F478028

General Info

Members Datasets Scaffolds Average Seq Length
732 412 640 201

Family's Representative Sequence

Representative Sequence 3300009036|Ga0105244_10122364|Ga0105244_101223641
Length 215
Sequence MAAVQSRKPRFHCLVAGSYWSQNMKVVAFERNLQGTGASRRLRNSGKTPGIVYGADKEVQLVELDHNALWHALKKEVFHSSILDLEVGGKSQPVLLRDVQYHPFKQMVLHVDFQRVDPKKKLHTKVPLXFMVINELEVECLPGDLPEFLEIDLAKIEAGQTMHAKDIVLPKGVALVAHVEAENPVIASATIPAAGVSDAATGGXXXTGEGETPAA

Samples

Sample ID Description Type Environment
1 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
2 2501025502 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510917013 Paraburkholderia unamae MTI-641 Isolate Rhizosphere
7 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
8 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
9 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
10 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
11 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
12 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
13 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
14 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
15 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
16 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
17 2519103095 Burkholderia sp. KJ006 Isolate Nodule
18 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
19 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
20 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
21 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
22 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
23 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
24 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
25 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
26 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
27 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
28 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
29 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
30 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
31 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
32 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
33 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
34 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
35 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
36 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
37 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
38 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
39 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
40 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
41 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
42 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
43 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
44 2818991450 Burkholderia sp. 604 Isolate Unclassified
45 2818991452 Burkholderia cepacia 561 Isolate Unclassified
46 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
47 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
48 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
49 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
50 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
51 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
52 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
53 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
54 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
55 2894023352 Diaphorobacter ruginosibacter DSM 27467 Isolate Nodule
56 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
57 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
58 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
59 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
60 2904564687 Burkholderia sp. 571 Isolate Unclassified
61 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
62 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
63 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
64 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
65 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
66 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
67 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
68 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
69 2928163908 Burkholderia sp. 567 Isolate Unclassified
70 2928170801 Burkholderia sp. 572 Isolate Unclassified
71 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
72 2928536128 Burkholderia sola 565 Isolate Unclassified
73 2939631187 Ottowia thiooxydans 2709 Isolate Rhizosphere
74 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
75 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
76 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
77 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
78 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
79 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
80 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
81 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
82 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
83 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
84 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
85 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
86 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
87 3300003479 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
88 3300003565 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
89 3300003567 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
90 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
91 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
92 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
93 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
94 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
95 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
96 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
97 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
98 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
99 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
100 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
101 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
102 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
103 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
104 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
105 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
106 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
107 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
108 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
109 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
110 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
111 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
112 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
113 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
114 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
115 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
116 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
117 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
118 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
119 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
120 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
123 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
124 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
125 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
126 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
127 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
128 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
129 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
130 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
131 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
132 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
133 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
134 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
135 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
136 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
137 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
138 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
139 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
140 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
141 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
142 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
143 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
144 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
145 3300019179 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
146 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
147 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
148 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
149 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
150 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
151 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
152 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
153 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
154 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
155 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
156 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
157 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
158 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
159 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
160 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
161 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
162 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
163 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
164 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
165 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
166 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
167 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
168 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
169 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
196 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
198 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
199 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
200 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
201 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
202 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
206 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
207 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
208 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
209 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
210 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
211 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
212 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
213 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
214 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
215 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
216 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
217 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
218 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
221 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
222 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
223 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
224 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
225 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
226 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
227 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
228 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
229 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
230 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
231 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
232 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
233 3300042119 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 Metagenome Rhizosphere
234 3300042129 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 Metagenome Rhizosphere
235 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
236 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
237 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
238 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
239 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
240 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
241 3300044666 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E Metagenome Unclassified
242 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
243 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
244 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
245 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
246 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
247 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
248 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
249 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
250 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
251 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
252 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
253 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
257 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
258 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
259 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
260 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
261 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
262 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
263 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
264 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
265 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
273 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
274 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
275 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
276 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
277 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
278 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
279 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
280 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
287 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
288 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
289 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
290 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
291 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
292 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
295 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
296 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
297 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
307 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
308 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
311 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
312 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
313 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
314 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
315 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
316 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
317 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
323 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
324 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
325 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
326 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
327 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
328 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
329 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
330 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
331 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
332 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
333 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
346 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
347 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
348 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
349 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
350 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
351 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
352 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
353 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
354 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
355 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
356 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
357 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
358 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
359 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
361 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
362 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
367 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
368 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
369 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
370 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
371 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
373 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
374 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
375 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
386 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
387 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
388 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
389 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
390 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
391 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
393 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
394 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
396 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
397 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
398 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
399 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
400 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
401 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
402 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
403 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
404 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
405 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
406 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
407 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
408 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
409 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
410 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
411 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
412 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 81.01
Metatranscriptomes 6.42
Isolates 12.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.28
Nodule 2.87
Rhizoplane 6.01
Rhizosphere 72.54
Stem 0
Stem Tuber 0
Unclassified 12.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1032396 3300001904 Bacteria 807
2 JGI24741J21665_1020862 3300001915 Bacteria 1027
3 JGI24740J21852_10000889 3300001979 Bacteria 13228
4 JGI24740J21852_10008433 3300001979 Bacteria 4105
5 JGI24740J21852_10086375 3300001979 Bacteria 814
6 JGI24739J22299_10010650 3300001989 Bacteria 3410
7 JGI24739J22299_10015759 3300001989 Bacteria 2745
8 JGI24739J22299_10017997 3300001989 Bacteria 2543
9 JGI24739J22299_10053645 3300001989 Bacteria 1294
10 JGI24735J21928_10002039 3300002067 Bacteria 7116
11 JGI24735J21928_10002083 3300002067 Bacteria 7050
12 JGI24735J21928_10010740 3300002067 Bacteria 2912
13 JGI24738J21930_10004015 3300002075 Bacteria 3651
14 JGI25156J39149_1017091 3300002705 Bacteria 1387
15 JGI25164J39214_1006160 3300002772 Bacteria 1269
16 JGI25165J46597_1001028 3300003214 Bacteria 18325
17 JGI25160J50197_1000049 3300003354 Bacteria 135107
18 Ga0006556J51387_1023789 3300003479 Bacteria 2348
19 Ga0006560J51390_1025002 3300003565 Bacteria 887
20 Ga0006554J51385_1022490 3300003567 Bacteria 2297
21 Ga0007409J51694_1053338 3300003575 Bacteria 832
22 Ga0007429J51699_1109854 3300003579 Bacteria 690
23 Ga0055532_1000031 3300003758 Bacteria 231440
24 Ga0055532_1002498 3300003758 Bacteria 3767
25 Ga0055527_1000020 3300003760 Bacteria 231441
26 Ga0055535_1000023 3300003761 Bacteria 231441
27 Ga0055542_1000035 3300003762 Bacteria 231441
28 Ga0055529_1000039 3300003763 Bacteria 231439
29 Ga0055528_1007923 3300003790 Bacteria 4631
30 Ga0055541_1004892 3300003841 Bacteria 2391
31 Ga0058692_1002184 3300003856 Bacteria 6680
32 Ga0058692_1023236 3300003856 Bacteria 1263
33 Ga0058692_1031587 3300003856 Bacteria 995
34 Ga0058860_11979007 3300004801 Bacteria 1585
35 Ga0065165_1000115 3300005262 Bacteria 135145
36 Ga0070658_10006938 3300005327 Bacteria 9149
37 Ga0070658_10106790 3300005327 Bacteria 2317
38 Ga0070658_10576092 3300005327 Bacteria 975
39 Ga0070666_10008389 3300005335 Bacteria 6415
40 Ga0070682_100115336 3300005337 Bacteria 1796
41 Ga0070682_100200310 3300005337 Bacteria 1408
42 Ga0070660_100001282 3300005339 Bacteria 17122
43 Ga0070660_100002463 3300005339 Bacteria 12700
44 Ga0070660_100011683 3300005339 Bacteria 6252
45 Ga0070673_100347238 3300005364 Bacteria 1316
46 Ga0070659_100000941 3300005366 Bacteria 21399
47 Ga0070659_100179926 3300005366 Bacteria 1735
48 Ga0070667_100027191 3300005367 Bacteria 4760
49 Ga0070663_100000078 3300005455 Bacteria 42943
50 Ga0070663_100009378 3300005455 Bacteria 6058
51 Ga0070663_100402753 3300005455 Bacteria 1119
52 Ga0070678_100100674 3300005456 Bacteria 2239
53 Ga0070678_100282507 3300005456 Bacteria 1404
54 Ga0068855_100002204 3300005563 Bacteria 24094
55 Ga0068855_100002445 3300005563 Bacteria 22936
56 Ga0068855_100022812 3300005563 Bacteria 7500
57 Ga0068855_100024592 3300005563 Bacteria 7205
58 Ga0070664_100018288 3300005564 Bacteria 5754
59 Ga0068857_100659944 3300005577 Bacteria 992
60 Ga0068856_100798596 3300005614 Bacteria 963
61 Ga0068852_100209858 3300005616 Bacteria 1847
62 Ga0068852_100912191 3300005616 Bacteria 896
63 Ga0068862_100547741 3300005844 Bacteria 1104
64 Ga0070717_10389748 3300006028 Bacteria 1250
65 Ga0075365_10165942 3300006038 Bacteria 1540
66 Ga0075363_100376705 3300006048 Bacteria 831
67 Ga0075366_10109254 3300006195 Bacteria 1663
68 Ga0075370_10000918 3300006353 Bacteria 12102
69 Ga0105251_10000055 3300009011 Bacteria 105044
70 Ga0105251_10000494 3300009011 Bacteria 37324
71 Ga0105244_10056688 3300009036 Bacteria 1982
72 Ga0105244_10122364 3300009036 Bacteria 1259
73 Ga0105250_10001544 3300009092 Bacteria 12364
74 Ga0105240_10002069 3300009093 Bacteria 32881
75 Ga0105240_10109589 3300009093 Bacteria 3343
76 Ga0105240_10143016 3300009093 Bacteria 2858
77 Ga0105240_10187322 3300009093 Bacteria 2436
78 Ga0105245_10578174 3300009098 Bacteria 1148
79 Ga0105248_10038843 3300009177 Bacteria 5329
80 Ga0105237_10003905 3300009545 Bacteria 17477
81 Ga0105237_10014560 3300009545 Bacteria 8218
82 Ga0105237_10205269 3300009545 Bacteria 1971
83 Ga0105237_11256959 3300009545 Bacteria 747
84 Ga0105238_10011579 3300009551 Bacteria 8887
85 Ga0105238_10028874 3300009551 Bacteria 5649
86 Ga0105238_10110806 3300009551 Bacteria 2725
87 Ga0105238_10159615 3300009551 Bacteria 2230
88 Ga0105249_10426684 3300009553 Bacteria 1361
89 Ga0105239_10507765 3300010375 Bacteria 1371
90 Ga0105239_10796970 3300010375 Bacteria 1082
91 Ga0157373_10050130 3300013100 Bacteria 2974
92 Ga0157373_10050698 3300013100 Bacteria 2955
93 Ga0157371_10007924 3300013102 Bacteria 8524
94 Ga0157370_10002906 3300013104 Bacteria 20425
95 Ga0157370_10219901 3300013104 Bacteria 1759
96 Ga0157370_10583055 3300013104 Bacteria 1024
97 Ga0157369_10000089 3300013105 Bacteria 127323
98 Ga0157369_10029387 3300013105 Bacteria 6074
99 Ga0157369_10133483 3300013105 Bacteria 2630
100 Ga0157374_10000230 3300013296 Bacteria 51820
101 Ga0157374_10013236 3300013296 Bacteria 7197
102 Ga0163162_10010537 3300013306 Bacteria 8991
103 Ga0163162_10380794 3300013306 Bacteria 1544
104 Ga0163162_11534499 3300013306 Bacteria 759
105 Ga0157372_10003271 3300013307 Bacteria 17509
106 Ga0157372_10103727 3300013307 Bacteria 3250
107 Ga0157372_10127335 3300013307 Bacteria 2928
108 Ga0157375_10178118 3300013308 Bacteria 2277
109 Ga0157375_10725796 3300013308 Bacteria 1146
110 Ga0182008_10027051 3300014497 Bacteria 2907
111 Ga0182008_10096766 3300014497 Bacteria 1457
112 Ga0182006_1061327 3300015261 Bacteria 1418
113 Ga0182006_1072622 3300015261 Bacteria 1272
114 Ga0182007_10001847 3300015262 Bacteria 11039
115 Ga0182007_10008215 3300015262 Bacteria 4301
116 Ga0182007_10086619 3300015262 Bacteria 1030
117 Ga0182005_1004296 3300015265 Bacteria 4633
118 Ga0183362_10005 3300015683 Bacteria 437616
119 Ga0184593_111152 3300019179 Bacteria 806
120 Ga0197907_11221094 3300020069 Bacteria 1076
121 Ga0197907_11270793 3300020069 Bacteria 995
122 Ga0206356_11658874 3300020070 Bacteria 1752
123 Ga0206349_1238021 3300020075 Bacteria 1000
124 Ga0206355_1492387 3300020076 Bacteria 2227
125 Ga0206352_10995492 3300020078 Bacteria 1902
126 Ga0206353_10800542 3300020082 Bacteria 1871
127 Ga0224712_10000007 3300022467 Bacteria 29755
128 Ga0209566_100164 3300025225 Bacteria 73577
129 Ga0209674_101938 3300025226 Bacteria 4851
130 Ga0209672_100001 3300025228 Bacteria 2828210
131 Ga0209672_100046 3300025228 Bacteria 264244
132 Ga0209672_100088 3300025228 Bacteria 121401
133 Ga0209672_100289 3300025228 Bacteria 35192
134 Ga0209147_100001 3300025229 Bacteria 2384371
135 Ga0209147_100043 3300025229 Bacteria 300460
136 Ga0209147_100130 3300025229 Bacteria 121401
137 Ga0209147_100214 3300025229 Bacteria 60481
138 Ga0209563_101354 3300025230 Bacteria 6650
139 Ga0207427_100478 3300025231 Bacteria 21607
140 Ga0209258_100001 3300025242 Bacteria 2384269
141 Ga0209258_100023 3300025242 Bacteria 547286
142 Ga0209258_100204 3300025242 Bacteria 121401
143 Ga0209148_1000003 3300025254 Bacteria 2384288
144 Ga0209148_1000029 3300025254 Bacteria 579199
145 Ga0209759_1000037 3300025256 Bacteria 259200
146 Ga0209759_1000175 3300025256 Bacteria 106788
147 Ga0209759_1000649 3300025256 Bacteria 32356
148 Ga0209759_1003128 3300025256 Bacteria 6767
149 Ga0209759_1007337 3300025256 Bacteria 3558
150 Ga0209233_1000123 3300025261 Bacteria 228400
151 Ga0209565_1018119 3300025263 Bacteria 1529
152 Ga0209455_1000001 3300025272 Bacteria 2384278
153 Ga0209455_1000064 3300025272 Bacteria 332404
154 Ga0209673_1000084 3300025273 Bacteria 215878
155 Ga0209130_1027198 3300025284 Bacteria 1218
156 Ga0209564_1002711 3300025295 Bacteria 13373
157 Ga0209564_1007255 3300025295 Bacteria 5759
158 Ga0207426_1000007 3300025302 Bacteria 971011
159 Ga0207426_1003361 3300025302 Bacteria 8780
160 Ga0207696_1005257 3300025711 Bacteria 5400
161 Ga0207713_1000089 3300025735 Bacteria 152927
162 Ga0207713_1000106 3300025735 Bacteria 137911
163 Ga0207713_1031275 3300025735 Bacteria 2355
164 Ga0207680_10010657 3300025903 Bacteria 4609
165 Ga0207647_10000161 3300025904 Bacteria 52943
166 Ga0207647_10001999 3300025904 Bacteria 15600
167 Ga0207647_10011776 3300025904 Bacteria 6117
168 Ga0207705_10000452 3300025909 Bacteria 35262
169 Ga0207705_10112980 3300025909 Bacteria 2008
170 Ga0207705_10325384 3300025909 Bacteria 1182
171 Ga0207695_10005494 3300025913 Bacteria 16777
172 Ga0207695_10008360 3300025913 Bacteria 12965
173 Ga0207695_10032748 3300025913 Bacteria 5683
174 Ga0207695_10100894 3300025913 Bacteria 2881
175 Ga0207695_10327799 3300025913 Bacteria 1420
176 Ga0207671_10008949 3300025914 Bacteria 8425
177 Ga0207671_10010980 3300025914 Bacteria 7417
178 Ga0207671_10137737 3300025914 Bacteria 1878
179 Ga0207671_10294312 3300025914 Bacteria 1282
180 Ga0207660_10151402 3300025917 Bacteria 1782
181 Ga0207657_10000022 3300025919 Bacteria 154101
182 Ga0207657_10021113 3300025919 Bacteria 6135
183 Ga0207657_10037495 3300025919 Bacteria 4327
184 Ga0207657_10067166 3300025919 Bacteria 3050
185 Ga0207694_10051653 3300025924 Bacteria 3186
186 Ga0207687_10432405 3300025927 Bacteria 1088
187 Ga0207644_10617556 3300025931 Bacteria 901
188 Ga0207690_10000010 3300025932 Bacteria 330298
189 Ga0207690_10142514 3300025932 Bacteria 1768
190 Ga0207669_10847820 3300025937 Bacteria 760
191 Ga0207711_10220466 3300025941 Bacteria 1735
192 Ga0207679_10056462 3300025945 Bacteria 2899
193 Ga0207667_10000701 3300025949 Bacteria 43431
194 Ga0207667_10018019 3300025949 Bacteria 7930
195 Ga0207667_10052254 3300025949 Bacteria 4305
196 Ga0207667_10506810 3300025949 Bacteria 1224
197 Ga0207651_10060430 3300025960 Bacteria 2631
198 Ga0207658_10029361 3300025986 Bacteria 3883
199 Ga0207703_10212184 3300026035 Bacteria 1727
200 Ga0207639_10561412 3300026041 Bacteria 1049
201 Ga0207678_10000226 3300026067 Bacteria 50299
202 Ga0207678_10014828 3300026067 Bacteria 6857
203 Ga0207678_10044383 3300026067 Bacteria 3846
204 Ga0207678_10155596 3300026067 Bacteria 1952
205 Ga0207702_10418981 3300026078 Bacteria 1295
206 Ga0207674_10397010 3300026116 Bacteria 1333
207 Ga0207683_10126389 3300026121 Bacteria 2298
208 Ga0207698_10087208 3300026142 Bacteria 2541
209 Ga0209371_1000160 3300027312 Bacteria 103642
210 Ga0209371_1001668 3300027312 Bacteria 14222
211 Ga0209971_1002743 3300027682 Bacteria 4207
212 Ga0209974_10013617 3300027876 Bacteria 2709
213 Ga0265318_10061967 3300028577 Bacteria 1393
214 Ga0307515_10000040 3300028794 Bacteria 322704
215 Ga0265338_10000133 3300028800 Bacteria 136570
216 Ga0268256_1000132 3300030500 Bacteria 103642
217 Ga0268256_1001457 3300030500 Bacteria 14207
218 Ga0265767_105182 3300030836 Bacteria 786
219 Ga0265766_1000743 3300030863 Bacteria 1471
220 Ga0265769_104049 3300030888 Bacteria 841
221 Ga0265332_10000028 3300031238 Bacteria 184029
222 Ga0265320_10079453 3300031240 Bacteria 1533
223 Ga0265325_10001397 3300031241 Bacteria 17039
224 Ga0307408_100001314 3300031548 Bacteria 18632
225 Ga0265314_10000054 3300031711 Bacteria 184029
226 Ga0265314_10001337 3300031711 Bacteria 27913
227 Ga0307405_10024361 3300031731 Bacteria 3456
228 Ga0307405_10178379 3300031731 Bacteria 1523
229 Ga0307412_10000014 3300031911 Bacteria 353795
230 Ga0307409_100070534 3300031995 Bacteria 2774
231 Ga0307416_100582390 3300032002 Bacteria 1196
232 Ga0316583_10000293 3300032133 Bacteria 14030
233 Ga0395899_0000031 3300037312 Bacteria 322356
234 Ga0395899_0041658 3300037312 Bacteria 3431
235 Ga0395899_0050724 3300037312 Bacteria 3081
236 Ga0395899_0146951 3300037312 Bacteria 1673
237 Ga0395900_0000057 3300037418 Bacteria 212535
238 Ga0395900_0000158 3300037418 Bacteria 112053
239 Ga0395900_0036214 3300037418 Bacteria 5086
240 Ga0395900_0038341 3300037418 Bacteria 4938
241 Ga0395900_0105733 3300037418 Bacteria 2891
242 Ga0395900_0118493 3300037418 Bacteria 2717
243 Ga0395900_0283691 3300037418 Bacteria 1647
244 Ga0395898_0000040 3300037466 Bacteria 317329
245 Ga0395898_0005183 3300037466 Bacteria 14097
246 Ga0395898_0007346 3300037466 Bacteria 11695
247 Ga0395898_0023156 3300037466 Bacteria 6278
248 Ga0395898_0077260 3300037466 Bacteria 3214
249 Ga0395898_0383212 3300037466 Bacteria 1341
250 Ga0395905_0000014 3300037471 Bacteria 394209
251 Ga0395905_0018267 3300037471 Bacteria 6657
252 Ga0395905_0116681 3300037471 Bacteria 2509
253 Ga0395905_0134600 3300037471 Bacteria 2324
254 Ga0395905_0437596 3300037471 Bacteria 1205
255 Ga0395901_0001107 3300038443 Bacteria 28663
256 Ga0395901_0001810 3300038443 Bacteria 22075
257 Ga0395901_0004171 3300038443 Bacteria 14590
258 Ga0395901_0056623 3300038443 Bacteria 4078
259 Ga0395901_0155248 3300038443 Bacteria 2404
260 Ga0395901_0245392 3300038443 Bacteria 1867
261 Ga0395901_0754943 3300038443 Bacteria 965
262 Ga0436361_0762421 3300039447 Bacteria 1842
263 Ga0439438_055437 3300041405 Bacteria 1000
264 Ga0439447_033256 3300041407 Bacteria 1286
265 Ga0439466_0022944 3300041411 Bacteria 2198
266 Ga0439465_0000277 3300041413 Bacteria 14344
267 Ga0439433_0001048 3300041999 Bacteria 5613
268 Ga0439442_024900 3300042002 Bacteria 1245
269 Ga0439445_0000763 3300042004 Bacteria 6751
270 Ga0439448_0000242 3300042005 Bacteria 11681
271 Ga0439432_001936 3300042006 Bacteria 7821
272 Ga0439449_0000120 3300042007 Bacteria 25953
273 Ga0439452_002310 3300042010 Bacteria 7105
274 Ga0439457_056205 3300042014 Bacteria 887
275 Ga0450915_002349 3300042119 Bacteria 983
276 Ga0450891_005582 3300042129 Bacteria 1163
277 Ga0450903_015969 3300042138 Bacteria 1180
278 Ga0439434_0032164 3300042435 Bacteria 1596
279 Ga0439434_0068203 3300042435 Bacteria 1117
280 Ga0439459_0073835 3300042438 Bacteria 794
281 Ga0450893_0018651 3300042532 Bacteria 1183
282 Ga0466969_0000396 3300044656 Bacteria 23866
283 Ga0466969_0011439 3300044656 Bacteria 4698
284 Ga0466969_0145172 3300044656 Bacteria 1095
285 Ga0466972_0051825 3300044658 Bacteria 1979
286 Ga0466972_0109688 3300044658 Bacteria 1304
287 Ga0466977_0000098 3300044666 Bacteria 18255
288 Ga0453683_0145506 3300044673 Bacteria 1496
289 Ga0453683_0390378 3300044673 Bacteria 897
290 Ga0466965_0000909 3300044683 Bacteria 11333
291 Ga0466965_0043811 3300044683 Bacteria 2210
292 Ga0466965_0078936 3300044683 Bacteria 1662
293 Ga0466965_0222614 3300044683 Bacteria 1006
294 Ga0466966_0000006 3300044684 Bacteria 179770
295 Ga0466966_0000265 3300044684 Bacteria 34719
296 Ga0466966_0033167 3300044684 Bacteria 3343
297 Ga0466966_0048187 3300044684 Bacteria 2715
298 Ga0466966_0185756 3300044684 Bacteria 1260
299 Ga0466961_0000989 3300044693 Bacteria 17560
300 Ga0466961_0014170 3300044693 Bacteria 5116
301 Ga0466961_0019264 3300044693 Bacteria 4391
302 Ga0466961_0067405 3300044693 Bacteria 2273
303 Ga0466961_0074687 3300044693 Bacteria 2149
304 Ga0466961_0106695 3300044693 Bacteria 1763
305 Ga0466963_0000828 3300044694 Bacteria 15502
306 Ga0466963_0001975 3300044694 Bacteria 11261
307 Ga0466963_0006961 3300044694 Bacteria 6730
308 Ga0466964_0002065 3300044706 Bacteria 7067
309 Ga0466964_0026561 3300044706 Bacteria 2267
310 Ga0466971_0003814 3300044719 Bacteria 6450
311 Ga0466971_0007013 3300044719 Bacteria 4905
312 Ga0466971_0103264 3300044719 Bacteria 1311
313 Ga0466968_0043784 3300044735 Bacteria 1896
314 Ga0466968_0062794 3300044735 Bacteria 1605
315 Ga0466970_0009250 3300044765 Bacteria 4973
316 Ga0466970_0014867 3300044765 Bacteria 4000
317 Ga0466970_0099096 3300044765 Bacteria 1586
318 Ga0466957_0016747 3300044842 Bacteria 4287
319 Ga0466957_0034949 3300044842 Bacteria 3015
320 Ga0466957_0067358 3300044842 Bacteria 2208
321 Ga0466957_0068577 3300044842 Bacteria 2190
322 Ga0466957_0226919 3300044842 Bacteria 1235
323 Ga0466960_0027899 3300044901 Bacteria 2580
324 Ga0466960_0029954 3300044901 Bacteria 2501
325 Ga0466959_0031486 3300045049 Bacteria 3923
326 Ga0466959_0080461 3300045049 Bacteria 2348
327 Ga0466959_0088349 3300045049 Bacteria 2228
328 Ga0466959_0095125 3300045049 Bacteria 2136
329 Ga0466959_0253906 3300045049 Bacteria 1212
330 Ga0466958_0000920 3300045836 Bacteria 13233
331 Ga0466958_0060887 3300045836 Bacteria 2298
332 Ga0466958_0066342 3300045836 Bacteria 2203
333 Ga0466958_0083118 3300045836 Bacteria 1973
334 Ga0466967_0313178 3300045976 Bacteria 1512
335 Ga0466967_0430688 3300045976 Bacteria 1287
336 Ga0466967_0508282 3300045976 Bacteria 1183
337 Ga0466967_0849871 3300045976 Bacteria 907
338 Ga0495603_0016288 3300046455 Bacteria 4499
339 Ga0495603_0024167 3300046455 Bacteria 3674
340 Ga0495603_0247004 3300046455 Bacteria 1027
341 Ga0495590_0014919 3300046457 Bacteria 2830
342 Ga0495590_0018763 3300046457 Bacteria 2474
343 Ga0495590_0020946 3300046457 Bacteria 2320
344 Ga0495590_0033229 3300046457 Bacteria 1804
345 Ga0495591_000791 3300046458 Bacteria 22446
346 Ga0495591_005442 3300046458 Bacteria 5902
347 Ga0495629_0001348 3300046459 Bacteria 19354
348 Ga0495629_0003125 3300046459 Bacteria 12552
349 Ga0495629_0027184 3300046459 Bacteria 4064
350 Ga0495629_0033751 3300046459 Bacteria 3619
351 Ga0495638_0004867 3300046460 Bacteria 10106
352 Ga0495638_0012178 3300046460 Bacteria 5905
353 Ga0495641_0013831 3300046461 Bacteria 4402
354 Ga0495651_0201333 3300046462 Bacteria 1393
355 Ga0495653_0112901 3300046463 Bacteria 1949
356 Ga0495653_0311867 3300046463 Bacteria 1022
357 Ga0495650_0002161 3300046471 Bacteria 16666
358 Ga0495650_0014347 3300046471 Bacteria 4130
359 Ga0495580_0007525 3300046472 Bacteria 8746
360 Ga0495580_0024823 3300046472 Bacteria 4383
361 Ga0495580_0034640 3300046472 Bacteria 3634
362 Ga0495582_0022261 3300046473 Bacteria 3468
363 Ga0495605_0001100 3300046474 Bacteria 17990
364 Ga0495605_0002292 3300046474 Bacteria 11951
365 Ga0495605_0002952 3300046474 Bacteria 10296
366 Ga0495605_0014364 3300046474 Bacteria 4340
367 Ga0495662_0024459 3300046476 Bacteria 2914
368 Ga0495664_0000322 3300046477 Bacteria 23081
369 Ga0495664_0016121 3300046477 Bacteria 4255
370 Ga0495664_0032119 3300046477 Bacteria 3079
371 Ga0495664_0171882 3300046477 Bacteria 1314
372 Ga0495584_0107186 3300046491 Bacteria 1413
373 Ga0495584_0231350 3300046491 Bacteria 940
374 Ga0495585_0144608 3300046492 Bacteria 1243
375 Ga0495596_0006565 3300046500 Bacteria 5338
376 Ga0495596_0022942 3300046500 Bacteria 2536
377 Ga0495607_0096904 3300046501 Bacteria 1587
378 Ga0495583_0005045 3300046506 Bacteria 9123
379 Ga0495583_0048668 3300046506 Bacteria 1944
380 Ga0495606_0005895 3300046507 Bacteria 11527
381 Ga0495606_0010464 3300046507 Bacteria 7692
382 Ga0495608_0063287 3300046511 Bacteria 2428
383 Ga0495610_0041979 3300046512 Bacteria 2291
384 Ga0495610_0129169 3300046512 Bacteria 1099
385 Ga0495616_0026456 3300046513 Bacteria 3088
386 Ga0495618_0011397 3300046514 Bacteria 5391
387 Ga0495620_0050120 3300046515 Bacteria 1783
388 Ga0495620_0052476 3300046515 Bacteria 1731
389 Ga0495628_0002241 3300046516 Bacteria 17484
390 Ga0495628_0066576 3300046516 Bacteria 2815
391 Ga0495628_0101891 3300046516 Bacteria 2215
392 Ga0495628_0180987 3300046516 Bacteria 1594
393 Ga0495630_0035456 3300046517 Bacteria 3728
394 Ga0495630_0061353 3300046517 Bacteria 2823
395 Ga0495630_0119088 3300046517 Bacteria 2002
396 Ga0495630_0131539 3300046517 Bacteria 1900
397 Ga0495631_0126571 3300046518 Bacteria 1098
398 Ga0495643_0289574 3300046522 Bacteria 750
399 Ga0495648_0016582 3300046524 Bacteria 5306
400 Ga0495648_0027013 3300046524 Bacteria 3851
401 Ga0495648_0035781 3300046524 Bacteria 3214
402 Ga0495666_0037013 3300046526 Bacteria 2374
403 Ga0495642_0012144 3300046528 Bacteria 3318
404 Ga0495642_0014713 3300046528 Bacteria 3035
405 Ga0495652_0028132 3300046529 Bacteria 4950
406 Ga0495652_0040219 3300046529 Bacteria 4041
407 Ga0495652_0081619 3300046529 Bacteria 2666
408 Ga0495654_0063029 3300046530 Bacteria 1776
409 Ga0495665_0019441 3300046531 Bacteria 3653
410 Ga0495665_0024081 3300046531 Bacteria 3269
411 Ga0495640_0024178 3300046533 Bacteria 4420
412 Ga0495586_0052371 3300046535 Bacteria 2210
413 Ga0495587_0008118 3300046536 Bacteria 6765
414 Ga0495609_0073917 3300046538 Bacteria 1495
415 Ga0495597_0008217 3300046542 Bacteria 5247
416 Ga0495597_0100480 3300046542 Bacteria 1220
417 Ga0495645_0000279 3300046543 Bacteria 37572
418 Ga0495645_0002307 3300046543 Bacteria 12965
419 Ga0495645_0007946 3300046543 Bacteria 7383
420 Ga0495645_0023746 3300046543 Bacteria 4443
421 Ga0495622_0000682 3300046557 Bacteria 19291
422 Ga0495667_0124783 3300046559 Bacteria 1662
423 Ga0495656_0116874 3300046615 Bacteria 1254
424 Ga0495611_0017563 3300046648 Bacteria 3061
425 Ga0495635_0004906 3300046663 Bacteria 9303
426 Ga0495635_0059149 3300046663 Bacteria 2635
427 Ga0495635_0059985 3300046663 Bacteria 2616
428 Ga0495661_0016604 3300046665 Bacteria 4874
429 Ga0495588_0114771 3300046674 Bacteria 1419
430 Ga0495657_0080549 3300046675 Bacteria 2107
431 Ga0495599_0017111 3300046678 Bacteria 4505
432 Ga0495599_0022737 3300046678 Bacteria 3915
433 Ga0495623_0008038 3300046679 Bacteria 6857
434 Ga0495623_0044486 3300046679 Bacteria 2821
435 Ga0495623_0115579 3300046679 Bacteria 1621
436 Ga0495646_0004119 3300046680 Bacteria 9126
437 Ga0495646_0014508 3300046680 Bacteria 5008
438 Ga0495646_0035582 3300046680 Bacteria 3088
439 Ga0495646_0040978 3300046680 Bacteria 2848
440 Ga0495646_0147398 3300046680 Bacteria 1311
441 Ga0495669_0015128 3300046684 Bacteria 3301
442 Ga0495669_0035818 3300046684 Bacteria 2192
443 Ga0495669_0129940 3300046684 Bacteria 1185
444 Ga0495613_0009641 3300046689 Bacteria 7173
445 Ga0495613_0077303 3300046689 Bacteria 2421
446 Ga0495613_0146088 3300046689 Bacteria 1687
447 Ga0495624_0006559 3300046690 Bacteria 8243
448 Ga0495624_0008020 3300046690 Bacteria 7398
449 Ga0495624_0009643 3300046690 Bacteria 6683
450 Ga0495624_0011954 3300046690 Bacteria 5950
451 Ga0495670_0060215 3300046691 Bacteria 1907
452 Ga0495649_0007008 3300046694 Bacteria 6949
453 Ga0495649_0010030 3300046694 Bacteria 5600
454 Ga0495649_0034391 3300046694 Bacteria 2788
455 Ga0495649_0146296 3300046694 Bacteria 1242
456 Ga0495649_0241755 3300046694 Bacteria 929
457 Ga0495589_0003243 3300046794 Bacteria 8868
458 Ga0495589_0030616 3300046794 Bacteria 2710
459 Ga0495589_0046246 3300046794 Bacteria 2160
460 Ga0495589_0099880 3300046794 Bacteria 1405
461 Ga0495600_0032604 3300046809 Bacteria 3381
462 Ga0495660_0074718 3300046810 Bacteria 1790
463 Ga0495660_0097087 3300046810 Bacteria 1522
464 Ga0495581_0008129 3300047315 Bacteria 6076
465 Ga0495604_0021636 3300047317 Bacteria 5134
466 Ga0495604_0226293 3300047317 Bacteria 1285
467 Ga0495674_0002606 3300047319 Bacteria 17571
468 Ga0495674_0003654 3300047319 Bacteria 14968
469 Ga0495674_0016538 3300047319 Bacteria 6883
470 Ga0495674_0054418 3300047319 Bacteria 3514
471 Ga0495674_0119954 3300047319 Bacteria 2222
472 Ga0495674_0270376 3300047319 Bacteria 1394
473 Ga0495672_0002712 3300047320 Bacteria 15890
474 Ga0495672_0008928 3300047320 Bacteria 7320
475 Ga0495672_0038179 3300047320 Bacteria 2931
476 Ga0495676_0007295 3300047321 Bacteria 10140
477 Ga0495676_0099540 3300047321 Bacteria 2154
478 Ga0495680_0003867 3300047322 Bacteria 14484
479 Ga0495680_0051852 3300047322 Bacteria 3200
480 Ga0495683_0021686 3300047323 Bacteria 3308
481 Ga0495683_0022416 3300047323 Bacteria 3247
482 Ga0495683_0056752 3300047323 Bacteria 1947
483 Ga0495683_0084549 3300047323 Bacteria 1544
484 Ga0495683_0140661 3300047323 Bacteria 1131
485 Ga0495687_000011 3300047443 Bacteria 397225
486 Ga0495687_007490 3300047443 Bacteria 6421
487 Ga0495687_014212 3300047443 Bacteria 4111
488 Ga0495687_031185 3300047443 Bacteria 2447
489 Ga0495675_0044483 3300047444 Bacteria 2828
490 Ga0495677_0065460 3300047445 Bacteria 1351
491 Ga0495679_000007 3300047446 Bacteria 401482
492 Ga0495679_001911 3300047446 Bacteria 11157
493 Ga0495679_028612 3300047446 Bacteria 1826
494 Ga0495685_098361 3300047447 Bacteria 967
495 Ga0495673_0006209 3300047469 Bacteria 7070
496 Ga0495673_0105101 3300047469 Bacteria 1136
497 Ga0495686_0034612 3300047472 Bacteria 3251
498 Ga0495686_0065065 3300047472 Bacteria 2255
499 Ga0495593_0021760 3300047673 Bacteria 3577
500 Ga0495593_0028703 3300047673 Bacteria 3054
501 Ga0495593_0033915 3300047673 Bacteria 2778
502 Ga0495593_0040811 3300047673 Bacteria 2497
503 Ga0495602_0019720 3300048088 Bacteria 6683
504 Ga0495602_0037077 3300048088 Bacteria 4529
505 Ga0495602_0063608 3300048088 Bacteria 3195
506 Ga0495614_0002345 3300048089 Bacteria 8421
507 Ga0495614_0003774 3300048089 Bacteria 6806
508 Ga0495626_0041950 3300048091 Bacteria 2152
509 Ga0495626_0118198 3300048091 Bacteria 1142
510 Ga0496100_0050393 3300048903 Bacteria 2697
511 Ga0496100_0213160 3300048903 Bacteria 1413
512 Ga0496100_0234325 3300048903 Bacteria 1352
513 Ga0496100_0248364 3300048903 Bacteria 1315
514 Ga0496100_0406659 3300048903 Bacteria 1037
515 Ga0496101_0036958 3300048904 Bacteria 3461
516 Ga0496101_0053481 3300048904 Bacteria 2914
517 Ga0496101_0098202 3300048904 Bacteria 2188
518 Ga0496101_0390413 3300048904 Bacteria 1095
519 Ga0496101_0397191 3300048904 Bacteria 1085
520 Ga0496102_0001577 3300048905 Bacteria 20115
521 Ga0496102_0065372 3300048905 Bacteria 3333
522 Ga0496103_0004929 3300048906 Bacteria 8059
523 Ga0496103_0012494 3300048906 Bacteria 5034
524 Ga0496103_0072618 3300048906 Bacteria 2155
525 Ga0496104_0007782 3300048907 Bacteria 9496
526 Ga0496104_0092598 3300048907 Bacteria 2890
527 Ga0496104_0425582 3300048907 Bacteria 1239
528 Ga0496105_0043106 3300048908 Bacteria 3721
529 Ga0496105_0055930 3300048908 Bacteria 3257
530 Ga0496105_0095642 3300048908 Bacteria 2453
531 Ga0496105_0247082 3300048908 Bacteria 1446
532 Ga0496105_0643788 3300048908 Bacteria 818
533 Ga0496106_0108068 3300048909 Bacteria 2164
534 Ga0496106_0389787 3300048909 Bacteria 1119
535 Ga0496107_0066679 3300048910 Bacteria 2610
536 Ga0496108_0206721 3300048911 Bacteria 1704
537 Ga0496109_0471080 3300048912 Bacteria 1186
538 Ga0496109_0493962 3300048912 Bacteria 1155
539 Ga0496110_0010435 3300048913 Bacteria 7554
540 Ga0496112_0004021 3300048915 Bacteria 12332
541 Ga0496112_0113531 3300048915 Bacteria 2680
542 Ga0496112_0144155 3300048915 Bacteria 2350
543 Ga0496114_0001303 3300048917 Bacteria 18882
544 Ga0496114_0355961 3300048917 Bacteria 1295
545 Ga0496114_0510647 3300048917 Bacteria 1063
546 Ga0496115_0104925 3300048918 Bacteria 2320
547 Ga0496115_0262548 3300048918 Bacteria 1420
548 Ga0496115_0325227 3300048918 Bacteria 1257
549 Ga0496116_0008846 3300048919 Bacteria 8668
550 Ga0496116_0029630 3300048919 Bacteria 3942
551 Ga0496116_0146119 3300048919 Bacteria 1321
552 Ga0496117_0003482 3300048920 Bacteria 18253
553 Ga0496117_0004451 3300048920 Bacteria 15452
554 Ga0496117_0006043 3300048920 Bacteria 12434
555 Ga0496117_0026468 3300048920 Bacteria 4538
556 Ga0496117_0027713 3300048920 Bacteria 4405
557 Ga0496117_0152051 3300048920 Bacteria 1368
558 Ga0496118_0002189 3300048921 Bacteria 27169
559 Ga0496118_0009107 3300048921 Bacteria 10105
560 Ga0496118_0014797 3300048921 Bacteria 7277
561 Ga0496118_0040781 3300048921 Bacteria 3686
562 Ga0496118_0052070 3300048921 Bacteria 3126
563 Ga0496118_0134601 3300048921 Bacteria 1579
564 Ga0496118_0156726 3300048921 Bacteria 1415
565 Ga0496119_0037839 3300048922 Bacteria 3127
566 Ga0496119_0099868 3300048922 Bacteria 1631
567 Ga0496119_0182330 3300048922 Bacteria 1100
568 Ga0496119_0204803 3300048922 Bacteria 1019
569 Ga0496120_0219750 3300048923 Bacteria 908
570 Ga0496121_0000333 3300048924 Bacteria 98583
571 Ga0496121_0013697 3300048924 Bacteria 8694
572 Ga0496121_0017772 3300048924 Bacteria 7230
573 Ga0496121_0152116 3300048924 Bacteria 1701
574 Ga0496121_0262167 3300048924 Bacteria 1192
575 Ga0496122_0068277 3300048925 Bacteria 2553
576 Ga0496123_0105432 3300048926 Bacteria 1627
577 Ga0496123_0124646 3300048926 Bacteria 1440
578 Ga0496123_0277293 3300048926 Bacteria 812
579 Ga0496124_0125246 3300048927 Bacteria 2048
580 Ga0496124_0151004 3300048927 Bacteria 1822
581 Ga0496125_0052026 3300048928 Bacteria 3371
582 Ga0496125_0086639 3300048928 Bacteria 2368
583 Ga0496125_0151767 3300048928 Bacteria 1590
584 Ga0496125_0284595 3300048928 Bacteria 1022
585 Ga0496126_0000088 3300048929 Bacteria 212256
586 Ga0496126_0001409 3300048929 Bacteria 38034
587 Ga0496126_0002413 3300048929 Bacteria 25289
588 Ga0496126_0005752 3300048929 Bacteria 14027
589 Ga0496126_0007047 3300048929 Bacteria 12397
590 Ga0496126_0027437 3300048929 Bacteria 5438
591 Ga0496126_0120059 3300048929 Bacteria 2281
592 Ga0501309_030075 3300049129 Bacteria 798
593 Ga0495678_012540 3300049459 Bacteria 4015
594 Ga0495682_0080488 3300049460 Bacteria 1171
595 Ga0501315_018868 3300049531 Bacteria 913
596 Ga0501316_010553 3300049532 Bacteria 1053
597 Ga0501034_0443581 3300049571 Bacteria 1216
598 Ga0501038_0168339 3300049574 Bacteria 1776
599 Ga0501046_0018470 3300049580 Bacteria 5801
600 Ga0501047_0057504 3300049581 Bacteria 3761
601 Ga0501047_0349870 3300049581 Bacteria 1314
602 Ga0501073_0180693 3300049589 Bacteria 1460
603 Ga0501209_010680 3300049656 Bacteria 1897
604 Ga0501080_0265649 3300049742 Bacteria 1562
605 Ga0501035_0163052 3300049822 Bacteria 1929
606 Ga0501044_0045812 3300049823 Bacteria 4530
607 nmdc:mga03683_7472_c1 3300050489 Bacteria 3794
608 nmdc:mga07m45_17182_c3 3300050496 Bacteria 1415
609 nmdc:mga07m45_6368_c1 3300050496 Bacteria 5963
610 Ga0587070_041131 3300059491 Bacteria 885
611 Ga0587073_0102713 3300059492 Bacteria 745
612 Ga0587080_005082 3300059503 Bacteria 1747
613 Ga0587080_035588 3300059503 Bacteria 887
614 Ga0587082_018637 3300059504 Bacteria 1107
615 Ga0587082_053293 3300059504 Bacteria 778
616 Ga0587083_0036934 3300059505 Bacteria 1003
617 Ga0587086_027160 3300059507 Bacteria 820
618 Ga0587090_031471 3300059510 Bacteria 890
619 Ga0587094_028030 3300059513 Bacteria 858
620 Ga0587098_001641 3300059604 Bacteria 1759
621 Ga0587109_039032 3300059624 Bacteria 934
622 Ga0587128_021701 3300059630 Bacteria 992
623 Ga0587068_036030 3300059641 Bacteria 879
624 Ga0587069_003104 3300059642 Bacteria 1763
625 Ga0587072_016147 3300059643 Bacteria 1275
626 Ga0587075_036119 3300059644 Bacteria 809
627 Ga0587076_013093 3300059645 Bacteria 1252
628 Ga0587076_044734 3300059645 Bacteria 841
629 Ga0587078_016382 3300059646 Bacteria 902
630 Ga0587078_029348 3300059646 Bacteria 735
631 Ga0587079_047612 3300059647 Bacteria 889
632 Ga0587100_020758 3300059648 Bacteria 639
633 Ga0587107_000692 3300059652 Bacteria 2376
634 Ga0587107_025443 3300059652 Bacteria 861
635 Ga0587071_012594 3300060344 Bacteria 1446
636 Ga0466962_0000412 3300061719 Bacteria 18479
637 Ga0466962_0000527 3300061719 Bacteria 16722
638 Ga0466962_0003369 3300061719 Bacteria 7606
639 Ga0466962_0094380 3300061719 Bacteria 1434
640 Ga0466962_0173559 3300061719 Bacteria 1050

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025903 Ga0207680_10010657 Ga0207680_100106575 181
2 3300048920 Ga0496117_0027713 Ga0496117_0027713_2228_2857 183
3 3300048929 Ga0496126_0001409 Ga0496126_0001409_9087_9716 183
4 3300004801 Ga0058860_11979007 Ga0058860_119790072 185
5 3300005335 Ga0070666_10008389 Ga0070666_100083897 185
6 3300005337 Ga0070682_100115336 Ga0070682_1001153361 185
7 3300005364 Ga0070673_100347238 Ga0070673_1003472381 185
8 3300005367 Ga0070667_100027191 Ga0070667_1000271915 185
9 3300005455 Ga0070663_100009378 Ga0070663_1000093787 185
10 3300005456 Ga0070678_100100674 Ga0070678_1001006742 185
11 3300005844 Ga0068862_100547741 Ga0068862_1005477411 185
12 3300009036 Ga0105244_10122364 Ga0105244_101223641 185
13 3300009177 Ga0105248_10038843 Ga0105248_100388437 185
14 3300009553 Ga0105249_10426684 Ga0105249_104266842 185
15 3300013306 Ga0163162_10010537 Ga0163162_1001053710 185
16 3300025937 Ga0207669_10847820 Ga0207669_108478201 185
17 3300025941 Ga0207711_10220466 Ga0207711_102204662 185
18 3300025960 Ga0207651_10060430 Ga0207651_100604301 185
19 3300025986 Ga0207658_10029361 Ga0207658_100293612 185
20 3300026067 Ga0207678_10014828 Ga0207678_100148282 185
21 3300026121 Ga0207683_10126389 Ga0207683_101263892 185
22 3300046460 Ga0495638_0012178 Ga0495638_0012178_4805_5503 185
23 3300046474 Ga0495605_0002292 Ga0495605_0002292_8564_9262 185
24 3300046492 Ga0495585_0144608 Ga0495585_0144608_577_1206 185
25 3300046501 Ga0495607_0096904 Ga0495607_0096904_83_781 185
26 3300046512 Ga0495610_0129169 Ga0495610_0129169_134_832 185
27 3300046542 Ga0495597_0100480 Ga0495597_0100480_162_791 185
28 3300046615 Ga0495656_0116874 Ga0495656_0116874_600_1220 185
29 3300046684 Ga0495669_0015128 Ga0495669_0015128_423_1121 185
30 3300046691 Ga0495670_0060215 Ga0495670_0060215_100_798 185
31 3300046794 Ga0495589_0003243 Ga0495589_0003243_4568_5266 185
32 3300048904 Ga0496101_0053481 Ga0496101_0053481_1755_2453 185
33 3300048910 Ga0496107_0066679 Ga0496107_0066679_1530_2228 185
34 3300048918 Ga0496115_0262548 Ga0496115_0262548_651_1349 185
35 3300048922 Ga0496119_0182330 Ga0496119_0182330_358_978 185
36 3300037312 Ga0395899_0000031 Ga0395899_0000031_154188_154796 186
37 3300037312 Ga0395899_0041658 Ga0395899_0041658_1166_1774 186
38 3300037418 Ga0395900_0000158 Ga0395900_0000158_105801_106409 186
39 3300037418 Ga0395900_0105733 Ga0395900_0105733_881_1489 186
40 3300037466 Ga0395898_0000040 Ga0395898_0000040_149206_149814 186
41 3300037466 Ga0395898_0077260 Ga0395898_0077260_1195_1803 186
42 3300038443 Ga0395901_0001107 Ga0395901_0001107_27852_28460 186
43 3300038443 Ga0395901_0001810 Ga0395901_0001810_11417_12028 186
44 3300044656 Ga0466969_0145172 Ga0466969_0145172_424_1032 186
45 3300044684 Ga0466966_0000006 Ga0466966_0000006_118650_119258 186
46 3300044693 Ga0466961_0000989 Ga0466961_0000989_9422_10030 186
47 3300044694 Ga0466963_0001975 Ga0466963_0001975_1086_1694 186
48 3300045049 Ga0466959_0095125 Ga0466959_0095125_765_1373 186
49 3300045836 Ga0466958_0060887 Ga0466958_0060887_642_1250 186
50 3300046458 Ga0495591_000791 Ga0495591_000791_14861_15481 186
51 3300046476 Ga0495662_0024459 Ga0495662_0024459_1180_1800 186
52 3300046477 Ga0495664_0032119 Ga0495664_0032119_1788_2408 186
53 3300046500 Ga0495596_0006565 Ga0495596_0006565_3833_4453 186
54 3300046511 Ga0495608_0063287 Ga0495608_0063287_1049_1669 186
55 3300046516 Ga0495628_0066576 Ga0495628_0066576_1330_1950 186
56 3300046517 Ga0495630_0131539 Ga0495630_0131539_931_1551 186
57 3300046524 Ga0495648_0035781 Ga0495648_0035781_1510_2130 186
58 3300046529 Ga0495652_0081619 Ga0495652_0081619_650_1270 186
59 3300046533 Ga0495640_0024178 Ga0495640_0024178_2041_2661 186
60 3300046557 Ga0495622_0000682 Ga0495622_0000682_17780_18400 186
61 3300046663 Ga0495635_0059149 Ga0495635_0059149_1064_1684 186
62 3300046680 Ga0495646_0035582 Ga0495646_0035582_943_1563 186
63 3300046689 Ga0495613_0077303 Ga0495613_0077303_1030_1650 186
64 3300046690 Ga0495624_0011954 Ga0495624_0011954_2171_2791 186
65 3300046794 Ga0495589_0046246 Ga0495589_0046246_649_1269 186
66 3300047319 Ga0495674_0119954 Ga0495674_0119954_650_1270 186
67 3300047322 Ga0495680_0051852 Ga0495680_0051852_1063_1683 186
68 3300047323 Ga0495683_0056752 Ga0495683_0056752_95_715 186
69 3300047446 Ga0495679_028612 Ga0495679_028612_513_1133 186
70 3300047673 Ga0495593_0021760 Ga0495593_0021760_811_1431 186
71 3300048088 Ga0495602_0063608 Ga0495602_0063608_1882_2502 186
72 3300048089 Ga0495614_0002345 Ga0495614_0002345_5856_6476 186
73 3300048906 Ga0496103_0072618 Ga0496103_0072618_236_856 186
74 3300061719 Ga0466962_0003369 Ga0466962_0003369_1372_1980 186
75 3300037312 Ga0395899_0050724 Ga0395899_0050724_2121_2729 188
76 3300037418 Ga0395900_0283691 Ga0395900_0283691_289_897 188
77 3300044656 Ga0466969_0011439 Ga0466969_0011439_2060_2668 188
78 3300044683 Ga0466965_0078936 Ga0466965_0078936_688_1296 188
79 3300044684 Ga0466966_0033167 Ga0466966_0033167_1987_2595 188
80 3300044693 Ga0466961_0074687 Ga0466961_0074687_738_1346 188
81 3300044706 Ga0466964_0002065 Ga0466964_0002065_896_1504 188
82 3300044765 Ga0466970_0014867 Ga0466970_0014867_2579_3187 188
83 3300044842 Ga0466957_0016747 Ga0466957_0016747_962_1570 188
84 3300045049 Ga0466959_0080461 Ga0466959_0080461_937_1545 188
85 3300045836 Ga0466958_0000920 Ga0466958_0000920_6763_7371 188
86 3300045836 Ga0466958_0066342 Ga0466958_0066342_1194_1802 188
87 3300019179 Ga0184593_111152 Ga0184593_1111521 190
88 3300037418 Ga0395900_0036214 Ga0395900_0036214_1300_2010 190
89 3300005577 Ga0068857_100659944 Ga0068857_1006599441 191
90 3300010375 Ga0105239_10507765 Ga0105239_105077652 191
91 3300026116 Ga0207674_10397010 Ga0207674_103970102 191
92 3300031548 Ga0307408_100001314 Ga0307408_10000131420 191
93 3300031731 Ga0307405_10024361 Ga0307405_100243612 191
94 3300031995 Ga0307409_100070534 Ga0307409_1000705343 191
95 3300049129 Ga0501309_030075 Ga0501309_030075_13_684 191
96 3300006038 Ga0075365_10165942 Ga0075365_101659422 192
97 3300042119 Ga0450915_002349 Ga0450915_002349_95_808 192
98 3300042129 Ga0450891_005582 Ga0450891_005582_264_977 192
99 3300042435 Ga0439434_0032164 Ga0439434_0032164_280_972 192
100 3300042532 Ga0450893_0018651 Ga0450893_0018651_49_762 192
101 3300045976 Ga0466967_0430688 Ga0466967_0430688_368_1066 192
102 3300048929 Ga0496126_0120059 Ga0496126_0120059_485_1114 192
103 3300005616 Ga0068852_100912191 Ga0068852_1009121911 193
104 3300006028 Ga0070717_10389748 Ga0070717_103897482 193
105 3300006195 Ga0075366_10109254 Ga0075366_101092541 193
106 3300013102 Ga0157371_10007924 Ga0157371_100079247 193
107 3300013306 Ga0163162_11534499 Ga0163162_115344991 193
108 3300014497 Ga0182008_10096766 Ga0182008_100967662 193
109 3300015683 Ga0183362_10005 Ga0183362_10005315 193
110 3300031711 Ga0265314_10001337 Ga0265314_1000133716 193
111 3300037466 Ga0395898_0023156 Ga0395898_0023156_3273_3968 193
112 3300037471 Ga0395905_0134600 Ga0395905_0134600_1302_1997 193
113 3300038443 Ga0395901_0245392 Ga0395901_0245392_1026_1781 193
114 3300038443 Ga0395901_0754943 Ga0395901_0754943_244_939 193
115 3300042438 Ga0439459_0073835 Ga0439459_0073835_42_758 193
116 3300048909 Ga0496106_0108068 Ga0496106_0108068_1321_1950 193
117 3300049571 Ga0501034_0443581 Ga0501034_0443581_345_1049 193
118 3300049574 Ga0501038_0168339 Ga0501038_0168339_1053_1757 193
119 3300049580 Ga0501046_0018470 Ga0501046_0018470_3280_3984 193
120 3300049581 Ga0501047_0349870 Ga0501047_0349870_356_1060 193
121 3300049589 Ga0501073_0180693 Ga0501073_0180693_717_1421 193
122 3300049742 Ga0501080_0265649 Ga0501080_0265649_682_1386 193
123 3300049822 Ga0501035_0163052 Ga0501035_0163052_681_1385 193
124 3300049823 Ga0501044_0045812 Ga0501044_0045812_3354_4058 193
125 3300001989 JGI24739J22299_10017997 JGI24739J22299_100179972 194
126 3300027682 Ga0209971_1002743 Ga0209971_10027434 194
127 3300027876 Ga0209974_10013617 Ga0209974_100136174 194
128 3300028577 Ga0265318_10061967 Ga0265318_100619672 194
129 3300031238 Ga0265332_10000028 Ga0265332_1000002861 194
130 3300031240 Ga0265320_10079453 Ga0265320_100794532 194
131 3300031241 Ga0265325_10001397 Ga0265325_1000139714 194
132 3300031711 Ga0265314_10000054 Ga0265314_1000005461 194
133 3300037312 Ga0395899_0146951 Ga0395899_0146951_272_883 194
134 3300037466 Ga0395898_0007346 Ga0395898_0007346_8856_9467 194
135 3300037471 Ga0395905_0437596 Ga0395905_0437596_421_1107 194
136 3300038443 Ga0395901_0004171 Ga0395901_0004171_7053_7664 194
137 3300044658 Ga0466972_0051825 Ga0466972_0051825_803_1414 194
138 3300044684 Ga0466966_0000265 Ga0466966_0000265_22936_23547 194
139 3300044693 Ga0466961_0106695 Ga0466961_0106695_355_966 194
140 3300044694 Ga0466963_0006961 Ga0466963_0006961_726_1337 194
141 3300044719 Ga0466971_0003814 Ga0466971_0003814_587_1198 194
142 3300044842 Ga0466957_0034949 Ga0466957_0034949_430_1041 194
143 3300045836 Ga0466958_0083118 Ga0466958_0083118_353_964 194
144 3300045976 Ga0466967_0849871 Ga0466967_0849871_215_826 194
145 3300046471 Ga0495650_0014347 Ga0495650_0014347_2402_3025 194
146 3300048921 Ga0496118_0002189 Ga0496118_0002189_1260_1880 194
147 3300049581 Ga0501047_0057504 Ga0501047_0057504_554_1243 194
148 3300049656 Ga0501209_010680 Ga0501209_010680_470_1111 194
149 3300059644 Ga0587075_036119 Ga0587075_036119_172_783 194
150 3300061719 Ga0466962_0000527 Ga0466962_0000527_410_1021 194
151 3300005327 Ga0070658_10006938 Ga0070658_100069386 195
152 3300005327 Ga0070658_10106790 Ga0070658_101067902 195
153 3300005339 Ga0070660_100011683 Ga0070660_1000116834 195
154 3300005366 Ga0070659_100179926 Ga0070659_1001799262 195
155 3300005563 Ga0068855_100002204 Ga0068855_1000022048 195
156 3300005563 Ga0068855_100022812 Ga0068855_1000228122 195
157 3300009545 Ga0105237_10205269 Ga0105237_102052692 195
158 3300009551 Ga0105238_10028874 Ga0105238_100288744 195
159 3300013104 Ga0157370_10002906 Ga0157370_1000290618 195
160 3300025909 Ga0207705_10000452 Ga0207705_1000045226 195
161 3300025909 Ga0207705_10112980 Ga0207705_101129802 195
162 3300025913 Ga0207695_10032748 Ga0207695_100327482 195
163 3300025913 Ga0207695_10327799 Ga0207695_103277992 195
164 3300025914 Ga0207671_10137737 Ga0207671_101377372 195
165 3300025917 Ga0207660_10151402 Ga0207660_101514022 195
166 3300025919 Ga0207657_10037495 Ga0207657_100374954 195
167 3300025932 Ga0207690_10142514 Ga0207690_101425142 195
168 3300025949 Ga0207667_10000701 Ga0207667_1000070117 195
169 3300028794 Ga0307515_10000040 Ga0307515_10000040125 195
170 3300038443 Ga0395901_0155248 Ga0395901_0155248_647_1390 195
171 3300041407 Ga0439447_033256 Ga0439447_033256_357_1016 195
172 3300041411 Ga0439466_0022944 Ga0439466_0022944_534_1193 195
173 3300041413 Ga0439465_0000277 Ga0439465_0000277_5884_6543 195
174 3300041999 Ga0439433_0001048 Ga0439433_0001048_673_1332 195
175 3300042002 Ga0439442_024900 Ga0439442_024900_355_1014 195
176 3300042004 Ga0439445_0000763 Ga0439445_0000763_3942_4601 195
177 3300042006 Ga0439432_001936 Ga0439432_001936_2260_2919 195
178 3300042007 Ga0439449_0000120 Ga0439449_0000120_3660_4319 195
179 3300042010 Ga0439452_002310 Ga0439452_002310_3860_4519 195
180 3300042014 Ga0439457_056205 Ga0439457_056205_173_832 195
181 3300042138 Ga0450903_015969 Ga0450903_015969_473_1159 195
182 3300042435 Ga0439434_0068203 Ga0439434_0068203_50_709 195
183 3300044673 Ga0453683_0390378 Ga0453683_0390378_38_760 195
184 3300050496 nmdc:mga07m45_17182_c3 nmdc:mga07m45_17182_c3_165_881 195
185 iso_pu_bacteria 2510917013 2511089687 195
186 iso_pu_bacteria 2857357740 2857366611 195
187 iso_pu_bacteria 2919704043 2919704142 195
188 3300005327 Ga0070658_10576092 Ga0070658_105760921 196
189 3300006048 Ga0075363_100376705 Ga0075363_1003767051 196
190 3300006353 Ga0075370_10000918 Ga0075370_100009189 196
191 3300026041 Ga0207639_10561412 Ga0207639_105614122 196
192 3300031731 Ga0307405_10178379 Ga0307405_101783793 196
193 3300032002 Ga0307416_100582390 Ga0307416_1005823901 196
194 3300032133 Ga0316583_10000293 Ga0316583_1000029313 196
195 3300041405 Ga0439438_055437 Ga0439438_055437_240_893 196
196 3300044684 Ga0466966_0185756 Ga0466966_0185756_131_805 196
197 3300044901 Ga0466960_0027899 Ga0466960_0027899_287_943 196
198 3300045049 Ga0466959_0253906 Ga0466959_0253906_13_687 196
199 3300046457 Ga0495590_0020946 Ga0495590_0020946_376_999 196
200 3300046459 Ga0495629_0003125 Ga0495629_0003125_1069_1692 196
201 3300046460 Ga0495638_0004867 Ga0495638_0004867_8598_9221 196
202 3300046474 Ga0495605_0001100 Ga0495605_0001100_2519_3142 196
203 3300046506 Ga0495583_0005045 Ga0495583_0005045_4811_5434 196
204 3300046515 Ga0495620_0052476 Ga0495620_0052476_527_1150 196
205 3300046524 Ga0495648_0027013 Ga0495648_0027013_1217_1840 196
206 3300046538 Ga0495609_0073917 Ga0495609_0073917_564_1187 196
207 3300046648 Ga0495611_0017563 Ga0495611_0017563_875_1498 196
208 3300046674 Ga0495588_0114771 Ga0495588_0114771_540_1163 196
209 3300046678 Ga0495599_0017111 Ga0495599_0017111_124_747 196
210 3300046679 Ga0495623_0008038 Ga0495623_0008038_3804_4427 196
211 3300046690 Ga0495624_0009643 Ga0495624_0009643_1087_1710 196
212 3300047320 Ga0495672_0038179 Ga0495672_0038179_588_1211 196
213 3300047443 Ga0495687_014212 Ga0495687_014212_2346_2969 196
214 3300047444 Ga0495675_0044483 Ga0495675_0044483_1524_2147 196
215 3300047446 Ga0495679_000007 Ga0495679_000007_131419_132042 196
216 3300047472 Ga0495686_0034612 Ga0495686_0034612_1343_1966 196
217 3300047673 Ga0495593_0033915 Ga0495593_0033915_201_824 196
218 3300048088 Ga0495602_0019720 Ga0495602_0019720_5545_6168 196
219 3300048924 Ga0496121_0013697 Ga0496121_0013697_2369_2992 196
220 3300049459 Ga0495678_012540 Ga0495678_012540_2388_3011 196
221 3300049531 Ga0501315_018868 Ga0501315_018868_221_898 196
222 3300049532 Ga0501316_010553 Ga0501316_010553_141_818 196
223 3300050489 nmdc:mga03683_7472_c1 nmdc:mga03683_7472_c1_2129_2785 196
224 3300050496 nmdc:mga07m45_6368_c1 nmdc:mga07m45_6368_c1_334_987 196
225 iso_pu_bacteria 2501025501 2501070813 196
226 iso_pu_bacteria 2501025504 2501413646 196
227 iso_pu_bacteria 2510917014 2511095084 196
228 iso_pu_bacteria 2510917015 2511104743 196
229 iso_pu_bacteria 2513237082 2513551402 196
230 iso_pu_bacteria 2513237083 2513560044 196
231 iso_pu_bacteria 2513237166 2514048008 196
232 iso_pu_bacteria 2515154189 2516016802 196
233 iso_pu_bacteria 2562617112 2563060014 196
234 iso_pu_bacteria 2711768613 2713479268 196
235 iso_pu_bacteria 2721755763 2723876240 196
236 iso_pu_bacteria 2791355137 2792834673 196
237 iso_pu_bacteria 2883087390 2883094552 196
238 iso_pu_bacteria 2904434214 2904435158 196
239 iso_pu_bacteria 2904615490 2904620392 196
240 iso_pu_bacteria 2921643360 2921644159 196
241 iso_pu_bacteria 642555112 642592077 196
242 iso_pu_bacteria 642555113 642620148 196
243 iso_pu_bacteria 8003955200 8003957309 196
244 3300037418 Ga0395900_0038341 Ga0395900_0038341_3455_4129 197
245 3300037471 Ga0395905_0116681 Ga0395905_0116681_342_1016 197
246 3300038443 Ga0395901_0056623 Ga0395901_0056623_1574_2248 197
247 3300044693 Ga0466961_0014170 Ga0466961_0014170_934_1638 197
248 3300044735 Ga0466968_0043784 Ga0466968_0043784_501_1205 197
249 3300045049 Ga0466959_0088349 Ga0466959_0088349_941_1645 197
250 iso_pu_bacteria 2508501125 2509129120 197
251 iso_pu_bacteria 2510065045 2510253203 197
252 iso_pu_bacteria 2512047030 2512347375 197
253 iso_pu_bacteria 2513237151 2513959202 197
254 iso_pu_bacteria 2515154122 2515685295 197
255 iso_pu_bacteria 2519103095 2519459845 197
256 iso_pu_bacteria 2526164713 2527078836 197
257 iso_pu_bacteria 2582581311 2585290651 197
258 iso_pu_bacteria 2599185239 2599740246 197
259 iso_pu_bacteria 2718217991 2719638992 197
260 iso_pu_bacteria 2738541296 2738823785 197
261 iso_pu_bacteria 2738541298 2738836176 197
262 iso_pu_bacteria 2738541306 2738877706 197
263 iso_pu_bacteria 2738543002 2739189412 197
264 iso_pu_bacteria 2738543008 2739224299 197
265 iso_pu_bacteria 2744054900 2746086346 197
266 iso_pu_bacteria 2744054901 2746093346 197
267 iso_pu_bacteria 2751185846 2753566252 197
268 iso_pu_bacteria 2816332253 2817262129 197
269 iso_pu_bacteria 2816332256 2817279830 197
270 iso_pu_bacteria 2816332286 2817455564 197
271 iso_pu_bacteria 2818991452 2819633710 197
272 iso_pu_bacteria 2863421361 2863427310 197
273 iso_pu_bacteria 2885270888 2885276739 197
274 iso_pu_bacteria 2894023352 2894024392 197
275 iso_pu_bacteria 2900634093 2900636389 197
276 iso_pu_bacteria 2902682994 2902689119 197
277 iso_pu_bacteria 2904483920 2904488538 197
278 iso_pu_bacteria 2904564687 2904567663 197
279 iso_pu_bacteria 2904571731 2904574935 197
280 iso_pu_bacteria 2919527303 2919532150 197
281 iso_pu_bacteria 2928170801 2928175468 197
282 iso_pu_bacteria 2928536128 2928538974 197
283 iso_pu_bacteria 2939631187 2939632127 197
284 iso_pu_bacteria 2945934425 2945935227 197
285 iso_pu_bacteria 2990703756 2990704179 197
286 iso_pu_bacteria 641736151 642422335 197
287 iso_pu_bacteria 8018845410 8018846251 197
288 iso_pu_bacteria 8020807995 8020814264 197
289 iso_pu_bacteria 8020938398 8020940024 197
290 iso_pu_bacteria 8020945358 8020950346 197
291 iso_pu_bacteria 8020953355 8020954693 197
292 iso_pu_bacteria 8021120328 8021125567 197
293 iso_pu_bacteria 8039098773 8039104477 197
294 iso_pu_bacteria 8040167225 8040172119 197
295 iso_pu_bacteria 8040173305 8040173972 197
296 iso_pu_bacteria 8055266321 8055268175 197
297 iso_pu_bacteria 8055301274 8055304073 197
298 iso_pu_bacteria 2515154123 2515689383 198
299 iso_pu_bacteria 2599185240 2599744078 198
300 iso_pu_bacteria 2599185355 2600210813 198
301 iso_pu_bacteria 2600255067 2600810334 198
302 iso_pu_bacteria 2675903129 2676743571 198
303 iso_pu_bacteria 2808606384 2808968309 198
304 iso_pu_bacteria 2808606390 2809003140 198
305 iso_pu_bacteria 2808606391 2809010417 198
306 iso_pu_bacteria 2818991450 2819623947 198
307 iso_pu_bacteria 2842324504 2842331843 198
308 iso_pu_bacteria 2842348783 2842356156 198
309 iso_pu_bacteria 2842454564 2842459356 198
310 iso_pu_bacteria 2870068957 2870070111 198
311 iso_pu_bacteria 2928108538 2928109516 198
312 iso_pu_bacteria 2928135762 2928137030 198
313 iso_pu_bacteria 2928157003 2928162066 198
314 iso_pu_bacteria 2928163908 2928169296 198
315 iso_pu_bacteria 2928503688 2928506558 198
316 iso_pu_bacteria 2981990288 2981992788 198
317 iso_pu_bacteria 641736154 642418038 198
318 3300009011 Ga0105251_10000055 Ga0105251_100000552 199
319 3300015262 Ga0182007_10001847 Ga0182007_1000184711 199
320 3300025735 Ga0207713_1000089 Ga0207713_1000089123 199
321 3300025735 Ga0207713_1000106 Ga0207713_100010629 199
322 3300048912 Ga0496109_0493962 Ga0496109_0493962_198_818 199
323 3300048919 Ga0496116_0029630 Ga0496116_0029630_731_1351 199
324 iso_pu_bacteria 2501025502 2501080337 199
325 iso_pu_bacteria 2856287931 2856293270 199
326 3300003354 JGI25160J50197_1000049 JGI25160J50197_100004955 200
327 3300005262 Ga0065165_1000115 Ga0065165_100011555 200
328 3300025284 Ga0209130_1027198 Ga0209130_10271982 200
329 3300025295 Ga0209564_1007255 Ga0209564_10072555 200
330 3300025302 Ga0207426_1000007 Ga0207426_1000007269 200
331 3300037471 Ga0395905_0000014 Ga0395905_0000014_189193_189816 200
332 3300044666 Ga0466977_0000098 Ga0466977_0000098_353_1099 200
333 3300046455 Ga0495603_0247004 Ga0495603_0247004_38_661 200
334 3300046457 Ga0495590_0018763 Ga0495590_0018763_813_1436 200
335 3300046457 Ga0495590_0033229 Ga0495590_0033229_419_1081 200
336 3300046472 Ga0495580_0007525 Ga0495580_0007525_376_999 200
337 3300046474 Ga0495605_0002952 Ga0495605_0002952_412_1035 200
338 3300046506 Ga0495583_0048668 Ga0495583_0048668_857_1480 200
339 3300046513 Ga0495616_0026456 Ga0495616_0026456_563_1186 200
340 3300046517 Ga0495630_0061353 Ga0495630_0061353_858_1481 200
341 3300046524 Ga0495648_0016582 Ga0495648_0016582_3397_4020 200
342 3300046678 Ga0495599_0022737 Ga0495599_0022737_2016_2639 200
343 3300046684 Ga0495669_0129940 Ga0495669_0129940_64_687 200
344 3300046694 Ga0495649_0034391 Ga0495649_0034391_770_1393 200
345 3300046694 Ga0495649_0146296 Ga0495649_0146296_16_678 200
346 3300046810 Ga0495660_0097087 Ga0495660_0097087_392_1003 200
347 3300047319 Ga0495674_0002606 Ga0495674_0002606_9166_9789 200
348 3300047319 Ga0495674_0003654 Ga0495674_0003654_10003_10620 200
349 3300047320 Ga0495672_0008928 Ga0495672_0008928_2329_2952 200
350 3300047323 Ga0495683_0021686 Ga0495683_0021686_1491_2114 200
351 3300047443 Ga0495687_000011 Ga0495687_000011_128260_128922 200
352 3300047443 Ga0495687_031185 Ga0495687_031185_499_1122 200
353 3300047469 Ga0495673_0006209 Ga0495673_0006209_1143_1766 200
354 3300048088 Ga0495602_0037077 Ga0495602_0037077_1659_2282 200
355 3300048091 Ga0495626_0118198 Ga0495626_0118198_437_1060 200
356 3300048903 Ga0496100_0050393 Ga0496100_0050393_1622_2245 200
357 3300048903 Ga0496100_0406659 Ga0496100_0406659_351_974 200
358 3300048904 Ga0496101_0036958 Ga0496101_0036958_717_1340 200
359 3300048904 Ga0496101_0390413 Ga0496101_0390413_429_1052 200
360 3300048905 Ga0496102_0001577 Ga0496102_0001577_17256_17879 200
361 3300048906 Ga0496103_0012494 Ga0496103_0012494_4005_4628 200
362 3300048908 Ga0496105_0043106 Ga0496105_0043106_2748_3371 200
363 3300048908 Ga0496105_0643788 Ga0496105_0643788_48_671 200
364 3300048915 Ga0496112_0113531 Ga0496112_0113531_215_838 200
365 3300048918 Ga0496115_0325227 Ga0496115_0325227_171_794 200
366 3300048920 Ga0496117_0004451 Ga0496117_0004451_13509_14132 200
367 3300048921 Ga0496118_0040781 Ga0496118_0040781_2757_3380 200
368 3300048922 Ga0496119_0037839 Ga0496119_0037839_717_1340 200
369 3300048923 Ga0496120_0219750 Ga0496120_0219750_245_868 200
370 3300048924 Ga0496121_0152116 Ga0496121_0152116_644_1267 200
371 3300048926 Ga0496123_0277293 Ga0496123_0277293_23_646 200
372 3300048927 Ga0496124_0125246 Ga0496124_0125246_959_1582 200
373 3300048928 Ga0496125_0151767 Ga0496125_0151767_426_1049 200
374 3300048929 Ga0496126_0007047 Ga0496126_0007047_805_1428 200
375 3300049460 Ga0495682_0080488 Ga0495682_0080488_376_999 200
376 3300059491 Ga0587070_041131 Ga0587070_041131_17_640 200
377 3300059503 Ga0587080_035588 Ga0587080_035588_17_676 200
378 3300059505 Ga0587083_0036934 Ga0587083_0036934_239_862 200
379 3300059507 Ga0587086_027160 Ga0587086_027160_17_640 200
380 3300059513 Ga0587094_028030 Ga0587094_028030_17_640 200
381 3300059604 Ga0587098_001641 Ga0587098_001641_17_640 200
382 3300059624 Ga0587109_039032 Ga0587109_039032_300_923 200
383 3300059630 Ga0587128_021701 Ga0587128_021701_14_637 200
384 3300059641 Ga0587068_036030 Ga0587068_036030_17_640 200
385 3300059642 Ga0587069_003104 Ga0587069_003104_14_640 200
386 3300059643 Ga0587072_016147 Ga0587072_016147_641_1264 200
387 3300059645 Ga0587076_044734 Ga0587076_044734_17_628 200
388 3300059646 Ga0587078_016382 Ga0587078_016382_167_790 200
389 3300059648 Ga0587100_020758 Ga0587100_020758_17_628 200
390 3300059652 Ga0587107_025443 Ga0587107_025443_11_634 200
391 3300060344 Ga0587071_012594 Ga0587071_012594_121_744 200
392 3300061719 Ga0466962_0094380 Ga0466962_0094380_474_1082 200
393 3300001979 JGI24740J21852_10000889 JGI24740J21852_1000088910 201
394 3300001979 JGI24740J21852_10086375 JGI24740J21852_100863751 201
395 3300001989 JGI24739J22299_10010650 JGI24739J22299_100106503 201
396 3300002067 JGI24735J21928_10002083 JGI24735J21928_100020836 201
397 3300002075 JGI24738J21930_10004015 JGI24738J21930_100040151 201
398 3300002705 JGI25156J39149_1017091 JGI25156J39149_10170912 201
399 3300002772 JGI25164J39214_1006160 JGI25164J39214_10061601 201
400 3300003214 JGI25165J46597_1001028 JGI25165J46597_100102815 201
401 3300003479 Ga0006556J51387_1023789 Ga0006556J51387_10237894 201
402 3300003565 Ga0006560J51390_1025002 Ga0006560J51390_10250021 201
403 3300003567 Ga0006554J51385_1022490 Ga0006554J51385_10224904 201
404 3300003575 Ga0007409J51694_1053338 Ga0007409J51694_10533381 201
405 3300003579 Ga0007429J51699_1109854 Ga0007429J51699_11098541 201
406 3300003758 Ga0055532_1000031 Ga0055532_100003158 201
407 3300003758 Ga0055532_1002498 Ga0055532_10024982 201
408 3300003760 Ga0055527_1000020 Ga0055527_100002058 201
409 3300003761 Ga0055535_1000023 Ga0055535_1000023160 201
410 3300003762 Ga0055542_1000035 Ga0055542_100003558 201
411 3300003763 Ga0055529_1000039 Ga0055529_1000039160 201
412 3300003790 Ga0055528_1007923 Ga0055528_10079236 201
413 3300003841 Ga0055541_1004892 Ga0055541_10048922 201
414 3300003856 Ga0058692_1002184 Ga0058692_10021846 201
415 3300003856 Ga0058692_1023236 Ga0058692_10232362 201
416 3300003856 Ga0058692_1031587 Ga0058692_10315872 201
417 3300005337 Ga0070682_100200310 Ga0070682_1002003101 201
418 3300005455 Ga0070663_100402753 Ga0070663_1004027531 201
419 3300005456 Ga0070678_100282507 Ga0070678_1002825072 201
420 3300009011 Ga0105251_10000494 Ga0105251_1000049427 201
421 3300009036 Ga0105244_10056688 Ga0105244_100566882 201
422 3300009093 Ga0105240_10187322 Ga0105240_101873223 201
423 3300009098 Ga0105245_10578174 Ga0105245_105781742 201
424 3300009545 Ga0105237_11256959 Ga0105237_112569591 201
425 3300009551 Ga0105238_10110806 Ga0105238_101108063 201
426 3300013105 Ga0157369_10000089 Ga0157369_1000008927 201
427 3300013296 Ga0157374_10013236 Ga0157374_100132364 201
428 3300013306 Ga0163162_10380794 Ga0163162_103807941 201
429 3300013307 Ga0157372_10103727 Ga0157372_101037272 201
430 3300013308 Ga0157375_10725796 Ga0157375_107257962 201
431 3300014497 Ga0182008_10027051 Ga0182008_100270513 201
432 3300015262 Ga0182007_10008215 Ga0182007_100082151 201
433 3300020069 Ga0197907_11221094 Ga0197907_112210942 201
434 3300020070 Ga0206356_11658874 Ga0206356_116588742 201
435 3300020075 Ga0206349_1238021 Ga0206349_12380212 201
436 3300020078 Ga0206352_10995492 Ga0206352_109954923 201
437 3300020082 Ga0206353_10800542 Ga0206353_108005423 201
438 3300022467 Ga0224712_10000007 Ga0224712_1000000715 201
439 3300025225 Ga0209566_100164 Ga0209566_10016436 201
440 3300025226 Ga0209674_101938 Ga0209674_1019383 201
441 3300025228 Ga0209672_100001 Ga0209672_1000011939 201
442 3300025228 Ga0209672_100046 Ga0209672_10004682 201
443 3300025229 Ga0209147_100001 Ga0209147_1000011939 201
444 3300025229 Ga0209147_100043 Ga0209147_100043181 201
445 3300025229 Ga0209147_100214 Ga0209147_10021436 201
446 3300025230 Ga0209563_101354 Ga0209563_1013546 201
447 3300025231 Ga0207427_100478 Ga0207427_10047821 201
448 3300025242 Ga0209258_100001 Ga0209258_1000011939 201
449 3300025242 Ga0209258_100023 Ga0209258_100023381 201
450 3300025254 Ga0209148_1000003 Ga0209148_10000031939 201
451 3300025254 Ga0209148_1000029 Ga0209148_1000029447 201
452 3300025256 Ga0209759_1000037 Ga0209759_1000037240 201
453 3300025256 Ga0209759_1000175 Ga0209759_100017513 201
454 3300025256 Ga0209759_1000649 Ga0209759_100064933 201
455 3300025261 Ga0209233_1000123 Ga0209233_1000123152 201
456 3300025263 Ga0209565_1018119 Ga0209565_10181192 201
457 3300025272 Ga0209455_1000001 Ga0209455_10000011939 201
458 3300025272 Ga0209455_1000064 Ga0209455_1000064176 201
459 3300025273 Ga0209673_1000084 Ga0209673_1000084171 201
460 3300025295 Ga0209564_1002711 Ga0209564_10027119 201
461 3300025302 Ga0207426_1003361 Ga0207426_10033618 201
462 3300025735 Ga0207713_1031275 Ga0207713_10312752 201
463 3300025904 Ga0207647_10011776 Ga0207647_100117765 201
464 3300025919 Ga0207657_10067166 Ga0207657_100671662 201
465 3300025927 Ga0207687_10432405 Ga0207687_104324052 201
466 3300025931 Ga0207644_10617556 Ga0207644_106175562 201
467 3300025949 Ga0207667_10506810 Ga0207667_105068102 201
468 3300026067 Ga0207678_10044383 Ga0207678_100443834 201
469 3300026067 Ga0207678_10155596 Ga0207678_101555962 201
470 3300027312 Ga0209371_1000160 Ga0209371_100016071 201
471 3300027312 Ga0209371_1001668 Ga0209371_100166815 201
472 3300030500 Ga0268256_1000132 Ga0268256_100013233 201
473 3300030500 Ga0268256_1001457 Ga0268256_100145715 201
474 3300030863 Ga0265766_1000743 Ga0265766_10007431 201
475 3300030888 Ga0265769_104049 Ga0265769_1040491 201
476 3300031911 Ga0307412_10000014 Ga0307412_10000014141 201
477 3300037418 Ga0395900_0000057 Ga0395900_0000057_24231_24842 201
478 3300037471 Ga0395905_0018267 Ga0395905_0018267_5856_6473 201
479 3300039447 Ga0436361_0762421 Ga0436361_0762421_491_1105 201
480 3300044656 Ga0466969_0000396 Ga0466969_0000396_19868_20491 201
481 3300044683 Ga0466965_0000909 Ga0466965_0000909_6124_6747 201
482 3300044683 Ga0466965_0222614 Ga0466965_0222614_159_776 201
483 3300044684 Ga0466966_0048187 Ga0466966_0048187_1501_2118 201
484 3300044693 Ga0466961_0019264 Ga0466961_0019264_850_1473 201
485 3300044694 Ga0466963_0000828 Ga0466963_0000828_2548_3171 201
486 3300044706 Ga0466964_0026561 Ga0466964_0026561_1071_1694 201
487 3300044719 Ga0466971_0007013 Ga0466971_0007013_2590_3213 201
488 3300044719 Ga0466971_0103264 Ga0466971_0103264_93_698 201
489 3300044735 Ga0466968_0062794 Ga0466968_0062794_243_866 201
490 3300044765 Ga0466970_0009250 Ga0466970_0009250_3579_4202 201
491 3300044842 Ga0466957_0068577 Ga0466957_0068577_906_1520 201
492 3300044842 Ga0466957_0226919 Ga0466957_0226919_565_1182 201
493 3300045049 Ga0466959_0031486 Ga0466959_0031486_1513_2136 201
494 3300045976 Ga0466967_0313178 Ga0466967_0313178_92_709 201
495 3300045976 Ga0466967_0508282 Ga0466967_0508282_507_1124 201
496 3300046455 Ga0495603_0024167 Ga0495603_0024167_1472_2089 201
497 3300046457 Ga0495590_0014919 Ga0495590_0014919_452_1072 201
498 3300046459 Ga0495629_0027184 Ga0495629_0027184_57_674 201
499 3300046459 Ga0495629_0033751 Ga0495629_0033751_180_797 201
500 3300046461 Ga0495641_0013831 Ga0495641_0013831_2494_3111 201
501 3300046463 Ga0495653_0112901 Ga0495653_0112901_784_1401 201
502 3300046463 Ga0495653_0311867 Ga0495653_0311867_178_798 201
503 3300046474 Ga0495605_0014364 Ga0495605_0014364_2588_3205 201
504 3300046477 Ga0495664_0000322 Ga0495664_0000322_9674_10294 201
505 3300046477 Ga0495664_0016121 Ga0495664_0016121_1706_2323 201
506 3300046477 Ga0495664_0171882 Ga0495664_0171882_216_851 201
507 3300046491 Ga0495584_0107186 Ga0495584_0107186_626_1243 201
508 3300046491 Ga0495584_0231350 Ga0495584_0231350_18_638 201
509 3300046500 Ga0495596_0022942 Ga0495596_0022942_944_1561 201
510 3300046507 Ga0495606_0005895 Ga0495606_0005895_8860_9480 201
511 3300046512 Ga0495610_0041979 Ga0495610_0041979_675_1292 201
512 3300046514 Ga0495618_0011397 Ga0495618_0011397_695_1312 201
513 3300046515 Ga0495620_0050120 Ga0495620_0050120_659_1279 201
514 3300046516 Ga0495628_0002241 Ga0495628_0002241_8926_9543 201
515 3300046516 Ga0495628_0101891 Ga0495628_0101891_640_1260 201
516 3300046516 Ga0495628_0180987 Ga0495628_0180987_728_1345 201
517 3300046517 Ga0495630_0119088 Ga0495630_0119088_256_873 201
518 3300046522 Ga0495643_0289574 Ga0495643_0289574_101_718 201
519 3300046526 Ga0495666_0037013 Ga0495666_0037013_716_1333 201
520 3300046528 Ga0495642_0012144 Ga0495642_0012144_1753_2373 201
521 3300046528 Ga0495642_0014713 Ga0495642_0014713_944_1561 201
522 3300046529 Ga0495652_0028132 Ga0495652_0028132_1372_1989 201
523 3300046529 Ga0495652_0040219 Ga0495652_0040219_609_1229 201
524 3300046531 Ga0495665_0019441 Ga0495665_0019441_2331_2951 201
525 3300046531 Ga0495665_0024081 Ga0495665_0024081_1600_2217 201
526 3300046535 Ga0495586_0052371 Ga0495586_0052371_1219_1839 201
527 3300046536 Ga0495587_0008118 Ga0495587_0008118_1077_1694 201
528 3300046542 Ga0495597_0008217 Ga0495597_0008217_1353_1973 201
529 3300046543 Ga0495645_0000279 Ga0495645_0000279_7833_8450 201
530 3300046543 Ga0495645_0007946 Ga0495645_0007946_2080_2703 201
531 3300046543 Ga0495645_0023746 Ga0495645_0023746_606_1226 201
532 3300046663 Ga0495635_0004906 Ga0495635_0004906_1176_1793 201
533 3300046663 Ga0495635_0059985 Ga0495635_0059985_1813_2433 201
534 3300046665 Ga0495661_0016604 Ga0495661_0016604_2945_3562 201
535 3300046675 Ga0495657_0080549 Ga0495657_0080549_923_1540 201
536 3300046679 Ga0495623_0044486 Ga0495623_0044486_1500_2120 201
537 3300046679 Ga0495623_0115579 Ga0495623_0115579_16_633 201
538 3300046680 Ga0495646_0004119 Ga0495646_0004119_2794_3411 201
539 3300046680 Ga0495646_0014508 Ga0495646_0014508_3221_3838 201
540 3300046680 Ga0495646_0040978 Ga0495646_0040978_175_795 201
541 3300046684 Ga0495669_0035818 Ga0495669_0035818_1010_1630 201
542 3300046689 Ga0495613_0009641 Ga0495613_0009641_3717_4334 201
543 3300046690 Ga0495624_0006559 Ga0495624_0006559_2962_3579 201
544 3300046690 Ga0495624_0008020 Ga0495624_0008020_5118_5738 201
545 3300046694 Ga0495649_0007008 Ga0495649_0007008_2744_3361 201
546 3300046694 Ga0495649_0241755 Ga0495649_0241755_102_722 201
547 3300046794 Ga0495589_0030616 Ga0495589_0030616_600_1217 201
548 3300046794 Ga0495589_0099880 Ga0495589_0099880_298_918 201
549 3300046810 Ga0495660_0074718 Ga0495660_0074718_18_635 201
550 3300047317 Ga0495604_0021636 Ga0495604_0021636_1086_1703 201
551 3300047317 Ga0495604_0226293 Ga0495604_0226293_124_744 201
552 3300047319 Ga0495674_0016538 Ga0495674_0016538_2607_3227 201
553 3300047319 Ga0495674_0054418 Ga0495674_0054418_1600_2217 201
554 3300047319 Ga0495674_0270376 Ga0495674_0270376_656_1273 201
555 3300047321 Ga0495676_0007295 Ga0495676_0007295_7938_8555 201
556 3300047321 Ga0495676_0099540 Ga0495676_0099540_18_635 201
557 3300047322 Ga0495680_0003867 Ga0495680_0003867_7942_8559 201
558 3300047323 Ga0495683_0022416 Ga0495683_0022416_1293_1910 201
559 3300047323 Ga0495683_0084549 Ga0495683_0084549_13_633 201
560 3300047446 Ga0495679_001911 Ga0495679_001911_1422_2039 201
561 3300047447 Ga0495685_098361 Ga0495685_098361_305_922 201
562 3300047472 Ga0495686_0065065 Ga0495686_0065065_1181_1804 201
563 3300047673 Ga0495593_0028703 Ga0495593_0028703_1782_2399 201
564 3300047673 Ga0495593_0040811 Ga0495593_0040811_97_717 201
565 3300048089 Ga0495614_0003774 Ga0495614_0003774_2610_3227 201
566 3300048091 Ga0495626_0041950 Ga0495626_0041950_707_1327 201
567 3300048903 Ga0496100_0213160 Ga0496100_0213160_436_1056 201
568 3300048905 Ga0496102_0065372 Ga0496102_0065372_2439_3071 201
569 3300048906 Ga0496103_0004929 Ga0496103_0004929_5582_6202 201
570 3300048907 Ga0496104_0007782 Ga0496104_0007782_4655_5275 201
571 3300048908 Ga0496105_0055930 Ga0496105_0055930_2032_2652 201
572 3300048911 Ga0496108_0206721 Ga0496108_0206721_662_1282 201
573 3300048913 Ga0496110_0010435 Ga0496110_0010435_4596_5216 201
574 3300048915 Ga0496112_0004021 Ga0496112_0004021_2153_2773 201
575 3300048917 Ga0496114_0510647 Ga0496114_0510647_283_903 201
576 3300048918 Ga0496115_0104925 Ga0496115_0104925_1179_1799 201
577 3300048919 Ga0496116_0008846 Ga0496116_0008846_1926_2546 201
578 3300048920 Ga0496117_0003482 Ga0496117_0003482_3586_4206 201
579 3300048920 Ga0496117_0026468 Ga0496117_0026468_103_720 201
580 3300048921 Ga0496118_0014797 Ga0496118_0014797_2816_3436 201
581 3300048921 Ga0496118_0052070 Ga0496118_0052070_940_1557 201
582 3300048921 Ga0496118_0156726 Ga0496118_0156726_317_940 201
583 3300048922 Ga0496119_0204803 Ga0496119_0204803_194_814 201
584 3300048924 Ga0496121_0000333 Ga0496121_0000333_82416_83030 201
585 3300048924 Ga0496121_0017772 Ga0496121_0017772_4562_5182 201
586 3300048926 Ga0496123_0105432 Ga0496123_0105432_299_919 201
587 3300048927 Ga0496124_0151004 Ga0496124_0151004_827_1447 201
588 3300048928 Ga0496125_0052026 Ga0496125_0052026_424_1044 201
589 3300048929 Ga0496126_0002413 Ga0496126_0002413_13920_14534 201
590 3300048929 Ga0496126_0027437 Ga0496126_0027437_2419_3039 201
591 3300059492 Ga0587073_0102713 Ga0587073_0102713_102_710 201
592 3300059504 Ga0587082_053293 Ga0587082_053293_142_753 201
593 3300059510 Ga0587090_031471 Ga0587090_031471_21_638 201
594 3300059646 Ga0587078_029348 Ga0587078_029348_17_634 201
595 3300059647 Ga0587079_047612 Ga0587079_047612_253_867 201
596 3300061719 Ga0466962_0000412 Ga0466962_0000412_12571_13194 201
597 3300061719 Ga0466962_0173559 Ga0466962_0173559_386_991 201
598 3300001904 JGI24736J21556_1032396 JGI24736J21556_10323961 202
599 3300001915 JGI24741J21665_1020862 JGI24741J21665_10208622 202
600 3300001979 JGI24740J21852_10008433 JGI24740J21852_100084333 202
601 3300001989 JGI24739J22299_10015759 JGI24739J22299_100157593 202
602 3300001989 JGI24739J22299_10053645 JGI24739J22299_100536451 202
603 3300002067 JGI24735J21928_10002039 JGI24735J21928_100020397 202
604 3300002067 JGI24735J21928_10010740 JGI24735J21928_100107405 202
605 3300005339 Ga0070660_100001282 Ga0070660_10000128212 202
606 3300005339 Ga0070660_100002463 Ga0070660_10000246312 202
607 3300005366 Ga0070659_100000941 Ga0070659_1000009418 202
608 3300005455 Ga0070663_100000078 Ga0070663_10000007827 202
609 3300005563 Ga0068855_100002445 Ga0068855_10000244525 202
610 3300005563 Ga0068855_100024592 Ga0068855_1000245928 202
611 3300005564 Ga0070664_100018288 Ga0070664_1000182881 202
612 3300005614 Ga0068856_100798596 Ga0068856_1007985961 202
613 3300005616 Ga0068852_100209858 Ga0068852_1002098582 202
614 3300009092 Ga0105250_10001544 Ga0105250_100015448 202
615 3300009093 Ga0105240_10002069 Ga0105240_1000206920 202
616 3300009093 Ga0105240_10109589 Ga0105240_101095894 202
617 3300009093 Ga0105240_10143016 Ga0105240_101430163 202
618 3300009545 Ga0105237_10003905 Ga0105237_100039053 202
619 3300009545 Ga0105237_10014560 Ga0105237_100145603 202
620 3300009551 Ga0105238_10011579 Ga0105238_100115798 202
621 3300009551 Ga0105238_10159615 Ga0105238_101596151 202
622 3300010375 Ga0105239_10796970 Ga0105239_107969701 202
623 3300013100 Ga0157373_10050130 Ga0157373_100501303 202
624 3300013100 Ga0157373_10050698 Ga0157373_100506982 202
625 3300013104 Ga0157370_10219901 Ga0157370_102199013 202
626 3300013104 Ga0157370_10583055 Ga0157370_105830552 202
627 3300013105 Ga0157369_10029387 Ga0157369_100293873 202
628 3300013105 Ga0157369_10133483 Ga0157369_101334834 202
629 3300013296 Ga0157374_10000230 Ga0157374_1000023044 202
630 3300013307 Ga0157372_10003271 Ga0157372_1000327114 202
631 3300013307 Ga0157372_10127335 Ga0157372_101273354 202
632 3300013308 Ga0157375_10178118 Ga0157375_101781181 202
633 3300015261 Ga0182006_1061327 Ga0182006_10613272 202
634 3300015261 Ga0182006_1072622 Ga0182006_10726221 202
635 3300015262 Ga0182007_10086619 Ga0182007_100866191 202
636 3300015265 Ga0182005_1004296 Ga0182005_10042966 202
637 3300020069 Ga0197907_11270793 Ga0197907_112707932 202
638 3300020076 Ga0206355_1492387 Ga0206355_14923874 202
639 3300025228 Ga0209672_100088 Ga0209672_10008885 202
640 3300025228 Ga0209672_100289 Ga0209672_10028934 202
641 3300025229 Ga0209147_100130 Ga0209147_10013085 202
642 3300025242 Ga0209258_100204 Ga0209258_10020485 202
643 3300025256 Ga0209759_1003128 Ga0209759_10031287 202
644 3300025256 Ga0209759_1007337 Ga0209759_10073374 202
645 3300025711 Ga0207696_1005257 Ga0207696_10052576 202
646 3300025904 Ga0207647_10000161 Ga0207647_1000016154 202
647 3300025904 Ga0207647_10001999 Ga0207647_1000199912 202
648 3300025909 Ga0207705_10325384 Ga0207705_103253841 202
649 3300025913 Ga0207695_10005494 Ga0207695_1000549412 202
650 3300025913 Ga0207695_10008360 Ga0207695_100083603 202
651 3300025913 Ga0207695_10100894 Ga0207695_101008944 202
652 3300025914 Ga0207671_10008949 Ga0207671_100089493 202
653 3300025914 Ga0207671_10010980 Ga0207671_100109808 202
654 3300025914 Ga0207671_10294312 Ga0207671_102943122 202
655 3300025919 Ga0207657_10000022 Ga0207657_100000228 202
656 3300025919 Ga0207657_10021113 Ga0207657_100211137 202
657 3300025924 Ga0207694_10051653 Ga0207694_100516535 202
658 3300025932 Ga0207690_10000010 Ga0207690_10000010303 202
659 3300025945 Ga0207679_10056462 Ga0207679_100564621 202
660 3300025949 Ga0207667_10018019 Ga0207667_100180197 202
661 3300025949 Ga0207667_10052254 Ga0207667_100522542 202
662 3300026035 Ga0207703_10212184 Ga0207703_102121841 202
663 3300026067 Ga0207678_10000226 Ga0207678_1000022632 202
664 3300026078 Ga0207702_10418981 Ga0207702_104189812 202
665 3300026142 Ga0207698_10087208 Ga0207698_100872082 202
666 3300028800 Ga0265338_10000133 Ga0265338_1000013356 202
667 3300030836 Ga0265767_105182 Ga0265767_1051821 202
668 3300037418 Ga0395900_0118493 Ga0395900_0118493_62_679 202
669 3300037466 Ga0395898_0005183 Ga0395898_0005183_4870_5484 202
670 3300037466 Ga0395898_0383212 Ga0395898_0383212_559_1176 202
671 3300042005 Ga0439448_0000242 Ga0439448_0000242_2923_3540 202
672 3300044658 Ga0466972_0109688 Ga0466972_0109688_604_1212 202
673 3300044673 Ga0453683_0145506 Ga0453683_0145506_760_1395 202
674 3300044683 Ga0466965_0043811 Ga0466965_0043811_1492_2100 202
675 3300044693 Ga0466961_0067405 Ga0466961_0067405_1388_1996 202
676 3300044765 Ga0466970_0099096 Ga0466970_0099096_165_773 202
677 3300044842 Ga0466957_0067358 Ga0466957_0067358_127_735 202
678 3300044901 Ga0466960_0029954 Ga0466960_0029954_1611_2219 202
679 3300046455 Ga0495603_0016288 Ga0495603_0016288_3361_3981 202
680 3300046458 Ga0495591_005442 Ga0495591_005442_2447_3067 202
681 3300046459 Ga0495629_0001348 Ga0495629_0001348_5823_6443 202
682 3300046462 Ga0495651_0201333 Ga0495651_0201333_543_1163 202
683 3300046471 Ga0495650_0002161 Ga0495650_0002161_13174_13794 202
684 3300046472 Ga0495580_0024823 Ga0495580_0024823_815_1438 202
685 3300046472 Ga0495580_0034640 Ga0495580_0034640_2724_3344 202
686 3300046473 Ga0495582_0022261 Ga0495582_0022261_957_1577 202
687 3300046507 Ga0495606_0010464 Ga0495606_0010464_5741_6361 202
688 3300046517 Ga0495630_0035456 Ga0495630_0035456_1222_1842 202
689 3300046518 Ga0495631_0126571 Ga0495631_0126571_241_870 202
690 3300046530 Ga0495654_0063029 Ga0495654_0063029_1043_1663 202
691 3300046543 Ga0495645_0002307 Ga0495645_0002307_8028_8648 202
692 3300046559 Ga0495667_0124783 Ga0495667_0124783_669_1289 202
693 3300046680 Ga0495646_0147398 Ga0495646_0147398_85_705 202
694 3300046689 Ga0495613_0146088 Ga0495613_0146088_169_789 202
695 3300046694 Ga0495649_0010030 Ga0495649_0010030_4408_5028 202
696 3300046809 Ga0495600_0032604 Ga0495600_0032604_25_645 202
697 3300047315 Ga0495581_0008129 Ga0495581_0008129_4442_5062 202
698 3300047320 Ga0495672_0002712 Ga0495672_0002712_269_901 202
699 3300047323 Ga0495683_0140661 Ga0495683_0140661_361_987 202
700 3300047443 Ga0495687_007490 Ga0495687_007490_4474_5091 202
701 3300047445 Ga0495677_0065460 Ga0495677_0065460_132_752 202
702 3300047469 Ga0495673_0105101 Ga0495673_0105101_241_873 202
703 3300048903 Ga0496100_0234325 Ga0496100_0234325_216_836 202
704 3300048903 Ga0496100_0248364 Ga0496100_0248364_499_1119 202
705 3300048904 Ga0496101_0098202 Ga0496101_0098202_916_1536 202
706 3300048904 Ga0496101_0397191 Ga0496101_0397191_234_854 202
707 3300048907 Ga0496104_0092598 Ga0496104_0092598_1659_2279 202
708 3300048907 Ga0496104_0425582 Ga0496104_0425582_215_835 202
709 3300048908 Ga0496105_0095642 Ga0496105_0095642_221_841 202
710 3300048908 Ga0496105_0247082 Ga0496105_0247082_185_805 202
711 3300048909 Ga0496106_0389787 Ga0496106_0389787_463_1083 202
712 3300048912 Ga0496109_0471080 Ga0496109_0471080_475_1095 202
713 3300048915 Ga0496112_0144155 Ga0496112_0144155_1521_2141 202
714 3300048917 Ga0496114_0001303 Ga0496114_0001303_5366_5986 202
715 3300048917 Ga0496114_0355961 Ga0496114_0355961_345_974 202
716 3300048919 Ga0496116_0146119 Ga0496116_0146119_454_1074 202
717 3300048920 Ga0496117_0006043 Ga0496117_0006043_1815_2444 202
718 3300048920 Ga0496117_0152051 Ga0496117_0152051_467_1087 202
719 3300048921 Ga0496118_0009107 Ga0496118_0009107_1815_2444 202
720 3300048921 Ga0496118_0134601 Ga0496118_0134601_783_1403 202
721 3300048922 Ga0496119_0099868 Ga0496119_0099868_789_1409 202
722 3300048924 Ga0496121_0262167 Ga0496121_0262167_282_902 202
723 3300048925 Ga0496122_0068277 Ga0496122_0068277_204_824 202
724 3300048926 Ga0496123_0124646 Ga0496123_0124646_453_1073 202
725 3300048928 Ga0496125_0086639 Ga0496125_0086639_163_783 202
726 3300048928 Ga0496125_0284595 Ga0496125_0284595_363_989 202
727 3300048929 Ga0496126_0000088 Ga0496126_0000088_61131_61760 202
728 3300048929 Ga0496126_0005752 Ga0496126_0005752_6473_7099 202
729 3300059503 Ga0587080_005082 Ga0587080_005082_18_638 202
730 3300059504 Ga0587082_018637 Ga0587082_018637_462_1082 202
731 3300059645 Ga0587076_013093 Ga0587076_013093_615_1235 202
732 3300059652 Ga0587107_000692 Ga0587107_000692_98_718 202

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01386

Ribosomal_L25p

Ribosomal L25p family

26

113

0.95

PF14693

Ribosomal_TL5_C

Ribosomal protein TL5, C-terminal domain

128

193

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dnc-assembly1.cif.gz_Z e.coli rf1 bound to e.coli 70s ribosome in response to uau sense a-site codon 0.9575 2 93
6ysi-assembly1.cif.gz_R acinetobacter baumannii ribosome-tigecycline complex - 50s subunit 0.9523 2 93
7m4v-assembly1.cif.gz_U a. baumannii ribosome-eravacycline complex: 50s 0.9467 2 93
6ogg-assembly1.cif.gz_v 70s termination complex with rf2 bound to the uga codon. rotated ribosome with rf2 bound (structure iv). 0.9425 2 93
7unw-assembly1.cif.gz_X pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) 0.9303 2 186
ID Description Score Start End Superfamily
af_F4JPA3_178_267_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9329 99 186 2.170.120.20
af_Q2G0S0_95_176_2.170.120.20 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.9151 94 167 2.170.120.20
af_A0A0P0W059_2_141_2.40.240.10 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.908 2 94 2.40.240.10
af_P9WHB5_5_98_2.40.240.10 Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P 0.8927 2 93 2.40.240.10
4rb6Z02 Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain 0.8882 97 180 2.170.120.20
ID Description Score Start End GO Terms
AF-A0A351NNR7-F1-model_v4 deleted 0.9836 25 93
AF-A0A354Z455-F1-model_v4 50S ribosomal protein L25 0.9738 2 97 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A4P2SQK3-F1-model_v4 deleted 0.9711 1 92
AF-E6KXM6-F1-model_v4 Large ribosomal subunit protein bL25 0.9699 2 93 GO:0003735
GO:0006412
GO:0008097
GO:0022625
AF-A0A2H9U0J8-F1-model_v4 Large ribosomal subunit protein bL25 0.9662 2 93 GO:0003735
GO:0006412
GO:0008097
GO:0022625

Feature Viewer

pLDDT pTM Quality
82.11 0.63 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map