F478040

General Info

Members Datasets Scaffolds Average Seq Length
732 388 1464 238

Family's Representative Sequence

Representative Sequence 3300035112|Ga0373932_0008911|Ga0373932_0008911_437_1273
Length 278
Sequence MGERGCEGAFILFERLLQRAACGDSPPAGYIGRTERIDNMITLRKSSDRGHADHGWLKSQHSFSFADYHDPKHMGFGNLRVINEDRIAPGTGFGTHGHRDMEIVSYVLSGELAHKDSMGNGAAGAAVSGVIRPGDVQRMSAGRGVMHSEFNHAADATTHFLQIWIEPNVRGIEAGYEQKHFDADSKRGTLRLVASPDGRDGSVTIHADAAIYSGLFDGAQKLTRALDPKRKFYVHVVRGSVAVNGQVLKGGDALKIEGETALSIEDGVDAELLLFDLQ

Samples

Sample ID Description Type Environment
1 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
4 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
5 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
6 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
11 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
22 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
23 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
27 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
28 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
29 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
33 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
34 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
42 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
43 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
44 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
47 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
48 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
49 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
50 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
51 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
52 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
86 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
87 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
92 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
93 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
102 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
117 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
118 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
119 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
120 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
121 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
122 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
123 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
126 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
127 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
128 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
129 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
130 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
131 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
132 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
133 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
134 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
144 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
202 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
207 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
208 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
209 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
210 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
211 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
212 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
213 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
214 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
215 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
216 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
217 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
218 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
226 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
227 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
228 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
229 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
230 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
231 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
238 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
241 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
242 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
243 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
244 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
245 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
246 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
247 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
248 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
249 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
252 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
253 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
254 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
255 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
256 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
257 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
258 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
259 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
260 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
261 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
262 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
263 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
264 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
265 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
266 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
267 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
268 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
269 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
270 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
271 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
272 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
273 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
274 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
275 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
276 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
277 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
278 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
279 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
280 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
281 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
282 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
283 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
284 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
285 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
286 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
287 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
288 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
289 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
290 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
291 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
292 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
293 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
294 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
295 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
296 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
297 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
298 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
299 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
300 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
301 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
302 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
303 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
304 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
305 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
306 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
307 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
308 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
309 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
310 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
311 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
312 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
316 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
317 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
318 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
319 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
320 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
321 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
322 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
323 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
324 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
325 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
326 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
327 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
329 3300049517 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_B_5_control Metagenome Rhizosphere
330 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
331 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
333 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
334 3300049761 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_A_4_control Metagenome Rhizosphere
335 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
336 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
337 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
338 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
339 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
340 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
341 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
342 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
343 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
344 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
345 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
346 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
347 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
348 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
349 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
350 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
351 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
352 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
353 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
354 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
355 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
356 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
357 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
358 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
359 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
360 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
361 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
362 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
363 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
364 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
365 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
366 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
367 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
368 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
369 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
370 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
371 2738541337 Pelomonas sp. BT06 Isolate Unclassified
372 2747842501 Xanthomonas sp. WCS2014-23 Isolate Unclassified
373 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
374 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
375 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
376 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
377 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
378 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
379 2842677519 Variovorax sp. R-72495 Isolate Unclassified
380 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
381 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
382 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
383 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
384 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
385 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
386 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
387 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
388 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 95.77
Metatranscriptomes 0.41
Isolates 3.83

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 14.34
Nodule 0.68
Rhizoplane 3.14
Rhizosphere 75.55
Stem 0
Stem Tuber 0
Unclassified 0.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0373932_0008911 3300035112 Bacteria 2404
2 SwRhRL2b_contig_3630290 2162886007 Unclassified 995
3 JGI25156J39149_1002099 3300002705 Bacteria 7539
4 JGI25152J39213_1000138 3300002773 Bacteria 50113
5 JGI25152J39213_1001574 3300002773 Bacteria 9576
6 JGI25150J39212_1000975 3300002774 Bacteria 9022
7 JGI25159J45721_1001236 3300002987 Bacteria 10779
8 JGI25151J46595_10003009 3300003187 Bacteria 9576
9 JGI25165J46597_1000679 3300003214 Bacteria 27370
10 JGI25153J46596_10000754 3300003215 Bacteria 19811
11 JGI25153J46596_10002982 3300003215 Bacteria 9576
12 JGI25161J50226_1001727 3300003374 Bacteria 6200
13 Ga0055533_1000038 3300003756 Bacteria 251370
14 Ga0055528_1003201 3300003790 Bacteria 8366
15 Ga0055530_10007905 3300003791 Bacteria 4364
16 Ga0055543_1001932 3300004625 Bacteria 7427
17 Ga0065165_1002672 3300005262 Bacteria 14396
18 Ga0065715_10103544 3300005293 Bacteria 2960
19 Ga0065715_10191522 3300005293 Bacteria 1409
20 Ga0065707_10099321 3300005295 Bacteria 3008
21 Ga0070676_10001020 3300005328 Bacteria 13912
22 Ga0070676_10004301 3300005328 Bacteria 7482
23 Ga0070690_100000156 3300005330 Bacteria 34929
24 Ga0070690_100000912 3300005330 Bacteria 15074
25 Ga0070670_100002105 3300005331 Bacteria 16325
26 Ga0070670_100015113 3300005331 Bacteria 6625
27 Ga0070670_100023254 3300005331 Bacteria 5335
28 Ga0070670_100198600 3300005331 Bacteria 1742
29 Ga0070670_100359261 3300005331 Bacteria 1280
30 Ga0070670_100402237 3300005331 Bacteria 1209
31 Ga0070670_100593288 3300005331 Bacteria 991
32 Ga0070670_100616897 3300005331 Bacteria 971
33 Ga0070677_10009771 3300005333 Bacteria 3262
34 Ga0068869_100000023 3300005334 Bacteria 64701
35 Ga0068869_100009338 3300005334 Bacteria 6361
36 Ga0068869_100013392 3300005334 Bacteria 5454
37 Ga0068869_100042006 3300005334 Bacteria 3276
38 Ga0068869_100914644 3300005334 Bacteria 760
39 Ga0070666_10015870 3300005335 Bacteria 4812
40 Ga0070680_100019205 3300005336 Bacteria 5415
41 Ga0070682_100030224 3300005337 Bacteria 3268
42 Ga0068868_100002689 3300005338 Bacteria 12335
43 Ga0068868_100004315 3300005338 Bacteria 9963
44 Ga0068868_100112454 3300005338 Bacteria 2214
45 Ga0068868_100143188 3300005338 Bacteria 1964
46 Ga0068868_100578589 3300005338 Bacteria 993
47 Ga0070660_100432951 3300005339 Bacteria 1090
48 Ga0070660_100439053 3300005339 Bacteria 1082
49 Ga0070689_100008306 3300005340 Bacteria 7308
50 Ga0070689_100017487 3300005340 Bacteria 5266
51 Ga0070689_100222165 3300005340 Bacteria 1550
52 Ga0070691_10000075 3300005341 Bacteria 27584
53 Ga0070687_100000137 3300005343 Bacteria 25207
54 Ga0070687_100008027 3300005343 Bacteria 4445
55 Ga0070661_100208541 3300005344 Bacteria 1495
56 Ga0070668_100004948 3300005347 Bacteria 9864
57 Ga0070669_100005106 3300005353 Bacteria 9493
58 Ga0070669_100060755 3300005353 Bacteria 2777
59 Ga0070669_100758326 3300005353 Bacteria 823
60 Ga0070675_100001775 3300005354 Bacteria 15916
61 Ga0070675_100038209 3300005354 Bacteria 3911
62 Ga0070675_100076368 3300005354 Bacteria 2786
63 Ga0070671_100000835 3300005355 Bacteria 22390
64 Ga0070671_100010044 3300005355 Bacteria 7603
65 Ga0070671_100027612 3300005355 Bacteria 4673
66 Ga0070671_100042078 3300005355 Bacteria 3797
67 Ga0070671_100056083 3300005355 Bacteria 3278
68 Ga0070671_100210966 3300005355 Bacteria 1647
69 Ga0070674_100004185 3300005356 Bacteria 8194
70 Ga0070674_100004251 3300005356 Bacteria 8145
71 Ga0070674_100014932 3300005356 Bacteria 4837
72 Ga0070673_100005082 3300005364 Bacteria 8393
73 Ga0070673_100148723 3300005364 Bacteria 1982
74 Ga0070673_100296043 3300005364 Bacteria 1423
75 Ga0070673_100578512 3300005364 Bacteria 1022
76 Ga0070688_100008845 3300005365 Bacteria 5481
77 Ga0070659_100003401 3300005366 Bacteria 11334
78 Ga0070667_100003495 3300005367 Bacteria 13394
79 Ga0070667_100199595 3300005367 Bacteria 1775
80 Ga0070667_100211272 3300005367 Bacteria 1725
81 Ga0070667_100719237 3300005367 Bacteria 924
82 Ga0070713_100126595 3300005436 Bacteria 2248
83 Ga0070710_10046470 3300005437 Bacteria 2418
84 Ga0070701_10262668 3300005438 Bacteria 1047
85 Ga0070711_100000329 3300005439 Bacteria 24414
86 Ga0070705_100000063 3300005440 Bacteria 56043
87 Ga0070700_100001225 3300005441 Bacteria 12727
88 Ga0070694_100001545 3300005444 Bacteria 13538
89 Ga0070708_100107733 3300005445 Bacteria 2558
90 Ga0070708_100109588 3300005445 Archaea 2536
91 Ga0070678_100002308 3300005456 Bacteria 10409
92 Ga0070678_100120068 3300005456 Bacteria 2071
93 Ga0070678_100528678 3300005456 Bacteria 1044
94 Ga0070662_100003510 3300005457 Bacteria 9776
95 Ga0070662_100125905 3300005457 Bacteria 1969
96 Ga0070662_100142757 3300005457 Bacteria 1857
97 Ga0070662_100206033 3300005457 Bacteria 1563
98 Ga0070681_10161203 3300005458 Bacteria 2167
99 Ga0070681_10379167 3300005458 Bacteria 1325
100 Ga0068867_100006465 3300005459 Bacteria 8275
101 Ga0068867_100028559 3300005459 Bacteria 4017
102 Ga0068867_100104232 3300005459 Bacteria 2170
103 Ga0070706_100009446 3300005467 Bacteria 9076
104 Ga0070706_100311545 3300005467 Bacteria 1468
105 Ga0070707_100113293 3300005468 Bacteria 2631
106 Ga0070707_100285196 3300005468 Unclassified 1605
107 Ga0070698_100000714 3300005471 Bacteria 35621
108 Ga0070699_100015191 3300005518 Bacteria 6615
109 Ga0070679_100007599 3300005530 Bacteria 10144
110 Ga0070679_100664224 3300005530 Bacteria 985
111 Ga0070697_100001655 3300005536 Bacteria 16982
112 Ga0068853_100096642 3300005539 Bacteria 2606
113 Ga0068853_100135000 3300005539 Bacteria 2211
114 Ga0070672_100000556 3300005543 Bacteria 21828
115 Ga0070672_100002385 3300005543 Bacteria 11889
116 Ga0070672_100005768 3300005543 Bacteria 8256
117 Ga0070672_100008893 3300005543 Bacteria 6899
118 Ga0070672_100024003 3300005543 Bacteria 4499
119 Ga0070686_100000851 3300005544 Bacteria 17724
120 Ga0070686_100162037 3300005544 Bacteria 1576
121 Ga0070695_100000180 3300005545 Bacteria 30134
122 Ga0070696_100004277 3300005546 Bacteria 9515
123 Ga0070693_100000094 3300005547 Bacteria 38543
124 Ga0070693_100021786 3300005547 Bacteria 3399
125 Ga0070665_100034245 3300005548 Bacteria 5107
126 Ga0070704_100000025 3300005549 Bacteria 49670
127 Ga0068855_100001759 3300005563 Bacteria 27056
128 Ga0070664_100053748 3300005564 Bacteria 3415
129 Ga0070664_100063295 3300005564 Bacteria 3154
130 Ga0070664_100244388 3300005564 Bacteria 1612
131 Ga0068857_100025524 3300005577 Bacteria 5202
132 Ga0068857_100156167 3300005577 Bacteria 2069
133 Ga0068854_100009646 3300005578 Bacteria 6235
134 Ga0068854_100051567 3300005578 Bacteria 2948
135 Ga0068854_100276321 3300005578 Bacteria 1351
136 Ga0068856_100155468 3300005614 Bacteria 2297
137 Ga0070702_100000044 3300005615 Bacteria 33777
138 Ga0070702_100383870 3300005615 Bacteria 1000
139 Ga0068852_100010987 3300005616 Bacteria 6791
140 Ga0068852_100016518 3300005616 Bacteria 5760
141 Ga0068852_100145382 3300005616 Bacteria 2199
142 Ga0068852_100244848 3300005616 Bacteria 1715
143 Ga0068859_100001300 3300005617 Bacteria 25510
144 Ga0068859_100078456 3300005617 Bacteria 3343
145 Ga0068864_100012910 3300005618 Bacteria 6910
146 Ga0068864_100014523 3300005618 Bacteria 6542
147 Ga0068864_100018923 3300005618 Bacteria 5758
148 Ga0068864_100085126 3300005618 Bacteria 2779
149 Ga0068864_100169925 3300005618 Bacteria 1987
150 Ga0068864_100669566 3300005618 Bacteria 1012
151 Ga0068866_10003526 3300005718 Bacteria 6404
152 Ga0068866_10013812 3300005718 Bacteria 3552
153 Ga0068861_100004184 3300005719 Bacteria 9675
154 Ga0068861_100007315 3300005719 Bacteria 7564
155 Ga0068851_10042914 3300005834 Bacteria 2278
156 Ga0068870_10055426 3300005840 Bacteria 2112
157 Ga0068870_10101348 3300005840 Bacteria 1628
158 Ga0068863_100005834 3300005841 Bacteria 12067
159 Ga0068863_100186702 3300005841 Bacteria 1991
160 Ga0068863_100206013 3300005841 Bacteria 1893
161 Ga0068863_100310596 3300005841 Bacteria 1530
162 Ga0068858_100002456 3300005842 Bacteria 18712
163 Ga0068858_100011098 3300005842 Bacteria 8518
164 Ga0068858_100192689 3300005842 Bacteria 1926
165 Ga0068860_100003639 3300005843 Bacteria 15856
166 Ga0068860_100054973 3300005843 Bacteria 3784
167 Ga0068862_100008117 3300005844 Bacteria 8684
168 Ga0068862_100049614 3300005844 Bacteria 3586
169 Ga0081540_1052157 3300005983 Bacteria 2016
170 Ga0075365_10108790 3300006038 Bacteria 1903
171 Ga0075368_10001398 3300006042 Bacteria 7701
172 Ga0075368_10061595 3300006042 Bacteria 1503
173 Ga0075363_100019138 3300006048 Bacteria 3420
174 Ga0075363_100066151 3300006048 Bacteria 1956
175 Ga0075363_100113014 3300006048 Bacteria 1511
176 Ga0075364_10015334 3300006051 Bacteria 4751
177 Ga0070712_100000542 3300006175 Bacteria 21816
178 Ga0075362_10004710 3300006177 Bacteria 4923
179 Ga0075362_10039671 3300006177 Bacteria 2071
180 Ga0075362_10063374 3300006177 Bacteria 1676
181 Ga0075367_10000719 3300006178 Bacteria 12806
182 Ga0075367_10004162 3300006178 Bacteria 7016
183 Ga0075367_10053264 3300006178 Bacteria 2397
184 Ga0075369_10007483 3300006186 Bacteria 4160
185 Ga0075369_10034589 3300006186 Bacteria 2145
186 Ga0075366_10000433 3300006195 Bacteria 19528
187 Ga0075366_10000692 3300006195 Bacteria 15947
188 Ga0075366_10006450 3300006195 Bacteria 6427
189 Ga0075366_10008468 3300006195 Bacteria 5720
190 Ga0075366_10045005 3300006195 Bacteria 2616
191 Ga0075366_10057524 3300006195 Bacteria 2311
192 Ga0075366_10073765 3300006195 Bacteria 2034
193 Ga0075366_10073802 3300006195 Bacteria 2034
194 Ga0097621_100000206 3300006237 Bacteria 38579
195 Ga0097621_100011135 3300006237 Bacteria 6617
196 Ga0097621_100047371 3300006237 Bacteria 3484
197 Ga0097621_100115225 3300006237 Bacteria 2274
198 Ga0097621_100414866 3300006237 Bacteria 1207
199 Ga0097621_100704982 3300006237 Bacteria 929
200 Ga0075370_10000630 3300006353 Bacteria 13623
201 Ga0075370_10001965 3300006353 Bacteria 9297
202 Ga0075370_10096089 3300006353 Bacteria 1712
203 Ga0075370_10104584 3300006353 Bacteria 1641
204 Ga0075370_10254754 3300006353 Bacteria 1040
205 Ga0068871_100002659 3300006358 Bacteria 12202
206 Ga0068871_100017010 3300006358 Bacteria 5492
207 Ga0068871_100108113 3300006358 Bacteria 2337
208 Ga0068871_100494928 3300006358 Unclassified 1101
209 Ga0068871_100685027 3300006358 Bacteria 938
210 Ga0075428_100011133 3300006844 Bacteria 10010
211 Ga0075431_100005405 3300006847 Bacteria 12617
212 Ga0075431_100131687 3300006847 Bacteria 2579
213 Ga0075431_100364990 3300006847 Bacteria 1450
214 Ga0068865_100003163 3300006881 Bacteria 9861
215 Ga0068865_100018546 3300006881 Bacteria 4491
216 Ga0068865_100164906 3300006881 Bacteria 1693
217 Ga0068865_100274867 3300006881 Bacteria 1339
218 Ga0068865_100510389 3300006881 Bacteria 1004
219 Ga0097620_100001300 3300006931 Bacteria 25510
220 Ga0097620_100078455 3300006931 Bacteria 3343
221 Ga0105240_10568691 3300009093 Bacteria 1252
222 Ga0105240_11227873 3300009093 Bacteria 793
223 Ga0111539_10052199 3300009094 Bacteria 4867
224 Ga0105245_10000224 3300009098 Bacteria 53847
225 Ga0105245_10073565 3300009098 Bacteria 3108
226 Ga0105245_10214392 3300009098 Bacteria 1855
227 Ga0105245_10302732 3300009098 Bacteria 1569
228 Ga0105245_11121643 3300009098 Bacteria 833
229 Ga0105245_11228760 3300009098 Unclassified 797
230 Ga0105243_10000035 3300009148 Bacteria 177598
231 Ga0105241_10039204 3300009174 Bacteria 3573
232 Ga0105242_10000300 3300009176 Bacteria 39346
233 Ga0105242_10029803 3300009176 Bacteria 4354
234 Ga0105242_10059220 3300009176 Bacteria 3141
235 Ga0105242_10203386 3300009176 Bacteria 1760
236 Ga0105248_10002156 3300009177 Bacteria 21778
237 Ga0105248_10081882 3300009177 Bacteria 3629
238 Ga0105248_10421040 3300009177 Bacteria 1504
239 Ga0105248_10503053 3300009177 Bacteria 1366
240 Ga0105237_10036062 3300009545 Bacteria 5003
241 Ga0105249_10003408 3300009553 Bacteria 13763
242 Ga0105249_10019263 3300009553 Bacteria 6085
243 Ga0105249_10258136 3300009553 Bacteria 1730
244 Ga0105239_10168455 3300010375 Bacteria 2449
245 Ga0105246_10217183 3300011119 Bacteria 1496
246 Ga0157371_10045140 3300013102 Bacteria 3137
247 Ga0157371_10159065 3300013102 Bacteria 1613
248 Ga0157374_11018531 3300013296 Bacteria 847
249 Ga0157378_10000528 3300013297 Bacteria 36299
250 Ga0157378_10043792 3300013297 Bacteria 3974
251 Ga0157378_10748160 3300013297 Bacteria 1000
252 Ga0163162_10001541 3300013306 Bacteria 21513
253 Ga0163162_10332290 3300013306 Bacteria 1652
254 Ga0163162_10767333 3300013306 Bacteria 1083
255 Ga0157372_10181052 3300013307 Bacteria 2439
256 Ga0157375_10012176 3300013308 Bacteria 7623
257 Ga0157375_10018925 3300013308 Bacteria 6253
258 Ga0157375_10019017 3300013308 Bacteria 6236
259 Ga0157375_10050072 3300013308 Bacteria 4097
260 Ga0157375_10056809 3300013308 Bacteria 3866
261 Ga0157375_10426234 3300013308 Bacteria 1493
262 Ga0157375_10554192 3300013308 Bacteria 1311
263 Ga0157375_10654255 3300013308 Bacteria 1207
264 Ga0157375_10799726 3300013308 Bacteria 1092
265 Ga0163163_10483773 3300014325 Bacteria 1299
266 Ga0157380_10003331 3300014326 Bacteria 11029
267 Ga0157380_10015044 3300014326 Bacteria 5677
268 Ga0157380_11004503 3300014326 Bacteria 868
269 Ga0157379_10005673 3300014968 Bacteria 10728
270 Ga0157379_10236584 3300014968 Bacteria 1656
271 Ga0157379_10237609 3300014968 Bacteria 1652
272 Ga0157379_10881038 3300014968 Bacteria 848
273 Ga0157376_10001545 3300014969 Bacteria 15178
274 Ga0157376_10100707 3300014969 Bacteria 2523
275 Ga0157376_10390034 3300014969 Bacteria 1344
276 Ga0182006_1010161 3300015261 Bacteria 4195
277 Ga0183361_10018 3300016635 Bacteria 133279
278 Ga0163161_10124373 3300017792 Bacteria 1941
279 Ga0163161_10127703 3300017792 Bacteria 1916
280 Ga0209436_102928 3300025208 Bacteria 4781
281 Ga0209674_100005 3300025226 Bacteria 1708125
282 Ga0209563_101442 3300025230 Bacteria 6295
283 Ga0207427_100585 3300025231 Bacteria 18340
284 Ga0207425_1000138 3300025245 Bacteria 65477
285 Ga0209759_1000116 3300025256 Bacteria 141810
286 Ga0209129_1000023 3300025258 Bacteria 420646
287 Ga0209129_1000558 3300025258 Bacteria 25653
288 Ga0209233_1000016 3300025261 Bacteria 907830
289 Ga0209565_1000403 3300025263 Bacteria 36050
290 Ga0209673_1000673 3300025273 Bacteria 49581
291 Ga0209130_1000222 3300025284 Bacteria 74607
292 Ga0209675_1001282 3300025291 Bacteria 14952
293 Ga0209025_1000476 3300025294 Bacteria 77754
294 Ga0209564_1000898 3300025295 Bacteria 39109
295 Ga0209758_1000064 3300025297 Bacteria 311812
296 Ga0209256_1000115 3300025299 Bacteria 173607
297 Ga0207426_1000001 3300025302 Bacteria 1341301
298 Ga0209051_1009885 3300025303 Bacteria 4874
299 Ga0209257_1004838 3300025304 Bacteria 9971
300 Ga0209257_1009341 3300025304 Bacteria 5283
301 Ga0207697_10009076 3300025315 Bacteria 4309
302 Ga0207697_10022600 3300025315 Bacteria 2576
303 Ga0207656_10034176 3300025321 Bacteria 2122
304 Ga0207653_10019074 3300025885 Bacteria 2162
305 Ga0207682_10001208 3300025893 Bacteria 11932
306 Ga0207682_10013431 3300025893 Bacteria 3191
307 Ga0207682_10057811 3300025893 Bacteria 1618
308 Ga0207682_10065418 3300025893 Bacteria 1530
309 Ga0207692_10073454 3300025898 Bacteria 1809
310 Ga0207642_10012940 3300025899 Bacteria 3028
311 Ga0207688_10047993 3300025901 Bacteria 2385
312 Ga0207688_10138451 3300025901 Bacteria 1431
313 Ga0207688_10261423 3300025901 Bacteria 1050
314 Ga0207680_10003102 3300025903 Bacteria 7804
315 Ga0207680_10029489 3300025903 Bacteria 3083
316 Ga0207647_10036172 3300025904 Bacteria 3139
317 Ga0207645_10023008 3300025907 Bacteria 4050
318 Ga0207643_10066164 3300025908 Bacteria 2072
319 Ga0207643_10158957 3300025908 Bacteria 1359
320 Ga0207705_10320680 3300025909 Bacteria 1191
321 Ga0207684_10014463 3300025910 Bacteria 6803
322 Ga0207684_10146887 3300025910 Bacteria 2028
323 Ga0207654_10134837 3300025911 Bacteria 1567
324 Ga0207707_10112338 3300025912 Bacteria 2382
325 Ga0207695_10159154 3300025913 Bacteria 2191
326 Ga0207695_10759071 3300025913 Bacteria 850
327 Ga0207663_10002606 3300025916 Bacteria 8681
328 Ga0207660_10002869 3300025917 Bacteria 11261
329 Ga0207662_10000091 3300025918 Bacteria 42710
330 Ga0207662_10013340 3300025918 Bacteria 4595
331 Ga0207657_10265475 3300025919 Bacteria 1365
332 Ga0207649_10080186 3300025920 Bacteria 2110
333 Ga0207649_10188762 3300025920 Bacteria 1448
334 Ga0207652_10003794 3300025921 Bacteria 12387
335 Ga0207652_10080613 3300025921 Bacteria 2846
336 Ga0207681_10000867 3300025923 Bacteria 19876
337 Ga0207681_10037451 3300025923 Bacteria 3206
338 Ga0207681_10776979 3300025923 Bacteria 799
339 Ga0207650_10000348 3300025925 Bacteria 44624
340 Ga0207650_10005681 3300025925 Bacteria 8512
341 Ga0207650_10560698 3300025925 Bacteria 958
342 Ga0207659_10428334 3300025926 Bacteria 1111
343 Ga0207687_10004949 3300025927 Bacteria 8840
344 Ga0207687_10025209 3300025927 Bacteria 3979
345 Ga0207687_10115320 3300025927 Bacteria 2001
346 Ga0207687_10576341 3300025927 Bacteria 946
347 Ga0207700_10057930 3300025928 Bacteria 2924
348 Ga0207644_10008149 3300025931 Bacteria 6865
349 Ga0207644_10010462 3300025931 Bacteria 6115
350 Ga0207644_10031499 3300025931 Bacteria 3694
351 Ga0207644_10115554 3300025931 Bacteria 2035
352 Ga0207690_10004966 3300025932 Bacteria 7852
353 Ga0207706_10014863 3300025933 Bacteria 7048
354 Ga0207706_10036246 3300025933 Bacteria 4382
355 Ga0207706_10148888 3300025933 Bacteria 2059
356 Ga0207706_10169285 3300025933 Bacteria 1920
357 Ga0207706_10315366 3300025933 Bacteria 1361
358 Ga0207686_10003132 3300025934 Bacteria 8894
359 Ga0207686_10021291 3300025934 Bacteria 3719
360 Ga0207709_10001029 3300025935 Bacteria 20622
361 Ga0207709_10158404 3300025935 Bacteria 1576
362 Ga0207670_10000774 3300025936 Bacteria 16821
363 Ga0207670_10019384 3300025936 Bacteria 4154
364 Ga0207669_10001910 3300025937 Bacteria 8840
365 Ga0207669_10002355 3300025937 Bacteria 8033
366 Ga0207704_10003275 3300025938 Bacteria 7353
367 Ga0207704_10009899 3300025938 Bacteria 4623
368 Ga0207704_10060414 3300025938 Bacteria 2345
369 Ga0207665_10029809 3300025939 Bacteria 3605
370 Ga0207665_10059496 3300025939 Bacteria 2586
371 Ga0207691_10000295 3300025940 Bacteria 49400
372 Ga0207691_10015654 3300025940 Bacteria 7208
373 Ga0207691_10022033 3300025940 Bacteria 6012
374 Ga0207691_10037825 3300025940 Bacteria 4467
375 Ga0207691_10187964 3300025940 Bacteria 1803
376 Ga0207689_10000024 3300025942 Bacteria 107574
377 Ga0207689_10003225 3300025942 Bacteria 14942
378 Ga0207689_10022925 3300025942 Bacteria 5244
379 Ga0207661_10545536 3300025944 Bacteria 1062
380 Ga0207679_10000351 3300025945 Bacteria 33566
381 Ga0207679_10188161 3300025945 Bacteria 1714
382 Ga0207679_10217141 3300025945 Bacteria 1607
383 Ga0207679_10559036 3300025945 Bacteria 1027
384 Ga0207667_10010005 3300025949 Bacteria 11122
385 Ga0207651_10002646 3300025960 Bacteria 8563
386 Ga0207651_10110651 3300025960 Bacteria 2061
387 Ga0207651_10325193 3300025960 Bacteria 1287
388 Ga0207712_10029541 3300025961 Bacteria 3678
389 Ga0207712_10122364 3300025961 Bacteria 1971
390 Ga0207712_10134769 3300025961 Bacteria 1887
391 Ga0207668_10018787 3300025972 Bacteria 4357
392 Ga0207668_10101911 3300025972 Bacteria 2135
393 Ga0207640_10068600 3300025981 Bacteria 2377
394 Ga0207640_10124921 3300025981 Bacteria 1851
395 Ga0207640_10217362 3300025981 Bacteria 1461
396 Ga0207658_10005567 3300025986 Bacteria 8622
397 Ga0207658_10168947 3300025986 Bacteria 1800
398 Ga0207658_10297130 3300025986 Bacteria 1390
399 Ga0207658_10402036 3300025986 Bacteria 1204
400 Ga0207677_10003352 3300026023 Bacteria 8487
401 Ga0207677_10005133 3300026023 Bacteria 7085
402 Ga0207677_10068181 3300026023 Bacteria 2495
403 Ga0207677_10108581 3300026023 Bacteria 2061
404 Ga0207703_10001562 3300026035 Bacteria 20760
405 Ga0207703_10005063 3300026035 Bacteria 10668
406 Ga0207703_11032654 3300026035 Bacteria 789
407 Ga0207678_10022605 3300026067 Bacteria 5507
408 Ga0207678_10029346 3300026067 Bacteria 4800
409 Ga0207678_10795914 3300026067 Bacteria 834
410 Ga0207708_10001013 3300026075 Bacteria 21022
411 Ga0207708_10046879 3300026075 Bacteria 3291
412 Ga0207708_10362386 3300026075 Bacteria 1192
413 Ga0207708_10548368 3300026075 Bacteria 975
414 Ga0207641_10000655 3300026088 Bacteria 37743
415 Ga0207641_10043195 3300026088 Bacteria 3784
416 Ga0207641_10056301 3300026088 Bacteria 3341
417 Ga0207641_10182166 3300026088 Bacteria 1925
418 Ga0207641_10537789 3300026088 Bacteria 1138
419 Ga0207641_10588292 3300026088 Bacteria 1088
420 Ga0207648_10011156 3300026089 Bacteria 8478
421 Ga0207648_10013762 3300026089 Bacteria 7509
422 Ga0207648_10043003 3300026089 Bacteria 3968
423 Ga0207648_10069702 3300026089 Bacteria 3064
424 Ga0207648_10092783 3300026089 Bacteria 2640
425 Ga0207648_10805508 3300026089 Bacteria 874
426 Ga0207676_10010337 3300026095 Bacteria 6644
427 Ga0207676_10021293 3300026095 Bacteria 4756
428 Ga0207676_10042838 3300026095 Bacteria 3482
429 Ga0207676_10195217 3300026095 Bacteria 1784
430 Ga0207676_10547032 3300026095 Bacteria 1105
431 Ga0207676_10710769 3300026095 Bacteria 974
432 Ga0207674_10029844 3300026116 Bacteria 5738
433 Ga0207674_10066286 3300026116 Bacteria 3637
434 Ga0207674_10257185 3300026116 Bacteria 1693
435 Ga0207674_11007446 3300026116 Bacteria 802
436 Ga0207675_100000017 3300026118 Bacteria 124338
437 Ga0207675_100003971 3300026118 Bacteria 14358
438 Ga0207675_100295986 3300026118 Bacteria 1575
439 Ga0207683_10006162 3300026121 Bacteria 10278
440 Ga0207683_10234591 3300026121 Bacteria 1673
441 Ga0207683_10251806 3300026121 Bacteria 1612
442 Ga0207698_10056943 3300026142 Bacteria 3021
443 Ga0207698_10135282 3300026142 Bacteria 2114
444 Ga0207698_10374771 3300026142 Bacteria 1352
445 Ga0209813_10002666 3300027866 Bacteria 4106
446 Ga0209813_10161412 3300027866 Bacteria 809
447 Ga0209974_10093295 3300027876 Bacteria 1046
448 Ga0268266_10146485 3300028379 Bacteria 2124
449 Ga0268265_10048795 3300028380 Bacteria 3180
450 Ga0268264_10000894 3300028381 Bacteria 31375
451 Ga0268264_10002476 3300028381 Bacteria 16226
452 Ga0268264_10112124 3300028381 Bacteria 2391
453 Ga0268264_10327215 3300028381 Bacteria 1451
454 Ga0307517_10000173 3300028786 Bacteria 105751
455 Ga0307517_10138331 3300028786 Bacteria 1721
456 Ga0307515_10000020 3300028794 Bacteria 411735
457 Ga0307515_10029773 3300028794 Bacteria 9207
458 Ga0307515_10051089 3300028794 Bacteria 6175
459 Ga0307512_10048466 3300030522 Bacteria 3440
460 Ga0307513_10178997 3300031456 Bacteria 1986
461 Ga0307513_10208759 3300031456 Bacteria 1786
462 Ga0307513_10227999 3300031456 Bacteria 1678
463 Ga0307509_10000181 3300031507 Bacteria 98346
464 Ga0307509_10012589 3300031507 Bacteria 10103
465 Ga0307509_10051820 3300031507 Bacteria 4384
466 Ga0307509_10112446 3300031507 Bacteria 2723
467 Ga0307509_10149623 3300031507 Bacteria 2253
468 Ga0307408_100037568 3300031548 Bacteria 3412
469 Ga0307408_100115995 3300031548 Bacteria 2066
470 Ga0307408_100425479 3300031548 Bacteria 1146
471 Ga0307408_100719495 3300031548 Bacteria 899
472 Ga0307508_10000738 3300031616 Bacteria 38723
473 Ga0307508_10002185 3300031616 Bacteria 20916
474 Ga0307508_10165733 3300031616 Bacteria 1813
475 Ga0307508_10218087 3300031616 Bacteria 1508
476 Ga0307514_10031063 3300031649 Bacteria 4284
477 Ga0265314_10078587 3300031711 Bacteria 2184
478 Ga0307516_10022146 3300031730 Bacteria 6530
479 Ga0307516_10115763 3300031730 Bacteria 2477
480 Ga0307516_10414481 3300031730 Bacteria 1005
481 Ga0307518_10243995 3300031838 Bacteria 1149
482 Ga0307410_10083613 3300031852 Bacteria 2248
483 Ga0307406_10138162 3300031901 Bacteria 1721
484 Ga0307412_10008460 3300031911 Bacteria 5875
485 Ga0307412_10017958 3300031911 Bacteria 4244
486 Ga0307412_10035177 3300031911 Bacteria 3198
487 Ga0307412_10900306 3300031911 Bacteria 775
488 Ga0307409_100009443 3300031995 Bacteria 5992
489 Ga0307409_100394563 3300031995 Bacteria 1320
490 Ga0307416_100007862 3300032002 Bacteria 6820
491 Ga0307416_100019108 3300032002 Bacteria 4850
492 Ga0307416_100128797 3300032002 Bacteria 2273
493 Ga0307414_10004315 3300032004 Bacteria 7715
494 Ga0307414_10018239 3300032004 Bacteria 4314
495 Ga0307414_10768663 3300032004 Bacteria 877
496 Ga0307411_10000784 3300032005 Bacteria 11779
497 Ga0307411_10024010 3300032005 Bacteria 3626
498 Ga0307411_10099712 3300032005 Bacteria 2051
499 Ga0307415_100001229 3300032126 Bacteria 12000
500 Ga0307415_100118645 3300032126 Bacteria 1979
501 Ga0307507_10051750 3300033179 Bacteria 3947
502 Ga0307510_10016350 3300033180 Bacteria 8757
503 Ga0373951_0012625 3300035091 Bacteria 1899
504 Ga0373936_0000050 3300035113 Bacteria 68503
505 Ga0373956_0084298 3300035119 Bacteria 1461
506 Ga0373960_0051125 3300035121 Bacteria 1227
507 Ga0373942_0061219 3300035207 Bacteria 1079
508 Ga0373961_0000068 3300035241 Bacteria 56597
509 Ga0373931_0003263 3300035691 Bacteria 7257
510 Ga0373927_0193867 3300035695 Bacteria 1333
511 Ga0373947_0142682 3300035725 Bacteria 1537
512 Ga0373937_0021310 3300036401 Bacteria 5817
513 Ga0373925_0064745 3300037068 Bacteria 2752
514 Ga0395905_0032190 3300037471 Bacteria 4932
515 Ga0395905_0623530 3300037471 Bacteria 980
516 Ga0436365_1605944 3300039437 Bacteria 1433
517 Ga0451789_0857723 3300041443 Bacteria 2541
518 Ga0451789_0889476 3300041443 Bacteria 1296
519 Ga0451795_0158256 3300041456 Bacteria 1742
520 Ga0451843_0612255 3300041509 Bacteria 1010
521 Ga0450898_026169 3300042134 Bacteria 1050
522 Ga0450904_000668 3300042139 Bacteria 6155
523 Ga0439458_0019926 3300042157 Bacteria 1547
524 Ga0451577_0112257 3300042876 Bacteria 2439
525 Ga0466972_0019726 3300044658 Bacteria 3371
526 Ga0466965_0150986 3300044683 Bacteria 1214
527 Ga0453684_0187181 3300044712 Bacteria 2425
528 Ga0453684_0277615 3300044712 Bacteria 1912
529 Ga0466970_0005760 3300044765 Bacteria 6158
530 Ga0466959_0025801 3300045049 Bacteria 4358
531 Ga0451576_0046906 3300045051 Bacteria 4546
532 Ga0451576_0063689 3300045051 Bacteria 3843
533 Ga0451576_0141636 3300045051 Bacteria 2507
534 Ga0495592_0000234 3300046454 Bacteria 47791
535 Ga0495603_0016020 3300046455 Bacteria 4532
536 Ga0495603_0020702 3300046455 Bacteria 3984
537 Ga0495590_0031657 3300046457 Bacteria 1851
538 Ga0495590_0035189 3300046457 Bacteria 1749
539 Ga0495590_0065367 3300046457 Bacteria 1273
540 Ga0495629_0133971 3300046459 Bacteria 1725
541 Ga0495629_0488751 3300046459 Bacteria 831
542 Ga0495653_0023490 3300046463 Bacteria 4979
543 Ga0495653_0044953 3300046463 Bacteria 3425
544 Ga0495580_0095536 3300046472 Bacteria 2067
545 Ga0495580_0427600 3300046472 Bacteria 890
546 Ga0495582_0001868 3300046473 Bacteria 11882
547 Ga0495605_0027067 3300046474 Bacteria 2974
548 Ga0495662_0125072 3300046476 Bacteria 1263
549 Ga0495664_0020817 3300046477 Bacteria 3786
550 Ga0495596_0012627 3300046500 Bacteria 3610
551 Ga0495596_0040974 3300046500 Bacteria 1827
552 Ga0495606_0004374 3300046507 Bacteria 14165
553 Ga0495608_0000783 3300046511 Bacteria 22295
554 Ga0495616_0012621 3300046513 Bacteria 4789
555 Ga0495618_0003896 3300046514 Bacteria 9214
556 Ga0495620_0008574 3300046515 Bacteria 5482
557 Ga0495620_0045651 3300046515 Bacteria 1895
558 Ga0495628_0084402 3300046516 Bacteria 2464
559 Ga0495628_0551383 3300046516 Bacteria 827
560 Ga0495630_0062336 3300046517 Bacteria 2801
561 Ga0495632_0007387 3300046519 Bacteria 6908
562 Ga0495648_0018879 3300046524 Bacteria 4865
563 Ga0495648_0160938 3300046524 Bacteria 1161
564 Ga0495642_0055159 3300046528 Bacteria 1640
565 Ga0495652_0077789 3300046529 Bacteria 2748
566 Ga0495665_0003847 3300046531 Bacteria 8127
567 Ga0495665_0024410 3300046531 Bacteria 3247
568 Ga0495640_0002521 3300046533 Bacteria 14714
569 Ga0495587_0028690 3300046536 Bacteria 3382
570 Ga0495609_0000001 3300046538 Bacteria 1060094
571 Ga0495597_0010864 3300046542 Bacteria 4432
572 Ga0495645_0021548 3300046543 Bacteria 4656
573 Ga0495622_0151968 3300046557 Bacteria 1047
574 Ga0495633_0038222 3300046558 Bacteria 2294
575 Ga0495633_0108447 3300046558 Bacteria 1288
576 Ga0495634_0006776 3300046642 Bacteria 8678
577 Ga0495625_0004650 3300046660 Bacteria 12892
578 Ga0495625_0266764 3300046660 Bacteria 1106
579 Ga0495625_0272101 3300046660 Bacteria 1093
580 Ga0495625_0278536 3300046660 Bacteria 1077
581 Ga0495635_0198430 3300046663 Bacteria 1361
582 Ga0495635_0261827 3300046663 Bacteria 1164
583 Ga0495657_0013813 3300046675 Bacteria 5944
584 Ga0495623_0047824 3300046679 Bacteria 2715
585 Ga0495646_0155225 3300046680 Bacteria 1270
586 Ga0495646_0261702 3300046680 Bacteria 924
587 Ga0495647_0053852 3300046681 Bacteria 1570
588 Ga0495658_0006924 3300046683 Bacteria 5590
589 Ga0495658_0010311 3300046683 Bacteria 4675
590 Ga0495624_0025837 3300046690 Bacteria 3852
591 Ga0495624_0034457 3300046690 Bacteria 3274
592 Ga0495649_0003263 3300046694 Bacteria 11050
593 Ga0495649_0076677 3300046694 Bacteria 1789
594 Ga0495600_0005081 3300046809 Bacteria 7906
595 Ga0495660_0095334 3300046810 Bacteria 1539
596 Ga0495581_0000476 3300047315 Bacteria 20443
597 Ga0495604_0009661 3300047317 Bacteria 7625
598 Ga0495636_0005540 3300047318 Bacteria 4957
599 Ga0495674_0011341 3300047319 Bacteria 8413
600 Ga0495674_0258412 3300047319 Bacteria 1431
601 Ga0495672_0058888 3300047320 Bacteria 2225
602 Ga0495672_0065492 3300047320 Bacteria 2077
603 Ga0495672_0082877 3300047320 Bacteria 1783
604 Ga0495676_0108692 3300047321 Bacteria 2039
605 Ga0495680_0027282 3300047322 Bacteria 4693
606 Ga0495680_0072850 3300047322 Bacteria 2612
607 Ga0495683_0018406 3300047323 Bacteria 3613
608 Ga0495683_0062655 3300047323 Bacteria 1839
609 Ga0495683_0103988 3300047323 Bacteria 1362
610 Ga0495687_000017 3300047443 Bacteria 350429
611 Ga0495687_000558 3300047443 Bacteria 43907
612 Ga0495687_007412 3300047443 Bacteria 6462
613 Ga0495687_038586 3300047443 Bacteria 2118
614 Ga0495675_0070045 3300047444 Bacteria 2214
615 Ga0495677_0011639 3300047445 Bacteria 3216
616 Ga0495673_0037840 3300047469 Bacteria 2200
617 Ga0495684_0061587 3300047471 Bacteria 2855
618 Ga0495686_0002539 3300047472 Bacteria 17057
619 Ga0495686_0005323 3300047472 Bacteria 10194
620 Ga0495593_0061768 3300047673 Bacteria 1959
621 Ga0495593_0161392 3300047673 Bacteria 1131
622 Ga0495602_0012748 3300048088 Bacteria 8618
623 Ga0495602_0190446 3300048088 Bacteria 1573
624 Ga0495614_0171144 3300048089 Bacteria 974
625 Ga0495626_0098702 3300048091 Bacteria 1275
626 Ga0495626_0127024 3300048091 Bacteria 1092
627 Ga0496100_0050797 3300048903 Bacteria 2688
628 Ga0496101_0090890 3300048904 Bacteria 2271
629 Ga0496101_0396883 3300048904 Bacteria 1086
630 Ga0496103_0412298 3300048906 Bacteria 867
631 Ga0496104_0021622 3300048907 Bacteria 5908
632 Ga0496104_0043884 3300048907 Bacteria 4200
633 Ga0496104_0084231 3300048907 Bacteria 3033
634 Ga0496105_0360097 3300048908 Bacteria 1160
635 Ga0496105_0417589 3300048908 Bacteria 1062
636 Ga0496106_0548680 3300048909 Bacteria 927
637 Ga0496107_0344759 3300048910 Bacteria 1108
638 Ga0496108_0289166 3300048911 Bacteria 1427
639 Ga0496109_0065289 3300048912 Bacteria 3332
640 Ga0496109_0594364 3300048912 Bacteria 1043
641 Ga0496110_0286526 3300048913 Bacteria 1500
642 Ga0496110_0424676 3300048913 Bacteria 1212
643 Ga0496112_0938487 3300048915 Bacteria 786
644 Ga0496114_0084657 3300048917 Bacteria 2685
645 Ga0496114_0272919 3300048917 Bacteria 1490
646 Ga0496114_0481460 3300048917 Bacteria 1098
647 Ga0496121_0008585 3300048924 Bacteria 11962
648 Ga0496121_0180937 3300048924 Bacteria 1522
649 Ga0496121_0449215 3300048924 Bacteria 831
650 Ga0496126_0046519 3300048929 Bacteria 3979
651 Ga0496126_0259741 3300048929 Bacteria 1445
652 Ga0501308_015231 3300049128 Bacteria 909
653 Ga0495678_063820 3300049459 Bacteria 1374
654 Ga0501294_003038 3300049517 Bacteria 1585
655 Ga0501312_021665 3300049528 Bacteria 958
656 Ga0501320_008201 3300049536 Bacteria 1023
657 Ga0501206_005762 3300049653 Bacteria 1600
658 Ga0501249_057619 3300049679 Bacteria 897
659 Ga0501264_006923 3300049761 Bacteria 1051
660 Ga0501265_005475 3300049762 Bacteria 1464
661 nmdc:mga03683_166400_c1 3300050489 Bacteria 1001
662 nmdc:mga03683_59991_c1 3300050489 Bacteria 1606
663 nmdc:mga03n38_117538_c1 3300050490 Bacteria 1303
664 nmdc:mga03n38_29692_c1 3300050490 Bacteria 2291
665 nmdc:mga03n38_71024_c1 3300050490 Bacteria 1611
666 nmdc:mga0yw44_70526_c1 3300050492 Bacteria 2167
667 nmdc:mga0k408_103658_c1 3300050493 Bacteria 1678
668 nmdc:mga0k408_25745_c1 3300050493 Bacteria 3334
669 nmdc:mga0k408_37640_c1 3300050493 Bacteria 2778
670 nmdc:mga0k408_42431_c1 3300050493 Bacteria 2620
671 nmdc:mga0k408_489_c1 3300050493 Bacteria 21719
672 nmdc:mga0k408_5725_c1 3300050493 Bacteria 6607
673 nmdc:mga0k408_917_c1 3300050493 Bacteria 16129
674 nmdc:mga0k408_973_c1 3300050493 Bacteria 15734
675 nmdc:mga06z11_108151_c1 3300050494 Bacteria 1536
676 nmdc:mga06z11_181855_c1 3300050494 Bacteria 1213
677 nmdc:mga04h51_187514_c1 3300050495 Bacteria 808
678 nmdc:mga07m45_118356_c1 3300050496 Bacteria 1529
679 nmdc:mga07m45_118789_c1 3300050496 Bacteria 1526
680 nmdc:mga07m45_153680_c1 3300050496 Bacteria 1335
681 nmdc:mga07m45_42_c1 3300050496 Bacteria 58731
682 nmdc:mga07m45_432_c1 3300050496 Bacteria 17386
683 nmdc:mga09592_483106_c1 3300050508 Bacteria 1067
684 nmdc:mga06r32_478_c1 3300050510 Bacteria 34407
685 nmdc:mga0sz30_32613_c1 3300050516 Bacteria 2161
686 Ga0495619_0018128 3300053085 Bacteria 4464
687 Ga0500578_0000007 3300053086 Bacteria 229642
688 Ga0500578_0134274 3300053086 Bacteria 1550
689 Ga0500583_0014265 3300053092 Bacteria 3105
690 Ga0500583_0030996 3300053092 Bacteria 2346
691 Ga0500651_0012641 3300053093 Bacteria 5121
692 Ga0500651_0130538 3300053093 Bacteria 1520
693 Ga0500594_0003527 3300053118 Bacteria 3444
694 Ga0500614_051060 3300053123 Bacteria 1086
695 Ga0500642_0052104 3300053130 Bacteria 1811
696 Ga0500655_007485 3300053133 Bacteria 1964
697 Ga0500658_0004006 3300053134 Bacteria 5531
698 Ga0500559_0000061 3300053136 Bacteria 87246
699 Ga0500568_0020120 3300053139 Bacteria 2893
700 Ga0500568_0020375 3300053139 Bacteria 2869
701 Ga0500616_0005720 3300053153 Bacteria 8370
702 Ga0500622_0049627 3300053156 Bacteria 2163
703 Ga0500645_005656 3300053730 Bacteria 4565
704 Ga0500587_002373 3300053739 Bacteria 2675
705 2501069545 2501025501 Bacteria 7768574
706 2501081416 2501025502 Bacteria 9641094
707 2501411185 2501025504 Bacteria 8008976
708 2511089186 2510917013 Bacteria 9951648
709 2511100171 2510917014 Bacteria 8296963
710 2511104160 2510917015 Bacteria 7950052
711 2516023625 2515154189 Bacteria 9629850
712 2563062400 2562617112 Bacteria 10918404
713 2644304079 2643221654 Bacteria 5273570
714 2713477743 2711768613 Bacteria 11048459
715 2739057153 2738541337 Bacteria 6183410
716 2748015602 2747842501 Bacteria 5293829
717 2808983182 2808606386 Bacteria 4471946
718 2809128402 2808606415 Bacteria 4576710
719 2809148023 2808606419 Bacteria 4576925
720 2842330150 2842324504 Bacteria 9364110
721 2842356807 2842348783 Bacteria 9002918
722 2842457734 2842454564 Bacteria 8730687
723 2842682838 2842677519 Bacteria 5615038
724 2852620562 2852618963 Bacteria 4577824
725 2856293891 2856287931 Bacteria 7223934
726 2857361907 2857357740 Bacteria 9937880
727 2883093969 2883087390 Bacteria 9532701
728 2895513853 2895511927 Bacteria 6802080
729 2904484298 2904483920 Bacteria 7545285
730 2919530242 2919527303 Bacteria 7718827
731 8055266376 8055266321 Bacteria 7999742
732 8055306290 8055301274 Bacteria 8587385
733 Ga0373932_0008911
734 SwRhRL2b_contig_3630290
735 JGI25156J39149_1002099
736 JGI25152J39213_1000138
737 JGI25152J39213_1001574
738 JGI25150J39212_1000975
739 JGI25159J45721_1001236
740 JGI25151J46595_10003009
741 JGI25165J46597_1000679
742 JGI25153J46596_10000754
743 JGI25153J46596_10002982
744 JGI25161J50226_1001727
745 Ga0055533_1000038
746 Ga0055528_1003201
747 Ga0055530_10007905
748 Ga0055543_1001932
749 Ga0065165_1002672
750 Ga0065715_10103544
751 Ga0065715_10191522
752 Ga0065707_10099321
753 Ga0070676_10001020
754 Ga0070676_10004301
755 Ga0070690_100000156
756 Ga0070690_100000912
757 Ga0070670_100002105
758 Ga0070670_100015113
759 Ga0070670_100023254
760 Ga0070670_100198600
761 Ga0070670_100359261
762 Ga0070670_100402237
763 Ga0070670_100593288
764 Ga0070670_100616897
765 Ga0070677_10009771
766 Ga0068869_100000023
767 Ga0068869_100009338
768 Ga0068869_100013392
769 Ga0068869_100042006
770 Ga0068869_100914644
771 Ga0070666_10015870
772 Ga0070680_100019205
773 Ga0070682_100030224
774 Ga0068868_100002689
775 Ga0068868_100004315
776 Ga0068868_100112454
777 Ga0068868_100143188
778 Ga0068868_100578589
779 Ga0070660_100432951
780 Ga0070660_100439053
781 Ga0070689_100008306
782 Ga0070689_100017487
783 Ga0070689_100222165
784 Ga0070691_10000075
785 Ga0070687_100000137
786 Ga0070687_100008027
787 Ga0070661_100208541
788 Ga0070668_100004948
789 Ga0070669_100005106
790 Ga0070669_100060755
791 Ga0070669_100758326
792 Ga0070675_100001775
793 Ga0070675_100038209
794 Ga0070675_100076368
795 Ga0070671_100000835
796 Ga0070671_100010044
797 Ga0070671_100027612
798 Ga0070671_100042078
799 Ga0070671_100056083
800 Ga0070671_100210966
801 Ga0070674_100004185
802 Ga0070674_100004251
803 Ga0070674_100014932
804 Ga0070673_100005082
805 Ga0070673_100148723
806 Ga0070673_100296043
807 Ga0070673_100578512
808 Ga0070688_100008845
809 Ga0070659_100003401
810 Ga0070667_100003495
811 Ga0070667_100199595
812 Ga0070667_100211272
813 Ga0070667_100719237
814 Ga0070713_100126595
815 Ga0070710_10046470
816 Ga0070701_10262668
817 Ga0070711_100000329
818 Ga0070705_100000063
819 Ga0070700_100001225
820 Ga0070694_100001545
821 Ga0070708_100107733
822 Ga0070708_100109588
823 Ga0070678_100002308
824 Ga0070678_100120068
825 Ga0070678_100528678
826 Ga0070662_100003510
827 Ga0070662_100125905
828 Ga0070662_100142757
829 Ga0070662_100206033
830 Ga0070681_10161203
831 Ga0070681_10379167
832 Ga0068867_100006465
833 Ga0068867_100028559
834 Ga0068867_100104232
835 Ga0070706_100009446
836 Ga0070706_100311545
837 Ga0070707_100113293
838 Ga0070707_100285196
839 Ga0070698_100000714
840 Ga0070699_100015191
841 Ga0070679_100007599
842 Ga0070679_100664224
843 Ga0070697_100001655
844 Ga0068853_100096642
845 Ga0068853_100135000
846 Ga0070672_100000556
847 Ga0070672_100002385
848 Ga0070672_100005768
849 Ga0070672_100008893
850 Ga0070672_100024003
851 Ga0070686_100000851
852 Ga0070686_100162037
853 Ga0070695_100000180
854 Ga0070696_100004277
855 Ga0070693_100000094
856 Ga0070693_100021786
857 Ga0070665_100034245
858 Ga0070704_100000025
859 Ga0068855_100001759
860 Ga0070664_100053748
861 Ga0070664_100063295
862 Ga0070664_100244388
863 Ga0068857_100025524
864 Ga0068857_100156167
865 Ga0068854_100009646
866 Ga0068854_100051567
867 Ga0068854_100276321
868 Ga0068856_100155468
869 Ga0070702_100000044
870 Ga0070702_100383870
871 Ga0068852_100010987
872 Ga0068852_100016518
873 Ga0068852_100145382
874 Ga0068852_100244848
875 Ga0068859_100001300
876 Ga0068859_100078456
877 Ga0068864_100012910
878 Ga0068864_100014523
879 Ga0068864_100018923
880 Ga0068864_100085126
881 Ga0068864_100169925
882 Ga0068864_100669566
883 Ga0068866_10003526
884 Ga0068866_10013812
885 Ga0068861_100004184
886 Ga0068861_100007315
887 Ga0068851_10042914
888 Ga0068870_10055426
889 Ga0068870_10101348
890 Ga0068863_100005834
891 Ga0068863_100186702
892 Ga0068863_100206013
893 Ga0068863_100310596
894 Ga0068858_100002456
895 Ga0068858_100011098
896 Ga0068858_100192689
897 Ga0068860_100003639
898 Ga0068860_100054973
899 Ga0068862_100008117
900 Ga0068862_100049614
901 Ga0081540_1052157
902 Ga0075365_10108790
903 Ga0075368_10001398
904 Ga0075368_10061595
905 Ga0075363_100019138
906 Ga0075363_100066151
907 Ga0075363_100113014
908 Ga0075364_10015334
909 Ga0070712_100000542
910 Ga0075362_10004710
911 Ga0075362_10039671
912 Ga0075362_10063374
913 Ga0075367_10000719
914 Ga0075367_10004162
915 Ga0075367_10053264
916 Ga0075369_10007483
917 Ga0075369_10034589
918 Ga0075366_10000433
919 Ga0075366_10000692
920 Ga0075366_10006450
921 Ga0075366_10008468
922 Ga0075366_10045005
923 Ga0075366_10057524
924 Ga0075366_10073765
925 Ga0075366_10073802
926 Ga0097621_100000206
927 Ga0097621_100011135
928 Ga0097621_100047371
929 Ga0097621_100115225
930 Ga0097621_100414866
931 Ga0097621_100704982
932 Ga0075370_10000630
933 Ga0075370_10001965
934 Ga0075370_10096089
935 Ga0075370_10104584
936 Ga0075370_10254754
937 Ga0068871_100002659
938 Ga0068871_100017010
939 Ga0068871_100108113
940 Ga0068871_100494928
941 Ga0068871_100685027
942 Ga0075428_100011133
943 Ga0075431_100005405
944 Ga0075431_100131687
945 Ga0075431_100364990
946 Ga0068865_100003163
947 Ga0068865_100018546
948 Ga0068865_100164906
949 Ga0068865_100274867
950 Ga0068865_100510389
951 Ga0097620_100001300
952 Ga0097620_100078455
953 Ga0105240_10568691
954 Ga0105240_11227873
955 Ga0111539_10052199
956 Ga0105245_10000224
957 Ga0105245_10073565
958 Ga0105245_10214392
959 Ga0105245_10302732
960 Ga0105245_11121643
961 Ga0105245_11228760
962 Ga0105243_10000035
963 Ga0105241_10039204
964 Ga0105242_10000300
965 Ga0105242_10029803
966 Ga0105242_10059220
967 Ga0105242_10203386
968 Ga0105248_10002156
969 Ga0105248_10081882
970 Ga0105248_10421040
971 Ga0105248_10503053
972 Ga0105237_10036062
973 Ga0105249_10003408
974 Ga0105249_10019263
975 Ga0105249_10258136
976 Ga0105239_10168455
977 Ga0105246_10217183
978 Ga0157371_10045140
979 Ga0157371_10159065
980 Ga0157374_11018531
981 Ga0157378_10000528
982 Ga0157378_10043792
983 Ga0157378_10748160
984 Ga0163162_10001541
985 Ga0163162_10332290
986 Ga0163162_10767333
987 Ga0157372_10181052
988 Ga0157375_10012176
989 Ga0157375_10018925
990 Ga0157375_10019017
991 Ga0157375_10050072
992 Ga0157375_10056809
993 Ga0157375_10426234
994 Ga0157375_10554192
995 Ga0157375_10654255
996 Ga0157375_10799726
997 Ga0163163_10483773
998 Ga0157380_10003331
999 Ga0157380_10015044
1000 Ga0157380_11004503
1001 Ga0157379_10005673
1002 Ga0157379_10236584
1003 Ga0157379_10237609
1004 Ga0157379_10881038
1005 Ga0157376_10001545
1006 Ga0157376_10100707
1007 Ga0157376_10390034
1008 Ga0182006_1010161
1009 Ga0183361_10018
1010 Ga0163161_10124373
1011 Ga0163161_10127703
1012 Ga0209436_102928
1013 Ga0209674_100005
1014 Ga0209563_101442
1015 Ga0207427_100585
1016 Ga0207425_1000138
1017 Ga0209759_1000116
1018 Ga0209129_1000023
1019 Ga0209129_1000558
1020 Ga0209233_1000016
1021 Ga0209565_1000403
1022 Ga0209673_1000673
1023 Ga0209130_1000222
1024 Ga0209675_1001282
1025 Ga0209025_1000476
1026 Ga0209564_1000898
1027 Ga0209758_1000064
1028 Ga0209256_1000115
1029 Ga0207426_1000001
1030 Ga0209051_1009885
1031 Ga0209257_1004838
1032 Ga0209257_1009341
1033 Ga0207697_10009076
1034 Ga0207697_10022600
1035 Ga0207656_10034176
1036 Ga0207653_10019074
1037 Ga0207682_10001208
1038 Ga0207682_10013431
1039 Ga0207682_10057811
1040 Ga0207682_10065418
1041 Ga0207692_10073454
1042 Ga0207642_10012940
1043 Ga0207688_10047993
1044 Ga0207688_10138451
1045 Ga0207688_10261423
1046 Ga0207680_10003102
1047 Ga0207680_10029489
1048 Ga0207647_10036172
1049 Ga0207645_10023008
1050 Ga0207643_10066164
1051 Ga0207643_10158957
1052 Ga0207705_10320680
1053 Ga0207684_10014463
1054 Ga0207684_10146887
1055 Ga0207654_10134837
1056 Ga0207707_10112338
1057 Ga0207695_10159154
1058 Ga0207695_10759071
1059 Ga0207663_10002606
1060 Ga0207660_10002869
1061 Ga0207662_10000091
1062 Ga0207662_10013340
1063 Ga0207657_10265475
1064 Ga0207649_10080186
1065 Ga0207649_10188762
1066 Ga0207652_10003794
1067 Ga0207652_10080613
1068 Ga0207681_10000867
1069 Ga0207681_10037451
1070 Ga0207681_10776979
1071 Ga0207650_10000348
1072 Ga0207650_10005681
1073 Ga0207650_10560698
1074 Ga0207659_10428334
1075 Ga0207687_10004949
1076 Ga0207687_10025209
1077 Ga0207687_10115320
1078 Ga0207687_10576341
1079 Ga0207700_10057930
1080 Ga0207644_10008149
1081 Ga0207644_10010462
1082 Ga0207644_10031499
1083 Ga0207644_10115554
1084 Ga0207690_10004966
1085 Ga0207706_10014863
1086 Ga0207706_10036246
1087 Ga0207706_10148888
1088 Ga0207706_10169285
1089 Ga0207706_10315366
1090 Ga0207686_10003132
1091 Ga0207686_10021291
1092 Ga0207709_10001029
1093 Ga0207709_10158404
1094 Ga0207670_10000774
1095 Ga0207670_10019384
1096 Ga0207669_10001910
1097 Ga0207669_10002355
1098 Ga0207704_10003275
1099 Ga0207704_10009899
1100 Ga0207704_10060414
1101 Ga0207665_10029809
1102 Ga0207665_10059496
1103 Ga0207691_10000295
1104 Ga0207691_10015654
1105 Ga0207691_10022033
1106 Ga0207691_10037825
1107 Ga0207691_10187964
1108 Ga0207689_10000024
1109 Ga0207689_10003225
1110 Ga0207689_10022925
1111 Ga0207661_10545536
1112 Ga0207679_10000351
1113 Ga0207679_10188161
1114 Ga0207679_10217141
1115 Ga0207679_10559036
1116 Ga0207667_10010005
1117 Ga0207651_10002646
1118 Ga0207651_10110651
1119 Ga0207651_10325193
1120 Ga0207712_10029541
1121 Ga0207712_10122364
1122 Ga0207712_10134769
1123 Ga0207668_10018787
1124 Ga0207668_10101911
1125 Ga0207640_10068600
1126 Ga0207640_10124921
1127 Ga0207640_10217362
1128 Ga0207658_10005567
1129 Ga0207658_10168947
1130 Ga0207658_10297130
1131 Ga0207658_10402036
1132 Ga0207677_10003352
1133 Ga0207677_10005133
1134 Ga0207677_10068181
1135 Ga0207677_10108581
1136 Ga0207703_10001562
1137 Ga0207703_10005063
1138 Ga0207703_11032654
1139 Ga0207678_10022605
1140 Ga0207678_10029346
1141 Ga0207678_10795914
1142 Ga0207708_10001013
1143 Ga0207708_10046879
1144 Ga0207708_10362386
1145 Ga0207708_10548368
1146 Ga0207641_10000655
1147 Ga0207641_10043195
1148 Ga0207641_10056301
1149 Ga0207641_10182166
1150 Ga0207641_10537789
1151 Ga0207641_10588292
1152 Ga0207648_10011156
1153 Ga0207648_10013762
1154 Ga0207648_10043003
1155 Ga0207648_10069702
1156 Ga0207648_10092783
1157 Ga0207648_10805508
1158 Ga0207676_10010337
1159 Ga0207676_10021293
1160 Ga0207676_10042838
1161 Ga0207676_10195217
1162 Ga0207676_10547032
1163 Ga0207676_10710769
1164 Ga0207674_10029844
1165 Ga0207674_10066286
1166 Ga0207674_10257185
1167 Ga0207674_11007446
1168 Ga0207675_100000017
1169 Ga0207675_100003971
1170 Ga0207675_100295986
1171 Ga0207683_10006162
1172 Ga0207683_10234591
1173 Ga0207683_10251806
1174 Ga0207698_10056943
1175 Ga0207698_10135282
1176 Ga0207698_10374771
1177 Ga0209813_10002666
1178 Ga0209813_10161412
1179 Ga0209974_10093295
1180 Ga0268266_10146485
1181 Ga0268265_10048795
1182 Ga0268264_10000894
1183 Ga0268264_10002476
1184 Ga0268264_10112124
1185 Ga0268264_10327215
1186 Ga0307517_10000173
1187 Ga0307517_10138331
1188 Ga0307515_10000020
1189 Ga0307515_10029773
1190 Ga0307515_10051089
1191 Ga0307512_10048466
1192 Ga0307513_10178997
1193 Ga0307513_10208759
1194 Ga0307513_10227999
1195 Ga0307509_10000181
1196 Ga0307509_10012589
1197 Ga0307509_10051820
1198 Ga0307509_10112446
1199 Ga0307509_10149623
1200 Ga0307408_100037568
1201 Ga0307408_100115995
1202 Ga0307408_100425479
1203 Ga0307408_100719495
1204 Ga0307508_10000738
1205 Ga0307508_10002185
1206 Ga0307508_10165733
1207 Ga0307508_10218087
1208 Ga0307514_10031063
1209 Ga0265314_10078587
1210 Ga0307516_10022146
1211 Ga0307516_10115763
1212 Ga0307516_10414481
1213 Ga0307518_10243995
1214 Ga0307410_10083613
1215 Ga0307406_10138162
1216 Ga0307412_10008460
1217 Ga0307412_10017958
1218 Ga0307412_10035177
1219 Ga0307412_10900306
1220 Ga0307409_100009443
1221 Ga0307409_100394563
1222 Ga0307416_100007862
1223 Ga0307416_100019108
1224 Ga0307416_100128797
1225 Ga0307414_10004315
1226 Ga0307414_10018239
1227 Ga0307414_10768663
1228 Ga0307411_10000784
1229 Ga0307411_10024010
1230 Ga0307411_10099712
1231 Ga0307415_100001229
1232 Ga0307415_100118645
1233 Ga0307507_10051750
1234 Ga0307510_10016350
1235 Ga0373951_0012625
1236 Ga0373936_0000050
1237 Ga0373956_0084298
1238 Ga0373960_0051125
1239 Ga0373942_0061219
1240 Ga0373961_0000068
1241 Ga0373931_0003263
1242 Ga0373927_0193867
1243 Ga0373947_0142682
1244 Ga0373937_0021310
1245 Ga0373925_0064745
1246 Ga0395905_0032190
1247 Ga0395905_0623530
1248 Ga0436365_1605944
1249 Ga0451789_0857723
1250 Ga0451789_0889476
1251 Ga0451795_0158256
1252 Ga0451843_0612255
1253 Ga0450898_026169
1254 Ga0450904_000668
1255 Ga0439458_0019926
1256 Ga0451577_0112257
1257 Ga0466972_0019726
1258 Ga0466965_0150986
1259 Ga0453684_0187181
1260 Ga0453684_0277615
1261 Ga0466970_0005760
1262 Ga0466959_0025801
1263 Ga0451576_0046906
1264 Ga0451576_0063689
1265 Ga0451576_0141636
1266 Ga0495592_0000234
1267 Ga0495603_0016020
1268 Ga0495603_0020702
1269 Ga0495590_0031657
1270 Ga0495590_0035189
1271 Ga0495590_0065367
1272 Ga0495629_0133971
1273 Ga0495629_0488751
1274 Ga0495653_0023490
1275 Ga0495653_0044953
1276 Ga0495580_0095536
1277 Ga0495580_0427600
1278 Ga0495582_0001868
1279 Ga0495605_0027067
1280 Ga0495662_0125072
1281 Ga0495664_0020817
1282 Ga0495596_0012627
1283 Ga0495596_0040974
1284 Ga0495606_0004374
1285 Ga0495608_0000783
1286 Ga0495616_0012621
1287 Ga0495618_0003896
1288 Ga0495620_0008574
1289 Ga0495620_0045651
1290 Ga0495628_0084402
1291 Ga0495628_0551383
1292 Ga0495630_0062336
1293 Ga0495632_0007387
1294 Ga0495648_0018879
1295 Ga0495648_0160938
1296 Ga0495642_0055159
1297 Ga0495652_0077789
1298 Ga0495665_0003847
1299 Ga0495665_0024410
1300 Ga0495640_0002521
1301 Ga0495587_0028690
1302 Ga0495609_0000001
1303 Ga0495597_0010864
1304 Ga0495645_0021548
1305 Ga0495622_0151968
1306 Ga0495633_0038222
1307 Ga0495633_0108447
1308 Ga0495634_0006776
1309 Ga0495625_0004650
1310 Ga0495625_0266764
1311 Ga0495625_0272101
1312 Ga0495625_0278536
1313 Ga0495635_0198430
1314 Ga0495635_0261827
1315 Ga0495657_0013813
1316 Ga0495623_0047824
1317 Ga0495646_0155225
1318 Ga0495646_0261702
1319 Ga0495647_0053852
1320 Ga0495658_0006924
1321 Ga0495658_0010311
1322 Ga0495624_0025837
1323 Ga0495624_0034457
1324 Ga0495649_0003263
1325 Ga0495649_0076677
1326 Ga0495600_0005081
1327 Ga0495660_0095334
1328 Ga0495581_0000476
1329 Ga0495604_0009661
1330 Ga0495636_0005540
1331 Ga0495674_0011341
1332 Ga0495674_0258412
1333 Ga0495672_0058888
1334 Ga0495672_0065492
1335 Ga0495672_0082877
1336 Ga0495676_0108692
1337 Ga0495680_0027282
1338 Ga0495680_0072850
1339 Ga0495683_0018406
1340 Ga0495683_0062655
1341 Ga0495683_0103988
1342 Ga0495687_000017
1343 Ga0495687_000558
1344 Ga0495687_007412
1345 Ga0495687_038586
1346 Ga0495675_0070045
1347 Ga0495677_0011639
1348 Ga0495673_0037840
1349 Ga0495684_0061587
1350 Ga0495686_0002539
1351 Ga0495686_0005323
1352 Ga0495593_0061768
1353 Ga0495593_0161392
1354 Ga0495602_0012748
1355 Ga0495602_0190446
1356 Ga0495614_0171144
1357 Ga0495626_0098702
1358 Ga0495626_0127024
1359 Ga0496100_0050797
1360 Ga0496101_0090890
1361 Ga0496101_0396883
1362 Ga0496103_0412298
1363 Ga0496104_0021622
1364 Ga0496104_0043884
1365 Ga0496104_0084231
1366 Ga0496105_0360097
1367 Ga0496105_0417589
1368 Ga0496106_0548680
1369 Ga0496107_0344759
1370 Ga0496108_0289166
1371 Ga0496109_0065289
1372 Ga0496109_0594364
1373 Ga0496110_0286526
1374 Ga0496110_0424676
1375 Ga0496112_0938487
1376 Ga0496114_0084657
1377 Ga0496114_0272919
1378 Ga0496114_0481460
1379 Ga0496121_0008585
1380 Ga0496121_0180937
1381 Ga0496121_0449215
1382 Ga0496126_0046519
1383 Ga0496126_0259741
1384 Ga0501308_015231
1385 Ga0495678_063820
1386 Ga0501294_003038
1387 Ga0501312_021665
1388 Ga0501320_008201
1389 Ga0501206_005762
1390 Ga0501249_057619
1391 Ga0501264_006923
1392 Ga0501265_005475
1393 nmdc:mga03683_166400_c1
1394 nmdc:mga03683_59991_c1
1395 nmdc:mga03n38_117538_c1
1396 nmdc:mga03n38_29692_c1
1397 nmdc:mga03n38_71024_c1
1398 nmdc:mga0yw44_70526_c1
1399 nmdc:mga0k408_103658_c1
1400 nmdc:mga0k408_25745_c1
1401 nmdc:mga0k408_37640_c1
1402 nmdc:mga0k408_42431_c1
1403 nmdc:mga0k408_489_c1
1404 nmdc:mga0k408_5725_c1
1405 nmdc:mga0k408_917_c1
1406 nmdc:mga0k408_973_c1
1407 nmdc:mga06z11_108151_c1
1408 nmdc:mga06z11_181855_c1
1409 nmdc:mga04h51_187514_c1
1410 nmdc:mga07m45_118356_c1
1411 nmdc:mga07m45_118789_c1
1412 nmdc:mga07m45_153680_c1
1413 nmdc:mga07m45_42_c1
1414 nmdc:mga07m45_432_c1
1415 nmdc:mga09592_483106_c1
1416 nmdc:mga06r32_478_c1
1417 nmdc:mga0sz30_32613_c1
1418 Ga0495619_0018128
1419 Ga0500578_0000007
1420 Ga0500578_0134274
1421 Ga0500583_0014265
1422 Ga0500583_0030996
1423 Ga0500651_0012641
1424 Ga0500651_0130538
1425 Ga0500594_0003527
1426 Ga0500614_051060
1427 Ga0500642_0052104
1428 Ga0500655_007485
1429 Ga0500658_0004006
1430 Ga0500559_0000061
1431 Ga0500568_0020120
1432 Ga0500568_0020375
1433 Ga0500616_0005720
1434 Ga0500622_0049627
1435 Ga0500645_005656
1436 Ga0500587_002373
1437 2501069545
1438 2501081416
1439 2501411185
1440 2511089186
1441 2511100171
1442 2511104160
1443 2516023625
1444 2563062400
1445 2644304079
1446 2713477743
1447 2739057153
1448 2748015602
1449 2808983182
1450 2809128402
1451 2809148023
1452 2842330150
1453 2842356807
1454 2842457734
1455 2842682838
1456 2852620562
1457 2856293891
1458 2857361907
1459 2883093969
1460 2895513853
1461 2904484298
1462 2919530242
1463 8055266376
1464 8055306290

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF17954

Pirin_C_2

Quercetinase C-terminal cupin domain

192

277

0.99

PF02678

Pirin

Pirin

42

165

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9774 1 232
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9747 1 231
1tq5-assembly1.cif.gz_A crystal structure of yhhw from escherichia coli 0.9609 1 232
6uts-assembly1.cif.gz_A crystal structure of bacterial pirin yhhw in complex with nickel(ii) from escherichia coli 0.9581 1 231
4oi2-assembly1.cif.gz_A c. elegans clp1 and adp and mg2+ (turnover state) 0.8475 165 228
ID Description Score Start End Superfamily
af_P9WI85_16_135_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.994 13 131 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9878 11 135 2.60.120.10
af_P46852_133_231_2.60.120.10 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9838 144 231 2.60.120.10
1tq5A02 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9797 11 135 2.60.120.10
1tq5A01 Mainly Beta;Sandwich;Jelly Rolls;Jelly Rolls 0.9785 142 232 2.60.120.10
ID Description Score Start End GO Terms
AF-A0A059WJ16-F1-model_v4 Pirin 1 1 232 GO:0046872
AF-A0A3D6EKF5-F1-model_v4 Quercetin 2,3-dioxygenase 0.9994 1 232 GO:0046872
GO:0051213
AF-A0A2W7A1N5-F1-model_v4 Quercetin 2,3-dioxygenase 0.9989 1 231 GO:0046872
GO:0051213
AF-A0A2H1PM95-F1-model_v4 deleted 0.9989 1 183
AF-A7HDG4-F1-model_v4 Pirin domain protein 0.9985 1 232

Map