F478118

General Info

Members Datasets Scaffolds Average Seq Length
734 398 1468 139

Family's Representative Sequence

Representative Sequence 3300005331|Ga0070670_101378627|Ga0070670_1013786271
Length 157
Sequence VPKTPIRDLPHAPVANTVLNPAGWPQPKGYANGIKARGEMVFTGGMVGWDEHGKFPKGFVAQTRQALVNVAAVLAAGGATPEHIVRMTWYVVDLGEYRSALPQIGAAYRDIMGRHYPAMALVEVKGLVEPEARLEIEATAVIPDWAIDPALFPSDSS

Samples

Sample ID Description Type Environment
1 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
10 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
11 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
12 3300003371 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM Metagenome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
28 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
45 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
46 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
49 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
50 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
51 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
68 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
69 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
77 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
78 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
79 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
80 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
81 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
82 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
83 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
87 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
88 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
89 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
90 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
91 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
98 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
99 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
100 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
102 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
103 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
129 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
130 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
192 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
200 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
201 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
204 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
205 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
206 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
207 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
208 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
209 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
211 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
214 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
215 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
216 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
217 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
218 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
219 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
221 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
222 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
223 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
224 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
225 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
226 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
227 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
228 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
229 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
230 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
231 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
232 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
233 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
234 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
235 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
236 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
237 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
238 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
241 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
242 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
246 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
247 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
248 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
249 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
250 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
253 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
257 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
258 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
259 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
260 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
261 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
262 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
263 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
264 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
265 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
266 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
267 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
268 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
269 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
270 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
271 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
272 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
273 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
274 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
275 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
276 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
277 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
278 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
279 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
280 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
281 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
282 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
283 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
284 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
285 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
288 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
289 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
290 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
291 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
292 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
293 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
294 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
295 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
296 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
297 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
298 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
299 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
300 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
301 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
302 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
303 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
304 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
305 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
306 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
307 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
308 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
309 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
310 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
311 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
312 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
313 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
314 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
315 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
316 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
317 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
318 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
319 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
320 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
321 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
322 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
323 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
326 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
327 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
328 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
329 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
331 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
332 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
333 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
334 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
335 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
336 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
337 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
340 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
341 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
342 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
343 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
344 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
345 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
346 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
347 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
348 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
349 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
350 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
351 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
352 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
353 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
354 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
355 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
359 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
360 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
361 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
362 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
363 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
364 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
365 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
366 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
367 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
368 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
369 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
370 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
371 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
372 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
373 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
374 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
375 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
376 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
377 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
378 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
379 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
380 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
381 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
382 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
383 3300053144 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 endosphere Metagenome Endosphere
384 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
385 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
386 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
387 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
388 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
389 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
390 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
391 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
392 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
393 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
396 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
397 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
398 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.59
Metatranscriptomes 0.14
Isolates 0.27

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.63
Nodule 0.14
Rhizoplane 6.81
Rhizosphere 86.38
Stem 0
Stem Tuber 0
Unclassified 1.23

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070670_101378627 3300005331 Bacteria 646
2 JGI24746J21847_1004296 3300001977 Bacteria 2248
3 JGI24737J22298_10038497 3300001990 Bacteria 1472
4 JGI24743J22301_10015799 3300001991 Bacteria 1403
5 JGI24750J21931_1008797 3300002070 Bacteria 1290
6 JGI24748J21848_1047985 3300002074 Bacteria 554
7 JGI24738J21930_10070717 3300002075 Bacteria 723
8 JGI24744J21845_10034007 3300002077 Unclassified 968
9 JGI24742J22300_10018619 3300002244 Bacteria 1177
10 JGI24751J29686_10019199 3300002459 Bacteria 1415
11 JGI24751J29686_10070775 3300002459 Bacteria 719
12 JGI25406J46586_10001454 3300003203 Bacteria 11164
13 JGI26145J50221_1005418 3300003371 Bacteria 1049
14 Ga0070683_100059476 3300005329 Bacteria 3550
15 Ga0070683_100102367 3300005329 Bacteria 2697
16 Ga0070690_100115416 3300005330 Bacteria 1796
17 Ga0070690_100271306 3300005330 Bacteria 1207
18 Ga0070670_100043796 3300005331 Bacteria 3847
19 Ga0070670_100111504 3300005331 Bacteria 2357
20 Ga0068869_100074184 3300005334 Bacteria 2525
21 Ga0070680_100006302 3300005336 Bacteria 9009
22 Ga0070680_100013218 3300005336 Bacteria 6426
23 Ga0070680_100025986 3300005336 Bacteria 4682
24 Ga0070680_100142586 3300005336 Bacteria 2009
25 Ga0070680_100593757 3300005336 Bacteria 950
26 Ga0070680_100633260 3300005336 Bacteria 919
27 Ga0070682_100126457 3300005337 Bacteria 1723
28 Ga0068868_100003937 3300005338 Bacteria 10376
29 Ga0068868_101676218 3300005338 Bacteria 599
30 Ga0068868_101988152 3300005338 Bacteria 552
31 Ga0070660_100136719 3300005339 Bacteria 1964
32 Ga0070660_101488532 3300005339 Bacteria 575
33 Ga0070689_100036422 3300005340 Bacteria 3763
34 Ga0070661_100289784 3300005344 Bacteria 1272
35 Ga0070661_100582786 3300005344 Bacteria 903
36 Ga0070668_100118015 3300005347 Bacteria 2118
37 Ga0070668_100150353 3300005347 Bacteria 1882
38 Ga0070668_101703167 3300005347 Bacteria 579
39 Ga0070669_100149230 3300005353 Bacteria 1809
40 Ga0070675_100104542 3300005354 Bacteria 2389
41 Ga0070671_100178617 3300005355 Bacteria 1797
42 Ga0070674_100071130 3300005356 Bacteria 2460
43 Ga0070674_100142259 3300005356 Bacteria 1801
44 Ga0070688_100069034 3300005365 Bacteria 2255
45 Ga0070659_100009241 3300005366 Bacteria 7236
46 Ga0070659_100184634 3300005366 Bacteria 1712
47 Ga0070659_100222155 3300005366 Bacteria 1559
48 Ga0070659_100427541 3300005366 Bacteria 1121
49 Ga0070667_100372126 3300005367 Bacteria 1296
50 Ga0070709_10040080 3300005434 Bacteria 2878
51 Ga0070709_10607442 3300005434 Bacteria 843
52 Ga0070709_10906897 3300005434 Bacteria 697
53 Ga0070714_100020964 3300005435 Bacteria 5343
54 Ga0070714_100033591 3300005435 Bacteria 4289
55 Ga0070714_100066379 3300005435 Bacteria 3109
56 Ga0070714_100332537 3300005435 Bacteria 1423
57 Ga0070713_100074971 3300005436 Bacteria 2868
58 Ga0070713_100241267 3300005436 Bacteria 1646
59 Ga0070713_101054250 3300005436 Bacteria 785
60 Ga0070710_10025558 3300005437 Bacteria 3128
61 Ga0070710_10033223 3300005437 Bacteria 2800
62 Ga0070701_10026215 3300005438 Bacteria 2840
63 Ga0070701_10041104 3300005438 Bacteria 2354
64 Ga0070711_100011073 3300005439 Bacteria 5596
65 Ga0070711_100658033 3300005439 Bacteria 879
66 Ga0070705_100003389 3300005440 Bacteria 7809
67 Ga0070705_100065930 3300005440 Bacteria 2170
68 Ga0070700_100133387 3300005441 Bacteria 1679
69 Ga0070694_100012740 3300005444 Bacteria 5237
70 Ga0070694_100098299 3300005444 Bacteria 2066
71 Ga0070694_100608480 3300005444 Bacteria 881
72 Ga0070663_100012742 3300005455 Bacteria 5331
73 Ga0070678_100305920 3300005456 Unclassified 1352
74 Ga0070662_100041308 3300005457 Bacteria 3289
75 Ga0070662_100669865 3300005457 Bacteria 876
76 Ga0070662_100897790 3300005457 Bacteria 756
77 Ga0070681_11179722 3300005458 Bacteria 687
78 Ga0070681_11826228 3300005458 Bacteria 535
79 Ga0068867_100069746 3300005459 Bacteria 2626
80 Ga0070685_10514582 3300005466 Bacteria 849
81 Ga0070706_100440395 3300005467 Bacteria 1213
82 Ga0070707_100149073 3300005468 Bacteria 2277
83 Ga0070698_100946089 3300005471 Bacteria 808
84 Ga0070698_101032901 3300005471 Unclassified 769
85 Ga0070699_100017329 3300005518 Bacteria 6186
86 Ga0070699_100255397 3300005518 Bacteria 1567
87 Ga0070699_100710469 3300005518 Bacteria 918
88 Ga0070679_100027051 3300005530 Bacteria 5640
89 Ga0070679_100309887 3300005530 Bacteria 1528
90 Ga0070684_100007708 3300005535 Bacteria 8394
91 Ga0070684_100015705 3300005535 Bacteria 6176
92 Ga0070697_100034563 3300005536 Bacteria 4076
93 Ga0070697_100805018 3300005536 Bacteria 831
94 Ga0068853_100030294 3300005539 Bacteria 4569
95 Ga0068853_100150963 3300005539 Bacteria 2092
96 Ga0070672_100039716 3300005543 Bacteria 3606
97 Ga0070672_100448472 3300005543 Bacteria 1111
98 Ga0070686_100206403 3300005544 Unclassified 1412
99 Ga0070686_100283450 3300005544 Bacteria 1223
100 Ga0070695_100008978 3300005545 Bacteria 5940
101 Ga0070695_100079417 3300005545 Bacteria 2166
102 Ga0070695_100176028 3300005545 Bacteria 1512
103 Ga0070696_100008630 3300005546 Bacteria 6816
104 Ga0070696_100096914 3300005546 Bacteria 2108
105 Ga0070696_100107131 3300005546 Bacteria 2010
106 Ga0070693_100147325 3300005547 Bacteria 1488
107 Ga0070693_101031922 3300005547 Bacteria 624
108 Ga0070665_101210485 3300005548 Bacteria 766
109 Ga0070704_100022383 3300005549 Bacteria 4111
110 Ga0070704_100456787 3300005549 Bacteria 1101
111 Ga0068855_100062157 3300005563 Bacteria 4360
112 Ga0068855_100707343 3300005563 Bacteria 1078
113 Ga0068855_102384104 3300005563 Bacteria 528
114 Ga0070664_100140031 3300005564 Bacteria 2130
115 Ga0068857_100543206 3300005577 Bacteria 1094
116 Ga0068857_101045099 3300005577 Bacteria 787
117 Ga0068857_101459941 3300005577 Bacteria 666
118 Ga0068854_100064035 3300005578 Bacteria 2670
119 Ga0068856_100002806 3300005614 Bacteria 17838
120 Ga0068856_100043735 3300005614 Bacteria 4406
121 Ga0070702_100013652 3300005615 Bacteria 4106
122 Ga0070702_100165567 3300005615 Bacteria 1433
123 Ga0068852_100018764 3300005616 Bacteria 5456
124 Ga0068852_100053567 3300005616 Bacteria 3473
125 Ga0068852_100187813 3300005616 Bacteria 1947
126 Ga0068852_100744800 3300005616 Bacteria 992
127 Ga0068852_101795425 3300005616 Bacteria 636
128 Ga0068864_100170463 3300005618 Bacteria 1984
129 Ga0068866_10056840 3300005718 Bacteria 2013
130 Ga0068861_100070512 3300005719 Bacteria 2706
131 Ga0068861_100137899 3300005719 Bacteria 1987
132 Ga0068870_10008552 3300005840 Bacteria 4610
133 Ga0068870_11295440 3300005840 Bacteria 531
134 Ga0068863_100226401 3300005841 Bacteria 1803
135 Ga0068858_100184157 3300005842 Bacteria 1972
136 Ga0068858_100356923 3300005842 Bacteria 1401
137 Ga0068860_100098687 3300005843 Bacteria 2785
138 Ga0068862_100254424 3300005844 Bacteria 1601
139 Ga0068862_100691924 3300005844 Bacteria 987
140 Ga0081455_10040871 3300005937 Bacteria 4086
141 Ga0081455_10278714 3300005937 Bacteria 1209
142 Ga0081455_10664194 3300005937 Bacteria 669
143 Ga0081540_1000085 3300005983 Bacteria 99716
144 Ga0081539_10000115 3300005985 Bacteria 188623
145 Ga0081539_10000233 3300005985 Bacteria 130647
146 Ga0081539_10148513 3300005985 Bacteria 1130
147 Ga0070717_10042041 3300006028 Bacteria 3728
148 Ga0070717_10351401 3300006028 Bacteria 1318
149 Ga0070717_10638143 3300006028 Bacteria 967
150 Ga0070717_11302714 3300006028 Bacteria 660
151 Ga0075365_10146614 3300006038 Bacteria 1640
152 Ga0075365_10962510 3300006038 Bacteria 602
153 Ga0075363_100751685 3300006048 Bacteria 591
154 Ga0070715_10013823 3300006163 Bacteria 2974
155 Ga0070716_100696368 3300006173 Bacteria 776
156 Ga0070716_101636555 3300006173 Bacteria 530
157 Ga0070712_100178289 3300006175 Bacteria 1654
158 Ga0075369_10399470 3300006186 Bacteria 648
159 Ga0097621_100037673 3300006237 Bacteria 3877
160 Ga0075428_100001052 3300006844 Bacteria 29310
161 Ga0075428_100071322 3300006844 Bacteria 3797
162 Ga0075430_101431162 3300006846 Bacteria 568
163 Ga0075431_100000254 3300006847 Bacteria 40759
164 Ga0075431_100256718 3300006847 Bacteria 1775
165 Ga0075433_10565794 3300006852 Bacteria 999
166 Ga0075433_10597983 3300006852 Bacteria 968
167 Ga0075434_100032257 3300006871 Bacteria 5165
168 Ga0075434_100061744 3300006871 Bacteria 3729
169 Ga0075434_100519885 3300006871 Bacteria 1210
170 Ga0075429_100006359 3300006880 Bacteria 10222
171 Ga0075429_101016058 3300006880 Bacteria 725
172 Ga0068865_100067309 3300006881 Bacteria 2529
173 Ga0068865_100298032 3300006881 Bacteria 1289
174 Ga0075436_100001103 3300006914 Bacteria 18234
175 Ga0075436_100043544 3300006914 Bacteria 3095
176 Ga0075436_100527129 3300006914 Bacteria 866
177 Ga0075435_100269019 3300007076 Bacteria 1453
178 Ga0075435_100327498 3300007076 Bacteria 1312
179 Ga0075435_100343670 3300007076 Bacteria 1279
180 Ga0075435_100677632 3300007076 Bacteria 896
181 Ga0075435_100897960 3300007076 Bacteria 773
182 Ga0075435_101324702 3300007076 Bacteria 631
183 Ga0099794_10588443 3300007265 Bacteria 589
184 Ga0099795_10224030 3300007788 Bacteria 801
185 Ga0111539_10000564 3300009094 Bacteria 47420
186 Ga0111539_10178108 3300009094 Bacteria 2484
187 Ga0111539_10381819 3300009094 Bacteria 1640
188 Ga0111539_10506533 3300009094 Bacteria 1406
189 Ga0111539_10617513 3300009094 Bacteria 1262
190 Ga0111539_11331927 3300009094 Bacteria 833
191 Ga0105245_10143127 3300009098 Bacteria 2254
192 Ga0105245_10160035 3300009098 Bacteria 2136
193 Ga0105245_10325421 3300009098 Bacteria 1516
194 Ga0105245_10431157 3300009098 Bacteria 1323
195 Ga0105245_10471221 3300009098 Bacteria 1267
196 Ga0105247_10094632 3300009101 Bacteria 1901
197 Ga0105247_10186518 3300009101 Bacteria 1387
198 Ga0114129_10000401 3300009147 Bacteria 50696
199 Ga0114129_10154099 3300009147 Bacteria 3144
200 Ga0114129_10385134 3300009147 Bacteria 1851
201 Ga0114129_10459595 3300009147 Bacteria 1668
202 Ga0114129_10841051 3300009147 Bacteria 1168
203 Ga0105243_10835784 3300009148 Bacteria 911
204 Ga0105241_12006217 3300009174 Bacteria 570
205 Ga0105242_10049066 3300009176 Bacteria 3434
206 Ga0105248_10108868 3300009177 Bacteria 3124
207 Ga0105248_11163334 3300009177 Bacteria 872
208 Ga0105237_10160225 3300009545 Bacteria 2248
209 Ga0105237_10746934 3300009545 Bacteria 985
210 Ga0105237_10880257 3300009545 Bacteria 902
211 Ga0105238_10117055 3300009551 Bacteria 2645
212 Ga0105249_10125301 3300009553 Bacteria 2446
213 Ga0105249_10638280 3300009553 Bacteria 1122
214 Ga0099796_10458302 3300010159 Bacteria 568
215 Ga0105239_10124104 3300010375 Bacteria 2869
216 Ga0105239_11501238 3300010375 Bacteria 779
217 Ga0105239_11981052 3300010375 Bacteria 676
218 Ga0105246_10627451 3300011119 Bacteria 932
219 Ga0157373_10166323 3300013100 Bacteria 1552
220 Ga0157370_10087399 3300013104 Bacteria 2928
221 Ga0157370_10533435 3300013104 Bacteria 1076
222 Ga0157370_10820076 3300013104 Bacteria 846
223 Ga0157369_10150158 3300013105 Bacteria 2462
224 Ga0157374_10118166 3300013296 Bacteria 2557
225 Ga0157374_10305550 3300013296 Bacteria 1574
226 Ga0157378_10039895 3300013297 Bacteria 4164
227 Ga0157378_10077169 3300013297 Bacteria 3003
228 Ga0157378_11384817 3300013297 Bacteria 746
229 Ga0163162_10381927 3300013306 Bacteria 1542
230 Ga0163162_10513287 3300013306 Bacteria 1328
231 Ga0157372_10025324 3300013307 Bacteria 6448
232 Ga0157372_10111197 3300013307 Bacteria 3138
233 Ga0157372_10307394 3300013307 Bacteria 1845
234 Ga0157372_11161471 3300013307 Bacteria 893
235 Ga0157372_11766464 3300013307 Bacteria 711
236 Ga0157375_10009515 3300013308 Bacteria 8532
237 Ga0157375_10034787 3300013308 Bacteria 4802
238 Ga0157375_10941942 3300013308 Bacteria 1006
239 Ga0157375_13710535 3300013308 Bacteria 508
240 Ga0163163_10070361 3300014325 Bacteria 3484
241 Ga0163163_10819335 3300014325 Bacteria 994
242 Ga0157380_10044331 3300014326 Bacteria 3486
243 Ga0157377_10155841 3300014745 Bacteria 1416
244 Ga0157379_10158316 3300014968 Bacteria 2044
245 Ga0157379_10721007 3300014968 Bacteria 937
246 Ga0157376_11043644 3300014969 Bacteria 841
247 Ga0163161_10208906 3300017792 Bacteria 1507
248 Ga0163161_10365622 3300017792 Bacteria 1150
249 Ga0206353_10575608 3300020082 Bacteria 702
250 Ga0213873_10050150 3300021358 Bacteria 1103
251 Ga0213876_10045343 3300021384 Bacteria 2325
252 Ga0213875_10000138 3300021388 Bacteria 79866
253 Ga0209758_1042818 3300025297 Bacteria 1675
254 Ga0207692_10013653 3300025898 Bacteria 3529
255 Ga0207692_10072850 3300025898 Bacteria 1815
256 Ga0207642_10003941 3300025899 Bacteria 4735
257 Ga0207642_10859493 3300025899 Bacteria 579
258 Ga0207710_10044074 3300025900 Bacteria 1986
259 Ga0207710_10082035 3300025900 Bacteria 1497
260 Ga0207688_10003505 3300025901 Bacteria 8561
261 Ga0207680_10171031 3300025903 Bacteria 1463
262 Ga0207647_10060827 3300025904 Bacteria 2307
263 Ga0207647_10208081 3300025904 Bacteria 1130
264 Ga0207699_10093174 3300025906 Bacteria 1895
265 Ga0207699_10201981 3300025906 Bacteria 1347
266 Ga0207699_10685890 3300025906 Bacteria 749
267 Ga0207643_10003204 3300025908 Bacteria 8814
268 Ga0207643_10893597 3300025908 Bacteria 576
269 Ga0207705_10042055 3300025909 Bacteria 3280
270 Ga0207705_10314201 3300025909 Bacteria 1203
271 Ga0207684_10091995 3300025910 Bacteria 2586
272 Ga0207684_10347844 3300025910 Bacteria 1276
273 Ga0207684_10891326 3300025910 Bacteria 748
274 Ga0207707_10000978 3300025912 Bacteria 27477
275 Ga0207695_11221264 3300025913 Bacteria 632
276 Ga0207671_10122302 3300025914 Bacteria 1990
277 Ga0207663_10298338 3300025916 Bacteria 1203
278 Ga0207660_10050255 3300025917 Bacteria 2960
279 Ga0207660_10076594 3300025917 Bacteria 2446
280 Ga0207660_10684265 3300025917 Bacteria 837
281 Ga0207662_10026501 3300025918 Bacteria 3343
282 Ga0207657_10008203 3300025919 Bacteria 10643
283 Ga0207657_10011925 3300025919 Bacteria 8601
284 Ga0207657_10085980 3300025919 Bacteria 2633
285 Ga0207649_10181213 3300025920 Bacteria 1474
286 Ga0207649_10238218 3300025920 Bacteria 1305
287 Ga0207652_10011694 3300025921 Bacteria 7082
288 Ga0207652_10337942 3300025921 Bacteria 1359
289 Ga0207652_11499926 3300025921 Bacteria 578
290 Ga0207646_10222228 3300025922 Bacteria 1706
291 Ga0207681_10612866 3300025923 Bacteria 900
292 Ga0207694_10216141 3300025924 Bacteria 1562
293 Ga0207650_10031109 3300025925 Bacteria 3851
294 Ga0207650_10338576 3300025925 Bacteria 1235
295 Ga0207650_11136855 3300025925 Bacteria 665
296 Ga0207659_10078806 3300025926 Bacteria 2428
297 Ga0207687_10016490 3300025927 Bacteria 4852
298 Ga0207687_10076146 3300025927 Bacteria 2409
299 Ga0207687_10709871 3300025927 Bacteria 854
300 Ga0207700_10080802 3300025928 Bacteria 2536
301 Ga0207700_10332188 3300025928 Bacteria 1320
302 Ga0207664_10014142 3300025929 Bacteria 5755
303 Ga0207664_10023885 3300025929 Bacteria 4587
304 Ga0207664_10052930 3300025929 Bacteria 3211
305 Ga0207664_10821194 3300025929 Bacteria 836
306 Ga0207644_10141778 3300025931 Bacteria 1851
307 Ga0207644_10486513 3300025931 Bacteria 1017
308 Ga0207644_11886447 3300025931 Bacteria 500
309 Ga0207690_10055449 3300025932 Bacteria 2669
310 Ga0207690_10107535 3300025932 Bacteria 2003
311 Ga0207706_10018002 3300025933 Bacteria 6357
312 Ga0207706_10483875 3300025933 Bacteria 1069
313 Ga0207709_10256602 3300025935 Bacteria 1280
314 Ga0207709_10280233 3300025935 Bacteria 1231
315 Ga0207670_10055498 3300025936 Bacteria 2678
316 Ga0207669_10021804 3300025937 Bacteria 3389
317 Ga0207704_10109711 3300025938 Bacteria 1862
318 Ga0207704_10251964 3300025938 Bacteria 1326
319 Ga0207665_10260345 3300025939 Bacteria 1285
320 Ga0207665_10677283 3300025939 Bacteria 810
321 Ga0207691_10027477 3300025940 Bacteria 5334
322 Ga0207711_10155642 3300025941 Bacteria 2065
323 Ga0207689_10019224 3300025942 Bacteria 5758
324 Ga0207661_10036039 3300025944 Bacteria 3859
325 Ga0207661_10133201 3300025944 Bacteria 2132
326 Ga0207679_10013734 3300025945 Bacteria 5310
327 Ga0207679_10088879 3300025945 Bacteria 2383
328 Ga0207679_10930069 3300025945 Bacteria 796
329 Ga0207667_10174008 3300025949 Bacteria 2212
330 Ga0207667_10264696 3300025949 Bacteria 1758
331 Ga0207667_10938066 3300025949 Bacteria 855
332 Ga0207712_10113083 3300025961 Bacteria 2040
333 Ga0207712_10471289 3300025961 Bacteria 1068
334 Ga0207668_10294361 3300025972 Bacteria 1337
335 Ga0207640_10434252 3300025981 Bacteria 1078
336 Ga0207640_11333189 3300025981 Bacteria 641
337 Ga0207658_10067383 3300025986 Bacteria 2696
338 Ga0207677_10039491 3300026023 Bacteria 3104
339 Ga0207677_10194964 3300026023 Bacteria 1605
340 Ga0207677_11122938 3300026023 Bacteria 717
341 Ga0207677_11657113 3300026023 Bacteria 593
342 Ga0207703_10047470 3300026035 Bacteria 3462
343 Ga0207703_11745110 3300026035 Bacteria 598
344 Ga0207639_10112203 3300026041 Bacteria 2224
345 Ga0207639_10246355 3300026041 Bacteria 1556
346 Ga0207678_10027199 3300026067 Bacteria 4988
347 Ga0207678_10253832 3300026067 Bacteria 1506
348 Ga0207708_10001574 3300026075 Bacteria 17043
349 Ga0207708_10029122 3300026075 Bacteria 4183
350 Ga0207708_10225760 3300026075 Bacteria 1502
351 Ga0207702_10000257 3300026078 Bacteria 61235
352 Ga0207702_10049831 3300026078 Bacteria 3534
353 Ga0207702_10384023 3300026078 Bacteria 1351
354 Ga0207641_10023689 3300026088 Bacteria 5058
355 Ga0207648_10000651 3300026089 Bacteria 38992
356 Ga0207648_10965646 3300026089 Bacteria 797
357 Ga0207676_10020617 3300026095 Bacteria 4825
358 Ga0207676_10442303 3300026095 Bacteria 1224
359 Ga0207674_10049301 3300026116 Bacteria 4307
360 Ga0207674_11385703 3300026116 Bacteria 672
361 Ga0207675_100190851 3300026118 Bacteria 1965
362 Ga0207675_100343851 3300026118 Bacteria 1461
363 Ga0207683_10004429 3300026121 Bacteria 12138
364 Ga0207698_10051267 3300026142 Bacteria 3154
365 Ga0207698_10308440 3300026142 Bacteria 1477
366 Ga0207698_10411860 3300026142 Bacteria 1295
367 Ga0209982_1040904 3300027552 Unclassified 739
368 Ga0209970_1015192 3300027614 Bacteria 1280
369 Ga0210002_1077872 3300027617 Unclassified 589
370 Ga0209983_1002713 3300027665 Bacteria 3843
371 Ga0209588_1065563 3300027671 Bacteria 1174
372 Ga0209588_1120730 3300027671 Bacteria 839
373 Ga0209971_1006523 3300027682 Bacteria 2759
374 Ga0209998_10006462 3300027717 Bacteria 2435
375 Ga0209974_10003221 3300027876 Bacteria 5900
376 Ga0207428_10006429 3300027907 Bacteria 10850
377 Ga0268265_10091775 3300028380 Bacteria 2429
378 Ga0268265_11088842 3300028380 Bacteria 793
379 Ga0268264_10481488 3300028381 Bacteria 1207
380 Ga0307517_10457256 3300028786 Bacteria 660
381 Ga0307515_10002897 3300028794 Bacteria 36452
382 Ga0307515_10077696 3300028794 Bacteria 4380
383 Ga0265314_10508260 3300031711 Bacteria 633
384 Ga0307405_12092949 3300031731 Bacteria 508
385 Ga0307510_10044903 3300033180 Bacteria 4779
386 Ga0373929_0067360 3300035085 Bacteria 850
387 Ga0373944_0119184 3300035089 Bacteria 908
388 Ga0373944_0134217 3300035089 Bacteria 862
389 Ga0373944_0145367 3300035089 Bacteria 832
390 Ga0373949_0201726 3300035090 Bacteria 598
391 Ga0373952_0062163 3300035092 Bacteria 916
392 Ga0373923_0155355 3300035111 Bacteria 1041
393 Ga0373936_0069414 3300035113 Bacteria 1450
394 Ga0373936_0078401 3300035113 Bacteria 1372
395 Ga0373936_0567278 3300035113 Bacteria 531
396 Ga0373939_0191337 3300035114 Bacteria 769
397 Ga0373945_0121739 3300035116 Bacteria 1038
398 Ga0373954_0164649 3300035118 Bacteria 1085
399 Ga0373956_0049253 3300035119 Bacteria 1889
400 Ga0373943_0007722 3300035170 Bacteria 4830
401 Ga0373943_0083771 3300035170 Bacteria 1639
402 Ga0373946_0705970 3300035171 Bacteria 527
403 Ga0373955_0034814 3300035172 Bacteria 2663
404 Ga0373955_0115807 3300035172 Bacteria 1554
405 Ga0373955_1032498 3300035172 Bacteria 506
406 Ga0373924_0191295 3300035410 Bacteria 901
407 Ga0373924_0235922 3300035410 Bacteria 809
408 Ga0373931_0363942 3300035691 Bacteria 908
409 Ga0373935_0120140 3300035692 Bacteria 1754
410 Ga0373935_0681385 3300035692 Bacteria 755
411 Ga0373927_0040935 3300035695 Bacteria 3005
412 Ga0373933_0766725 3300035724 Bacteria 635
413 Ga0373947_0046232 3300035725 Bacteria 2606
414 Ga0373947_0674533 3300035725 Bacteria 705
415 Ga0373947_0874626 3300035725 Bacteria 613
416 Ga0373937_0031713 3300036401 Bacteria 4790
417 Ga0373925_0090463 3300037068 Bacteria 2339
418 Ga0373925_0392655 3300037068 Bacteria 1131
419 Ga0373925_0795841 3300037068 Bacteria 779
420 Ga0436364_0959444 3300037853 Bacteria 1191
421 Ga0436364_1132821 3300037853 Bacteria 32633
422 Ga0395901_1912350 3300038443 Bacteria 541
423 Ga0436365_0368188 3300039437 Bacteria 3467
424 Ga0436365_0775983 3300039437 Bacteria 609
425 Ga0436365_1569483 3300039437 Bacteria 705
426 Ga0436360_0878016 3300039438 Bacteria 599
427 Ga0436360_0964724 3300039438 Bacteria 979
428 Ga0436361_0125704 3300039447 Bacteria 1174
429 Ga0436361_0398385 3300039447 Bacteria 4111
430 Ga0436363_1338574 3300039450 Bacteria 621
431 Ga0436362_0366829 3300039453 Bacteria 1281
432 Ga0436362_1306563 3300039453 Bacteria 1024
433 Ga0451798_1045371 3300041458 Bacteria 585
434 Ga0451807_0479642 3300041486 Bacteria 513
435 Ga0451849_1130782 3300041505 Bacteria 1336
436 Ga0451853_0277863 3300041512 Bacteria 1728
437 Ga0439441_000414 3300042001 Bacteria 4490
438 Ga0439464_0189979 3300042439 Bacteria 652
439 Ga0451577_0373374 3300042876 Bacteria 1294
440 Ga0466963_0023937 3300044694 Bacteria 3884
441 Ga0466964_0184398 3300044706 Bacteria 992
442 Ga0451576_0131454 3300045051 Bacteria 2609
443 Ga0451576_0796229 3300045051 Bacteria 993
444 Ga0495627_124911 3300046453 Bacteria 726
445 Ga0495592_0077364 3300046454 Bacteria 2412
446 Ga0495603_0010559 3300046455 Bacteria 5593
447 Ga0495603_0108490 3300046455 Bacteria 1620
448 Ga0495590_0074023 3300046457 Bacteria 1198
449 Ga0495629_0014878 3300046459 Bacteria 5596
450 Ga0495629_0489810 3300046459 Bacteria 830
451 Ga0495641_0023265 3300046461 Bacteria 3082
452 Ga0495580_0067978 3300046472 Bacteria 2492
453 Ga0495582_0093722 3300046473 Bacteria 1676
454 Ga0495605_0185563 3300046474 Bacteria 913
455 Ga0495639_0069589 3300046475 Bacteria 1623
456 Ga0495639_0636050 3300046475 Bacteria 549
457 Ga0495664_0034270 3300046477 Bacteria 2986
458 Ga0495584_0079027 3300046491 Bacteria 1655
459 Ga0495584_0243281 3300046491 Bacteria 915
460 Ga0495584_0501622 3300046491 Bacteria 618
461 Ga0495585_0362174 3300046492 Bacteria 703
462 Ga0495594_0013437 3300046499 Bacteria 4277
463 Ga0495594_0883227 3300046499 Bacteria 503
464 Ga0495596_0171871 3300046500 Bacteria 842
465 Ga0495607_0322864 3300046501 Bacteria 720
466 Ga0495608_0213436 3300046511 Bacteria 1213
467 Ga0495616_0269681 3300046513 Bacteria 726
468 Ga0495618_0165833 3300046514 Bacteria 1407
469 Ga0495620_0074987 3300046515 Bacteria 1377
470 Ga0495630_0049764 3300046517 Bacteria 3136
471 Ga0495630_0131834 3300046517 Bacteria 1898
472 Ga0495630_0437768 3300046517 Bacteria 1002
473 Ga0495632_0239601 3300046519 Bacteria 816
474 Ga0495637_0075335 3300046520 Bacteria 1354
475 Ga0495644_0406792 3300046523 Bacteria 539
476 Ga0495663_0061117 3300046525 Bacteria 1185
477 Ga0495666_0012526 3300046526 Bacteria 4228
478 Ga0495666_0069540 3300046526 Bacteria 1675
479 Ga0495666_0403604 3300046526 Bacteria 614
480 Ga0495652_0236092 3300046529 Bacteria 1364
481 Ga0495665_0241725 3300046531 Bacteria 930
482 Ga0495665_0280228 3300046531 Bacteria 855
483 Ga0495640_0044436 3300046533 Bacteria 3089
484 Ga0495587_0328514 3300046536 Bacteria 854
485 Ga0495598_0210322 3300046537 Bacteria 706
486 Ga0495645_0187360 3300046543 Bacteria 1413
487 Ga0495645_0419333 3300046543 Bacteria 850
488 Ga0495622_0053028 3300046557 Bacteria 1882
489 Ga0495622_0141329 3300046557 Bacteria 1093
490 Ga0495633_0082789 3300046558 Bacteria 1493
491 Ga0495633_0219360 3300046558 Bacteria 871
492 Ga0495667_0417499 3300046559 Bacteria 844
493 Ga0495656_0048717 3300046615 Bacteria 1802
494 Ga0495656_0568588 3300046615 Bacteria 605
495 Ga0495668_0177762 3300046616 Bacteria 1166
496 Ga0495634_0049903 3300046642 Bacteria 2812
497 Ga0495611_0113720 3300046648 Bacteria 1261
498 Ga0495611_0152373 3300046648 Bacteria 1079
499 Ga0495611_0270999 3300046648 Bacteria 785
500 Ga0495625_0174335 3300046660 Bacteria 1434
501 Ga0495635_0021527 3300046663 Bacteria 4495
502 Ga0495659_0167724 3300046664 Bacteria 889
503 Ga0495661_0557169 3300046665 Bacteria 542
504 Ga0495588_0339049 3300046674 Bacteria 790
505 Ga0495657_0444091 3300046675 Bacteria 760
506 Ga0495599_0167553 3300046678 Bacteria 1356
507 Ga0495599_0176924 3300046678 Bacteria 1316
508 Ga0495647_0014596 3300046681 Bacteria 2739
509 Ga0495647_0176515 3300046681 Bacteria 928
510 Ga0495658_0061822 3300046683 Bacteria 2151
511 Ga0495658_0221179 3300046683 Bacteria 1185
512 Ga0495669_0051210 3300046684 Bacteria 1853
513 Ga0495613_0444994 3300046689 Bacteria 878
514 Ga0495613_0473151 3300046689 Bacteria 846
515 Ga0495624_0019842 3300046690 Bacteria 4479
516 Ga0495624_0097393 3300046690 Bacteria 1812
517 Ga0495670_0017058 3300046691 Bacteria 3571
518 Ga0495649_0358196 3300046694 Unclassified 736
519 Ga0495589_0036976 3300046794 Bacteria 2447
520 Ga0495589_0232233 3300046794 Bacteria 865
521 Ga0495660_0068214 3300046810 Bacteria 1893
522 Ga0495581_0047740 3300047315 Bacteria 2474
523 Ga0495604_0408440 3300047317 Bacteria 893
524 Ga0495674_0027777 3300047319 Bacteria 5167
525 Ga0495674_0670202 3300047319 Bacteria 816
526 Ga0495672_0185742 3300047320 Bacteria 1049
527 Ga0495676_0133044 3300047321 Bacteria 1792
528 Ga0495683_0077578 3300047323 Bacteria 1624
529 Ga0495683_0313918 3300047323 Bacteria 670
530 Ga0495677_0035850 3300047445 Bacteria 1811
531 Ga0495677_0066892 3300047445 Bacteria 1337
532 Ga0495685_144853 3300047447 Bacteria 773
533 Ga0495684_0055678 3300047471 Bacteria 3016
534 Ga0495593_0086232 3300047673 Bacteria 1619
535 Ga0495602_0237651 3300048088 Bacteria 1365
536 Ga0495602_0288478 3300048088 Bacteria 1206
537 Ga0495615_0015808 3300048090 Bacteria 1618
538 Ga0495615_0198824 3300048090 Bacteria 618
539 Ga0495615_0247357 3300048090 Bacteria 564
540 Ga0495626_0066033 3300048091 Bacteria 1637
541 Ga0496100_0208395 3300048903 Bacteria 1428
542 Ga0496100_1001721 3300048903 Bacteria 657
543 Ga0496100_1378569 3300048903 Bacteria 556
544 Ga0496101_0036364 3300048904 Bacteria 3487
545 Ga0496101_0068843 3300048904 Bacteria 2588
546 Ga0496101_0595380 3300048904 Bacteria 874
547 Ga0496102_0033040 3300048905 Bacteria 4648
548 Ga0496102_0113703 3300048905 Bacteria 2526
549 Ga0496102_0566186 3300048905 Bacteria 1059
550 Ga0496103_0137001 3300048906 Bacteria 1564
551 Ga0496103_0179823 3300048906 Bacteria 1359
552 Ga0496104_0002845 3300048907 Bacteria 14920
553 Ga0496104_0026370 3300048907 Bacteria 5365
554 Ga0496104_0031613 3300048907 Bacteria 4923
555 Ga0496104_0062824 3300048907 Bacteria 3521
556 Ga0496105_0021253 3300048908 Bacteria 5251
557 Ga0496105_0035669 3300048908 Bacteria 4094
558 Ga0496105_0098654 3300048908 Bacteria 2412
559 Ga0496105_0102908 3300048908 Bacteria 2358
560 Ga0496106_0022989 3300048909 Bacteria 4630
561 Ga0496106_0040269 3300048909 Bacteria 3499
562 Ga0496106_0211170 3300048909 Bacteria 1546
563 Ga0496107_0173242 3300048910 Bacteria 1601
564 Ga0496108_0034272 3300048911 Bacteria 4217
565 Ga0496108_0344326 3300048911 Bacteria 1300
566 Ga0496108_0662934 3300048911 Bacteria 906
567 Ga0496109_0007016 3300048912 Bacteria 9504
568 Ga0496109_0017030 3300048912 Bacteria 6360
569 Ga0496109_0034510 3300048912 Bacteria 4557
570 Ga0496110_0012479 3300048913 Bacteria 6987
571 Ga0496110_0013740 3300048913 Bacteria 6709
572 Ga0496110_0154923 3300048913 Bacteria 2076
573 Ga0496110_0219837 3300048913 Bacteria 1727
574 Ga0496110_0417517 3300048913 Bacteria 1223
575 Ga0496110_0567000 3300048913 Bacteria 1031
576 Ga0496111_0018628 3300048914 Bacteria 4811
577 Ga0496111_0021560 3300048914 Bacteria 4501
578 Ga0496111_0634572 3300048914 Bacteria 780
579 Ga0496112_0005390 3300048915 Bacteria 11055
580 Ga0496112_0116790 3300048915 Bacteria 2638
581 Ga0496112_0792852 3300048915 Bacteria 872
582 Ga0496112_0796025 3300048915 Bacteria 870
583 Ga0496113_0026362 3300048916 Bacteria 4154
584 Ga0496113_0059353 3300048916 Bacteria 2881
585 Ga0496114_0016642 3300048917 Bacteria 5929
586 Ga0496114_0155701 3300048917 Bacteria 1984
587 Ga0496115_0050363 3300048918 Bacteria 3336
588 Ga0496115_0169345 3300048918 Bacteria 1806
589 Ga0501031_0010318 3300049568 Bacteria 6085
590 Ga0501031_0132030 3300049568 Unclassified 1631
591 Ga0501032_0000054 3300049569 Bacteria 100621
592 Ga0501032_0097470 3300049569 Bacteria 1949
593 Ga0501032_0621770 3300049569 Bacteria 686
594 Ga0501033_0000557 3300049570 Bacteria 34720
595 Ga0501033_0011867 3300049570 Bacteria 6659
596 Ga0501033_0066923 3300049570 Bacteria 2642
597 Ga0501033_0583732 3300049570 Bacteria 767
598 Ga0501034_0000177 3300049571 Bacteria 118966
599 Ga0501034_0297773 3300049571 Bacteria 1550
600 Ga0501036_0000025 3300049572 Bacteria 106029
601 Ga0501036_0091065 3300049572 Bacteria 2576
602 Ga0501037_0001015 3300049573 Bacteria 20764
603 Ga0501037_0224217 3300049573 Bacteria 1321
604 Ga0501037_0243875 3300049573 Bacteria 1259
605 Ga0501037_0657783 3300049573 Bacteria 700
606 Ga0501038_0000029 3300049574 Bacteria 132861
607 Ga0501038_0098334 3300049574 Bacteria 2440
608 Ga0501039_0002097 3300049575 Bacteria 14779
609 Ga0501039_1186446 3300049575 Bacteria 591
610 Ga0501040_0106291 3300049576 Bacteria 1961
611 Ga0501041_0022430 3300049577 Bacteria 3780
612 Ga0501042_0068248 3300049578 Bacteria 2542
613 Ga0501042_0151032 3300049578 Unclassified 1675
614 Ga0501042_0615876 3300049578 Bacteria 789
615 Ga0501042_0962161 3300049578 Bacteria 622
616 Ga0501043_0000176 3300049579 Bacteria 57036
617 Ga0501043_0020658 3300049579 Bacteria 5166
618 Ga0501043_0190823 3300049579 Bacteria 1593
619 Ga0501043_0308271 3300049579 Bacteria 1208
620 Ga0501046_0000530 3300049580 Bacteria 37764
621 Ga0501046_0060733 3300049580 Bacteria 2957
622 Ga0501046_0432133 3300049580 Bacteria 948
623 Ga0501047_0002427 3300049581 Bacteria 17807
624 Ga0501047_0011925 3300049581 Bacteria 8226
625 Ga0501047_0617860 3300049581 Bacteria 904
626 Ga0501047_0838364 3300049581 Bacteria 733
627 Ga0501048_0001428 3300049582 Bacteria 18099
628 Ga0501048_0448309 3300049582 Bacteria 924
629 Ga0501048_0453272 3300049582 Bacteria 919
630 Ga0501067_0000125 3300049583 Bacteria 42216
631 Ga0501067_0492723 3300049583 Bacteria 685
632 Ga0501068_0010090 3300049584 Bacteria 5299
633 Ga0501068_0146673 3300049584 Bacteria 1481
634 Ga0501068_0165934 3300049584 Bacteria 1393
635 Ga0501070_0008210 3300049586 Bacteria 8831
636 Ga0501070_0094970 3300049586 Bacteria 2467
637 Ga0501070_0464800 3300049586 Bacteria 1019
638 Ga0501070_0557340 3300049586 Bacteria 917
639 Ga0501071_0115349 3300049587 Bacteria 1987
640 Ga0501072_0010402 3300049588 Bacteria 7089
641 Ga0501072_0293204 3300049588 Bacteria 1293
642 Ga0501073_0000295 3300049589 Bacteria 32831
643 Ga0501073_0214064 3300049589 Bacteria 1331
644 Ga0501074_0002314 3300049590 Bacteria 13249
645 Ga0501074_0095742 3300049590 Bacteria 2126
646 Ga0501074_0377063 3300049590 Bacteria 1006
647 Ga0501074_0404148 3300049590 Bacteria 969
648 Ga0501075_0545836 3300049591 Bacteria 885
649 Ga0501076_0262895 3300049592 Bacteria 1413
650 Ga0501076_1333032 3300049592 Bacteria 590
651 Ga0501077_0132222 3300049593 Bacteria 1582
652 Ga0501077_0606063 3300049593 Bacteria 703
653 Ga0501079_0001153 3300049741 Bacteria 18482
654 Ga0501079_0110702 3300049741 Bacteria 2134
655 Ga0501079_0447715 3300049741 Bacteria 1014
656 Ga0501080_0001595 3300049742 Bacteria 19254
657 Ga0501081_0031680 3300049743 Bacteria 3584
658 Ga0501083_0005711 3300049744 Bacteria 8806
659 Ga0501035_0001332 3300049822 Bacteria 25478
660 Ga0501035_0093812 3300049822 Bacteria 2640
661 Ga0501044_0000888 3300049823 Bacteria 36065
662 Ga0501044_0158907 3300049823 Bacteria 2238
663 Ga0501044_0294233 3300049823 Bacteria 1554
664 Ga0501044_1081064 3300049823 Bacteria 672
665 Ga0501045_0005971 3300049824 Bacteria 8427
666 nmdc:mga03683_148421_c1 3300050489 Bacteria 1057
667 nmdc:mga0yw44_210196_c1 3300050492 Bacteria 1287
668 nmdc:mga0yw44_32235_c1 3300050492 Bacteria 2499
669 nmdc:mga0yw44_487886_c1 3300050492 Bacteria 836
670 nmdc:mga06z11_213210_c1 3300050494 Bacteria 1126
671 nmdc:mga05p37_1022211_c1 3300050507 Bacteria 875
672 nmdc:mga05p37_1024475_c1 3300050507 Bacteria 874
673 nmdc:mga05p37_1066769_c1 3300050507 Bacteria 850
674 nmdc:mga05p37_293_c1 3300050507 Bacteria 52375
675 nmdc:mga05p37_31274_c1 3300050507 Bacteria 6188
676 nmdc:mga09592_1602_c1 3300050508 Bacteria 18242
677 nmdc:mga06r32_70_c1 3300050510 Bacteria 66330
678 nmdc:mga08y16_226279_c1 3300050511 Bacteria 1935
679 nmdc:mga08y16_304222_c1 3300050511 Bacteria 1643
680 nmdc:mga08y16_390666_c1 3300050511 Bacteria 1425
681 nmdc:mga08y16_81_c1 3300050511 Bacteria 81573
682 nmdc:mga0n895_1057600_c1 3300050512 Bacteria 790
683 nmdc:mga0n895_217143_c1 3300050512 Bacteria 1942
684 nmdc:mga0n895_71694_c1 3300050512 Bacteria 3436
685 nmdc:mga0n895_737420_c1 3300050512 Bacteria 979
686 nmdc:mga0rr50_1108947_c1 3300050513 Bacteria 673
687 nmdc:mga0rr50_1463900_c1 3300050513 Bacteria 578
688 nmdc:mga0rr50_198618_c1 3300050513 Bacteria 1647
689 nmdc:mga0rr50_269613_c1 3300050513 Bacteria 1418
690 nmdc:mga0rr50_474035_c1 3300050513 Bacteria 1063
691 nmdc:mga0rr50_678379_c1 3300050513 Bacteria 879
692 nmdc:mga08x19_125844_c1 3300050514 Bacteria 1721
693 nmdc:mga08x19_26397_c1 3300050514 Bacteria 3624
694 nmdc:mga08x19_438_c1 3300050514 Bacteria 28587
695 nmdc:mga08x19_518648_c1 3300050514 Bacteria 842
696 nmdc:mga0a205_50057_c1 3300050515 Bacteria 4034
697 Ga0495601_0364814 3300053077 Bacteria 938
698 Ga0495612_0081033 3300053078 Bacteria 1364
699 Ga0495612_0300465 3300053078 Bacteria 720
700 Ga0495612_0311064 3300053078 Bacteria 707
701 Ga0500635_0085208 3300053080 Bacteria 1141
702 Ga0495655_0234846 3300053083 Bacteria 611
703 Ga0495619_0017031 3300053085 Bacteria 4607
704 Ga0495619_0059207 3300053085 Bacteria 2545
705 Ga0495619_0184857 3300053085 Bacteria 1442
706 Ga0500647_0041430 3300053091 Bacteria 2209
707 Ga0500566_0000047 3300053094 Bacteria 58577
708 Ga0500640_002289 3300053095 Bacteria 6270
709 Ga0500554_001486 3300053102 Bacteria 4528
710 Ga0500562_018695 3300053108 Bacteria 1790
711 Ga0500572_000071 3300053111 Bacteria 32122
712 Ga0500591_018443 3300053115 Bacteria 3378
713 Ga0500614_001972 3300053123 Bacteria 4706
714 Ga0500559_0004045 3300053136 Bacteria 7038
715 Ga0500585_113667 3300053144 Bacteria 969
716 Ga0500603_000619 3300053150 Bacteria 8762
717 Ga0500603_010658 3300053150 Bacteria 2079
718 Ga0500616_0166158 3300053153 Bacteria 1007
719 Ga0500630_000804 3300053159 Bacteria 14475
720 Ga0500638_027024 3300053162 Bacteria 2752
721 Ga0500639_000087 3300053163 Bacteria 43854
722 Ga0500639_116240 3300053163 Bacteria 1292
723 Ga0500636_0135596 3300053177 Bacteria 1367
724 Ga0500637_0001173 3300053178 Bacteria 10903
725 Ga0500637_0117452 3300053178 Bacteria 1543
726 Ga0500576_045682 3300053725 Bacteria 1959
727 Ga0500645_001319 3300053730 Bacteria 12868
728 Ga0500596_000342 3300053735 Bacteria 8381
729 Ga0501084_0011442 3300054114 Bacteria 7347
730 Ga0501084_0425357 3300054114 Bacteria 1123
731 Ga0590077_187679 3300059426 Bacteria 500
732 Ga0501082_0020362 3300060353 Bacteria 5719
733 2514587560 2513237351 Bacteria 6968952
734 2996312097 2996310559 Bacteria 6357320
735 Ga0070670_101378627
736 JGI24746J21847_1004296
737 JGI24737J22298_10038497
738 JGI24743J22301_10015799
739 JGI24750J21931_1008797
740 JGI24748J21848_1047985
741 JGI24738J21930_10070717
742 JGI24744J21845_10034007
743 JGI24742J22300_10018619
744 JGI24751J29686_10019199
745 JGI24751J29686_10070775
746 JGI25406J46586_10001454
747 JGI26145J50221_1005418
748 Ga0070683_100059476
749 Ga0070683_100102367
750 Ga0070690_100115416
751 Ga0070690_100271306
752 Ga0070670_100043796
753 Ga0070670_100111504
754 Ga0068869_100074184
755 Ga0070680_100006302
756 Ga0070680_100013218
757 Ga0070680_100025986
758 Ga0070680_100142586
759 Ga0070680_100593757
760 Ga0070680_100633260
761 Ga0070682_100126457
762 Ga0068868_100003937
763 Ga0068868_101676218
764 Ga0068868_101988152
765 Ga0070660_100136719
766 Ga0070660_101488532
767 Ga0070689_100036422
768 Ga0070661_100289784
769 Ga0070661_100582786
770 Ga0070668_100118015
771 Ga0070668_100150353
772 Ga0070668_101703167
773 Ga0070669_100149230
774 Ga0070675_100104542
775 Ga0070671_100178617
776 Ga0070674_100071130
777 Ga0070674_100142259
778 Ga0070688_100069034
779 Ga0070659_100009241
780 Ga0070659_100184634
781 Ga0070659_100222155
782 Ga0070659_100427541
783 Ga0070667_100372126
784 Ga0070709_10040080
785 Ga0070709_10607442
786 Ga0070709_10906897
787 Ga0070714_100020964
788 Ga0070714_100033591
789 Ga0070714_100066379
790 Ga0070714_100332537
791 Ga0070713_100074971
792 Ga0070713_100241267
793 Ga0070713_101054250
794 Ga0070710_10025558
795 Ga0070710_10033223
796 Ga0070701_10026215
797 Ga0070701_10041104
798 Ga0070711_100011073
799 Ga0070711_100658033
800 Ga0070705_100003389
801 Ga0070705_100065930
802 Ga0070700_100133387
803 Ga0070694_100012740
804 Ga0070694_100098299
805 Ga0070694_100608480
806 Ga0070663_100012742
807 Ga0070678_100305920
808 Ga0070662_100041308
809 Ga0070662_100669865
810 Ga0070662_100897790
811 Ga0070681_11179722
812 Ga0070681_11826228
813 Ga0068867_100069746
814 Ga0070685_10514582
815 Ga0070706_100440395
816 Ga0070707_100149073
817 Ga0070698_100946089
818 Ga0070698_101032901
819 Ga0070699_100017329
820 Ga0070699_100255397
821 Ga0070699_100710469
822 Ga0070679_100027051
823 Ga0070679_100309887
824 Ga0070684_100007708
825 Ga0070684_100015705
826 Ga0070697_100034563
827 Ga0070697_100805018
828 Ga0068853_100030294
829 Ga0068853_100150963
830 Ga0070672_100039716
831 Ga0070672_100448472
832 Ga0070686_100206403
833 Ga0070686_100283450
834 Ga0070695_100008978
835 Ga0070695_100079417
836 Ga0070695_100176028
837 Ga0070696_100008630
838 Ga0070696_100096914
839 Ga0070696_100107131
840 Ga0070693_100147325
841 Ga0070693_101031922
842 Ga0070665_101210485
843 Ga0070704_100022383
844 Ga0070704_100456787
845 Ga0068855_100062157
846 Ga0068855_100707343
847 Ga0068855_102384104
848 Ga0070664_100140031
849 Ga0068857_100543206
850 Ga0068857_101045099
851 Ga0068857_101459941
852 Ga0068854_100064035
853 Ga0068856_100002806
854 Ga0068856_100043735
855 Ga0070702_100013652
856 Ga0070702_100165567
857 Ga0068852_100018764
858 Ga0068852_100053567
859 Ga0068852_100187813
860 Ga0068852_100744800
861 Ga0068852_101795425
862 Ga0068864_100170463
863 Ga0068866_10056840
864 Ga0068861_100070512
865 Ga0068861_100137899
866 Ga0068870_10008552
867 Ga0068870_11295440
868 Ga0068863_100226401
869 Ga0068858_100184157
870 Ga0068858_100356923
871 Ga0068860_100098687
872 Ga0068862_100254424
873 Ga0068862_100691924
874 Ga0081455_10040871
875 Ga0081455_10278714
876 Ga0081455_10664194
877 Ga0081540_1000085
878 Ga0081539_10000115
879 Ga0081539_10000233
880 Ga0081539_10148513
881 Ga0070717_10042041
882 Ga0070717_10351401
883 Ga0070717_10638143
884 Ga0070717_11302714
885 Ga0075365_10146614
886 Ga0075365_10962510
887 Ga0075363_100751685
888 Ga0070715_10013823
889 Ga0070716_100696368
890 Ga0070716_101636555
891 Ga0070712_100178289
892 Ga0075369_10399470
893 Ga0097621_100037673
894 Ga0075428_100001052
895 Ga0075428_100071322
896 Ga0075430_101431162
897 Ga0075431_100000254
898 Ga0075431_100256718
899 Ga0075433_10565794
900 Ga0075433_10597983
901 Ga0075434_100032257
902 Ga0075434_100061744
903 Ga0075434_100519885
904 Ga0075429_100006359
905 Ga0075429_101016058
906 Ga0068865_100067309
907 Ga0068865_100298032
908 Ga0075436_100001103
909 Ga0075436_100043544
910 Ga0075436_100527129
911 Ga0075435_100269019
912 Ga0075435_100327498
913 Ga0075435_100343670
914 Ga0075435_100677632
915 Ga0075435_100897960
916 Ga0075435_101324702
917 Ga0099794_10588443
918 Ga0099795_10224030
919 Ga0111539_10000564
920 Ga0111539_10178108
921 Ga0111539_10381819
922 Ga0111539_10506533
923 Ga0111539_10617513
924 Ga0111539_11331927
925 Ga0105245_10143127
926 Ga0105245_10160035
927 Ga0105245_10325421
928 Ga0105245_10431157
929 Ga0105245_10471221
930 Ga0105247_10094632
931 Ga0105247_10186518
932 Ga0114129_10000401
933 Ga0114129_10154099
934 Ga0114129_10385134
935 Ga0114129_10459595
936 Ga0114129_10841051
937 Ga0105243_10835784
938 Ga0105241_12006217
939 Ga0105242_10049066
940 Ga0105248_10108868
941 Ga0105248_11163334
942 Ga0105237_10160225
943 Ga0105237_10746934
944 Ga0105237_10880257
945 Ga0105238_10117055
946 Ga0105249_10125301
947 Ga0105249_10638280
948 Ga0099796_10458302
949 Ga0105239_10124104
950 Ga0105239_11501238
951 Ga0105239_11981052
952 Ga0105246_10627451
953 Ga0157373_10166323
954 Ga0157370_10087399
955 Ga0157370_10533435
956 Ga0157370_10820076
957 Ga0157369_10150158
958 Ga0157374_10118166
959 Ga0157374_10305550
960 Ga0157378_10039895
961 Ga0157378_10077169
962 Ga0157378_11384817
963 Ga0163162_10381927
964 Ga0163162_10513287
965 Ga0157372_10025324
966 Ga0157372_10111197
967 Ga0157372_10307394
968 Ga0157372_11161471
969 Ga0157372_11766464
970 Ga0157375_10009515
971 Ga0157375_10034787
972 Ga0157375_10941942
973 Ga0157375_13710535
974 Ga0163163_10070361
975 Ga0163163_10819335
976 Ga0157380_10044331
977 Ga0157377_10155841
978 Ga0157379_10158316
979 Ga0157379_10721007
980 Ga0157376_11043644
981 Ga0163161_10208906
982 Ga0163161_10365622
983 Ga0206353_10575608
984 Ga0213873_10050150
985 Ga0213876_10045343
986 Ga0213875_10000138
987 Ga0209758_1042818
988 Ga0207692_10013653
989 Ga0207692_10072850
990 Ga0207642_10003941
991 Ga0207642_10859493
992 Ga0207710_10044074
993 Ga0207710_10082035
994 Ga0207688_10003505
995 Ga0207680_10171031
996 Ga0207647_10060827
997 Ga0207647_10208081
998 Ga0207699_10093174
999 Ga0207699_10201981
1000 Ga0207699_10685890
1001 Ga0207643_10003204
1002 Ga0207643_10893597
1003 Ga0207705_10042055
1004 Ga0207705_10314201
1005 Ga0207684_10091995
1006 Ga0207684_10347844
1007 Ga0207684_10891326
1008 Ga0207707_10000978
1009 Ga0207695_11221264
1010 Ga0207671_10122302
1011 Ga0207663_10298338
1012 Ga0207660_10050255
1013 Ga0207660_10076594
1014 Ga0207660_10684265
1015 Ga0207662_10026501
1016 Ga0207657_10008203
1017 Ga0207657_10011925
1018 Ga0207657_10085980
1019 Ga0207649_10181213
1020 Ga0207649_10238218
1021 Ga0207652_10011694
1022 Ga0207652_10337942
1023 Ga0207652_11499926
1024 Ga0207646_10222228
1025 Ga0207681_10612866
1026 Ga0207694_10216141
1027 Ga0207650_10031109
1028 Ga0207650_10338576
1029 Ga0207650_11136855
1030 Ga0207659_10078806
1031 Ga0207687_10016490
1032 Ga0207687_10076146
1033 Ga0207687_10709871
1034 Ga0207700_10080802
1035 Ga0207700_10332188
1036 Ga0207664_10014142
1037 Ga0207664_10023885
1038 Ga0207664_10052930
1039 Ga0207664_10821194
1040 Ga0207644_10141778
1041 Ga0207644_10486513
1042 Ga0207644_11886447
1043 Ga0207690_10055449
1044 Ga0207690_10107535
1045 Ga0207706_10018002
1046 Ga0207706_10483875
1047 Ga0207709_10256602
1048 Ga0207709_10280233
1049 Ga0207670_10055498
1050 Ga0207669_10021804
1051 Ga0207704_10109711
1052 Ga0207704_10251964
1053 Ga0207665_10260345
1054 Ga0207665_10677283
1055 Ga0207691_10027477
1056 Ga0207711_10155642
1057 Ga0207689_10019224
1058 Ga0207661_10036039
1059 Ga0207661_10133201
1060 Ga0207679_10013734
1061 Ga0207679_10088879
1062 Ga0207679_10930069
1063 Ga0207667_10174008
1064 Ga0207667_10264696
1065 Ga0207667_10938066
1066 Ga0207712_10113083
1067 Ga0207712_10471289
1068 Ga0207668_10294361
1069 Ga0207640_10434252
1070 Ga0207640_11333189
1071 Ga0207658_10067383
1072 Ga0207677_10039491
1073 Ga0207677_10194964
1074 Ga0207677_11122938
1075 Ga0207677_11657113
1076 Ga0207703_10047470
1077 Ga0207703_11745110
1078 Ga0207639_10112203
1079 Ga0207639_10246355
1080 Ga0207678_10027199
1081 Ga0207678_10253832
1082 Ga0207708_10001574
1083 Ga0207708_10029122
1084 Ga0207708_10225760
1085 Ga0207702_10000257
1086 Ga0207702_10049831
1087 Ga0207702_10384023
1088 Ga0207641_10023689
1089 Ga0207648_10000651
1090 Ga0207648_10965646
1091 Ga0207676_10020617
1092 Ga0207676_10442303
1093 Ga0207674_10049301
1094 Ga0207674_11385703
1095 Ga0207675_100190851
1096 Ga0207675_100343851
1097 Ga0207683_10004429
1098 Ga0207698_10051267
1099 Ga0207698_10308440
1100 Ga0207698_10411860
1101 Ga0209982_1040904
1102 Ga0209970_1015192
1103 Ga0210002_1077872
1104 Ga0209983_1002713
1105 Ga0209588_1065563
1106 Ga0209588_1120730
1107 Ga0209971_1006523
1108 Ga0209998_10006462
1109 Ga0209974_10003221
1110 Ga0207428_10006429
1111 Ga0268265_10091775
1112 Ga0268265_11088842
1113 Ga0268264_10481488
1114 Ga0307517_10457256
1115 Ga0307515_10002897
1116 Ga0307515_10077696
1117 Ga0265314_10508260
1118 Ga0307405_12092949
1119 Ga0307510_10044903
1120 Ga0373929_0067360
1121 Ga0373944_0119184
1122 Ga0373944_0134217
1123 Ga0373944_0145367
1124 Ga0373949_0201726
1125 Ga0373952_0062163
1126 Ga0373923_0155355
1127 Ga0373936_0069414
1128 Ga0373936_0078401
1129 Ga0373936_0567278
1130 Ga0373939_0191337
1131 Ga0373945_0121739
1132 Ga0373954_0164649
1133 Ga0373956_0049253
1134 Ga0373943_0007722
1135 Ga0373943_0083771
1136 Ga0373946_0705970
1137 Ga0373955_0034814
1138 Ga0373955_0115807
1139 Ga0373955_1032498
1140 Ga0373924_0191295
1141 Ga0373924_0235922
1142 Ga0373931_0363942
1143 Ga0373935_0120140
1144 Ga0373935_0681385
1145 Ga0373927_0040935
1146 Ga0373933_0766725
1147 Ga0373947_0046232
1148 Ga0373947_0674533
1149 Ga0373947_0874626
1150 Ga0373937_0031713
1151 Ga0373925_0090463
1152 Ga0373925_0392655
1153 Ga0373925_0795841
1154 Ga0436364_0959444
1155 Ga0436364_1132821
1156 Ga0395901_1912350
1157 Ga0436365_0368188
1158 Ga0436365_0775983
1159 Ga0436365_1569483
1160 Ga0436360_0878016
1161 Ga0436360_0964724
1162 Ga0436361_0125704
1163 Ga0436361_0398385
1164 Ga0436363_1338574
1165 Ga0436362_0366829
1166 Ga0436362_1306563
1167 Ga0451798_1045371
1168 Ga0451807_0479642
1169 Ga0451849_1130782
1170 Ga0451853_0277863
1171 Ga0439441_000414
1172 Ga0439464_0189979
1173 Ga0451577_0373374
1174 Ga0466963_0023937
1175 Ga0466964_0184398
1176 Ga0451576_0131454
1177 Ga0451576_0796229
1178 Ga0495627_124911
1179 Ga0495592_0077364
1180 Ga0495603_0010559
1181 Ga0495603_0108490
1182 Ga0495590_0074023
1183 Ga0495629_0014878
1184 Ga0495629_0489810
1185 Ga0495641_0023265
1186 Ga0495580_0067978
1187 Ga0495582_0093722
1188 Ga0495605_0185563
1189 Ga0495639_0069589
1190 Ga0495639_0636050
1191 Ga0495664_0034270
1192 Ga0495584_0079027
1193 Ga0495584_0243281
1194 Ga0495584_0501622
1195 Ga0495585_0362174
1196 Ga0495594_0013437
1197 Ga0495594_0883227
1198 Ga0495596_0171871
1199 Ga0495607_0322864
1200 Ga0495608_0213436
1201 Ga0495616_0269681
1202 Ga0495618_0165833
1203 Ga0495620_0074987
1204 Ga0495630_0049764
1205 Ga0495630_0131834
1206 Ga0495630_0437768
1207 Ga0495632_0239601
1208 Ga0495637_0075335
1209 Ga0495644_0406792
1210 Ga0495663_0061117
1211 Ga0495666_0012526
1212 Ga0495666_0069540
1213 Ga0495666_0403604
1214 Ga0495652_0236092
1215 Ga0495665_0241725
1216 Ga0495665_0280228
1217 Ga0495640_0044436
1218 Ga0495587_0328514
1219 Ga0495598_0210322
1220 Ga0495645_0187360
1221 Ga0495645_0419333
1222 Ga0495622_0053028
1223 Ga0495622_0141329
1224 Ga0495633_0082789
1225 Ga0495633_0219360
1226 Ga0495667_0417499
1227 Ga0495656_0048717
1228 Ga0495656_0568588
1229 Ga0495668_0177762
1230 Ga0495634_0049903
1231 Ga0495611_0113720
1232 Ga0495611_0152373
1233 Ga0495611_0270999
1234 Ga0495625_0174335
1235 Ga0495635_0021527
1236 Ga0495659_0167724
1237 Ga0495661_0557169
1238 Ga0495588_0339049
1239 Ga0495657_0444091
1240 Ga0495599_0167553
1241 Ga0495599_0176924
1242 Ga0495647_0014596
1243 Ga0495647_0176515
1244 Ga0495658_0061822
1245 Ga0495658_0221179
1246 Ga0495669_0051210
1247 Ga0495613_0444994
1248 Ga0495613_0473151
1249 Ga0495624_0019842
1250 Ga0495624_0097393
1251 Ga0495670_0017058
1252 Ga0495649_0358196
1253 Ga0495589_0036976
1254 Ga0495589_0232233
1255 Ga0495660_0068214
1256 Ga0495581_0047740
1257 Ga0495604_0408440
1258 Ga0495674_0027777
1259 Ga0495674_0670202
1260 Ga0495672_0185742
1261 Ga0495676_0133044
1262 Ga0495683_0077578
1263 Ga0495683_0313918
1264 Ga0495677_0035850
1265 Ga0495677_0066892
1266 Ga0495685_144853
1267 Ga0495684_0055678
1268 Ga0495593_0086232
1269 Ga0495602_0237651
1270 Ga0495602_0288478
1271 Ga0495615_0015808
1272 Ga0495615_0198824
1273 Ga0495615_0247357
1274 Ga0495626_0066033
1275 Ga0496100_0208395
1276 Ga0496100_1001721
1277 Ga0496100_1378569
1278 Ga0496101_0036364
1279 Ga0496101_0068843
1280 Ga0496101_0595380
1281 Ga0496102_0033040
1282 Ga0496102_0113703
1283 Ga0496102_0566186
1284 Ga0496103_0137001
1285 Ga0496103_0179823
1286 Ga0496104_0002845
1287 Ga0496104_0026370
1288 Ga0496104_0031613
1289 Ga0496104_0062824
1290 Ga0496105_0021253
1291 Ga0496105_0035669
1292 Ga0496105_0098654
1293 Ga0496105_0102908
1294 Ga0496106_0022989
1295 Ga0496106_0040269
1296 Ga0496106_0211170
1297 Ga0496107_0173242
1298 Ga0496108_0034272
1299 Ga0496108_0344326
1300 Ga0496108_0662934
1301 Ga0496109_0007016
1302 Ga0496109_0017030
1303 Ga0496109_0034510
1304 Ga0496110_0012479
1305 Ga0496110_0013740
1306 Ga0496110_0154923
1307 Ga0496110_0219837
1308 Ga0496110_0417517
1309 Ga0496110_0567000
1310 Ga0496111_0018628
1311 Ga0496111_0021560
1312 Ga0496111_0634572
1313 Ga0496112_0005390
1314 Ga0496112_0116790
1315 Ga0496112_0792852
1316 Ga0496112_0796025
1317 Ga0496113_0026362
1318 Ga0496113_0059353
1319 Ga0496114_0016642
1320 Ga0496114_0155701
1321 Ga0496115_0050363
1322 Ga0496115_0169345
1323 Ga0501031_0010318
1324 Ga0501031_0132030
1325 Ga0501032_0000054
1326 Ga0501032_0097470
1327 Ga0501032_0621770
1328 Ga0501033_0000557
1329 Ga0501033_0011867
1330 Ga0501033_0066923
1331 Ga0501033_0583732
1332 Ga0501034_0000177
1333 Ga0501034_0297773
1334 Ga0501036_0000025
1335 Ga0501036_0091065
1336 Ga0501037_0001015
1337 Ga0501037_0224217
1338 Ga0501037_0243875
1339 Ga0501037_0657783
1340 Ga0501038_0000029
1341 Ga0501038_0098334
1342 Ga0501039_0002097
1343 Ga0501039_1186446
1344 Ga0501040_0106291
1345 Ga0501041_0022430
1346 Ga0501042_0068248
1347 Ga0501042_0151032
1348 Ga0501042_0615876
1349 Ga0501042_0962161
1350 Ga0501043_0000176
1351 Ga0501043_0020658
1352 Ga0501043_0190823
1353 Ga0501043_0308271
1354 Ga0501046_0000530
1355 Ga0501046_0060733
1356 Ga0501046_0432133
1357 Ga0501047_0002427
1358 Ga0501047_0011925
1359 Ga0501047_0617860
1360 Ga0501047_0838364
1361 Ga0501048_0001428
1362 Ga0501048_0448309
1363 Ga0501048_0453272
1364 Ga0501067_0000125
1365 Ga0501067_0492723
1366 Ga0501068_0010090
1367 Ga0501068_0146673
1368 Ga0501068_0165934
1369 Ga0501070_0008210
1370 Ga0501070_0094970
1371 Ga0501070_0464800
1372 Ga0501070_0557340
1373 Ga0501071_0115349
1374 Ga0501072_0010402
1375 Ga0501072_0293204
1376 Ga0501073_0000295
1377 Ga0501073_0214064
1378 Ga0501074_0002314
1379 Ga0501074_0095742
1380 Ga0501074_0377063
1381 Ga0501074_0404148
1382 Ga0501075_0545836
1383 Ga0501076_0262895
1384 Ga0501076_1333032
1385 Ga0501077_0132222
1386 Ga0501077_0606063
1387 Ga0501079_0001153
1388 Ga0501079_0110702
1389 Ga0501079_0447715
1390 Ga0501080_0001595
1391 Ga0501081_0031680
1392 Ga0501083_0005711
1393 Ga0501035_0001332
1394 Ga0501035_0093812
1395 Ga0501044_0000888
1396 Ga0501044_0158907
1397 Ga0501044_0294233
1398 Ga0501044_1081064
1399 Ga0501045_0005971
1400 nmdc:mga03683_148421_c1
1401 nmdc:mga0yw44_210196_c1
1402 nmdc:mga0yw44_32235_c1
1403 nmdc:mga0yw44_487886_c1
1404 nmdc:mga06z11_213210_c1
1405 nmdc:mga05p37_1022211_c1
1406 nmdc:mga05p37_1024475_c1
1407 nmdc:mga05p37_1066769_c1
1408 nmdc:mga05p37_293_c1
1409 nmdc:mga05p37_31274_c1
1410 nmdc:mga09592_1602_c1
1411 nmdc:mga06r32_70_c1
1412 nmdc:mga08y16_226279_c1
1413 nmdc:mga08y16_304222_c1
1414 nmdc:mga08y16_390666_c1
1415 nmdc:mga08y16_81_c1
1416 nmdc:mga0n895_1057600_c1
1417 nmdc:mga0n895_217143_c1
1418 nmdc:mga0n895_71694_c1
1419 nmdc:mga0n895_737420_c1
1420 nmdc:mga0rr50_1108947_c1
1421 nmdc:mga0rr50_1463900_c1
1422 nmdc:mga0rr50_198618_c1
1423 nmdc:mga0rr50_269613_c1
1424 nmdc:mga0rr50_474035_c1
1425 nmdc:mga0rr50_678379_c1
1426 nmdc:mga08x19_125844_c1
1427 nmdc:mga08x19_26397_c1
1428 nmdc:mga08x19_438_c1
1429 nmdc:mga08x19_518648_c1
1430 nmdc:mga0a205_50057_c1
1431 Ga0495601_0364814
1432 Ga0495612_0081033
1433 Ga0495612_0300465
1434 Ga0495612_0311064
1435 Ga0500635_0085208
1436 Ga0495655_0234846
1437 Ga0495619_0017031
1438 Ga0495619_0059207
1439 Ga0495619_0184857
1440 Ga0500647_0041430
1441 Ga0500566_0000047
1442 Ga0500640_002289
1443 Ga0500554_001486
1444 Ga0500562_018695
1445 Ga0500572_000071
1446 Ga0500591_018443
1447 Ga0500614_001972
1448 Ga0500559_0004045
1449 Ga0500585_113667
1450 Ga0500603_000619
1451 Ga0500603_010658
1452 Ga0500616_0166158
1453 Ga0500630_000804
1454 Ga0500638_027024
1455 Ga0500639_000087
1456 Ga0500639_116240
1457 Ga0500636_0135596
1458 Ga0500637_0001173
1459 Ga0500637_0117452
1460 Ga0500576_045682
1461 Ga0500645_001319
1462 Ga0500596_000342
1463 Ga0501084_0011442
1464 Ga0501084_0425357
1465 Ga0590077_187679
1466 Ga0501082_0020362
1467 2514587560
1468 2996312097

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

25

142

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
5v4f-assembly1.cif.gz_A crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis 0.8781 13 140
3i7t-assembly1.cif.gz_A crystal structure of rv2704, a member of highly conserved yjgf/yer057c/uk114 family, from mycobacterium tuberculosis 0.848 27 140
5v4f-assembly1.cif.gz_A crystal structure of the protein of unknown function of the conserved rid protein family yyfb from yersinia pestis 0.8412 13 140
5yu2-assembly1.cif.gz_B structure of ribonuclease yabj 0.8393 29 141
7cd2-assembly1.cif.gz_C crystal structure of the s103f mutant of bacillus subtilis (natto) yabj protein. 0.8366 38 141
ID Description Score Start End Superfamily
3i7tA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.848 27 140 3.30.1330.40
af_Q9USQ7_300_402_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8223 33 141 3.30.1330.40
5hp8A00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8186 29 140 3.30.1330.40
3m1xA00 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8152 26 140 3.30.1330.40
af_Q86I26_20_139_3.30.1330.40 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like 0.8141 33 140 3.30.1330.40
ID Description Score Start End GO Terms
AF-A0A0J6STN9-F1-model_v4 Endoribonuclease L-PSP 0.9982 14 142 GO:0005829
GO:0019239
AF-A0A531LM97-F1-model_v4 RidA family protein 0.9971 67 142
AF-A0A4R9VQN0-F1-model_v4 RidA family protein 0.9969 14 142
AF-A0A2A3AZZ6-F1-model_v4 Enamine deaminase RidA 0.9968 14 142
AF-A0A1Q4ANL7-F1-model_v4 Enamine deaminase RidA 0.9967 14 142

Map