475
278 Ga0163161_10379412 3300017792 Bacteria 1130
279 Ga0213872_10333460 3300021361 Bacteria 625
280 Ga0213874_10155723 3300021377 Bacteria 800
281 Ga0213874_10378954 3300021377 Bacteria 547
282 Ga0213876_10002020 3300021384 Bacteria 12119
283 Ga0213876_10201969 3300021384 Bacteria 1057
284 Ga0213875_10011877 3300021388 Bacteria 4318
285 Ga0213875_10621076 3300021388 Bacteria 523
286 Ga0207672_1003246 3300025223 Bacteria 934
287 Ga0207696_1047401 3300025711 Bacteria 1238
288 Ga0207653_10028251 3300025885 Bacteria 1804
289 Ga0207682_10201039 3300025893 Bacteria 916
290 Ga0207692_10009413 3300025898 Bacteria 4081
291 Ga0207692_10024317 3300025898 Bacteria 2815
292 Ga0207692_11096842 3300025898 Bacteria 527
293 Ga0207642_10000167 3300025899 Bacteria 18730
294 Ga0207642_10011950 3300025899 Bacteria 3117
295 Ga0207710_10000060 3300025900 Bacteria 168230
296 Ga0207710_10002164 3300025900 Bacteria 9233
297 Ga0207688_10002083 3300025901 Bacteria 10748
298 Ga0207688_10002935 3300025901 Bacteria 9273
299 Ga0207688_10308502 3300025901 Bacteria 969
300 Ga0207688_10464274 3300025901 Bacteria 790
301 Ga0207680_10227594 3300025903 Bacteria 1281
302 Ga0207680_10356304 3300025903 Bacteria 1028
303 Ga0207647_10110703 3300025904 Bacteria 1624
304 Ga0207647_10123121 3300025904 Bacteria 1528
305 Ga0207685_10001566 3300025905 Bacteria 4871
306 Ga0207685_10011806 3300025905 Bacteria 2642
307 Ga0207699_10043101 3300025906 Bacteria 2620
308 Ga0207699_10324815 3300025906 Bacteria 1080
309 Ga0207645_10006460 3300025907 Bacteria 8410
310 Ga0207654_10105711 3300025911 Bacteria 1742
311 Ga0207707_11039206 3300025912 Bacteria 670
312 Ga0207671_10460298 3300025914 Bacteria 1013
313 Ga0207693_10001382 3300025915 Bacteria 21519
314 Ga0207693_10001847 3300025915 Bacteria 18553
315 Ga0207693_10429275 3300025915 Bacteria 1033
316 Ga0207663_10002032 3300025916 Bacteria 9618
317 Ga0207663_10011241 3300025916 Bacteria 4801
318 Ga0207662_10057183 3300025918 Bacteria 2330
319 Ga0207662_10455245 3300025918 Bacteria 875
320 Ga0207657_10053439 3300025919 Bacteria 3499
321 Ga0207657_10297913 3300025919 Bacteria 1278
322 Ga0207652_10550576 3300025921 Bacteria 1037
323 Ga0207681_10014914 3300025923 Bacteria 4840
324 Ga0207681_10048026 3300025923 Bacteria 2879
325 Ga0207694_11042688 3300025924 Bacteria 692
326 Ga0207650_11906520 3300025925 Bacteria 502
327 Ga0207659_10216495 3300025926 Bacteria 1537
328 Ga0207687_10006868 3300025927 Bacteria 7497
329 Ga0207687_10055429 3300025927 Bacteria 2778
330 Ga0207687_10520984 3300025927 Bacteria 994
331 Ga0207687_11082534 3300025927 Bacteria 688
332 Ga0207700_10934600 3300025928 Bacteria 776
333 Ga0207664_10170042 3300025929 Bacteria 1865
334 Ga0207664_10273554 3300025929 Bacteria 1480
335 Ga0207664_11607051 3300025929 Bacteria 572
336 Ga0207644_10013536 3300025931 Bacteria 5441
337 Ga0207690_10013779 3300025932 Bacteria 4868
338 Ga0207690_11112989 3300025932 Bacteria 658
339 Ga0207706_10007224 3300025933 Bacteria 10270
340 Ga0207686_10001374 3300025934 Bacteria 13815
341 Ga0207686_10864728 3300025934 Bacteria 728
342 Ga0207686_11295226 3300025934 Bacteria 598
343 Ga0207709_10004392 3300025935 Bacteria 8164
344 Ga0207709_10060986 3300025935 Bacteria 2355
345 Ga0207670_10166891 3300025936 Bacteria 1648
346 Ga0207670_11612016 3300025936 Bacteria 552
347 Ga0207669_10002459 3300025937 Bacteria 7909
348 Ga0207669_10850045 3300025937 Bacteria 759
349 Ga0207704_10000782 3300025938 Bacteria 14026
350 Ga0207704_10255994 3300025938 Bacteria 1317
351 Ga0207665_10002538 3300025939 Bacteria 12277
352 Ga0207665_10009183 3300025939 Bacteria 6493
353 Ga0207665_10238527 3300025939 Bacteria 1339
354 Ga0207665_10464640 3300025939 Bacteria 973
355 Ga0207711_10000202 3300025941 Bacteria 63414
356 Ga0207711_10034656 3300025941 Bacteria 4275
357 Ga0207711_10196945 3300025941 Bacteria 1838
358 Ga0207689_10026005 3300025942 Bacteria 4901
359 Ga0207689_11229313 3300025942 Bacteria 630
360 Ga0207661_10534907 3300025944 Bacteria 1073
361 Ga0207667_10438704 3300025949 Bacteria 1328
362 Ga0207667_10748967 3300025949 Bacteria 976
363 Ga0207651_10336513 3300025960 Bacteria 1267
364 Ga0207651_10377840 3300025960 Bacteria 1200
365 Ga0207712_10000042 3300025961 Bacteria 176338
366 Ga0207712_10008647 3300025961 Bacteria 6438
367 Ga0207712_10065648 3300025961 Bacteria 2591
368 Ga0207712_10370364 3300025961 Bacteria 1196
369 Ga0207712_11190356 3300025961 Bacteria 680
370 Ga0207668_10011924 3300025972 Bacteria 5302
371 Ga0207668_10111900 3300025972 Bacteria 2050
372 Ga0207668_11357484 3300025972 Bacteria 640
373 Ga0207640_10004834 3300025981 Bacteria 7314
374 Ga0207640_10182979 3300025981 Bacteria 1573
375 Ga0207640_10522786 3300025981 Bacteria 992
376 Ga0207658_10000409 3300025986 Bacteria 40927
377 Ga0207658_10010952 3300025986 Bacteria 6174
378 Ga0207658_10161563 3300025986 Bacteria 1836
379 Ga0207658_10263243 3300025986 Bacteria 1470
380 Ga0207658_11474042 3300025986 Bacteria 622
381 Ga0207677_10004948 3300026023 Bacteria 7194
382 Ga0207677_10031317 3300026023 Bacteria 3406
383 Ga0207677_10437664 3300026023 Bacteria 1117
384 Ga0207703_10010438 3300026035 Bacteria 7263
385 Ga0207703_10210689 3300026035 Bacteria 1732
386 Ga0207703_10335301 3300026035 Bacteria 1388
387 Ga0207703_11463870 3300026035 Bacteria 657
388 Ga0207639_10039781 3300026041 Bacteria 3506
389 Ga0207639_10497629 3300026041 Bacteria 1113
390 Ga0207678_10006686 3300026067 Bacteria 10223
391 Ga0207678_10015033 3300026067 Bacteria 6810
392 Ga0207708_10004516 3300026075 Bacteria 10238
393 Ga0207708_10052632 3300026075 Bacteria 3101
394 Ga0207708_10268385 3300026075 Bacteria 1379
395 Ga0207708_10623401 3300026075 Bacteria 916
396 Ga0207702_10386599 3300026078 Bacteria 1346
397 Ga0207641_10007933 3300026088 Bacteria 8805
398 Ga0207641_10009388 3300026088 Bacteria 8061
399 Ga0207641_10093421 3300026088 Bacteria 2637
400 Ga0207648_10004400 3300026089 Bacteria 14473
401 Ga0207648_10122222 3300026089 Bacteria 2289
402 Ga0207676_10207378 3300026095 Bacteria 1736
403 Ga0207676_10696378 3300026095 Bacteria 984
404 Ga0207676_11563999 3300026095 Bacteria 657
405 Ga0207675_100000419 3300026118 Bacteria 41020
406 Ga0207675_100085853 3300026118 Bacteria 2954
407 Ga0207675_101726178 3300026118 Bacteria 646
408 Ga0207683_10000386 3300026121 Bacteria 40766
409 Ga0207683_10096016 3300026121 Bacteria 2643
410 Ga0207698_10187837 3300026142 Bacteria 1837
411 Ga0207698_10344979 3300026142 Bacteria 1404
412 Ga0209813_10133789 3300027866 Bacteria 874
413 Ga0268266_10015538 3300028379 Bacteria 6528
414 Ga0268266_10020057 3300028379 Bacteria 5698
415 Ga0268266_10033092 3300028379 Bacteria 4396
416 Ga0268265_10000051 3300028380 Bacteria 174968
417 Ga0268265_10006561 3300028380 Bacteria 7874
418 Ga0268265_10188270 3300028380 Bacteria 1780
419 Ga0268265_10197437 3300028380 Bacteria 1742
420 Ga0268265_10524320 3300028380 Bacteria 1120
421 Ga0268265_11726196 3300028380 Bacteria 632
422 Ga0268264_10000108 3300028381 Bacteria 208791
423 Ga0268264_10019336 3300028381 Bacteria 5566
424 Ga0268264_10181326 3300028381 Bacteria 1913
425 Ga0268264_10258218 3300028381 Bacteria 1622
426 Ga0268264_11229131 3300028381 Bacteria 759
427 Ga0268264_11319055 3300028381 Bacteria 732
428 Ga0307410_10002941 3300031852 Bacteria 8400
429 Ga0307410_10160464 3300031852 Bacteria 1684
430 Ga0307410_11374609 3300031852 Bacteria 619
431 Ga0307406_10037252 3300031901 Bacteria 3003
432 Ga0307407_10169413 3300031903 Bacteria 1437
433 Ga0307407_10706202 3300031903 Bacteria 760
434 Ga0307409_100117999 3300031995 Bacteria 2240
435 Ga0307409_100516895 3300031995 Bacteria 1166
436 Ga0307409_101360740 3300031995 Bacteria 736
437 Ga0307416_100239307 3300032002 Bacteria 1757
438 Ga0307416_101046657 3300032002 Bacteria 920
439 Ga0307414_10329339 3300032004 Bacteria 1303
440 Ga0307411_10010708 3300032005 Bacteria 4904
441 Ga0307411_10844074 3300032005 Bacteria 810
442 Ga0307415_100191992 3300032126 Bacteria 1612
443 Ga0373958_0075028 3300034819 Bacteria 757
444 Ga0373938_0161466 3300034957 Bacteria 602
445 Ga0373951_0108321 3300035091 Bacteria 745
446 Ga0373939_0126951 3300035114 Bacteria 906
447 Ga0373941_0068426 3300035115 Bacteria 1173
448 Ga0373960_0032858 3300035121 Bacteria 1459
449 Ga0373931_0007355 3300035691 Bacteria 5184
450 Ga0373931_0172817 3300035691 Bacteria 1274
451 Ga0373947_0413402 3300035725 Bacteria 911
452 Ga0373925_0720096 3300037068 Bacteria 823
453 Ga0395898_1044394 3300037466 Bacteria 752
454 Ga0395905_0656641 3300037471 Bacteria 951
455 Ga0436364_0210802 3300037853 Bacteria 2295
456 Ga0436364_0665239 3300037853 Bacteria 42065
457 Ga0436364_0740200 3300037853 Bacteria 725
458 Ga0436364_1035203 3300037853 Bacteria 776
459 Ga0436365_0085052 3300039437 Bacteria 14182
460 Ga0436365_0411865 3300039437 Bacteria 16194
461 Ga0436365_0922410 3300039437 Bacteria 2846
462 Ga0436365_1355905 3300039437 Bacteria 26021
463 Ga0436360_0892117 3300039438 Bacteria 2189
464 Ga0436361_0217454 3300039447 Bacteria 785
465 Ga0436361_0492283 3300039447 Bacteria 848
466 Ga0436363_0141792 3300039450 Bacteria 555
467 Ga0436363_0669183 3300039450 Bacteria 797
468 Ga0436363_0829327 3300039450 Bacteria 840
469 Ga0436363_0861738 3300039450 Bacteria 669
470 Ga0436363_1362967 3300039450 Bacteria 1680
471 Ga0436363_1519424 3300039450 Bacteria 2600
472 Ga0436363_1702584 3300039450 Bacteria 1416
473 Ga0436362_1160607 3300039453 Bacteria 500
474 Ga0439461_0012051 3300041410 Bacteria 1614
475 Ga0439466_0001413 3300041411 Bacteria 9363
476 Ga0439466_0052592 3300041411 Bacteria 1331
477 Ga0439465_0002196 3300041413 Bacteria 6397
478 Ga0439465_0002908 3300041413 Bacteria 5614
479 Ga0439465_0209662 3300041413 Bacteria 712
480 Ga0451833_1334059 3300041491 Bacteria 605
481 Ga0451845_0290541 3300041501 Bacteria 927
482 Ga0451851_1366376 3300041507 Bacteria 513
483 Ga0451853_0827965 3300041512 Bacteria 1263
484 Ga0439431_0085283 3300041997 Bacteria 855
485 Ga0439431_0155130 3300041997 Bacteria 652
486 Ga0439442_004331 3300042002 Bacteria 2818
487 Ga0439445_0012586 3300042004 Bacteria 2036
488 Ga0439445_0026649 3300042004 Bacteria 1481
489 Ga0439434_0010245 3300042435 Bacteria 2763
490 Ga0439459_0071878 3300042438 Bacteria 802
491 Ga0466969_0041698 3300044656 Bacteria 2295
492 Ga0466969_0117849 3300044656 Bacteria 1238
493 Ga0466972_0048372 3300044658 Bacteria 2055
494 Ga0466972_0089285 3300044658 Bacteria 1462
495 Ga0466972_0138215 3300044658 Bacteria 1147
496 Ga0466965_0300226 3300044683 Bacteria 871
497 Ga0466966_0003513 3300044684 Bacteria 10340
498 Ga0466966_0010506 3300044684 Bacteria 6152
499 Ga0466966_0136596 3300044684 Bacteria 1499
500 Ga0466961_0011041 3300044693 Bacteria 5774
501 Ga0466961_0137673 3300044693 Bacteria 1529
502 Ga0466961_0985250 3300044693 Bacteria 501
503 Ga0466963_0065877 3300044694 Bacteria 2429
504 Ga0466963_0088987 3300044694 Bacteria 2100
505 Ga0466963_0186490 3300044694 Bacteria 1449
506 Ga0466963_0190247 3300044694 Bacteria 1434
507 Ga0466963_0190617 3300044694 Bacteria 1432
508 Ga0466963_0552132 3300044694 Bacteria 813
509 Ga0466964_0096277 3300044706 Bacteria 1297
510 Ga0466964_0162813 3300044706 Bacteria 1044
511 Ga0466964_0324821 3300044706 Bacteria 783
512 Ga0466971_0030802 3300044719 Bacteria 2401
513 Ga0466971_0077300 3300044719 Bacteria 1515
514 Ga0466971_0177058 3300044719 Bacteria 1002
515 Ga0466971_0378190 3300044719 Bacteria 688
516 Ga0466968_0004782 3300044735 Bacteria 5069
517 Ga0466968_0266771 3300044735 Bacteria 816
518 Ga0466970_0046356 3300044765 Bacteria 2315
519 Ga0466957_0003608 3300044842 Bacteria 8532
520 Ga0466957_0156352 3300044842 Bacteria 1478
521 Ga0466957_0200628 3300044842 Bacteria 1310
522 Ga0466957_0217607 3300044842 Bacteria 1260
523 Ga0466957_0452894 3300044842 Bacteria 884
524 Ga0466960_0002343 3300044901 Bacteria 7118
525 Ga0466960_0020412 3300044901 Bacteria 2934
526 Ga0466960_0564862 3300044901 Bacteria 672
527 Ga0466960_0985694 3300044901 Bacteria 517
528 Ga0466959_0068362 3300045049 Bacteria 2574
529 Ga0466959_0582925 3300045049 Bacteria 753
530 Ga0466958_0002894 3300045836 Bacteria 8760
531 Ga0466958_0042317 3300045836 Bacteria 2743
532 Ga0466958_0063326 3300045836 Bacteria 2255
533 Ga0466958_0105310 3300045836 Bacteria 1757
534 Ga0466967_0007417 3300045976 Bacteria 7910
535 Ga0466967_0128451 3300045976 Bacteria 2350
536 Ga0466967_0354590 3300045976 Bacteria 1420
537 Ga0466967_0507133 3300045976 Bacteria 1184
538 Ga0466967_0679503 3300045976 Bacteria 1019
539 Ga0466967_0754954 3300045976 Bacteria 965
540 Ga0466967_2169028 3300045976 Bacteria 552
541 Ga0466967_2434759 3300045976 Bacteria 519
542 Ga0495629_0144134 3300046459 Bacteria 1657
543 Ga0495641_0016281 3300046461 Bacteria 3922
544 Ga0495582_0008239 3300046473 Bacteria 5751
545 Ga0495639_0137128 3300046475 Bacteria 1174
546 Ga0495584_0376903 3300046491 Bacteria 721
547 Ga0495606_0617058 3300046507 Bacteria 530
548 Ga0495630_0055810 3300046517 Bacteria 2960
549 Ga0495640_0049163 3300046533 Bacteria 2909
550 Ga0495622_0394675 3300046557 Bacteria 596
551 Ga0495634_0883627 3300046642 Bacteria 506
552 Ga0495611_0315501 3300046648 Bacteria 720
553 Ga0495658_0037158 3300046683 Bacteria 2691
554 Ga0495613_0492805 3300046689 Bacteria 826
555 Ga0495624_0562225 3300046690 Bacteria 681
556 Ga0495649_0243805 3300046694 Bacteria 925
557 Ga0495589_0440009 3300046794 Bacteria 597
558 Ga0495581_0259194 3300047315 Bacteria 1017
559 Ga0495674_0130317 3300047319 Bacteria 2119
560 Ga0495672_0109666 3300047320 Bacteria 1483
561 Ga0495676_0236647 3300047321 Bacteria 1252
562 Ga0495684_0672487 3300047471 Bacteria 690
563 Ga0495593_0170572 3300047673 Bacteria 1097
564 Ga0495626_0408599 3300048091 Bacteria 524
565 Ga0496100_0020033 3300048903 Bacteria 4004
566 Ga0496100_0120217 3300048903 Bacteria 1836
567 Ga0496100_0121195 3300048903 Bacteria 1830
568 Ga0496100_0445024 3300048903 Bacteria 993
569 Ga0496100_1434927 3300048903 Bacteria 545
570 Ga0496101_0002255 3300048904 Bacteria 11786
571 Ga0496101_0006735 3300048904 Bacteria 7412
572 Ga0496101_0032011 3300048904 Bacteria 3700
573 Ga0496101_0040574 3300048904 Bacteria 3315
574 Ga0496101_0582327 3300048904 Bacteria 885
575 Ga0496101_0728461 3300048904 Bacteria 783
576 Ga0496101_1362230 3300048904 Bacteria 554
577 Ga0496102_0001066 3300048905 Bacteria 25405
578 Ga0496102_0014356 3300048905 Bacteria 6880
579 Ga0496102_0052105 3300048905 Bacteria 3728
580 Ga0496102_0082538 3300048905 Bacteria 2964
581 Ga0496102_0085035 3300048905 Bacteria 2920
582 Ga0496102_0156613 3300048905 Bacteria 2141
583 Ga0496102_0201134 3300048905 Bacteria 1878
584 Ga0496103_0001226 3300048906 Bacteria 17581
585 Ga0496103_0002026 3300048906 Bacteria 13017
586 Ga0496103_0055611 3300048906 Bacteria 2455
587 Ga0496103_0146630 3300048906 Bacteria 1511
588 Ga0496103_0769103 3300048906 Bacteria 608
589 Ga0496103_0802779 3300048906 Bacteria 593
590 Ga0496104_0198656 3300048907 Bacteria 1917
591 Ga0496104_1780180 3300048907 Bacteria 518
592 Ga0496105_0063979 3300048908 Bacteria 3035
593 Ga0496105_0394129 3300048908 Bacteria 1100
594 Ga0496105_0533487 3300048908 Bacteria 918
595 Ga0496105_0606666 3300048908 Bacteria 849
596 Ga0496105_0648962 3300048908 Bacteria 815
597 Ga0496106_0001406 3300048909 Bacteria 18048
598 Ga0496106_0188350 3300048909 Bacteria 1640
599 Ga0496106_0197064 3300048909 Bacteria 1602
600 Ga0496106_0702616 3300048909 Bacteria 806
601 Ga0496107_0001641 3300048910 Bacteria 13951
602 Ga0496107_0209830 3300048910 Bacteria 1448
603 Ga0496107_0849672 3300048910 Bacteria 667
604 Ga0496108_0012478 3300048911 Bacteria 6919
605 Ga0496108_0147864 3300048911 Bacteria 2026
606 Ga0496108_0183240 3300048911 Bacteria 1814
607 Ga0496109_0005854 3300048912 Bacteria 10307
608 Ga0496109_0009168 3300048912 Bacteria 8427
609 Ga0496109_0562674 3300048912 Bacteria 1075
610 Ga0496109_0720040 3300048912 Bacteria 935
611 Ga0496109_0969161 3300048912 Bacteria 788
612 Ga0496110_0051203 3300048913 Bacteria 3629
613 Ga0496110_0143004 3300048913 Bacteria 2163
614 Ga0496110_0414374 3300048913 Bacteria 1228
615 Ga0496110_0485996 3300048913 Bacteria 1125
616 Ga0496110_1046413 3300048913 Bacteria 724
617 Ga0496111_0226749 3300048914 Bacteria 1388
618 Ga0496111_0381433 3300048914 Bacteria 1042
619 Ga0496111_1062026 3300048914 Bacteria 578
620 Ga0496112_0014391 3300048915 Bacteria 7336
621 Ga0496112_0038501 3300048915 Bacteria 4669
622 Ga0496112_0045521 3300048915 Bacteria 4301
623 Ga0496112_0085695 3300048915 Bacteria 3117
624 Ga0496112_0322217 3300048915 Bacteria 1490
625 Ga0496112_0796494 3300048915 Bacteria 870
626 Ga0496112_1044831 3300048915 Bacteria 736
627 Ga0496113_0034812 3300048916 Bacteria 3678
628 Ga0496113_0267046 3300048916 Bacteria 1367
629 Ga0496113_0668779 3300048916 Bacteria 830
630 Ga0496114_0000486 3300048917 Bacteria 29134
631 Ga0496114_0445083 3300048917 Bacteria 1147
632 Ga0496114_0799519 3300048917 Bacteria 822
633 Ga0496114_1541820 3300048917 Bacteria 552
634 Ga0496115_0002673 3300048918 Bacteria 12785
635 Ga0496115_0362645 3300048918 Bacteria 1181
636 Ga0496115_0625441 3300048918 Bacteria 854
637 Ga0496116_0181686 3300048919 Bacteria 1125
638 Ga0496117_0000430 3300048920 Bacteria 70406
639 Ga0496118_0000165 3300048921 Bacteria 119376
640 Ga0496118_0002530 3300048921 Bacteria 24503
641 Ga0496119_0005297 3300048922 Bacteria 12422
642 Ga0496120_0020219 3300048923 Bacteria 4238
643 Ga0496121_0007201 3300048924 Bacteria 13473
644 Ga0496122_0362701 3300048925 Bacteria 751
645 Ga0496124_0203883 3300048927 Bacteria 1501
646 Ga0496125_0006092 3300048928 Bacteria 13162
647 Ga0496126_0003255 3300048929 Bacteria 20757
648 Ga0496126_0010065 3300048929 Bacteria 9976
649 Ga0501032_0006334 3300049569 Bacteria 8723
650 Ga0501033_0008828 3300049570 Bacteria 7787
651 Ga0501033_0614765 3300049570 Bacteria 744
652 Ga0501034_0005259 3300049571 Bacteria 14207
653 Ga0501034_0075196 3300049571 Bacteria 3386
654 Ga0501034_0530082 3300049571 Bacteria 1089
655 Ga0501036_0076998 3300049572 Bacteria 2822
656 Ga0501037_0003402 3300049573 Bacteria 11568
657 Ga0501039_0772504 3300049575 Bacteria 750
658 Ga0501043_0461422 3300049579 Bacteria 953
659 Ga0501046_0003379 3300049580 Bacteria 14646
660 Ga0501046_0683761 3300049580 Bacteria 724
661 Ga0501046_1079268 3300049580 Bacteria 555
662 Ga0501047_0004498 3300049581 Bacteria 13115
663 Ga0501047_0019957 3300049581 Bacteria 6435
664 Ga0501047_0425496 3300049581 Bacteria 1159
665 Ga0501047_1357948 3300049581 Bacteria 525
666 Ga0501048_0000667 3300049582 Bacteria 24833
667 Ga0501068_0742350 3300049584 Bacteria 643
668 Ga0501069_0034450 3300049585 Bacteria 2789
669 Ga0501070_0000669 3300049586 Bacteria 31597
670 Ga0501070_0026142 3300049586 Bacteria 4899
671 Ga0501073_0296647 3300049589 Bacteria 1115
672 Ga0501073_0379916 3300049589 Bacteria 976
673 Ga0501075_0504579 3300049591 Bacteria 923
674 Ga0501080_0061436 3300049742 Bacteria 3498
675 Ga0501080_0162495 3300049742 Bacteria 2062
676 Ga0501035_0001642 3300049822 Bacteria 22591
677 Ga0501035_0005600 3300049822 Bacteria 11861
678 Ga0501044_0002795 3300049823 Bacteria 19887
679 Ga0501044_0080500 3300049823 Bacteria 3299
680 Ga0501044_0759775 3300049823 Bacteria 851
681 nmdc:mga03683_391651_c1 3300050489 Bacteria 662
682 nmdc:mga03n38_10754_c1 3300050490 Bacteria 3382
683 nmdc:mga03n38_1784_c1 3300050490 Bacteria 6377
684 nmdc:mga03n38_24001_c1 3300050490 Bacteria 2489
685 nmdc:mga03n38_646847_c1 3300050490 Bacteria 605
686 nmdc:mga03n38_7109_c1 3300050490 Bacteria 3939
687 nmdc:mga03n38_7316_c1 3300050490 Bacteria 3901
688 nmdc:mga00v17_19256_c1 3300050491 Bacteria 3894
689 nmdc:mga00v17_3944_c1 3300050491 Bacteria 7656
690 nmdc:mga00v17_940870_c1 3300050491 Bacteria 546
691 nmdc:mga0yw44_1004714_c1 3300050492 Bacteria 565
692 nmdc:mga0yw44_143534_c1 3300050492 Bacteria 1553
693 nmdc:mga0yw44_198331_c1 3300050492 Bacteria 1325
694 nmdc:mga0yw44_5528_c1 3300050492 Bacteria 5989
695 nmdc:mga06z11_224830_c1 3300050494 Bacteria 1098
696 nmdc:mga06z11_73724_c1 3300050494 Bacteria 1813
697 nmdc:mga06z11_78535_c1 3300050494 Bacteria 1764
698 nmdc:mga04h51_127934_c1 3300050495 Bacteria 952
699 nmdc:mga04h51_143312_c1 3300050495 Bacteria 908
700 nmdc:mga04h51_253272_c1 3300050495 Bacteria 706
701 nmdc:mga07m45_110684_c1 3300050496 Bacteria 1581
702 nmdc:mga07m45_12019_c2 3300050496 Bacteria 2913
703 nmdc:mga07m45_189061_c1 3300050496 Bacteria 1197
704 nmdc:mga07m45_44078_c1 3300050496 Bacteria 1980
705 nmdc:mga07m45_47558_c1 3300050496 Bacteria 2412
706 nmdc:mga07m45_97324_c1 3300050496 Bacteria 1689
707 nmdc:mga05p37_95168_c1 3300050507 Bacteria 3669
708 nmdc:mga0qj67_28389_c1 3300050509 Bacteria 4343
709 nmdc:mga0qj67_60357_c1 3300050509 Bacteria 3009
710 nmdc:mga06r32_21217_c1 3300050510 Bacteria 5995
711 nmdc:mga08y16_384990_c1 3300050511 Bacteria 1437
712 nmdc:mga08y16_760618_c1 3300050511 Bacteria 964
713 nmdc:mga0n895_794066_c1 3300050512 Bacteria 937
714 nmdc:mga0sz30_14487_c1 3300050516 Bacteria 3105
715 nmdc:mga0sz30_14605_c1 3300050516 Bacteria 3094
716 nmdc:mga0sz30_5539_c1 3300050516 Bacteria 4638
717 nmdc:mga0sz30_63749_c1 3300050516 Bacteria 1578
718 Ga0495655_0152644 3300053083 Bacteria 727
719 Ga0495619_1066477 3300053085 Bacteria 538
720 Ga0500578_0093282 3300053086 Bacteria 1910
721 Ga0500642_0049190 3300053130 Bacteria 1855
722 Ga0500604_0228985 3300053151 Bacteria 642
723 Ga0500620_106883 3300053155 Bacteria 979
724 Ga0466962_0149282 3300061719 Bacteria 1134
725 Ga0466962_0183455 3300061719 Bacteria 1020
726 Ga0466962_0368541 3300061719 Bacteria 717
727 2508672945 2508501039 Bacteria 9978592
728 2508675341 2508501039 Bacteria 9978592
729 2686534866 2684623035 Bacteria 8032739
730 2686539147 2684623035 Bacteria 8032739
731 2689955756 2687453737 Bacteria 11203906
732 2689991030 2687453743 Bacteria 8361025
733 2895881981 2895880812 Bacteria 11255272
734 2895887673 2895880812 Bacteria 11255272
735 Ga0070701_11237876
736 JGI24746J21847_1003844
737 JGI24747J21853_1040525
738 JGI24739J22299_10142746
739 JGI24739J22299_10167850
740 JGI24737J22298_10067153
741 JGI24743J22301_10069859
742 JGI24750J21931_1010568
743 JGI24750J21931_1014002
744 JGI24745J21846_1003575
745 JGI24738J21930_10102929
746 JGI24749J21850_1006529
747 JGI24744J21845_10004148
748 JGI24034J26672_10005717
749 JGI24742J22300_10000982
750 JGI24751J29686_10022339
751 Ga0070676_10003809
752 Ga0070676_10111686
753 Ga0070683_100949319
754 Ga0070690_100143236
755 Ga0070677_10293857
756 Ga0068869_100352668
757 Ga0068869_101691055
758 Ga0070666_10027962
759 Ga0070666_10138787
760 Ga0070680_101358935
761 Ga0070682_100004846
762 Ga0070682_100008532
763 Ga0070682_100114231
764 Ga0070682_100202482
765 Ga0070682_102003385
766 Ga0068868_100006571
767 Ga0068868_100050862
768 Ga0068868_100225213
769 Ga0070660_100308245
770 Ga0070689_100017358
771 Ga0070689_100695098
772 Ga0070689_102047397
773 Ga0070691_10011557
774 Ga0070691_11014694
775 Ga0070687_100053109
776 Ga0070687_100553947
777 Ga0070661_100944430
778 Ga0070668_100017633
779 Ga0070668_100461139
780 Ga0070668_100755082
781 Ga0070669_100121698
782 Ga0070669_100803285
783 Ga0070669_101106707
784 Ga0070675_100050003
785 Ga0070675_100215175
786 Ga0070671_100007747
787 Ga0070671_100817756
788 Ga0070674_100000125
789 Ga0070674_100618146
790 Ga0070674_101103215
791 Ga0070673_100462271
792 Ga0070688_100015022
793 Ga0070688_100017298
794 Ga0070688_100383610
795 Ga0070659_100491028
796 Ga0070659_101600805
797 Ga0070667_100000056
798 Ga0070667_100001317
799 Ga0070667_100008096
800 Ga0070667_100516773
801 Ga0070667_101841691
802 Ga0070703_10618581
803 Ga0070709_10038393
804 Ga0070709_10131988
805 Ga0070714_100033072
806 Ga0070714_100417176
807 Ga0070713_100021734
808 Ga0070710_10000890
809 Ga0070710_10360544
810 Ga0070701_10002203
811 Ga0070701_10079012
812 Ga0070711_100000244
813 Ga0070711_100002056
814 Ga0070711_101140039
815 Ga0070705_100003441
816 Ga0070705_100803031
817 Ga0070700_100038052
818 Ga0070700_100042260
819 Ga0070694_100012110
820 Ga0070694_101882304
821 Ga0070708_100474824
822 Ga0070663_100006113
823 Ga0070663_100038377
824 Ga0070678_100001944
825 Ga0070678_100087424
826 Ga0070662_100004850
827 Ga0070662_100732064
828 Ga0070681_11110476
829 Ga0068867_100002467
830 Ga0068867_100222207
831 Ga0070685_10027360
832 Ga0070685_10156666
833 Ga0070679_100254143
834 Ga0070684_100899269
835 Ga0068853_100998417
836 Ga0070672_100171461
837 Ga0070672_100597421
838 Ga0070686_100119173
839 Ga0070695_100046005
840 Ga0070695_100237823
841 Ga0070696_100004673
842 Ga0070693_100044051
843 Ga0070693_100051890
844 Ga0070693_100356719
845 Ga0070665_100002065
846 Ga0070665_100018546
847 Ga0070665_100125228
848 Ga0070665_100132369
849 Ga0070704_100044657
850 Ga0068855_100202858
851 Ga0068855_101754197
852 Ga0068854_100000659
853 Ga0068854_100059346
854 Ga0068854_100168774
855 Ga0068856_100821730
856 Ga0070702_100091209
857 Ga0068852_100029304
858 Ga0068852_100636864
859 Ga0068852_100808859
860 Ga0068859_100000801
861 Ga0068859_100001161
862 Ga0068859_103058062
863 Ga0068864_100058296
864 Ga0068864_101413687
865 Ga0068866_10003532
866 Ga0068866_10009379
867 Ga0068861_100002743
868 Ga0068861_100802914
869 Ga0068861_101001818
870 Ga0068861_101870850
871 Ga0068861_102321736
872 Ga0068870_11356155
873 Ga0068863_100001477
874 Ga0068863_100008103
875 Ga0068858_100005735
876 Ga0068858_100065066
877 Ga0068860_100000092
878 Ga0068860_100000743
879 Ga0068860_100127206
880 Ga0068860_100432761
881 Ga0068862_100000035
882 Ga0068862_100001026
883 Ga0068862_100270806
884 Ga0068862_100580203
885 Ga0068862_102291687
886 Ga0081455_10057421
887 Ga0081455_10345322
888 Ga0081538_10093999
889 Ga0075365_10018897
890 Ga0075368_10168052
891 Ga0075368_10528402
892 Ga0075363_100001319
893 Ga0075363_100003961
894 Ga0075363_100005296
895 Ga0075363_100017527
896 Ga0075363_100060736
897 Ga0075363_100464694
898 Ga0075363_100514708
899 Ga0075364_10002016
900 Ga0075364_10164966
901 Ga0070715_10007687
902 Ga0070715_10039854
903 Ga0070715_10200384
904 Ga0070716_100001677
905 Ga0070716_100014528
906 Ga0070716_100021378
907 Ga0070712_100002977
908 Ga0070712_100135898
909 Ga0075367_10112952
910 Ga0075369_10011236
911 Ga0075369_10026716
912 Ga0075369_10031671
913 Ga0075369_10454059
914 Ga0097621_100039034
915 Ga0097621_100852837
916 Ga0075370_10007593
917 Ga0075370_10129248
918 Ga0075370_10520229
919 Ga0068871_100049221
920 Ga0075428_100017974
921 Ga0075430_100018968
922 Ga0075430_100063237
923 Ga0075431_100026875
924 Ga0068865_100003557
925 Ga0068865_100946340
926 Ga0075436_100773281
927 Ga0097620_100000801
928 Ga0097620_100001161
929 Ga0097620_103058010
930 Ga0099795_10227932
931 Ga0099795_10293691
932 Ga0105250_10062397
933 Ga0105240_10209469
934 Ga0105240_10701408
935 Ga0111539_10665372
936 Ga0111539_13363862
937 Ga0105245_10004088
938 Ga0105245_10266341
939 Ga0105245_10477959
940 Ga0105247_10000062
941 Ga0105247_10000806
942 Ga0105247_10107295
943 Ga0114129_10046799
944 Ga0114129_10691953
945 Ga0105243_10003563
946 Ga0105243_10018727
947 Ga0105241_10057026
948 Ga0105241_11621191
949 Ga0105241_12045680
950 Ga0105241_12233381
951 Ga0105242_10007246
952 Ga0105242_10099489
953 Ga0105242_11233799
954 Ga0105248_10000036
955 Ga0105248_10000634
956 Ga0105248_10553936
957 Ga0105248_10754286
958 Ga0105248_10767147
959 Ga0105237_10111323
960 Ga0105237_10129714
961 Ga0105237_10701180
962 Ga0105238_10222721
963 Ga0105238_11123542
964 Ga0105249_10000046
965 Ga0105249_10001173
966 Ga0105249_10049221
967 Ga0105249_11959758
968 Ga0099796_10085731
969 Ga0099796_10127969
970 Ga0105239_10003767
971 Ga0105239_10111843
972 Ga0105239_10591824
973 Ga0105239_12893421
974 Ga0105246_10058357
975 Ga0105246_10963103
976 Ga0105246_11025176
977 Ga0105246_12254920
978 Ga0157373_10522362
979 Ga0157369_10497233
980 Ga0157374_10059129
981 Ga0157378_10004246
982 Ga0157378_10271142
983 Ga0163162_10024496
984 Ga0163162_10154319
985 Ga0163162_10419971
986 Ga0163162_10529598
987 Ga0163162_10678895
988 Ga0163162_10819523
989 Ga0163162_11571371
990 Ga0163162_13154370
991 Ga0157372_10001604
992 Ga0157372_10473707
993 Ga0157372_10519610
994 Ga0157375_10000618
995 Ga0157375_10780559
996 Ga0157375_13141042
997 Ga0157375_13165848
998 Ga0163163_10010547
999 Ga0163163_10012529
1000 Ga0163163_10694615
1001 Ga0163163_10719066
1002 Ga0157380_10000392
1003 Ga0157380_10144014
1004 Ga0157377_10001431
1005 Ga0157379_10028061
1006 Ga0157379_10075352
1007 Ga0157376_10117550
1008 Ga0157376_10723711
1009 Ga0163161_10016460
1010 Ga0163161_10070881
1011 Ga0163161_10218509
1012 Ga0163161_10379412
1013 Ga0213872_10333460
1014 Ga0213874_10155723
1015 Ga0213874_10378954
1016 Ga0213876_10002020
1017 Ga0213876_10201969
1018 Ga0213875_10011877
1019 Ga0213875_10621076
1020 Ga0207672_1003246
1021 Ga0207696_1047401
1022 Ga0207653_10028251
1023 Ga0207682_10201039
1024 Ga0207692_10009413
1025 Ga0207692_10024317
1026 Ga0207692_11096842
1027 Ga0207642_10000167
1028 Ga0207642_10011950
1029 Ga0207710_10000060
1030 Ga0207710_10002164
1031 Ga0207688_10002083
1032 Ga0207688_10002935
1033 Ga0207688_10308502
1034 Ga0207688_10464274
1035 Ga0207680_10227594
1036 Ga0207680_10356304
1037 Ga0207647_10110703
1038 Ga0207647_10123121
1039 Ga0207685_10001566
1040 Ga0207685_10011806
1041 Ga0207699_10043101
1042 Ga0207699_10324815
1043 Ga0207645_10006460
1044 Ga0207654_10105711
1045 Ga0207707_11039206
1046 Ga0207671_10460298
1047 Ga0207693_10001382
1048 Ga0207693_10001847
1049 Ga0207693_10429275
1050 Ga0207663_10002032
1051 Ga0207663_10011241
1052 Ga0207662_10057183
1053 Ga0207662_10455245
1054 Ga0207657_10053439
1055 Ga0207657_10297913
1056 Ga0207652_10550576
1057 Ga0207681_10014914
1058 Ga0207681_10048026
1059 Ga0207694_11042688
1060 Ga0207650_11906520
1061 Ga0207659_10216495
1062 Ga0207687_10006868
1063 Ga0207687_10055429
1064 Ga0207687_10520984
1065 Ga0207687_11082534
1066 Ga0207700_10934600
1067 Ga0207664_10170042
1068 Ga0207664_10273554
1069 Ga0207664_11607051
1070 Ga0207644_10013536
1071 Ga0207690_10013779
1072 Ga0207690_11112989
1073 Ga0207706_10007224
1074 Ga0207686_10001374
1075 Ga0207686_10864728
1076 Ga0207686_11295226
1077 Ga0207709_10004392
1078 Ga0207709_10060986
1079 Ga0207670_10166891
1080 Ga0207670_11612016
1081 Ga0207669_10002459
1082 Ga0207669_10850045
1083 Ga0207704_10000782
1084 Ga0207704_10255994
1085 Ga0207665_10002538
1086 Ga0207665_10009183
1087 Ga0207665_10238527
1088 Ga0207665_10464640
1089 Ga0207711_10000202
1090 Ga0207711_10034656
1091 Ga0207711_10196945
1092 Ga0207689_10026005
1093 Ga0207689_11229313
1094 Ga0207661_10534907
1095 Ga0207667_10438704
1096 Ga0207667_10748967
1097 Ga0207651_10336513
1098 Ga0207651_10377840
1099 Ga0207712_10000042
1100 Ga0207712_10008647
1101 Ga0207712_10065648
1102 Ga0207712_10370364
1103 Ga0207712_11190356
1104 Ga0207668_10011924
1105 Ga0207668_10111900
1106 Ga0207668_11357484
1107 Ga0207640_10004834
1108 Ga0207640_10182979
1109 Ga0207640_10522786
1110 Ga0207658_10000409
1111 Ga0207658_10010952
1112 Ga0207658_10161563
1113 Ga0207658_10263243
1114 Ga0207658_11474042
1115 Ga0207677_10004948
1116 Ga0207677_10031317
1117 Ga0207677_10437664
1118 Ga0207703_10010438
1119 Ga0207703_10210689
1120 Ga0207703_10335301
1121 Ga0207703_11463870
1122 Ga0207639_10039781
1123 Ga0207639_10497629
1124 Ga0207678_10006686
1125 Ga0207678_10015033
1126 Ga0207708_10004516
1127 Ga0207708_10052632
1128 Ga0207708_10268385
1129 Ga0207708_10623401
1130 Ga0207702_10386599
1131 Ga0207641_10007933
1132 Ga0207641_10009388
1133 Ga0207641_10093421
1134 Ga0207648_10004400
1135 Ga0207648_10122222
1136 Ga0207676_10207378
1137 Ga0207676_10696378
1138 Ga0207676_11563999
1139 Ga0207675_100000419
1140 Ga0207675_100085853
1141 Ga0207675_101726178
1142 Ga0207683_10000386
1143 Ga0207683_10096016
1144 Ga0207698_10187837
1145 Ga0207698_10344979
1146 Ga0209813_10133789
1147 Ga0268266_10015538
1148 Ga0268266_10020057
1149 Ga0268266_10033092
1150 Ga0268265_10000051
1151 Ga0268265_10006561
1152 Ga0268265_10188270
1153 Ga0268265_10197437
1154 Ga0268265_10524320
1155 Ga0268265_11726196
1156 Ga0268264_10000108
1157 Ga0268264_10019336
1158 Ga0268264_10181326
1159 Ga0268264_10258218
1160 Ga0268264_11229131
1161 Ga0268264_11319055
1162 Ga0307410_10002941
1163 Ga0307410_10160464
1164 Ga0307410_11374609
1165 Ga0307406_10037252
1166 Ga0307407_10169413
1167 Ga0307407_10706202
1168 Ga0307409_100117999
1169 Ga0307409_100516895
1170 Ga0307409_101360740
1171 Ga0307416_100239307
1172 Ga0307416_101046657
1173 Ga0307414_10329339
1174 Ga0307411_10010708
1175 Ga0307411_10844074
1176 Ga0307415_100191992
1177 Ga0373958_0075028
1178 Ga0373938_0161466
1179 Ga0373951_0108321
1180 Ga0373939_0126951
1181 Ga0373941_0068426
1182 Ga0373960_0032858
1183 Ga0373931_0007355
1184 Ga0373931_0172817
1185 Ga0373947_0413402
1186 Ga0373925_0720096
1187 Ga0395898_1044394
1188 Ga0395905_0656641
1189 Ga0436364_0210802
1190 Ga0436364_0665239
1191 Ga0436364_0740200
1192 Ga0436364_1035203
1193 Ga0436365_0085052
1194 Ga0436365_0411865
1195 Ga0436365_0922410
1196 Ga0436365_1355905
1197 Ga0436360_0892117
1198 Ga0436361_0217454
1199 Ga0436361_0492283
1200 Ga0436363_0141792
1201 Ga0436363_0669183
1202 Ga0436363_0829327
1203 Ga0436363_0861738
1204 Ga0436363_1362967
1205 Ga0436363_1519424
1206 Ga0436363_1702584
1207 Ga0436362_1160607
1208 Ga0439461_0012051
1209 Ga0439466_0001413
1210 Ga0439466_0052592
1211 Ga0439465_0002196
1212 Ga0439465_0002908
1213 Ga0439465_0209662
1214 Ga0451833_1334059
1215 Ga0451845_0290541
1216 Ga0451851_1366376
1217 Ga0451853_0827965
1218 Ga0439431_0085283
1219 Ga0439431_0155130
1220 Ga0439442_004331
1221 Ga0439445_0012586
1222 Ga0439445_0026649
1223 Ga0439434_0010245
1224 Ga0439459_0071878
1225 Ga0466969_0041698
1226 Ga0466969_0117849
1227 Ga0466972_0048372
1228 Ga0466972_0089285
1229 Ga0466972_0138215
1230 Ga0466965_0300226
1231 Ga0466966_0003513
1232 Ga0466966_0010506
1233 Ga0466966_0136596
1234 Ga0466961_0011041
1235 Ga0466961_0137673
1236 Ga0466961_0985250
1237 Ga0466963_0065877
1238 Ga0466963_0088987
1239 Ga0466963_0186490
1240 Ga0466963_0190247
1241 Ga0466963_0190617
1242 Ga0466963_0552132
1243 Ga0466964_0096277
1244 Ga0466964_0162813
1245 Ga0466964_0324821
1246 Ga0466971_0030802
1247 Ga0466971_0077300
1248 Ga0466971_0177058
1249 Ga0466971_0378190
1250 Ga0466968_0004782
1251 Ga0466968_0266771
1252 Ga0466970_0046356
1253 Ga0466957_0003608
1254 Ga0466957_0156352
1255 Ga0466957_0200628
1256 Ga0466957_0217607
1257 Ga0466957_0452894
1258 Ga0466960_0002343
1259 Ga0466960_0020412
1260 Ga0466960_0564862
1261 Ga0466960_0985694
1262 Ga0466959_0068362
1263 Ga0466959_0582925
1264 Ga0466958_0002894
1265 Ga0466958_0042317
1266 Ga0466958_0063326
1267 Ga0466958_0105310
1268 Ga0466967_0007417
1269 Ga0466967_0128451
1270 Ga0466967_0354590
1271 Ga0466967_0507133
1272 Ga0466967_0679503
1273 Ga0466967_0754954
1274 Ga0466967_2169028
1275 Ga0466967_2434759
1276 Ga0495629_0144134
1277 Ga0495641_0016281
1278 Ga0495582_0008239
1279 Ga0495639_0137128
1280 Ga0495584_0376903
1281 Ga0495606_0617058
1282 Ga0495630_0055810
1283 Ga0495640_0049163
1284 Ga0495622_0394675
1285 Ga0495634_0883627
1286 Ga0495611_0315501
1287 Ga0495658_0037158
1288 Ga0495613_0492805
1289 Ga0495624_0562225
1290 Ga0495649_0243805
1291 Ga0495589_0440009
1292 Ga0495581_0259194
1293 Ga0495674_0130317
1294 Ga0495672_0109666
1295 Ga0495676_0236647
1296 Ga0495684_0672487
1297 Ga0495593_0170572
1298 Ga0495626_0408599
1299 Ga0496100_0020033
1300 Ga0496100_0120217
1301 Ga0496100_0121195
1302 Ga0496100_0445024
1303 Ga0496100_1434927
1304 Ga0496101_0002255
1305 Ga0496101_0006735
1306 Ga0496101_0032011
1307 Ga0496101_0040574
1308 Ga0496101_0582327
1309 Ga0496101_0728461
1310 Ga0496101_1362230
1311 Ga0496102_0001066
1312 Ga0496102_0014356
1313 Ga0496102_0052105
1314 Ga0496102_0082538
1315 Ga0496102_0085035
1316 Ga0496102_0156613
1317 Ga0496102_0201134
1318 Ga0496103_0001226
1319 Ga0496103_0002026
1320 Ga0496103_0055611
1321 Ga0496103_0146630
1322 Ga0496103_0769103
1323 Ga0496103_0802779
1324 Ga0496104_0198656
1325 Ga0496104_1780180
1326 Ga0496105_0063979
1327 Ga0496105_0394129
1328 Ga0496105_0533487
1329 Ga0496105_0606666
1330 Ga0496105_0648962
1331 Ga0496106_0001406
1332 Ga0496106_0188350
1333 Ga0496106_0197064
1334 Ga0496106_0702616
1335 Ga0496107_0001641
1336 Ga0496107_0209830
1337 Ga0496107_0849672
1338 Ga0496108_0012478
1339 Ga0496108_0147864
1340 Ga0496108_0183240
1341 Ga0496109_0005854
1342 Ga0496109_0009168
1343 Ga0496109_0562674
1344 Ga0496109_0720040
1345 Ga0496109_0969161
1346 Ga0496110_0051203
1347 Ga0496110_0143004
1348 Ga0496110_0414374
1349 Ga0496110_0485996
1350 Ga0496110_1046413
1351 Ga0496111_0226749
1352 Ga0496111_0381433
1353 Ga0496111_1062026
1354 Ga0496112_0014391
1355 Ga0496112_0038501
1356 Ga0496112_0045521
1357 Ga0496112_0085695
1358 Ga0496112_0322217
1359 Ga0496112_0796494
1360 Ga0496112_1044831
1361 Ga0496113_0034812
1362 Ga0496113_0267046
1363 Ga0496113_0668779
1364 Ga0496114_0000486
1365 Ga0496114_0445083
1366 Ga0496114_0799519
1367 Ga0496114_1541820
1368 Ga0496115_0002673
1369 Ga0496115_0362645
1370 Ga0496115_0625441
1371 Ga0496116_0181686
1372 Ga0496117_0000430
1373 Ga0496118_0000165
1374 Ga0496118_0002530
1375 Ga0496119_0005297
1376 Ga0496120_0020219
1377 Ga0496121_0007201
1378 Ga0496122_0362701
1379 Ga0496124_0203883
1380 Ga0496125_0006092
1381 Ga0496126_0003255
1382 Ga0496126_0010065
1383 Ga0501032_0006334
1384 Ga0501033_0008828
1385 Ga0501033_0614765
1386 Ga0501034_0005259
1387 Ga0501034_0075196
1388 Ga0501034_0530082
1389 Ga0501036_0076998
1390 Ga0501037_0003402
1391 Ga0501039_0772504
1392 Ga0501043_0461422
1393 Ga0501046_0003379
1394 Ga0501046_0683761
1395 Ga0501046_1079268
1396 Ga0501047_0004498
1397 Ga0501047_0019957
1398 Ga0501047_0425496
1399 Ga0501047_1357948
1400 Ga0501048_0000667
1401 Ga0501068_0742350
1402 Ga0501069_0034450
1403 Ga0501070_0000669
1404 Ga0501070_0026142
1405 Ga0501073_0296647
1406 Ga0501073_0379916
1407 Ga0501075_0504579
1408 Ga0501080_0061436
1409 Ga0501080_0162495
1410 Ga0501035_0001642
1411 Ga0501035_0005600
1412 Ga0501044_0002795
1413 Ga0501044_0080500
1414 Ga0501044_0759775
1415 nmdc:mga03683_391651_c1
1416 nmdc:mga03n38_10754_c1
1417 nmdc:mga03n38_1784_c1
1418 nmdc:mga03n38_24001_c1
1419 nmdc:mga03n38_646847_c1
1420 nmdc:mga03n38_7109_c1
1421 nmdc:mga03n38_7316_c1
1422 nmdc:mga00v17_19256_c1
1423 nmdc:mga00v17_3944_c1
1424 nmdc:mga00v17_940870_c1
1425 nmdc:mga0yw44_1004714_c1
1426 nmdc:mga0yw44_143534_c1
1427 nmdc:mga0yw44_198331_c1
1428 nmdc:mga0yw44_5528_c1
1429 nmdc:mga06z11_224830_c1
1430 nmdc:mga06z11_73724_c1
1431 nmdc:mga06z11_78535_c1
1432 nmdc:mga04h51_127934_c1
1433 nmdc:mga04h51_143312_c1
1434 nmdc:mga04h51_253272_c1
1435 nmdc:mga07m45_110684_c1
1436 nmdc:mga07m45_12019_c2
1437 nmdc:mga07m45_189061_c1
1438 nmdc:mga07m45_44078_c1
1439 nmdc:mga07m45_47558_c1
1440 nmdc:mga07m45_97324_c1
1441 nmdc:mga05p37_95168_c1
1442 nmdc:mga0qj67_28389_c1
1443 nmdc:mga0qj67_60357_c1
1444 nmdc:mga06r32_21217_c1
1445 nmdc:mga08y16_384990_c1
1446 nmdc:mga08y16_760618_c1
1447 nmdc:mga0n895_794066_c1
1448 nmdc:mga0sz30_14487_c1
1449 nmdc:mga0sz30_14605_c1
1450 nmdc:mga0sz30_5539_c1
1451 nmdc:mga0sz30_63749_c1
1452 Ga0495655_0152644
1453 Ga0495619_1066477
1454 Ga0500578_0093282
1455 Ga0500642_0049190
1456 Ga0500604_0228985
1457 Ga0500620_106883
1458 Ga0466962_0149282
1459 Ga0466962_0183455
1460 Ga0466962_0368541
1461 2508672945
1462 2508675341
1463 2686534866
1464 2686539147
1465 2689955756
1466 2689991030
1467 2895881981
1468 2895887673

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00364

Biotin_lipoyl

Biotin-requiring enzyme

19

90

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
5csa-assembly1.cif.gz_A crystal structure of domains bt-bccp-ac1-ac5 of yeast acetyl-coa carboxylase 0.9421 5 77
5csa-assembly1.cif.gz_B crystal structure of domains bt-bccp-ac1-ac5 of yeast acetyl-coa carboxylase 0.94 5 77
2kcc-assembly1.cif.gz_A solution structure of biotinoyl domain from human acetyl-coa carboxylase 2 0.9363 4 78
2pnr-assembly2.cif.gz_G crystal structure of the asymmetric pdk3-l2 complex 0.9331 6 78
6g2d-assembly1.cif.gz_D citrate-induced acetyl-coa carboxylase (acc-cit) filament at 5.4 a resolution 0.9328 4 77
ID Description Score Start End Superfamily
af_P9WIS7_123_196_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9717 7 77 2.40.50.100
af_A0A1D6KPB2_40_143_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9612 2 76 2.40.50.100
af_Q2FYM2_1_102_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9597 5 78 2.40.50.100
af_A4I3X3_25_102_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9591 4 78 2.40.50.100
af_A0A0R0K6S7_676_747_2.40.50.100 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);RNA polymerase II/Efflux pump adaptor protein, barrel-sandwich hybrid domain 0.9571 16 78 2.40.50.100
ID Description Score Start End GO Terms
AF-A0A031K6L3-F1-model_v4 Biotin/lipoyl attachment domain-containing protein 0.9967 3 77 GO:0005737
GO:0016407
GO:0031405
AF-A0A1A2P3P7-F1-model_v4 Dihydrolipoamide acyltransferase 0.9944 1 78 GO:0016746
AF-A0A6J7B039-F1-model_v4 Unannotated protein 0.9927 4 78 GO:0006086
GO:0045254
AF-A0A2U3PG49-F1-model_v4 Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component 0.9924 1 78 GO:0016746
AF-A0A7C7Q232-F1-model_v4 Lipoyl-binding domain-containing protein 0.9923 2 77 GO:0006086
GO:0045254

Map