F478028
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 732 | 412 | 640 | 201 |
Family's Representative Sequence
| Representative Sequence | 3300009036|Ga0105244_10122364|Ga0105244_101223641 |
| Length | 215 |
| Sequence | MAAVQSRKPRFHCLVAGSYWSQNMKVVAFERNLQGTGASRRLRNSGKTPGIVYGADKEVQLVELDHNALWHALKKEVFHSSILDLEVGGKSQPVLLRDVQYHPFKQMVLHVDFQRVDPKKKLHTKVPLXFMVINELEVECLPGDLPEFLEIDLAKIEAGQTMHAKDIVLPKGVALVAHVEAENPVIASATIPAAGVSDAATGGXXXTGEGETPAA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 2 | 2501025502 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 5 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 6 | 2510917013 | Paraburkholderia unamae MTI-641 | Isolate | Rhizosphere |
| 7 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 8 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 9 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 10 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 11 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 12 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 13 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 14 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 15 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 16 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 17 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 18 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 19 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 20 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 21 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 22 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 23 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 24 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 25 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 26 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 27 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 28 | 2721755763 | Pandoraea thiooxydans ATSB16 | Isolate | Rhizosphere |
| 29 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 30 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 31 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 32 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 33 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 34 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 35 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 36 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 37 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 38 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 39 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 40 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 41 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 42 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 43 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 44 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 45 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 46 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 47 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 48 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 49 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 50 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 51 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 52 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 53 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 54 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 55 | 2894023352 | Diaphorobacter ruginosibacter DSM 27467 | Isolate | Nodule |
| 56 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 57 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 58 | 2904434214 | Robbsia andropogonis 1567 | Isolate | Rhizosphere |
| 59 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 60 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 61 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 62 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 63 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 64 | 2919704043 | Hydrogenophaga palleronii 4249 | Isolate | Unclassified |
| 65 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 66 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 67 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 68 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 69 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 70 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 71 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 72 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 73 | 2939631187 | Ottowia thiooxydans 2709 | Isolate | Rhizosphere |
| 74 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 75 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 76 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 77 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 78 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 79 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 80 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 81 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 82 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 83 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 84 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 85 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 86 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 87 | 3300003479 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 88 | 3300003565 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_16_lowP_mix3_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 89 | 3300003567 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_04_fullP_mix3_d1 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 90 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 91 | 3300003579 | Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 92 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 93 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 94 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 95 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 96 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 97 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 98 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 99 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 100 | 3300004801 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 101 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 102 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 105 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 107 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 108 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 110 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 111 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 112 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 114 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 115 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 116 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 117 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 118 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 119 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 120 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 121 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 122 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 123 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 124 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 125 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 126 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 127 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 128 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 129 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 130 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 131 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 132 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 140 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 141 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 142 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 143 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 144 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 145 | 3300019179 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI2 metaT (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 146 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 147 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 148 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 149 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 150 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 151 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 152 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 153 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 154 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 155 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 156 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 157 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 158 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 159 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 160 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 161 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 162 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 163 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 164 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 165 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 166 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 167 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 168 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 169 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 199 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 200 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 201 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300030836 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 203 | 3300030863 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 204 | 3300030888 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 205 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 206 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 207 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 208 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 209 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 211 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 212 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 213 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 214 | 3300032133 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA | Metagenome | Rhizosphere |
| 215 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 216 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 217 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 218 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 221 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 222 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 223 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 224 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 225 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 226 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 227 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 228 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 229 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 230 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 231 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 232 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 233 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 234 | 3300042129 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_070516_95 | Metagenome | Rhizosphere |
| 235 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 236 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 237 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 238 | 3300042532 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 | Metagenome | Rhizosphere |
| 239 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 240 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 241 | 3300044666 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E | Metagenome | Unclassified |
| 242 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 243 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 247 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 248 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 251 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 252 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 253 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 346 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 347 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 348 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 349 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 350 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 351 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 352 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 353 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 354 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 355 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 356 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 357 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 358 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 359 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 360 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 363 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 370 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 374 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 375 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 376 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 377 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 378 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 379 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 380 | 3300059507 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 381 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 382 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 386 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 387 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 388 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 389 | 3300059644 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 390 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 391 | 3300059646 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 393 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 394 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 395 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 396 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 397 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 398 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 399 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 400 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 401 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 402 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 403 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 404 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 405 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 406 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 407 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 408 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 409 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 410 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 411 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 412 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 81.01 |
| Metatranscriptomes | 6.42 |
| Isolates | 12.57 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.28 |
| Nodule | 2.87 |
| Rhizoplane | 6.01 |
| Rhizosphere | 72.54 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.3 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24736J21556_1032396 | 3300001904 | Bacteria | 807 |
| 2 | JGI24741J21665_1020862 | 3300001915 | Bacteria | 1027 |
| 3 | JGI24740J21852_10000889 | 3300001979 | Bacteria | 13228 |
| 4 | JGI24740J21852_10008433 | 3300001979 | Bacteria | 4105 |
| 5 | JGI24740J21852_10086375 | 3300001979 | Bacteria | 814 |
| 6 | JGI24739J22299_10010650 | 3300001989 | Bacteria | 3410 |
| 7 | JGI24739J22299_10015759 | 3300001989 | Bacteria | 2745 |
| 8 | JGI24739J22299_10017997 | 3300001989 | Bacteria | 2543 |
| 9 | JGI24739J22299_10053645 | 3300001989 | Bacteria | 1294 |
| 10 | JGI24735J21928_10002039 | 3300002067 | Bacteria | 7116 |
| 11 | JGI24735J21928_10002083 | 3300002067 | Bacteria | 7050 |
| 12 | JGI24735J21928_10010740 | 3300002067 | Bacteria | 2912 |
| 13 | JGI24738J21930_10004015 | 3300002075 | Bacteria | 3651 |
| 14 | JGI25156J39149_1017091 | 3300002705 | Bacteria | 1387 |
| 15 | JGI25164J39214_1006160 | 3300002772 | Bacteria | 1269 |
| 16 | JGI25165J46597_1001028 | 3300003214 | Bacteria | 18325 |
| 17 | JGI25160J50197_1000049 | 3300003354 | Bacteria | 135107 |
| 18 | Ga0006556J51387_1023789 | 3300003479 | Bacteria | 2348 |
| 19 | Ga0006560J51390_1025002 | 3300003565 | Bacteria | 887 |
| 20 | Ga0006554J51385_1022490 | 3300003567 | Bacteria | 2297 |
| 21 | Ga0007409J51694_1053338 | 3300003575 | Bacteria | 832 |
| 22 | Ga0007429J51699_1109854 | 3300003579 | Bacteria | 690 |
| 23 | Ga0055532_1000031 | 3300003758 | Bacteria | 231440 |
| 24 | Ga0055532_1002498 | 3300003758 | Bacteria | 3767 |
| 25 | Ga0055527_1000020 | 3300003760 | Bacteria | 231441 |
| 26 | Ga0055535_1000023 | 3300003761 | Bacteria | 231441 |
| 27 | Ga0055542_1000035 | 3300003762 | Bacteria | 231441 |
| 28 | Ga0055529_1000039 | 3300003763 | Bacteria | 231439 |
| 29 | Ga0055528_1007923 | 3300003790 | Bacteria | 4631 |
| 30 | Ga0055541_1004892 | 3300003841 | Bacteria | 2391 |
| 31 | Ga0058692_1002184 | 3300003856 | Bacteria | 6680 |
| 32 | Ga0058692_1023236 | 3300003856 | Bacteria | 1263 |
| 33 | Ga0058692_1031587 | 3300003856 | Bacteria | 995 |
| 34 | Ga0058860_11979007 | 3300004801 | Bacteria | 1585 |
| 35 | Ga0065165_1000115 | 3300005262 | Bacteria | 135145 |
| 36 | Ga0070658_10006938 | 3300005327 | Bacteria | 9149 |
| 37 | Ga0070658_10106790 | 3300005327 | Bacteria | 2317 |
| 38 | Ga0070658_10576092 | 3300005327 | Bacteria | 975 |
| 39 | Ga0070666_10008389 | 3300005335 | Bacteria | 6415 |
| 40 | Ga0070682_100115336 | 3300005337 | Bacteria | 1796 |
| 41 | Ga0070682_100200310 | 3300005337 | Bacteria | 1408 |
| 42 | Ga0070660_100001282 | 3300005339 | Bacteria | 17122 |
| 43 | Ga0070660_100002463 | 3300005339 | Bacteria | 12700 |
| 44 | Ga0070660_100011683 | 3300005339 | Bacteria | 6252 |
| 45 | Ga0070673_100347238 | 3300005364 | Bacteria | 1316 |
| 46 | Ga0070659_100000941 | 3300005366 | Bacteria | 21399 |
| 47 | Ga0070659_100179926 | 3300005366 | Bacteria | 1735 |
| 48 | Ga0070667_100027191 | 3300005367 | Bacteria | 4760 |
| 49 | Ga0070663_100000078 | 3300005455 | Bacteria | 42943 |
| 50 | Ga0070663_100009378 | 3300005455 | Bacteria | 6058 |
| 51 | Ga0070663_100402753 | 3300005455 | Bacteria | 1119 |
| 52 | Ga0070678_100100674 | 3300005456 | Bacteria | 2239 |
| 53 | Ga0070678_100282507 | 3300005456 | Bacteria | 1404 |
| 54 | Ga0068855_100002204 | 3300005563 | Bacteria | 24094 |
| 55 | Ga0068855_100002445 | 3300005563 | Bacteria | 22936 |
| 56 | Ga0068855_100022812 | 3300005563 | Bacteria | 7500 |
| 57 | Ga0068855_100024592 | 3300005563 | Bacteria | 7205 |
| 58 | Ga0070664_100018288 | 3300005564 | Bacteria | 5754 |
| 59 | Ga0068857_100659944 | 3300005577 | Bacteria | 992 |
| 60 | Ga0068856_100798596 | 3300005614 | Bacteria | 963 |
| 61 | Ga0068852_100209858 | 3300005616 | Bacteria | 1847 |
| 62 | Ga0068852_100912191 | 3300005616 | Bacteria | 896 |
| 63 | Ga0068862_100547741 | 3300005844 | Bacteria | 1104 |
| 64 | Ga0070717_10389748 | 3300006028 | Bacteria | 1250 |
| 65 | Ga0075365_10165942 | 3300006038 | Bacteria | 1540 |
| 66 | Ga0075363_100376705 | 3300006048 | Bacteria | 831 |
| 67 | Ga0075366_10109254 | 3300006195 | Bacteria | 1663 |
| 68 | Ga0075370_10000918 | 3300006353 | Bacteria | 12102 |
| 69 | Ga0105251_10000055 | 3300009011 | Bacteria | 105044 |
| 70 | Ga0105251_10000494 | 3300009011 | Bacteria | 37324 |
| 71 | Ga0105244_10056688 | 3300009036 | Bacteria | 1982 |
| 72 | Ga0105244_10122364 | 3300009036 | Bacteria | 1259 |
| 73 | Ga0105250_10001544 | 3300009092 | Bacteria | 12364 |
| 74 | Ga0105240_10002069 | 3300009093 | Bacteria | 32881 |
| 75 | Ga0105240_10109589 | 3300009093 | Bacteria | 3343 |
| 76 | Ga0105240_10143016 | 3300009093 | Bacteria | 2858 |
| 77 | Ga0105240_10187322 | 3300009093 | Bacteria | 2436 |
| 78 | Ga0105245_10578174 | 3300009098 | Bacteria | 1148 |
| 79 | Ga0105248_10038843 | 3300009177 | Bacteria | 5329 |
| 80 | Ga0105237_10003905 | 3300009545 | Bacteria | 17477 |
| 81 | Ga0105237_10014560 | 3300009545 | Bacteria | 8218 |
| 82 | Ga0105237_10205269 | 3300009545 | Bacteria | 1971 |
| 83 | Ga0105237_11256959 | 3300009545 | Bacteria | 747 |
| 84 | Ga0105238_10011579 | 3300009551 | Bacteria | 8887 |
| 85 | Ga0105238_10028874 | 3300009551 | Bacteria | 5649 |
| 86 | Ga0105238_10110806 | 3300009551 | Bacteria | 2725 |
| 87 | Ga0105238_10159615 | 3300009551 | Bacteria | 2230 |
| 88 | Ga0105249_10426684 | 3300009553 | Bacteria | 1361 |
| 89 | Ga0105239_10507765 | 3300010375 | Bacteria | 1371 |
| 90 | Ga0105239_10796970 | 3300010375 | Bacteria | 1082 |
| 91 | Ga0157373_10050130 | 3300013100 | Bacteria | 2974 |
| 92 | Ga0157373_10050698 | 3300013100 | Bacteria | 2955 |
| 93 | Ga0157371_10007924 | 3300013102 | Bacteria | 8524 |
| 94 | Ga0157370_10002906 | 3300013104 | Bacteria | 20425 |
| 95 | Ga0157370_10219901 | 3300013104 | Bacteria | 1759 |
| 96 | Ga0157370_10583055 | 3300013104 | Bacteria | 1024 |
| 97 | Ga0157369_10000089 | 3300013105 | Bacteria | 127323 |
| 98 | Ga0157369_10029387 | 3300013105 | Bacteria | 6074 |
| 99 | Ga0157369_10133483 | 3300013105 | Bacteria | 2630 |
| 100 | Ga0157374_10000230 | 3300013296 | Bacteria | 51820 |
| 101 | Ga0157374_10013236 | 3300013296 | Bacteria | 7197 |
| 102 | Ga0163162_10010537 | 3300013306 | Bacteria | 8991 |
| 103 | Ga0163162_10380794 | 3300013306 | Bacteria | 1544 |
| 104 | Ga0163162_11534499 | 3300013306 | Bacteria | 759 |
| 105 | Ga0157372_10003271 | 3300013307 | Bacteria | 17509 |
| 106 | Ga0157372_10103727 | 3300013307 | Bacteria | 3250 |
| 107 | Ga0157372_10127335 | 3300013307 | Bacteria | 2928 |
| 108 | Ga0157375_10178118 | 3300013308 | Bacteria | 2277 |
| 109 | Ga0157375_10725796 | 3300013308 | Bacteria | 1146 |
| 110 | Ga0182008_10027051 | 3300014497 | Bacteria | 2907 |
| 111 | Ga0182008_10096766 | 3300014497 | Bacteria | 1457 |
| 112 | Ga0182006_1061327 | 3300015261 | Bacteria | 1418 |
| 113 | Ga0182006_1072622 | 3300015261 | Bacteria | 1272 |
| 114 | Ga0182007_10001847 | 3300015262 | Bacteria | 11039 |
| 115 | Ga0182007_10008215 | 3300015262 | Bacteria | 4301 |
| 116 | Ga0182007_10086619 | 3300015262 | Bacteria | 1030 |
| 117 | Ga0182005_1004296 | 3300015265 | Bacteria | 4633 |
| 118 | Ga0183362_10005 | 3300015683 | Bacteria | 437616 |
| 119 | Ga0184593_111152 | 3300019179 | Bacteria | 806 |
| 120 | Ga0197907_11221094 | 3300020069 | Bacteria | 1076 |
| 121 | Ga0197907_11270793 | 3300020069 | Bacteria | 995 |
| 122 | Ga0206356_11658874 | 3300020070 | Bacteria | 1752 |
| 123 | Ga0206349_1238021 | 3300020075 | Bacteria | 1000 |
| 124 | Ga0206355_1492387 | 3300020076 | Bacteria | 2227 |
| 125 | Ga0206352_10995492 | 3300020078 | Bacteria | 1902 |
| 126 | Ga0206353_10800542 | 3300020082 | Bacteria | 1871 |
| 127 | Ga0224712_10000007 | 3300022467 | Bacteria | 29755 |
| 128 | Ga0209566_100164 | 3300025225 | Bacteria | 73577 |
| 129 | Ga0209674_101938 | 3300025226 | Bacteria | 4851 |
| 130 | Ga0209672_100001 | 3300025228 | Bacteria | 2828210 |
| 131 | Ga0209672_100046 | 3300025228 | Bacteria | 264244 |
| 132 | Ga0209672_100088 | 3300025228 | Bacteria | 121401 |
| 133 | Ga0209672_100289 | 3300025228 | Bacteria | 35192 |
| 134 | Ga0209147_100001 | 3300025229 | Bacteria | 2384371 |
| 135 | Ga0209147_100043 | 3300025229 | Bacteria | 300460 |
| 136 | Ga0209147_100130 | 3300025229 | Bacteria | 121401 |
| 137 | Ga0209147_100214 | 3300025229 | Bacteria | 60481 |
| 138 | Ga0209563_101354 | 3300025230 | Bacteria | 6650 |
| 139 | Ga0207427_100478 | 3300025231 | Bacteria | 21607 |
| 140 | Ga0209258_100001 | 3300025242 | Bacteria | 2384269 |
| 141 | Ga0209258_100023 | 3300025242 | Bacteria | 547286 |
| 142 | Ga0209258_100204 | 3300025242 | Bacteria | 121401 |
| 143 | Ga0209148_1000003 | 3300025254 | Bacteria | 2384288 |
| 144 | Ga0209148_1000029 | 3300025254 | Bacteria | 579199 |
| 145 | Ga0209759_1000037 | 3300025256 | Bacteria | 259200 |
| 146 | Ga0209759_1000175 | 3300025256 | Bacteria | 106788 |
| 147 | Ga0209759_1000649 | 3300025256 | Bacteria | 32356 |
| 148 | Ga0209759_1003128 | 3300025256 | Bacteria | 6767 |
| 149 | Ga0209759_1007337 | 3300025256 | Bacteria | 3558 |
| 150 | Ga0209233_1000123 | 3300025261 | Bacteria | 228400 |
| 151 | Ga0209565_1018119 | 3300025263 | Bacteria | 1529 |
| 152 | Ga0209455_1000001 | 3300025272 | Bacteria | 2384278 |
| 153 | Ga0209455_1000064 | 3300025272 | Bacteria | 332404 |
| 154 | Ga0209673_1000084 | 3300025273 | Bacteria | 215878 |
| 155 | Ga0209130_1027198 | 3300025284 | Bacteria | 1218 |
| 156 | Ga0209564_1002711 | 3300025295 | Bacteria | 13373 |
| 157 | Ga0209564_1007255 | 3300025295 | Bacteria | 5759 |
| 158 | Ga0207426_1000007 | 3300025302 | Bacteria | 971011 |
| 159 | Ga0207426_1003361 | 3300025302 | Bacteria | 8780 |
| 160 | Ga0207696_1005257 | 3300025711 | Bacteria | 5400 |
| 161 | Ga0207713_1000089 | 3300025735 | Bacteria | 152927 |
| 162 | Ga0207713_1000106 | 3300025735 | Bacteria | 137911 |
| 163 | Ga0207713_1031275 | 3300025735 | Bacteria | 2355 |
| 164 | Ga0207680_10010657 | 3300025903 | Bacteria | 4609 |
| 165 | Ga0207647_10000161 | 3300025904 | Bacteria | 52943 |
| 166 | Ga0207647_10001999 | 3300025904 | Bacteria | 15600 |
| 167 | Ga0207647_10011776 | 3300025904 | Bacteria | 6117 |
| 168 | Ga0207705_10000452 | 3300025909 | Bacteria | 35262 |
| 169 | Ga0207705_10112980 | 3300025909 | Bacteria | 2008 |
| 170 | Ga0207705_10325384 | 3300025909 | Bacteria | 1182 |
| 171 | Ga0207695_10005494 | 3300025913 | Bacteria | 16777 |
| 172 | Ga0207695_10008360 | 3300025913 | Bacteria | 12965 |
| 173 | Ga0207695_10032748 | 3300025913 | Bacteria | 5683 |
| 174 | Ga0207695_10100894 | 3300025913 | Bacteria | 2881 |
| 175 | Ga0207695_10327799 | 3300025913 | Bacteria | 1420 |
| 176 | Ga0207671_10008949 | 3300025914 | Bacteria | 8425 |
| 177 | Ga0207671_10010980 | 3300025914 | Bacteria | 7417 |
| 178 | Ga0207671_10137737 | 3300025914 | Bacteria | 1878 |
| 179 | Ga0207671_10294312 | 3300025914 | Bacteria | 1282 |
| 180 | Ga0207660_10151402 | 3300025917 | Bacteria | 1782 |
| 181 | Ga0207657_10000022 | 3300025919 | Bacteria | 154101 |
| 182 | Ga0207657_10021113 | 3300025919 | Bacteria | 6135 |
| 183 | Ga0207657_10037495 | 3300025919 | Bacteria | 4327 |
| 184 | Ga0207657_10067166 | 3300025919 | Bacteria | 3050 |
| 185 | Ga0207694_10051653 | 3300025924 | Bacteria | 3186 |
| 186 | Ga0207687_10432405 | 3300025927 | Bacteria | 1088 |
| 187 | Ga0207644_10617556 | 3300025931 | Bacteria | 901 |
| 188 | Ga0207690_10000010 | 3300025932 | Bacteria | 330298 |
| 189 | Ga0207690_10142514 | 3300025932 | Bacteria | 1768 |
| 190 | Ga0207669_10847820 | 3300025937 | Bacteria | 760 |
| 191 | Ga0207711_10220466 | 3300025941 | Bacteria | 1735 |
| 192 | Ga0207679_10056462 | 3300025945 | Bacteria | 2899 |
| 193 | Ga0207667_10000701 | 3300025949 | Bacteria | 43431 |
| 194 | Ga0207667_10018019 | 3300025949 | Bacteria | 7930 |
| 195 | Ga0207667_10052254 | 3300025949 | Bacteria | 4305 |
| 196 | Ga0207667_10506810 | 3300025949 | Bacteria | 1224 |
| 197 | Ga0207651_10060430 | 3300025960 | Bacteria | 2631 |
| 198 | Ga0207658_10029361 | 3300025986 | Bacteria | 3883 |
| 199 | Ga0207703_10212184 | 3300026035 | Bacteria | 1727 |
| 200 | Ga0207639_10561412 | 3300026041 | Bacteria | 1049 |
| 201 | Ga0207678_10000226 | 3300026067 | Bacteria | 50299 |
| 202 | Ga0207678_10014828 | 3300026067 | Bacteria | 6857 |
| 203 | Ga0207678_10044383 | 3300026067 | Bacteria | 3846 |
| 204 | Ga0207678_10155596 | 3300026067 | Bacteria | 1952 |
| 205 | Ga0207702_10418981 | 3300026078 | Bacteria | 1295 |
| 206 | Ga0207674_10397010 | 3300026116 | Bacteria | 1333 |
| 207 | Ga0207683_10126389 | 3300026121 | Bacteria | 2298 |
| 208 | Ga0207698_10087208 | 3300026142 | Bacteria | 2541 |
| 209 | Ga0209371_1000160 | 3300027312 | Bacteria | 103642 |
| 210 | Ga0209371_1001668 | 3300027312 | Bacteria | 14222 |
| 211 | Ga0209971_1002743 | 3300027682 | Bacteria | 4207 |
| 212 | Ga0209974_10013617 | 3300027876 | Bacteria | 2709 |
| 213 | Ga0265318_10061967 | 3300028577 | Bacteria | 1393 |
| 214 | Ga0307515_10000040 | 3300028794 | Bacteria | 322704 |
| 215 | Ga0265338_10000133 | 3300028800 | Bacteria | 136570 |
| 216 | Ga0268256_1000132 | 3300030500 | Bacteria | 103642 |
| 217 | Ga0268256_1001457 | 3300030500 | Bacteria | 14207 |
| 218 | Ga0265767_105182 | 3300030836 | Bacteria | 786 |
| 219 | Ga0265766_1000743 | 3300030863 | Bacteria | 1471 |
| 220 | Ga0265769_104049 | 3300030888 | Bacteria | 841 |
| 221 | Ga0265332_10000028 | 3300031238 | Bacteria | 184029 |
| 222 | Ga0265320_10079453 | 3300031240 | Bacteria | 1533 |
| 223 | Ga0265325_10001397 | 3300031241 | Bacteria | 17039 |
| 224 | Ga0307408_100001314 | 3300031548 | Bacteria | 18632 |
| 225 | Ga0265314_10000054 | 3300031711 | Bacteria | 184029 |
| 226 | Ga0265314_10001337 | 3300031711 | Bacteria | 27913 |
| 227 | Ga0307405_10024361 | 3300031731 | Bacteria | 3456 |
| 228 | Ga0307405_10178379 | 3300031731 | Bacteria | 1523 |
| 229 | Ga0307412_10000014 | 3300031911 | Bacteria | 353795 |
| 230 | Ga0307409_100070534 | 3300031995 | Bacteria | 2774 |
| 231 | Ga0307416_100582390 | 3300032002 | Bacteria | 1196 |
| 232 | Ga0316583_10000293 | 3300032133 | Bacteria | 14030 |
| 233 | Ga0395899_0000031 | 3300037312 | Bacteria | 322356 |
| 234 | Ga0395899_0041658 | 3300037312 | Bacteria | 3431 |
| 235 | Ga0395899_0050724 | 3300037312 | Bacteria | 3081 |
| 236 | Ga0395899_0146951 | 3300037312 | Bacteria | 1673 |
| 237 | Ga0395900_0000057 | 3300037418 | Bacteria | 212535 |
| 238 | Ga0395900_0000158 | 3300037418 | Bacteria | 112053 |
| 239 | Ga0395900_0036214 | 3300037418 | Bacteria | 5086 |
| 240 | Ga0395900_0038341 | 3300037418 | Bacteria | 4938 |
| 241 | Ga0395900_0105733 | 3300037418 | Bacteria | 2891 |
| 242 | Ga0395900_0118493 | 3300037418 | Bacteria | 2717 |
| 243 | Ga0395900_0283691 | 3300037418 | Bacteria | 1647 |
| 244 | Ga0395898_0000040 | 3300037466 | Bacteria | 317329 |
| 245 | Ga0395898_0005183 | 3300037466 | Bacteria | 14097 |
| 246 | Ga0395898_0007346 | 3300037466 | Bacteria | 11695 |
| 247 | Ga0395898_0023156 | 3300037466 | Bacteria | 6278 |
| 248 | Ga0395898_0077260 | 3300037466 | Bacteria | 3214 |
| 249 | Ga0395898_0383212 | 3300037466 | Bacteria | 1341 |
| 250 | Ga0395905_0000014 | 3300037471 | Bacteria | 394209 |
| 251 | Ga0395905_0018267 | 3300037471 | Bacteria | 6657 |
| 252 | Ga0395905_0116681 | 3300037471 | Bacteria | 2509 |
| 253 | Ga0395905_0134600 | 3300037471 | Bacteria | 2324 |
| 254 | Ga0395905_0437596 | 3300037471 | Bacteria | 1205 |
| 255 | Ga0395901_0001107 | 3300038443 | Bacteria | 28663 |
| 256 | Ga0395901_0001810 | 3300038443 | Bacteria | 22075 |
| 257 | Ga0395901_0004171 | 3300038443 | Bacteria | 14590 |
| 258 | Ga0395901_0056623 | 3300038443 | Bacteria | 4078 |
| 259 | Ga0395901_0155248 | 3300038443 | Bacteria | 2404 |
| 260 | Ga0395901_0245392 | 3300038443 | Bacteria | 1867 |
| 261 | Ga0395901_0754943 | 3300038443 | Bacteria | 965 |
| 262 | Ga0436361_0762421 | 3300039447 | Bacteria | 1842 |
| 263 | Ga0439438_055437 | 3300041405 | Bacteria | 1000 |
| 264 | Ga0439447_033256 | 3300041407 | Bacteria | 1286 |
| 265 | Ga0439466_0022944 | 3300041411 | Bacteria | 2198 |
| 266 | Ga0439465_0000277 | 3300041413 | Bacteria | 14344 |
| 267 | Ga0439433_0001048 | 3300041999 | Bacteria | 5613 |
| 268 | Ga0439442_024900 | 3300042002 | Bacteria | 1245 |
| 269 | Ga0439445_0000763 | 3300042004 | Bacteria | 6751 |
| 270 | Ga0439448_0000242 | 3300042005 | Bacteria | 11681 |
| 271 | Ga0439432_001936 | 3300042006 | Bacteria | 7821 |
| 272 | Ga0439449_0000120 | 3300042007 | Bacteria | 25953 |
| 273 | Ga0439452_002310 | 3300042010 | Bacteria | 7105 |
| 274 | Ga0439457_056205 | 3300042014 | Bacteria | 887 |
| 275 | Ga0450915_002349 | 3300042119 | Bacteria | 983 |
| 276 | Ga0450891_005582 | 3300042129 | Bacteria | 1163 |
| 277 | Ga0450903_015969 | 3300042138 | Bacteria | 1180 |
| 278 | Ga0439434_0032164 | 3300042435 | Bacteria | 1596 |
| 279 | Ga0439434_0068203 | 3300042435 | Bacteria | 1117 |
| 280 | Ga0439459_0073835 | 3300042438 | Bacteria | 794 |
| 281 | Ga0450893_0018651 | 3300042532 | Bacteria | 1183 |
| 282 | Ga0466969_0000396 | 3300044656 | Bacteria | 23866 |
| 283 | Ga0466969_0011439 | 3300044656 | Bacteria | 4698 |
| 284 | Ga0466969_0145172 | 3300044656 | Bacteria | 1095 |
| 285 | Ga0466972_0051825 | 3300044658 | Bacteria | 1979 |
| 286 | Ga0466972_0109688 | 3300044658 | Bacteria | 1304 |
| 287 | Ga0466977_0000098 | 3300044666 | Bacteria | 18255 |
| 288 | Ga0453683_0145506 | 3300044673 | Bacteria | 1496 |
| 289 | Ga0453683_0390378 | 3300044673 | Bacteria | 897 |
| 290 | Ga0466965_0000909 | 3300044683 | Bacteria | 11333 |
| 291 | Ga0466965_0043811 | 3300044683 | Bacteria | 2210 |
| 292 | Ga0466965_0078936 | 3300044683 | Bacteria | 1662 |
| 293 | Ga0466965_0222614 | 3300044683 | Bacteria | 1006 |
| 294 | Ga0466966_0000006 | 3300044684 | Bacteria | 179770 |
| 295 | Ga0466966_0000265 | 3300044684 | Bacteria | 34719 |
| 296 | Ga0466966_0033167 | 3300044684 | Bacteria | 3343 |
| 297 | Ga0466966_0048187 | 3300044684 | Bacteria | 2715 |
| 298 | Ga0466966_0185756 | 3300044684 | Bacteria | 1260 |
| 299 | Ga0466961_0000989 | 3300044693 | Bacteria | 17560 |
| 300 | Ga0466961_0014170 | 3300044693 | Bacteria | 5116 |
| 301 | Ga0466961_0019264 | 3300044693 | Bacteria | 4391 |
| 302 | Ga0466961_0067405 | 3300044693 | Bacteria | 2273 |
| 303 | Ga0466961_0074687 | 3300044693 | Bacteria | 2149 |
| 304 | Ga0466961_0106695 | 3300044693 | Bacteria | 1763 |
| 305 | Ga0466963_0000828 | 3300044694 | Bacteria | 15502 |
| 306 | Ga0466963_0001975 | 3300044694 | Bacteria | 11261 |
| 307 | Ga0466963_0006961 | 3300044694 | Bacteria | 6730 |
| 308 | Ga0466964_0002065 | 3300044706 | Bacteria | 7067 |
| 309 | Ga0466964_0026561 | 3300044706 | Bacteria | 2267 |
| 310 | Ga0466971_0003814 | 3300044719 | Bacteria | 6450 |
| 311 | Ga0466971_0007013 | 3300044719 | Bacteria | 4905 |
| 312 | Ga0466971_0103264 | 3300044719 | Bacteria | 1311 |
| 313 | Ga0466968_0043784 | 3300044735 | Bacteria | 1896 |
| 314 | Ga0466968_0062794 | 3300044735 | Bacteria | 1605 |
| 315 | Ga0466970_0009250 | 3300044765 | Bacteria | 4973 |
| 316 | Ga0466970_0014867 | 3300044765 | Bacteria | 4000 |
| 317 | Ga0466970_0099096 | 3300044765 | Bacteria | 1586 |
| 318 | Ga0466957_0016747 | 3300044842 | Bacteria | 4287 |
| 319 | Ga0466957_0034949 | 3300044842 | Bacteria | 3015 |
| 320 | Ga0466957_0067358 | 3300044842 | Bacteria | 2208 |
| 321 | Ga0466957_0068577 | 3300044842 | Bacteria | 2190 |
| 322 | Ga0466957_0226919 | 3300044842 | Bacteria | 1235 |
| 323 | Ga0466960_0027899 | 3300044901 | Bacteria | 2580 |
| 324 | Ga0466960_0029954 | 3300044901 | Bacteria | 2501 |
| 325 | Ga0466959_0031486 | 3300045049 | Bacteria | 3923 |
| 326 | Ga0466959_0080461 | 3300045049 | Bacteria | 2348 |
| 327 | Ga0466959_0088349 | 3300045049 | Bacteria | 2228 |
| 328 | Ga0466959_0095125 | 3300045049 | Bacteria | 2136 |
| 329 | Ga0466959_0253906 | 3300045049 | Bacteria | 1212 |
| 330 | Ga0466958_0000920 | 3300045836 | Bacteria | 13233 |
| 331 | Ga0466958_0060887 | 3300045836 | Bacteria | 2298 |
| 332 | Ga0466958_0066342 | 3300045836 | Bacteria | 2203 |
| 333 | Ga0466958_0083118 | 3300045836 | Bacteria | 1973 |
| 334 | Ga0466967_0313178 | 3300045976 | Bacteria | 1512 |
| 335 | Ga0466967_0430688 | 3300045976 | Bacteria | 1287 |
| 336 | Ga0466967_0508282 | 3300045976 | Bacteria | 1183 |
| 337 | Ga0466967_0849871 | 3300045976 | Bacteria | 907 |
| 338 | Ga0495603_0016288 | 3300046455 | Bacteria | 4499 |
| 339 | Ga0495603_0024167 | 3300046455 | Bacteria | 3674 |
| 340 | Ga0495603_0247004 | 3300046455 | Bacteria | 1027 |
| 341 | Ga0495590_0014919 | 3300046457 | Bacteria | 2830 |
| 342 | Ga0495590_0018763 | 3300046457 | Bacteria | 2474 |
| 343 | Ga0495590_0020946 | 3300046457 | Bacteria | 2320 |
| 344 | Ga0495590_0033229 | 3300046457 | Bacteria | 1804 |
| 345 | Ga0495591_000791 | 3300046458 | Bacteria | 22446 |
| 346 | Ga0495591_005442 | 3300046458 | Bacteria | 5902 |
| 347 | Ga0495629_0001348 | 3300046459 | Bacteria | 19354 |
| 348 | Ga0495629_0003125 | 3300046459 | Bacteria | 12552 |
| 349 | Ga0495629_0027184 | 3300046459 | Bacteria | 4064 |
| 350 | Ga0495629_0033751 | 3300046459 | Bacteria | 3619 |
| 351 | Ga0495638_0004867 | 3300046460 | Bacteria | 10106 |
| 352 | Ga0495638_0012178 | 3300046460 | Bacteria | 5905 |
| 353 | Ga0495641_0013831 | 3300046461 | Bacteria | 4402 |
| 354 | Ga0495651_0201333 | 3300046462 | Bacteria | 1393 |
| 355 | Ga0495653_0112901 | 3300046463 | Bacteria | 1949 |
| 356 | Ga0495653_0311867 | 3300046463 | Bacteria | 1022 |
| 357 | Ga0495650_0002161 | 3300046471 | Bacteria | 16666 |
| 358 | Ga0495650_0014347 | 3300046471 | Bacteria | 4130 |
| 359 | Ga0495580_0007525 | 3300046472 | Bacteria | 8746 |
| 360 | Ga0495580_0024823 | 3300046472 | Bacteria | 4383 |
| 361 | Ga0495580_0034640 | 3300046472 | Bacteria | 3634 |
| 362 | Ga0495582_0022261 | 3300046473 | Bacteria | 3468 |
| 363 | Ga0495605_0001100 | 3300046474 | Bacteria | 17990 |
| 364 | Ga0495605_0002292 | 3300046474 | Bacteria | 11951 |
| 365 | Ga0495605_0002952 | 3300046474 | Bacteria | 10296 |
| 366 | Ga0495605_0014364 | 3300046474 | Bacteria | 4340 |
| 367 | Ga0495662_0024459 | 3300046476 | Bacteria | 2914 |
| 368 | Ga0495664_0000322 | 3300046477 | Bacteria | 23081 |
| 369 | Ga0495664_0016121 | 3300046477 | Bacteria | 4255 |
| 370 | Ga0495664_0032119 | 3300046477 | Bacteria | 3079 |
| 371 | Ga0495664_0171882 | 3300046477 | Bacteria | 1314 |
| 372 | Ga0495584_0107186 | 3300046491 | Bacteria | 1413 |
| 373 | Ga0495584_0231350 | 3300046491 | Bacteria | 940 |
| 374 | Ga0495585_0144608 | 3300046492 | Bacteria | 1243 |
| 375 | Ga0495596_0006565 | 3300046500 | Bacteria | 5338 |
| 376 | Ga0495596_0022942 | 3300046500 | Bacteria | 2536 |
| 377 | Ga0495607_0096904 | 3300046501 | Bacteria | 1587 |
| 378 | Ga0495583_0005045 | 3300046506 | Bacteria | 9123 |
| 379 | Ga0495583_0048668 | 3300046506 | Bacteria | 1944 |
| 380 | Ga0495606_0005895 | 3300046507 | Bacteria | 11527 |
| 381 | Ga0495606_0010464 | 3300046507 | Bacteria | 7692 |
| 382 | Ga0495608_0063287 | 3300046511 | Bacteria | 2428 |
| 383 | Ga0495610_0041979 | 3300046512 | Bacteria | 2291 |
| 384 | Ga0495610_0129169 | 3300046512 | Bacteria | 1099 |
| 385 | Ga0495616_0026456 | 3300046513 | Bacteria | 3088 |
| 386 | Ga0495618_0011397 | 3300046514 | Bacteria | 5391 |
| 387 | Ga0495620_0050120 | 3300046515 | Bacteria | 1783 |
| 388 | Ga0495620_0052476 | 3300046515 | Bacteria | 1731 |
| 389 | Ga0495628_0002241 | 3300046516 | Bacteria | 17484 |
| 390 | Ga0495628_0066576 | 3300046516 | Bacteria | 2815 |
| 391 | Ga0495628_0101891 | 3300046516 | Bacteria | 2215 |
| 392 | Ga0495628_0180987 | 3300046516 | Bacteria | 1594 |
| 393 | Ga0495630_0035456 | 3300046517 | Bacteria | 3728 |
| 394 | Ga0495630_0061353 | 3300046517 | Bacteria | 2823 |
| 395 | Ga0495630_0119088 | 3300046517 | Bacteria | 2002 |
| 396 | Ga0495630_0131539 | 3300046517 | Bacteria | 1900 |
| 397 | Ga0495631_0126571 | 3300046518 | Bacteria | 1098 |
| 398 | Ga0495643_0289574 | 3300046522 | Bacteria | 750 |
| 399 | Ga0495648_0016582 | 3300046524 | Bacteria | 5306 |
| 400 | Ga0495648_0027013 | 3300046524 | Bacteria | 3851 |
| 401 | Ga0495648_0035781 | 3300046524 | Bacteria | 3214 |
| 402 | Ga0495666_0037013 | 3300046526 | Bacteria | 2374 |
| 403 | Ga0495642_0012144 | 3300046528 | Bacteria | 3318 |
| 404 | Ga0495642_0014713 | 3300046528 | Bacteria | 3035 |
| 405 | Ga0495652_0028132 | 3300046529 | Bacteria | 4950 |
| 406 | Ga0495652_0040219 | 3300046529 | Bacteria | 4041 |
| 407 | Ga0495652_0081619 | 3300046529 | Bacteria | 2666 |
| 408 | Ga0495654_0063029 | 3300046530 | Bacteria | 1776 |
| 409 | Ga0495665_0019441 | 3300046531 | Bacteria | 3653 |
| 410 | Ga0495665_0024081 | 3300046531 | Bacteria | 3269 |
| 411 | Ga0495640_0024178 | 3300046533 | Bacteria | 4420 |
| 412 | Ga0495586_0052371 | 3300046535 | Bacteria | 2210 |
| 413 | Ga0495587_0008118 | 3300046536 | Bacteria | 6765 |
| 414 | Ga0495609_0073917 | 3300046538 | Bacteria | 1495 |
| 415 | Ga0495597_0008217 | 3300046542 | Bacteria | 5247 |
| 416 | Ga0495597_0100480 | 3300046542 | Bacteria | 1220 |
| 417 | Ga0495645_0000279 | 3300046543 | Bacteria | 37572 |
| 418 | Ga0495645_0002307 | 3300046543 | Bacteria | 12965 |
| 419 | Ga0495645_0007946 | 3300046543 | Bacteria | 7383 |
| 420 | Ga0495645_0023746 | 3300046543 | Bacteria | 4443 |
| 421 | Ga0495622_0000682 | 3300046557 | Bacteria | 19291 |
| 422 | Ga0495667_0124783 | 3300046559 | Bacteria | 1662 |
| 423 | Ga0495656_0116874 | 3300046615 | Bacteria | 1254 |
| 424 | Ga0495611_0017563 | 3300046648 | Bacteria | 3061 |
| 425 | Ga0495635_0004906 | 3300046663 | Bacteria | 9303 |
| 426 | Ga0495635_0059149 | 3300046663 | Bacteria | 2635 |
| 427 | Ga0495635_0059985 | 3300046663 | Bacteria | 2616 |
| 428 | Ga0495661_0016604 | 3300046665 | Bacteria | 4874 |
| 429 | Ga0495588_0114771 | 3300046674 | Bacteria | 1419 |
| 430 | Ga0495657_0080549 | 3300046675 | Bacteria | 2107 |
| 431 | Ga0495599_0017111 | 3300046678 | Bacteria | 4505 |
| 432 | Ga0495599_0022737 | 3300046678 | Bacteria | 3915 |
| 433 | Ga0495623_0008038 | 3300046679 | Bacteria | 6857 |
| 434 | Ga0495623_0044486 | 3300046679 | Bacteria | 2821 |
| 435 | Ga0495623_0115579 | 3300046679 | Bacteria | 1621 |
| 436 | Ga0495646_0004119 | 3300046680 | Bacteria | 9126 |
| 437 | Ga0495646_0014508 | 3300046680 | Bacteria | 5008 |
| 438 | Ga0495646_0035582 | 3300046680 | Bacteria | 3088 |
| 439 | Ga0495646_0040978 | 3300046680 | Bacteria | 2848 |
| 440 | Ga0495646_0147398 | 3300046680 | Bacteria | 1311 |
| 441 | Ga0495669_0015128 | 3300046684 | Bacteria | 3301 |
| 442 | Ga0495669_0035818 | 3300046684 | Bacteria | 2192 |
| 443 | Ga0495669_0129940 | 3300046684 | Bacteria | 1185 |
| 444 | Ga0495613_0009641 | 3300046689 | Bacteria | 7173 |
| 445 | Ga0495613_0077303 | 3300046689 | Bacteria | 2421 |
| 446 | Ga0495613_0146088 | 3300046689 | Bacteria | 1687 |
| 447 | Ga0495624_0006559 | 3300046690 | Bacteria | 8243 |
| 448 | Ga0495624_0008020 | 3300046690 | Bacteria | 7398 |
| 449 | Ga0495624_0009643 | 3300046690 | Bacteria | 6683 |
| 450 | Ga0495624_0011954 | 3300046690 | Bacteria | 5950 |
| 451 | Ga0495670_0060215 | 3300046691 | Bacteria | 1907 |
| 452 | Ga0495649_0007008 | 3300046694 | Bacteria | 6949 |
| 453 | Ga0495649_0010030 | 3300046694 | Bacteria | 5600 |
| 454 | Ga0495649_0034391 | 3300046694 | Bacteria | 2788 |
| 455 | Ga0495649_0146296 | 3300046694 | Bacteria | 1242 |
| 456 | Ga0495649_0241755 | 3300046694 | Bacteria | 929 |
| 457 | Ga0495589_0003243 | 3300046794 | Bacteria | 8868 |
| 458 | Ga0495589_0030616 | 3300046794 | Bacteria | 2710 |
| 459 | Ga0495589_0046246 | 3300046794 | Bacteria | 2160 |
| 460 | Ga0495589_0099880 | 3300046794 | Bacteria | 1405 |
| 461 | Ga0495600_0032604 | 3300046809 | Bacteria | 3381 |
| 462 | Ga0495660_0074718 | 3300046810 | Bacteria | 1790 |
| 463 | Ga0495660_0097087 | 3300046810 | Bacteria | 1522 |
| 464 | Ga0495581_0008129 | 3300047315 | Bacteria | 6076 |
| 465 | Ga0495604_0021636 | 3300047317 | Bacteria | 5134 |
| 466 | Ga0495604_0226293 | 3300047317 | Bacteria | 1285 |
| 467 | Ga0495674_0002606 | 3300047319 | Bacteria | 17571 |
| 468 | Ga0495674_0003654 | 3300047319 | Bacteria | 14968 |
| 469 | Ga0495674_0016538 | 3300047319 | Bacteria | 6883 |
| 470 | Ga0495674_0054418 | 3300047319 | Bacteria | 3514 |
| 471 | Ga0495674_0119954 | 3300047319 | Bacteria | 2222 |
| 472 | Ga0495674_0270376 | 3300047319 | Bacteria | 1394 |
| 473 | Ga0495672_0002712 | 3300047320 | Bacteria | 15890 |
| 474 | Ga0495672_0008928 | 3300047320 | Bacteria | 7320 |
| 475 | Ga0495672_0038179 | 3300047320 | Bacteria | 2931 |
| 476 | Ga0495676_0007295 | 3300047321 | Bacteria | 10140 |
| 477 | Ga0495676_0099540 | 3300047321 | Bacteria | 2154 |
| 478 | Ga0495680_0003867 | 3300047322 | Bacteria | 14484 |
| 479 | Ga0495680_0051852 | 3300047322 | Bacteria | 3200 |
| 480 | Ga0495683_0021686 | 3300047323 | Bacteria | 3308 |
| 481 | Ga0495683_0022416 | 3300047323 | Bacteria | 3247 |
| 482 | Ga0495683_0056752 | 3300047323 | Bacteria | 1947 |
| 483 | Ga0495683_0084549 | 3300047323 | Bacteria | 1544 |
| 484 | Ga0495683_0140661 | 3300047323 | Bacteria | 1131 |
| 485 | Ga0495687_000011 | 3300047443 | Bacteria | 397225 |
| 486 | Ga0495687_007490 | 3300047443 | Bacteria | 6421 |
| 487 | Ga0495687_014212 | 3300047443 | Bacteria | 4111 |
| 488 | Ga0495687_031185 | 3300047443 | Bacteria | 2447 |
| 489 | Ga0495675_0044483 | 3300047444 | Bacteria | 2828 |
| 490 | Ga0495677_0065460 | 3300047445 | Bacteria | 1351 |
| 491 | Ga0495679_000007 | 3300047446 | Bacteria | 401482 |
| 492 | Ga0495679_001911 | 3300047446 | Bacteria | 11157 |
| 493 | Ga0495679_028612 | 3300047446 | Bacteria | 1826 |
| 494 | Ga0495685_098361 | 3300047447 | Bacteria | 967 |
| 495 | Ga0495673_0006209 | 3300047469 | Bacteria | 7070 |
| 496 | Ga0495673_0105101 | 3300047469 | Bacteria | 1136 |
| 497 | Ga0495686_0034612 | 3300047472 | Bacteria | 3251 |
| 498 | Ga0495686_0065065 | 3300047472 | Bacteria | 2255 |
| 499 | Ga0495593_0021760 | 3300047673 | Bacteria | 3577 |
| 500 | Ga0495593_0028703 | 3300047673 | Bacteria | 3054 |
| 501 | Ga0495593_0033915 | 3300047673 | Bacteria | 2778 |
| 502 | Ga0495593_0040811 | 3300047673 | Bacteria | 2497 |
| 503 | Ga0495602_0019720 | 3300048088 | Bacteria | 6683 |
| 504 | Ga0495602_0037077 | 3300048088 | Bacteria | 4529 |
| 505 | Ga0495602_0063608 | 3300048088 | Bacteria | 3195 |
| 506 | Ga0495614_0002345 | 3300048089 | Bacteria | 8421 |
| 507 | Ga0495614_0003774 | 3300048089 | Bacteria | 6806 |
| 508 | Ga0495626_0041950 | 3300048091 | Bacteria | 2152 |
| 509 | Ga0495626_0118198 | 3300048091 | Bacteria | 1142 |
| 510 | Ga0496100_0050393 | 3300048903 | Bacteria | 2697 |
| 511 | Ga0496100_0213160 | 3300048903 | Bacteria | 1413 |
| 512 | Ga0496100_0234325 | 3300048903 | Bacteria | 1352 |
| 513 | Ga0496100_0248364 | 3300048903 | Bacteria | 1315 |
| 514 | Ga0496100_0406659 | 3300048903 | Bacteria | 1037 |
| 515 | Ga0496101_0036958 | 3300048904 | Bacteria | 3461 |
| 516 | Ga0496101_0053481 | 3300048904 | Bacteria | 2914 |
| 517 | Ga0496101_0098202 | 3300048904 | Bacteria | 2188 |
| 518 | Ga0496101_0390413 | 3300048904 | Bacteria | 1095 |
| 519 | Ga0496101_0397191 | 3300048904 | Bacteria | 1085 |
| 520 | Ga0496102_0001577 | 3300048905 | Bacteria | 20115 |
| 521 | Ga0496102_0065372 | 3300048905 | Bacteria | 3333 |
| 522 | Ga0496103_0004929 | 3300048906 | Bacteria | 8059 |
| 523 | Ga0496103_0012494 | 3300048906 | Bacteria | 5034 |
| 524 | Ga0496103_0072618 | 3300048906 | Bacteria | 2155 |
| 525 | Ga0496104_0007782 | 3300048907 | Bacteria | 9496 |
| 526 | Ga0496104_0092598 | 3300048907 | Bacteria | 2890 |
| 527 | Ga0496104_0425582 | 3300048907 | Bacteria | 1239 |
| 528 | Ga0496105_0043106 | 3300048908 | Bacteria | 3721 |
| 529 | Ga0496105_0055930 | 3300048908 | Bacteria | 3257 |
| 530 | Ga0496105_0095642 | 3300048908 | Bacteria | 2453 |
| 531 | Ga0496105_0247082 | 3300048908 | Bacteria | 1446 |
| 532 | Ga0496105_0643788 | 3300048908 | Bacteria | 818 |
| 533 | Ga0496106_0108068 | 3300048909 | Bacteria | 2164 |
| 534 | Ga0496106_0389787 | 3300048909 | Bacteria | 1119 |
| 535 | Ga0496107_0066679 | 3300048910 | Bacteria | 2610 |
| 536 | Ga0496108_0206721 | 3300048911 | Bacteria | 1704 |
| 537 | Ga0496109_0471080 | 3300048912 | Bacteria | 1186 |
| 538 | Ga0496109_0493962 | 3300048912 | Bacteria | 1155 |
| 539 | Ga0496110_0010435 | 3300048913 | Bacteria | 7554 |
| 540 | Ga0496112_0004021 | 3300048915 | Bacteria | 12332 |
| 541 | Ga0496112_0113531 | 3300048915 | Bacteria | 2680 |
| 542 | Ga0496112_0144155 | 3300048915 | Bacteria | 2350 |
| 543 | Ga0496114_0001303 | 3300048917 | Bacteria | 18882 |
| 544 | Ga0496114_0355961 | 3300048917 | Bacteria | 1295 |
| 545 | Ga0496114_0510647 | 3300048917 | Bacteria | 1063 |
| 546 | Ga0496115_0104925 | 3300048918 | Bacteria | 2320 |
| 547 | Ga0496115_0262548 | 3300048918 | Bacteria | 1420 |
| 548 | Ga0496115_0325227 | 3300048918 | Bacteria | 1257 |
| 549 | Ga0496116_0008846 | 3300048919 | Bacteria | 8668 |
| 550 | Ga0496116_0029630 | 3300048919 | Bacteria | 3942 |
| 551 | Ga0496116_0146119 | 3300048919 | Bacteria | 1321 |
| 552 | Ga0496117_0003482 | 3300048920 | Bacteria | 18253 |
| 553 | Ga0496117_0004451 | 3300048920 | Bacteria | 15452 |
| 554 | Ga0496117_0006043 | 3300048920 | Bacteria | 12434 |
| 555 | Ga0496117_0026468 | 3300048920 | Bacteria | 4538 |
| 556 | Ga0496117_0027713 | 3300048920 | Bacteria | 4405 |
| 557 | Ga0496117_0152051 | 3300048920 | Bacteria | 1368 |
| 558 | Ga0496118_0002189 | 3300048921 | Bacteria | 27169 |
| 559 | Ga0496118_0009107 | 3300048921 | Bacteria | 10105 |
| 560 | Ga0496118_0014797 | 3300048921 | Bacteria | 7277 |
| 561 | Ga0496118_0040781 | 3300048921 | Bacteria | 3686 |
| 562 | Ga0496118_0052070 | 3300048921 | Bacteria | 3126 |
| 563 | Ga0496118_0134601 | 3300048921 | Bacteria | 1579 |
| 564 | Ga0496118_0156726 | 3300048921 | Bacteria | 1415 |
| 565 | Ga0496119_0037839 | 3300048922 | Bacteria | 3127 |
| 566 | Ga0496119_0099868 | 3300048922 | Bacteria | 1631 |
| 567 | Ga0496119_0182330 | 3300048922 | Bacteria | 1100 |
| 568 | Ga0496119_0204803 | 3300048922 | Bacteria | 1019 |
| 569 | Ga0496120_0219750 | 3300048923 | Bacteria | 908 |
| 570 | Ga0496121_0000333 | 3300048924 | Bacteria | 98583 |
| 571 | Ga0496121_0013697 | 3300048924 | Bacteria | 8694 |
| 572 | Ga0496121_0017772 | 3300048924 | Bacteria | 7230 |
| 573 | Ga0496121_0152116 | 3300048924 | Bacteria | 1701 |
| 574 | Ga0496121_0262167 | 3300048924 | Bacteria | 1192 |
| 575 | Ga0496122_0068277 | 3300048925 | Bacteria | 2553 |
| 576 | Ga0496123_0105432 | 3300048926 | Bacteria | 1627 |
| 577 | Ga0496123_0124646 | 3300048926 | Bacteria | 1440 |
| 578 | Ga0496123_0277293 | 3300048926 | Bacteria | 812 |
| 579 | Ga0496124_0125246 | 3300048927 | Bacteria | 2048 |
| 580 | Ga0496124_0151004 | 3300048927 | Bacteria | 1822 |
| 581 | Ga0496125_0052026 | 3300048928 | Bacteria | 3371 |
| 582 | Ga0496125_0086639 | 3300048928 | Bacteria | 2368 |
| 583 | Ga0496125_0151767 | 3300048928 | Bacteria | 1590 |
| 584 | Ga0496125_0284595 | 3300048928 | Bacteria | 1022 |
| 585 | Ga0496126_0000088 | 3300048929 | Bacteria | 212256 |
| 586 | Ga0496126_0001409 | 3300048929 | Bacteria | 38034 |
| 587 | Ga0496126_0002413 | 3300048929 | Bacteria | 25289 |
| 588 | Ga0496126_0005752 | 3300048929 | Bacteria | 14027 |
| 589 | Ga0496126_0007047 | 3300048929 | Bacteria | 12397 |
| 590 | Ga0496126_0027437 | 3300048929 | Bacteria | 5438 |
| 591 | Ga0496126_0120059 | 3300048929 | Bacteria | 2281 |
| 592 | Ga0501309_030075 | 3300049129 | Bacteria | 798 |
| 593 | Ga0495678_012540 | 3300049459 | Bacteria | 4015 |
| 594 | Ga0495682_0080488 | 3300049460 | Bacteria | 1171 |
| 595 | Ga0501315_018868 | 3300049531 | Bacteria | 913 |
| 596 | Ga0501316_010553 | 3300049532 | Bacteria | 1053 |
| 597 | Ga0501034_0443581 | 3300049571 | Bacteria | 1216 |
| 598 | Ga0501038_0168339 | 3300049574 | Bacteria | 1776 |
| 599 | Ga0501046_0018470 | 3300049580 | Bacteria | 5801 |
| 600 | Ga0501047_0057504 | 3300049581 | Bacteria | 3761 |
| 601 | Ga0501047_0349870 | 3300049581 | Bacteria | 1314 |
| 602 | Ga0501073_0180693 | 3300049589 | Bacteria | 1460 |
| 603 | Ga0501209_010680 | 3300049656 | Bacteria | 1897 |
| 604 | Ga0501080_0265649 | 3300049742 | Bacteria | 1562 |
| 605 | Ga0501035_0163052 | 3300049822 | Bacteria | 1929 |
| 606 | Ga0501044_0045812 | 3300049823 | Bacteria | 4530 |
| 607 | nmdc:mga03683_7472_c1 | 3300050489 | Bacteria | 3794 |
| 608 | nmdc:mga07m45_17182_c3 | 3300050496 | Bacteria | 1415 |
| 609 | nmdc:mga07m45_6368_c1 | 3300050496 | Bacteria | 5963 |
| 610 | Ga0587070_041131 | 3300059491 | Bacteria | 885 |
| 611 | Ga0587073_0102713 | 3300059492 | Bacteria | 745 |
| 612 | Ga0587080_005082 | 3300059503 | Bacteria | 1747 |
| 613 | Ga0587080_035588 | 3300059503 | Bacteria | 887 |
| 614 | Ga0587082_018637 | 3300059504 | Bacteria | 1107 |
| 615 | Ga0587082_053293 | 3300059504 | Bacteria | 778 |
| 616 | Ga0587083_0036934 | 3300059505 | Bacteria | 1003 |
| 617 | Ga0587086_027160 | 3300059507 | Bacteria | 820 |
| 618 | Ga0587090_031471 | 3300059510 | Bacteria | 890 |
| 619 | Ga0587094_028030 | 3300059513 | Bacteria | 858 |
| 620 | Ga0587098_001641 | 3300059604 | Bacteria | 1759 |
| 621 | Ga0587109_039032 | 3300059624 | Bacteria | 934 |
| 622 | Ga0587128_021701 | 3300059630 | Bacteria | 992 |
| 623 | Ga0587068_036030 | 3300059641 | Bacteria | 879 |
| 624 | Ga0587069_003104 | 3300059642 | Bacteria | 1763 |
| 625 | Ga0587072_016147 | 3300059643 | Bacteria | 1275 |
| 626 | Ga0587075_036119 | 3300059644 | Bacteria | 809 |
| 627 | Ga0587076_013093 | 3300059645 | Bacteria | 1252 |
| 628 | Ga0587076_044734 | 3300059645 | Bacteria | 841 |
| 629 | Ga0587078_016382 | 3300059646 | Bacteria | 902 |
| 630 | Ga0587078_029348 | 3300059646 | Bacteria | 735 |
| 631 | Ga0587079_047612 | 3300059647 | Bacteria | 889 |
| 632 | Ga0587100_020758 | 3300059648 | Bacteria | 639 |
| 633 | Ga0587107_000692 | 3300059652 | Bacteria | 2376 |
| 634 | Ga0587107_025443 | 3300059652 | Bacteria | 861 |
| 635 | Ga0587071_012594 | 3300060344 | Bacteria | 1446 |
| 636 | Ga0466962_0000412 | 3300061719 | Bacteria | 18479 |
| 637 | Ga0466962_0000527 | 3300061719 | Bacteria | 16722 |
| 638 | Ga0466962_0003369 | 3300061719 | Bacteria | 7606 |
| 639 | Ga0466962_0094380 | 3300061719 | Bacteria | 1434 |
| 640 | Ga0466962_0173559 | 3300061719 | Bacteria | 1050 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300025903 | Ga0207680_10010657 | Ga0207680_100106575 | 181 |
| 2 | 3300048920 | Ga0496117_0027713 | Ga0496117_0027713_2228_2857 | 183 |
| 3 | 3300048929 | Ga0496126_0001409 | Ga0496126_0001409_9087_9716 | 183 |
| 4 | 3300004801 | Ga0058860_11979007 | Ga0058860_119790072 | 185 |
| 5 | 3300005335 | Ga0070666_10008389 | Ga0070666_100083897 | 185 |
| 6 | 3300005337 | Ga0070682_100115336 | Ga0070682_1001153361 | 185 |
| 7 | 3300005364 | Ga0070673_100347238 | Ga0070673_1003472381 | 185 |
| 8 | 3300005367 | Ga0070667_100027191 | Ga0070667_1000271915 | 185 |
| 9 | 3300005455 | Ga0070663_100009378 | Ga0070663_1000093787 | 185 |
| 10 | 3300005456 | Ga0070678_100100674 | Ga0070678_1001006742 | 185 |
| 11 | 3300005844 | Ga0068862_100547741 | Ga0068862_1005477411 | 185 |
| 12 | 3300009036 | Ga0105244_10122364 | Ga0105244_101223641 | 185 |
| 13 | 3300009177 | Ga0105248_10038843 | Ga0105248_100388437 | 185 |
| 14 | 3300009553 | Ga0105249_10426684 | Ga0105249_104266842 | 185 |
| 15 | 3300013306 | Ga0163162_10010537 | Ga0163162_1001053710 | 185 |
| 16 | 3300025937 | Ga0207669_10847820 | Ga0207669_108478201 | 185 |
| 17 | 3300025941 | Ga0207711_10220466 | Ga0207711_102204662 | 185 |
| 18 | 3300025960 | Ga0207651_10060430 | Ga0207651_100604301 | 185 |
| 19 | 3300025986 | Ga0207658_10029361 | Ga0207658_100293612 | 185 |
| 20 | 3300026067 | Ga0207678_10014828 | Ga0207678_100148282 | 185 |
| 21 | 3300026121 | Ga0207683_10126389 | Ga0207683_101263892 | 185 |
| 22 | 3300046460 | Ga0495638_0012178 | Ga0495638_0012178_4805_5503 | 185 |
| 23 | 3300046474 | Ga0495605_0002292 | Ga0495605_0002292_8564_9262 | 185 |
| 24 | 3300046492 | Ga0495585_0144608 | Ga0495585_0144608_577_1206 | 185 |
| 25 | 3300046501 | Ga0495607_0096904 | Ga0495607_0096904_83_781 | 185 |
| 26 | 3300046512 | Ga0495610_0129169 | Ga0495610_0129169_134_832 | 185 |
| 27 | 3300046542 | Ga0495597_0100480 | Ga0495597_0100480_162_791 | 185 |
| 28 | 3300046615 | Ga0495656_0116874 | Ga0495656_0116874_600_1220 | 185 |
| 29 | 3300046684 | Ga0495669_0015128 | Ga0495669_0015128_423_1121 | 185 |
| 30 | 3300046691 | Ga0495670_0060215 | Ga0495670_0060215_100_798 | 185 |
| 31 | 3300046794 | Ga0495589_0003243 | Ga0495589_0003243_4568_5266 | 185 |
| 32 | 3300048904 | Ga0496101_0053481 | Ga0496101_0053481_1755_2453 | 185 |
| 33 | 3300048910 | Ga0496107_0066679 | Ga0496107_0066679_1530_2228 | 185 |
| 34 | 3300048918 | Ga0496115_0262548 | Ga0496115_0262548_651_1349 | 185 |
| 35 | 3300048922 | Ga0496119_0182330 | Ga0496119_0182330_358_978 | 185 |
| 36 | 3300037312 | Ga0395899_0000031 | Ga0395899_0000031_154188_154796 | 186 |
| 37 | 3300037312 | Ga0395899_0041658 | Ga0395899_0041658_1166_1774 | 186 |
| 38 | 3300037418 | Ga0395900_0000158 | Ga0395900_0000158_105801_106409 | 186 |
| 39 | 3300037418 | Ga0395900_0105733 | Ga0395900_0105733_881_1489 | 186 |
| 40 | 3300037466 | Ga0395898_0000040 | Ga0395898_0000040_149206_149814 | 186 |
| 41 | 3300037466 | Ga0395898_0077260 | Ga0395898_0077260_1195_1803 | 186 |
| 42 | 3300038443 | Ga0395901_0001107 | Ga0395901_0001107_27852_28460 | 186 |
| 43 | 3300038443 | Ga0395901_0001810 | Ga0395901_0001810_11417_12028 | 186 |
| 44 | 3300044656 | Ga0466969_0145172 | Ga0466969_0145172_424_1032 | 186 |
| 45 | 3300044684 | Ga0466966_0000006 | Ga0466966_0000006_118650_119258 | 186 |
| 46 | 3300044693 | Ga0466961_0000989 | Ga0466961_0000989_9422_10030 | 186 |
| 47 | 3300044694 | Ga0466963_0001975 | Ga0466963_0001975_1086_1694 | 186 |
| 48 | 3300045049 | Ga0466959_0095125 | Ga0466959_0095125_765_1373 | 186 |
| 49 | 3300045836 | Ga0466958_0060887 | Ga0466958_0060887_642_1250 | 186 |
| 50 | 3300046458 | Ga0495591_000791 | Ga0495591_000791_14861_15481 | 186 |
| 51 | 3300046476 | Ga0495662_0024459 | Ga0495662_0024459_1180_1800 | 186 |
| 52 | 3300046477 | Ga0495664_0032119 | Ga0495664_0032119_1788_2408 | 186 |
| 53 | 3300046500 | Ga0495596_0006565 | Ga0495596_0006565_3833_4453 | 186 |
| 54 | 3300046511 | Ga0495608_0063287 | Ga0495608_0063287_1049_1669 | 186 |
| 55 | 3300046516 | Ga0495628_0066576 | Ga0495628_0066576_1330_1950 | 186 |
| 56 | 3300046517 | Ga0495630_0131539 | Ga0495630_0131539_931_1551 | 186 |
| 57 | 3300046524 | Ga0495648_0035781 | Ga0495648_0035781_1510_2130 | 186 |
| 58 | 3300046529 | Ga0495652_0081619 | Ga0495652_0081619_650_1270 | 186 |
| 59 | 3300046533 | Ga0495640_0024178 | Ga0495640_0024178_2041_2661 | 186 |
| 60 | 3300046557 | Ga0495622_0000682 | Ga0495622_0000682_17780_18400 | 186 |
| 61 | 3300046663 | Ga0495635_0059149 | Ga0495635_0059149_1064_1684 | 186 |
| 62 | 3300046680 | Ga0495646_0035582 | Ga0495646_0035582_943_1563 | 186 |
| 63 | 3300046689 | Ga0495613_0077303 | Ga0495613_0077303_1030_1650 | 186 |
| 64 | 3300046690 | Ga0495624_0011954 | Ga0495624_0011954_2171_2791 | 186 |
| 65 | 3300046794 | Ga0495589_0046246 | Ga0495589_0046246_649_1269 | 186 |
| 66 | 3300047319 | Ga0495674_0119954 | Ga0495674_0119954_650_1270 | 186 |
| 67 | 3300047322 | Ga0495680_0051852 | Ga0495680_0051852_1063_1683 | 186 |
| 68 | 3300047323 | Ga0495683_0056752 | Ga0495683_0056752_95_715 | 186 |
| 69 | 3300047446 | Ga0495679_028612 | Ga0495679_028612_513_1133 | 186 |
| 70 | 3300047673 | Ga0495593_0021760 | Ga0495593_0021760_811_1431 | 186 |
| 71 | 3300048088 | Ga0495602_0063608 | Ga0495602_0063608_1882_2502 | 186 |
| 72 | 3300048089 | Ga0495614_0002345 | Ga0495614_0002345_5856_6476 | 186 |
| 73 | 3300048906 | Ga0496103_0072618 | Ga0496103_0072618_236_856 | 186 |
| 74 | 3300061719 | Ga0466962_0003369 | Ga0466962_0003369_1372_1980 | 186 |
| 75 | 3300037312 | Ga0395899_0050724 | Ga0395899_0050724_2121_2729 | 188 |
| 76 | 3300037418 | Ga0395900_0283691 | Ga0395900_0283691_289_897 | 188 |
| 77 | 3300044656 | Ga0466969_0011439 | Ga0466969_0011439_2060_2668 | 188 |
| 78 | 3300044683 | Ga0466965_0078936 | Ga0466965_0078936_688_1296 | 188 |
| 79 | 3300044684 | Ga0466966_0033167 | Ga0466966_0033167_1987_2595 | 188 |
| 80 | 3300044693 | Ga0466961_0074687 | Ga0466961_0074687_738_1346 | 188 |
| 81 | 3300044706 | Ga0466964_0002065 | Ga0466964_0002065_896_1504 | 188 |
| 82 | 3300044765 | Ga0466970_0014867 | Ga0466970_0014867_2579_3187 | 188 |
| 83 | 3300044842 | Ga0466957_0016747 | Ga0466957_0016747_962_1570 | 188 |
| 84 | 3300045049 | Ga0466959_0080461 | Ga0466959_0080461_937_1545 | 188 |
| 85 | 3300045836 | Ga0466958_0000920 | Ga0466958_0000920_6763_7371 | 188 |
| 86 | 3300045836 | Ga0466958_0066342 | Ga0466958_0066342_1194_1802 | 188 |
| 87 | 3300019179 | Ga0184593_111152 | Ga0184593_1111521 | 190 |
| 88 | 3300037418 | Ga0395900_0036214 | Ga0395900_0036214_1300_2010 | 190 |
| 89 | 3300005577 | Ga0068857_100659944 | Ga0068857_1006599441 | 191 |
| 90 | 3300010375 | Ga0105239_10507765 | Ga0105239_105077652 | 191 |
| 91 | 3300026116 | Ga0207674_10397010 | Ga0207674_103970102 | 191 |
| 92 | 3300031548 | Ga0307408_100001314 | Ga0307408_10000131420 | 191 |
| 93 | 3300031731 | Ga0307405_10024361 | Ga0307405_100243612 | 191 |
| 94 | 3300031995 | Ga0307409_100070534 | Ga0307409_1000705343 | 191 |
| 95 | 3300049129 | Ga0501309_030075 | Ga0501309_030075_13_684 | 191 |
| 96 | 3300006038 | Ga0075365_10165942 | Ga0075365_101659422 | 192 |
| 97 | 3300042119 | Ga0450915_002349 | Ga0450915_002349_95_808 | 192 |
| 98 | 3300042129 | Ga0450891_005582 | Ga0450891_005582_264_977 | 192 |
| 99 | 3300042435 | Ga0439434_0032164 | Ga0439434_0032164_280_972 | 192 |
| 100 | 3300042532 | Ga0450893_0018651 | Ga0450893_0018651_49_762 | 192 |
| 101 | 3300045976 | Ga0466967_0430688 | Ga0466967_0430688_368_1066 | 192 |
| 102 | 3300048929 | Ga0496126_0120059 | Ga0496126_0120059_485_1114 | 192 |
| 103 | 3300005616 | Ga0068852_100912191 | Ga0068852_1009121911 | 193 |
| 104 | 3300006028 | Ga0070717_10389748 | Ga0070717_103897482 | 193 |
| 105 | 3300006195 | Ga0075366_10109254 | Ga0075366_101092541 | 193 |
| 106 | 3300013102 | Ga0157371_10007924 | Ga0157371_100079247 | 193 |
| 107 | 3300013306 | Ga0163162_11534499 | Ga0163162_115344991 | 193 |
| 108 | 3300014497 | Ga0182008_10096766 | Ga0182008_100967662 | 193 |
| 109 | 3300015683 | Ga0183362_10005 | Ga0183362_10005315 | 193 |
| 110 | 3300031711 | Ga0265314_10001337 | Ga0265314_1000133716 | 193 |
| 111 | 3300037466 | Ga0395898_0023156 | Ga0395898_0023156_3273_3968 | 193 |
| 112 | 3300037471 | Ga0395905_0134600 | Ga0395905_0134600_1302_1997 | 193 |
| 113 | 3300038443 | Ga0395901_0245392 | Ga0395901_0245392_1026_1781 | 193 |
| 114 | 3300038443 | Ga0395901_0754943 | Ga0395901_0754943_244_939 | 193 |
| 115 | 3300042438 | Ga0439459_0073835 | Ga0439459_0073835_42_758 | 193 |
| 116 | 3300048909 | Ga0496106_0108068 | Ga0496106_0108068_1321_1950 | 193 |
| 117 | 3300049571 | Ga0501034_0443581 | Ga0501034_0443581_345_1049 | 193 |
| 118 | 3300049574 | Ga0501038_0168339 | Ga0501038_0168339_1053_1757 | 193 |
| 119 | 3300049580 | Ga0501046_0018470 | Ga0501046_0018470_3280_3984 | 193 |
| 120 | 3300049581 | Ga0501047_0349870 | Ga0501047_0349870_356_1060 | 193 |
| 121 | 3300049589 | Ga0501073_0180693 | Ga0501073_0180693_717_1421 | 193 |
| 122 | 3300049742 | Ga0501080_0265649 | Ga0501080_0265649_682_1386 | 193 |
| 123 | 3300049822 | Ga0501035_0163052 | Ga0501035_0163052_681_1385 | 193 |
| 124 | 3300049823 | Ga0501044_0045812 | Ga0501044_0045812_3354_4058 | 193 |
| 125 | 3300001989 | JGI24739J22299_10017997 | JGI24739J22299_100179972 | 194 |
| 126 | 3300027682 | Ga0209971_1002743 | Ga0209971_10027434 | 194 |
| 127 | 3300027876 | Ga0209974_10013617 | Ga0209974_100136174 | 194 |
| 128 | 3300028577 | Ga0265318_10061967 | Ga0265318_100619672 | 194 |
| 129 | 3300031238 | Ga0265332_10000028 | Ga0265332_1000002861 | 194 |
| 130 | 3300031240 | Ga0265320_10079453 | Ga0265320_100794532 | 194 |
| 131 | 3300031241 | Ga0265325_10001397 | Ga0265325_1000139714 | 194 |
| 132 | 3300031711 | Ga0265314_10000054 | Ga0265314_1000005461 | 194 |
| 133 | 3300037312 | Ga0395899_0146951 | Ga0395899_0146951_272_883 | 194 |
| 134 | 3300037466 | Ga0395898_0007346 | Ga0395898_0007346_8856_9467 | 194 |
| 135 | 3300037471 | Ga0395905_0437596 | Ga0395905_0437596_421_1107 | 194 |
| 136 | 3300038443 | Ga0395901_0004171 | Ga0395901_0004171_7053_7664 | 194 |
| 137 | 3300044658 | Ga0466972_0051825 | Ga0466972_0051825_803_1414 | 194 |
| 138 | 3300044684 | Ga0466966_0000265 | Ga0466966_0000265_22936_23547 | 194 |
| 139 | 3300044693 | Ga0466961_0106695 | Ga0466961_0106695_355_966 | 194 |
| 140 | 3300044694 | Ga0466963_0006961 | Ga0466963_0006961_726_1337 | 194 |
| 141 | 3300044719 | Ga0466971_0003814 | Ga0466971_0003814_587_1198 | 194 |
| 142 | 3300044842 | Ga0466957_0034949 | Ga0466957_0034949_430_1041 | 194 |
| 143 | 3300045836 | Ga0466958_0083118 | Ga0466958_0083118_353_964 | 194 |
| 144 | 3300045976 | Ga0466967_0849871 | Ga0466967_0849871_215_826 | 194 |
| 145 | 3300046471 | Ga0495650_0014347 | Ga0495650_0014347_2402_3025 | 194 |
| 146 | 3300048921 | Ga0496118_0002189 | Ga0496118_0002189_1260_1880 | 194 |
| 147 | 3300049581 | Ga0501047_0057504 | Ga0501047_0057504_554_1243 | 194 |
| 148 | 3300049656 | Ga0501209_010680 | Ga0501209_010680_470_1111 | 194 |
| 149 | 3300059644 | Ga0587075_036119 | Ga0587075_036119_172_783 | 194 |
| 150 | 3300061719 | Ga0466962_0000527 | Ga0466962_0000527_410_1021 | 194 |
| 151 | 3300005327 | Ga0070658_10006938 | Ga0070658_100069386 | 195 |
| 152 | 3300005327 | Ga0070658_10106790 | Ga0070658_101067902 | 195 |
| 153 | 3300005339 | Ga0070660_100011683 | Ga0070660_1000116834 | 195 |
| 154 | 3300005366 | Ga0070659_100179926 | Ga0070659_1001799262 | 195 |
| 155 | 3300005563 | Ga0068855_100002204 | Ga0068855_1000022048 | 195 |
| 156 | 3300005563 | Ga0068855_100022812 | Ga0068855_1000228122 | 195 |
| 157 | 3300009545 | Ga0105237_10205269 | Ga0105237_102052692 | 195 |
| 158 | 3300009551 | Ga0105238_10028874 | Ga0105238_100288744 | 195 |
| 159 | 3300013104 | Ga0157370_10002906 | Ga0157370_1000290618 | 195 |
| 160 | 3300025909 | Ga0207705_10000452 | Ga0207705_1000045226 | 195 |
| 161 | 3300025909 | Ga0207705_10112980 | Ga0207705_101129802 | 195 |
| 162 | 3300025913 | Ga0207695_10032748 | Ga0207695_100327482 | 195 |
| 163 | 3300025913 | Ga0207695_10327799 | Ga0207695_103277992 | 195 |
| 164 | 3300025914 | Ga0207671_10137737 | Ga0207671_101377372 | 195 |
| 165 | 3300025917 | Ga0207660_10151402 | Ga0207660_101514022 | 195 |
| 166 | 3300025919 | Ga0207657_10037495 | Ga0207657_100374954 | 195 |
| 167 | 3300025932 | Ga0207690_10142514 | Ga0207690_101425142 | 195 |
| 168 | 3300025949 | Ga0207667_10000701 | Ga0207667_1000070117 | 195 |
| 169 | 3300028794 | Ga0307515_10000040 | Ga0307515_10000040125 | 195 |
| 170 | 3300038443 | Ga0395901_0155248 | Ga0395901_0155248_647_1390 | 195 |
| 171 | 3300041407 | Ga0439447_033256 | Ga0439447_033256_357_1016 | 195 |
| 172 | 3300041411 | Ga0439466_0022944 | Ga0439466_0022944_534_1193 | 195 |
| 173 | 3300041413 | Ga0439465_0000277 | Ga0439465_0000277_5884_6543 | 195 |
| 174 | 3300041999 | Ga0439433_0001048 | Ga0439433_0001048_673_1332 | 195 |
| 175 | 3300042002 | Ga0439442_024900 | Ga0439442_024900_355_1014 | 195 |
| 176 | 3300042004 | Ga0439445_0000763 | Ga0439445_0000763_3942_4601 | 195 |
| 177 | 3300042006 | Ga0439432_001936 | Ga0439432_001936_2260_2919 | 195 |
| 178 | 3300042007 | Ga0439449_0000120 | Ga0439449_0000120_3660_4319 | 195 |
| 179 | 3300042010 | Ga0439452_002310 | Ga0439452_002310_3860_4519 | 195 |
| 180 | 3300042014 | Ga0439457_056205 | Ga0439457_056205_173_832 | 195 |
| 181 | 3300042138 | Ga0450903_015969 | Ga0450903_015969_473_1159 | 195 |
| 182 | 3300042435 | Ga0439434_0068203 | Ga0439434_0068203_50_709 | 195 |
| 183 | 3300044673 | Ga0453683_0390378 | Ga0453683_0390378_38_760 | 195 |
| 184 | 3300050496 | nmdc:mga07m45_17182_c3 | nmdc:mga07m45_17182_c3_165_881 | 195 |
| 185 | iso_pu_bacteria | 2510917013 | 2511089687 | 195 |
| 186 | iso_pu_bacteria | 2857357740 | 2857366611 | 195 |
| 187 | iso_pu_bacteria | 2919704043 | 2919704142 | 195 |
| 188 | 3300005327 | Ga0070658_10576092 | Ga0070658_105760921 | 196 |
| 189 | 3300006048 | Ga0075363_100376705 | Ga0075363_1003767051 | 196 |
| 190 | 3300006353 | Ga0075370_10000918 | Ga0075370_100009189 | 196 |
| 191 | 3300026041 | Ga0207639_10561412 | Ga0207639_105614122 | 196 |
| 192 | 3300031731 | Ga0307405_10178379 | Ga0307405_101783793 | 196 |
| 193 | 3300032002 | Ga0307416_100582390 | Ga0307416_1005823901 | 196 |
| 194 | 3300032133 | Ga0316583_10000293 | Ga0316583_1000029313 | 196 |
| 195 | 3300041405 | Ga0439438_055437 | Ga0439438_055437_240_893 | 196 |
| 196 | 3300044684 | Ga0466966_0185756 | Ga0466966_0185756_131_805 | 196 |
| 197 | 3300044901 | Ga0466960_0027899 | Ga0466960_0027899_287_943 | 196 |
| 198 | 3300045049 | Ga0466959_0253906 | Ga0466959_0253906_13_687 | 196 |
| 199 | 3300046457 | Ga0495590_0020946 | Ga0495590_0020946_376_999 | 196 |
| 200 | 3300046459 | Ga0495629_0003125 | Ga0495629_0003125_1069_1692 | 196 |
| 201 | 3300046460 | Ga0495638_0004867 | Ga0495638_0004867_8598_9221 | 196 |
| 202 | 3300046474 | Ga0495605_0001100 | Ga0495605_0001100_2519_3142 | 196 |
| 203 | 3300046506 | Ga0495583_0005045 | Ga0495583_0005045_4811_5434 | 196 |
| 204 | 3300046515 | Ga0495620_0052476 | Ga0495620_0052476_527_1150 | 196 |
| 205 | 3300046524 | Ga0495648_0027013 | Ga0495648_0027013_1217_1840 | 196 |
| 206 | 3300046538 | Ga0495609_0073917 | Ga0495609_0073917_564_1187 | 196 |
| 207 | 3300046648 | Ga0495611_0017563 | Ga0495611_0017563_875_1498 | 196 |
| 208 | 3300046674 | Ga0495588_0114771 | Ga0495588_0114771_540_1163 | 196 |
| 209 | 3300046678 | Ga0495599_0017111 | Ga0495599_0017111_124_747 | 196 |
| 210 | 3300046679 | Ga0495623_0008038 | Ga0495623_0008038_3804_4427 | 196 |
| 211 | 3300046690 | Ga0495624_0009643 | Ga0495624_0009643_1087_1710 | 196 |
| 212 | 3300047320 | Ga0495672_0038179 | Ga0495672_0038179_588_1211 | 196 |
| 213 | 3300047443 | Ga0495687_014212 | Ga0495687_014212_2346_2969 | 196 |
| 214 | 3300047444 | Ga0495675_0044483 | Ga0495675_0044483_1524_2147 | 196 |
| 215 | 3300047446 | Ga0495679_000007 | Ga0495679_000007_131419_132042 | 196 |
| 216 | 3300047472 | Ga0495686_0034612 | Ga0495686_0034612_1343_1966 | 196 |
| 217 | 3300047673 | Ga0495593_0033915 | Ga0495593_0033915_201_824 | 196 |
| 218 | 3300048088 | Ga0495602_0019720 | Ga0495602_0019720_5545_6168 | 196 |
| 219 | 3300048924 | Ga0496121_0013697 | Ga0496121_0013697_2369_2992 | 196 |
| 220 | 3300049459 | Ga0495678_012540 | Ga0495678_012540_2388_3011 | 196 |
| 221 | 3300049531 | Ga0501315_018868 | Ga0501315_018868_221_898 | 196 |
| 222 | 3300049532 | Ga0501316_010553 | Ga0501316_010553_141_818 | 196 |
| 223 | 3300050489 | nmdc:mga03683_7472_c1 | nmdc:mga03683_7472_c1_2129_2785 | 196 |
| 224 | 3300050496 | nmdc:mga07m45_6368_c1 | nmdc:mga07m45_6368_c1_334_987 | 196 |
| 225 | iso_pu_bacteria | 2501025501 | 2501070813 | 196 |
| 226 | iso_pu_bacteria | 2501025504 | 2501413646 | 196 |
| 227 | iso_pu_bacteria | 2510917014 | 2511095084 | 196 |
| 228 | iso_pu_bacteria | 2510917015 | 2511104743 | 196 |
| 229 | iso_pu_bacteria | 2513237082 | 2513551402 | 196 |
| 230 | iso_pu_bacteria | 2513237083 | 2513560044 | 196 |
| 231 | iso_pu_bacteria | 2513237166 | 2514048008 | 196 |
| 232 | iso_pu_bacteria | 2515154189 | 2516016802 | 196 |
| 233 | iso_pu_bacteria | 2562617112 | 2563060014 | 196 |
| 234 | iso_pu_bacteria | 2711768613 | 2713479268 | 196 |
| 235 | iso_pu_bacteria | 2721755763 | 2723876240 | 196 |
| 236 | iso_pu_bacteria | 2791355137 | 2792834673 | 196 |
| 237 | iso_pu_bacteria | 2883087390 | 2883094552 | 196 |
| 238 | iso_pu_bacteria | 2904434214 | 2904435158 | 196 |
| 239 | iso_pu_bacteria | 2904615490 | 2904620392 | 196 |
| 240 | iso_pu_bacteria | 2921643360 | 2921644159 | 196 |
| 241 | iso_pu_bacteria | 642555112 | 642592077 | 196 |
| 242 | iso_pu_bacteria | 642555113 | 642620148 | 196 |
| 243 | iso_pu_bacteria | 8003955200 | 8003957309 | 196 |
| 244 | 3300037418 | Ga0395900_0038341 | Ga0395900_0038341_3455_4129 | 197 |
| 245 | 3300037471 | Ga0395905_0116681 | Ga0395905_0116681_342_1016 | 197 |
| 246 | 3300038443 | Ga0395901_0056623 | Ga0395901_0056623_1574_2248 | 197 |
| 247 | 3300044693 | Ga0466961_0014170 | Ga0466961_0014170_934_1638 | 197 |
| 248 | 3300044735 | Ga0466968_0043784 | Ga0466968_0043784_501_1205 | 197 |
| 249 | 3300045049 | Ga0466959_0088349 | Ga0466959_0088349_941_1645 | 197 |
| 250 | iso_pu_bacteria | 2508501125 | 2509129120 | 197 |
| 251 | iso_pu_bacteria | 2510065045 | 2510253203 | 197 |
| 252 | iso_pu_bacteria | 2512047030 | 2512347375 | 197 |
| 253 | iso_pu_bacteria | 2513237151 | 2513959202 | 197 |
| 254 | iso_pu_bacteria | 2515154122 | 2515685295 | 197 |
| 255 | iso_pu_bacteria | 2519103095 | 2519459845 | 197 |
| 256 | iso_pu_bacteria | 2526164713 | 2527078836 | 197 |
| 257 | iso_pu_bacteria | 2582581311 | 2585290651 | 197 |
| 258 | iso_pu_bacteria | 2599185239 | 2599740246 | 197 |
| 259 | iso_pu_bacteria | 2718217991 | 2719638992 | 197 |
| 260 | iso_pu_bacteria | 2738541296 | 2738823785 | 197 |
| 261 | iso_pu_bacteria | 2738541298 | 2738836176 | 197 |
| 262 | iso_pu_bacteria | 2738541306 | 2738877706 | 197 |
| 263 | iso_pu_bacteria | 2738543002 | 2739189412 | 197 |
| 264 | iso_pu_bacteria | 2738543008 | 2739224299 | 197 |
| 265 | iso_pu_bacteria | 2744054900 | 2746086346 | 197 |
| 266 | iso_pu_bacteria | 2744054901 | 2746093346 | 197 |
| 267 | iso_pu_bacteria | 2751185846 | 2753566252 | 197 |
| 268 | iso_pu_bacteria | 2816332253 | 2817262129 | 197 |
| 269 | iso_pu_bacteria | 2816332256 | 2817279830 | 197 |
| 270 | iso_pu_bacteria | 2816332286 | 2817455564 | 197 |
| 271 | iso_pu_bacteria | 2818991452 | 2819633710 | 197 |
| 272 | iso_pu_bacteria | 2863421361 | 2863427310 | 197 |
| 273 | iso_pu_bacteria | 2885270888 | 2885276739 | 197 |
| 274 | iso_pu_bacteria | 2894023352 | 2894024392 | 197 |
| 275 | iso_pu_bacteria | 2900634093 | 2900636389 | 197 |
| 276 | iso_pu_bacteria | 2902682994 | 2902689119 | 197 |
| 277 | iso_pu_bacteria | 2904483920 | 2904488538 | 197 |
| 278 | iso_pu_bacteria | 2904564687 | 2904567663 | 197 |
| 279 | iso_pu_bacteria | 2904571731 | 2904574935 | 197 |
| 280 | iso_pu_bacteria | 2919527303 | 2919532150 | 197 |
| 281 | iso_pu_bacteria | 2928170801 | 2928175468 | 197 |
| 282 | iso_pu_bacteria | 2928536128 | 2928538974 | 197 |
| 283 | iso_pu_bacteria | 2939631187 | 2939632127 | 197 |
| 284 | iso_pu_bacteria | 2945934425 | 2945935227 | 197 |
| 285 | iso_pu_bacteria | 2990703756 | 2990704179 | 197 |
| 286 | iso_pu_bacteria | 641736151 | 642422335 | 197 |
| 287 | iso_pu_bacteria | 8018845410 | 8018846251 | 197 |
| 288 | iso_pu_bacteria | 8020807995 | 8020814264 | 197 |
| 289 | iso_pu_bacteria | 8020938398 | 8020940024 | 197 |
| 290 | iso_pu_bacteria | 8020945358 | 8020950346 | 197 |
| 291 | iso_pu_bacteria | 8020953355 | 8020954693 | 197 |
| 292 | iso_pu_bacteria | 8021120328 | 8021125567 | 197 |
| 293 | iso_pu_bacteria | 8039098773 | 8039104477 | 197 |
| 294 | iso_pu_bacteria | 8040167225 | 8040172119 | 197 |
| 295 | iso_pu_bacteria | 8040173305 | 8040173972 | 197 |
| 296 | iso_pu_bacteria | 8055266321 | 8055268175 | 197 |
| 297 | iso_pu_bacteria | 8055301274 | 8055304073 | 197 |
| 298 | iso_pu_bacteria | 2515154123 | 2515689383 | 198 |
| 299 | iso_pu_bacteria | 2599185240 | 2599744078 | 198 |
| 300 | iso_pu_bacteria | 2599185355 | 2600210813 | 198 |
| 301 | iso_pu_bacteria | 2600255067 | 2600810334 | 198 |
| 302 | iso_pu_bacteria | 2675903129 | 2676743571 | 198 |
| 303 | iso_pu_bacteria | 2808606384 | 2808968309 | 198 |
| 304 | iso_pu_bacteria | 2808606390 | 2809003140 | 198 |
| 305 | iso_pu_bacteria | 2808606391 | 2809010417 | 198 |
| 306 | iso_pu_bacteria | 2818991450 | 2819623947 | 198 |
| 307 | iso_pu_bacteria | 2842324504 | 2842331843 | 198 |
| 308 | iso_pu_bacteria | 2842348783 | 2842356156 | 198 |
| 309 | iso_pu_bacteria | 2842454564 | 2842459356 | 198 |
| 310 | iso_pu_bacteria | 2870068957 | 2870070111 | 198 |
| 311 | iso_pu_bacteria | 2928108538 | 2928109516 | 198 |
| 312 | iso_pu_bacteria | 2928135762 | 2928137030 | 198 |
| 313 | iso_pu_bacteria | 2928157003 | 2928162066 | 198 |
| 314 | iso_pu_bacteria | 2928163908 | 2928169296 | 198 |
| 315 | iso_pu_bacteria | 2928503688 | 2928506558 | 198 |
| 316 | iso_pu_bacteria | 2981990288 | 2981992788 | 198 |
| 317 | iso_pu_bacteria | 641736154 | 642418038 | 198 |
| 318 | 3300009011 | Ga0105251_10000055 | Ga0105251_100000552 | 199 |
| 319 | 3300015262 | Ga0182007_10001847 | Ga0182007_1000184711 | 199 |
| 320 | 3300025735 | Ga0207713_1000089 | Ga0207713_1000089123 | 199 |
| 321 | 3300025735 | Ga0207713_1000106 | Ga0207713_100010629 | 199 |
| 322 | 3300048912 | Ga0496109_0493962 | Ga0496109_0493962_198_818 | 199 |
| 323 | 3300048919 | Ga0496116_0029630 | Ga0496116_0029630_731_1351 | 199 |
| 324 | iso_pu_bacteria | 2501025502 | 2501080337 | 199 |
| 325 | iso_pu_bacteria | 2856287931 | 2856293270 | 199 |
| 326 | 3300003354 | JGI25160J50197_1000049 | JGI25160J50197_100004955 | 200 |
| 327 | 3300005262 | Ga0065165_1000115 | Ga0065165_100011555 | 200 |
| 328 | 3300025284 | Ga0209130_1027198 | Ga0209130_10271982 | 200 |
| 329 | 3300025295 | Ga0209564_1007255 | Ga0209564_10072555 | 200 |
| 330 | 3300025302 | Ga0207426_1000007 | Ga0207426_1000007269 | 200 |
| 331 | 3300037471 | Ga0395905_0000014 | Ga0395905_0000014_189193_189816 | 200 |
| 332 | 3300044666 | Ga0466977_0000098 | Ga0466977_0000098_353_1099 | 200 |
| 333 | 3300046455 | Ga0495603_0247004 | Ga0495603_0247004_38_661 | 200 |
| 334 | 3300046457 | Ga0495590_0018763 | Ga0495590_0018763_813_1436 | 200 |
| 335 | 3300046457 | Ga0495590_0033229 | Ga0495590_0033229_419_1081 | 200 |
| 336 | 3300046472 | Ga0495580_0007525 | Ga0495580_0007525_376_999 | 200 |
| 337 | 3300046474 | Ga0495605_0002952 | Ga0495605_0002952_412_1035 | 200 |
| 338 | 3300046506 | Ga0495583_0048668 | Ga0495583_0048668_857_1480 | 200 |
| 339 | 3300046513 | Ga0495616_0026456 | Ga0495616_0026456_563_1186 | 200 |
| 340 | 3300046517 | Ga0495630_0061353 | Ga0495630_0061353_858_1481 | 200 |
| 341 | 3300046524 | Ga0495648_0016582 | Ga0495648_0016582_3397_4020 | 200 |
| 342 | 3300046678 | Ga0495599_0022737 | Ga0495599_0022737_2016_2639 | 200 |
| 343 | 3300046684 | Ga0495669_0129940 | Ga0495669_0129940_64_687 | 200 |
| 344 | 3300046694 | Ga0495649_0034391 | Ga0495649_0034391_770_1393 | 200 |
| 345 | 3300046694 | Ga0495649_0146296 | Ga0495649_0146296_16_678 | 200 |
| 346 | 3300046810 | Ga0495660_0097087 | Ga0495660_0097087_392_1003 | 200 |
| 347 | 3300047319 | Ga0495674_0002606 | Ga0495674_0002606_9166_9789 | 200 |
| 348 | 3300047319 | Ga0495674_0003654 | Ga0495674_0003654_10003_10620 | 200 |
| 349 | 3300047320 | Ga0495672_0008928 | Ga0495672_0008928_2329_2952 | 200 |
| 350 | 3300047323 | Ga0495683_0021686 | Ga0495683_0021686_1491_2114 | 200 |
| 351 | 3300047443 | Ga0495687_000011 | Ga0495687_000011_128260_128922 | 200 |
| 352 | 3300047443 | Ga0495687_031185 | Ga0495687_031185_499_1122 | 200 |
| 353 | 3300047469 | Ga0495673_0006209 | Ga0495673_0006209_1143_1766 | 200 |
| 354 | 3300048088 | Ga0495602_0037077 | Ga0495602_0037077_1659_2282 | 200 |
| 355 | 3300048091 | Ga0495626_0118198 | Ga0495626_0118198_437_1060 | 200 |
| 356 | 3300048903 | Ga0496100_0050393 | Ga0496100_0050393_1622_2245 | 200 |
| 357 | 3300048903 | Ga0496100_0406659 | Ga0496100_0406659_351_974 | 200 |
| 358 | 3300048904 | Ga0496101_0036958 | Ga0496101_0036958_717_1340 | 200 |
| 359 | 3300048904 | Ga0496101_0390413 | Ga0496101_0390413_429_1052 | 200 |
| 360 | 3300048905 | Ga0496102_0001577 | Ga0496102_0001577_17256_17879 | 200 |
| 361 | 3300048906 | Ga0496103_0012494 | Ga0496103_0012494_4005_4628 | 200 |
| 362 | 3300048908 | Ga0496105_0043106 | Ga0496105_0043106_2748_3371 | 200 |
| 363 | 3300048908 | Ga0496105_0643788 | Ga0496105_0643788_48_671 | 200 |
| 364 | 3300048915 | Ga0496112_0113531 | Ga0496112_0113531_215_838 | 200 |
| 365 | 3300048918 | Ga0496115_0325227 | Ga0496115_0325227_171_794 | 200 |
| 366 | 3300048920 | Ga0496117_0004451 | Ga0496117_0004451_13509_14132 | 200 |
| 367 | 3300048921 | Ga0496118_0040781 | Ga0496118_0040781_2757_3380 | 200 |
| 368 | 3300048922 | Ga0496119_0037839 | Ga0496119_0037839_717_1340 | 200 |
| 369 | 3300048923 | Ga0496120_0219750 | Ga0496120_0219750_245_868 | 200 |
| 370 | 3300048924 | Ga0496121_0152116 | Ga0496121_0152116_644_1267 | 200 |
| 371 | 3300048926 | Ga0496123_0277293 | Ga0496123_0277293_23_646 | 200 |
| 372 | 3300048927 | Ga0496124_0125246 | Ga0496124_0125246_959_1582 | 200 |
| 373 | 3300048928 | Ga0496125_0151767 | Ga0496125_0151767_426_1049 | 200 |
| 374 | 3300048929 | Ga0496126_0007047 | Ga0496126_0007047_805_1428 | 200 |
| 375 | 3300049460 | Ga0495682_0080488 | Ga0495682_0080488_376_999 | 200 |
| 376 | 3300059491 | Ga0587070_041131 | Ga0587070_041131_17_640 | 200 |
| 377 | 3300059503 | Ga0587080_035588 | Ga0587080_035588_17_676 | 200 |
| 378 | 3300059505 | Ga0587083_0036934 | Ga0587083_0036934_239_862 | 200 |
| 379 | 3300059507 | Ga0587086_027160 | Ga0587086_027160_17_640 | 200 |
| 380 | 3300059513 | Ga0587094_028030 | Ga0587094_028030_17_640 | 200 |
| 381 | 3300059604 | Ga0587098_001641 | Ga0587098_001641_17_640 | 200 |
| 382 | 3300059624 | Ga0587109_039032 | Ga0587109_039032_300_923 | 200 |
| 383 | 3300059630 | Ga0587128_021701 | Ga0587128_021701_14_637 | 200 |
| 384 | 3300059641 | Ga0587068_036030 | Ga0587068_036030_17_640 | 200 |
| 385 | 3300059642 | Ga0587069_003104 | Ga0587069_003104_14_640 | 200 |
| 386 | 3300059643 | Ga0587072_016147 | Ga0587072_016147_641_1264 | 200 |
| 387 | 3300059645 | Ga0587076_044734 | Ga0587076_044734_17_628 | 200 |
| 388 | 3300059646 | Ga0587078_016382 | Ga0587078_016382_167_790 | 200 |
| 389 | 3300059648 | Ga0587100_020758 | Ga0587100_020758_17_628 | 200 |
| 390 | 3300059652 | Ga0587107_025443 | Ga0587107_025443_11_634 | 200 |
| 391 | 3300060344 | Ga0587071_012594 | Ga0587071_012594_121_744 | 200 |
| 392 | 3300061719 | Ga0466962_0094380 | Ga0466962_0094380_474_1082 | 200 |
| 393 | 3300001979 | JGI24740J21852_10000889 | JGI24740J21852_1000088910 | 201 |
| 394 | 3300001979 | JGI24740J21852_10086375 | JGI24740J21852_100863751 | 201 |
| 395 | 3300001989 | JGI24739J22299_10010650 | JGI24739J22299_100106503 | 201 |
| 396 | 3300002067 | JGI24735J21928_10002083 | JGI24735J21928_100020836 | 201 |
| 397 | 3300002075 | JGI24738J21930_10004015 | JGI24738J21930_100040151 | 201 |
| 398 | 3300002705 | JGI25156J39149_1017091 | JGI25156J39149_10170912 | 201 |
| 399 | 3300002772 | JGI25164J39214_1006160 | JGI25164J39214_10061601 | 201 |
| 400 | 3300003214 | JGI25165J46597_1001028 | JGI25165J46597_100102815 | 201 |
| 401 | 3300003479 | Ga0006556J51387_1023789 | Ga0006556J51387_10237894 | 201 |
| 402 | 3300003565 | Ga0006560J51390_1025002 | Ga0006560J51390_10250021 | 201 |
| 403 | 3300003567 | Ga0006554J51385_1022490 | Ga0006554J51385_10224904 | 201 |
| 404 | 3300003575 | Ga0007409J51694_1053338 | Ga0007409J51694_10533381 | 201 |
| 405 | 3300003579 | Ga0007429J51699_1109854 | Ga0007429J51699_11098541 | 201 |
| 406 | 3300003758 | Ga0055532_1000031 | Ga0055532_100003158 | 201 |
| 407 | 3300003758 | Ga0055532_1002498 | Ga0055532_10024982 | 201 |
| 408 | 3300003760 | Ga0055527_1000020 | Ga0055527_100002058 | 201 |
| 409 | 3300003761 | Ga0055535_1000023 | Ga0055535_1000023160 | 201 |
| 410 | 3300003762 | Ga0055542_1000035 | Ga0055542_100003558 | 201 |
| 411 | 3300003763 | Ga0055529_1000039 | Ga0055529_1000039160 | 201 |
| 412 | 3300003790 | Ga0055528_1007923 | Ga0055528_10079236 | 201 |
| 413 | 3300003841 | Ga0055541_1004892 | Ga0055541_10048922 | 201 |
| 414 | 3300003856 | Ga0058692_1002184 | Ga0058692_10021846 | 201 |
| 415 | 3300003856 | Ga0058692_1023236 | Ga0058692_10232362 | 201 |
| 416 | 3300003856 | Ga0058692_1031587 | Ga0058692_10315872 | 201 |
| 417 | 3300005337 | Ga0070682_100200310 | Ga0070682_1002003101 | 201 |
| 418 | 3300005455 | Ga0070663_100402753 | Ga0070663_1004027531 | 201 |
| 419 | 3300005456 | Ga0070678_100282507 | Ga0070678_1002825072 | 201 |
| 420 | 3300009011 | Ga0105251_10000494 | Ga0105251_1000049427 | 201 |
| 421 | 3300009036 | Ga0105244_10056688 | Ga0105244_100566882 | 201 |
| 422 | 3300009093 | Ga0105240_10187322 | Ga0105240_101873223 | 201 |
| 423 | 3300009098 | Ga0105245_10578174 | Ga0105245_105781742 | 201 |
| 424 | 3300009545 | Ga0105237_11256959 | Ga0105237_112569591 | 201 |
| 425 | 3300009551 | Ga0105238_10110806 | Ga0105238_101108063 | 201 |
| 426 | 3300013105 | Ga0157369_10000089 | Ga0157369_1000008927 | 201 |
| 427 | 3300013296 | Ga0157374_10013236 | Ga0157374_100132364 | 201 |
| 428 | 3300013306 | Ga0163162_10380794 | Ga0163162_103807941 | 201 |
| 429 | 3300013307 | Ga0157372_10103727 | Ga0157372_101037272 | 201 |
| 430 | 3300013308 | Ga0157375_10725796 | Ga0157375_107257962 | 201 |
| 431 | 3300014497 | Ga0182008_10027051 | Ga0182008_100270513 | 201 |
| 432 | 3300015262 | Ga0182007_10008215 | Ga0182007_100082151 | 201 |
| 433 | 3300020069 | Ga0197907_11221094 | Ga0197907_112210942 | 201 |
| 434 | 3300020070 | Ga0206356_11658874 | Ga0206356_116588742 | 201 |
| 435 | 3300020075 | Ga0206349_1238021 | Ga0206349_12380212 | 201 |
| 436 | 3300020078 | Ga0206352_10995492 | Ga0206352_109954923 | 201 |
| 437 | 3300020082 | Ga0206353_10800542 | Ga0206353_108005423 | 201 |
| 438 | 3300022467 | Ga0224712_10000007 | Ga0224712_1000000715 | 201 |
| 439 | 3300025225 | Ga0209566_100164 | Ga0209566_10016436 | 201 |
| 440 | 3300025226 | Ga0209674_101938 | Ga0209674_1019383 | 201 |
| 441 | 3300025228 | Ga0209672_100001 | Ga0209672_1000011939 | 201 |
| 442 | 3300025228 | Ga0209672_100046 | Ga0209672_10004682 | 201 |
| 443 | 3300025229 | Ga0209147_100001 | Ga0209147_1000011939 | 201 |
| 444 | 3300025229 | Ga0209147_100043 | Ga0209147_100043181 | 201 |
| 445 | 3300025229 | Ga0209147_100214 | Ga0209147_10021436 | 201 |
| 446 | 3300025230 | Ga0209563_101354 | Ga0209563_1013546 | 201 |
| 447 | 3300025231 | Ga0207427_100478 | Ga0207427_10047821 | 201 |
| 448 | 3300025242 | Ga0209258_100001 | Ga0209258_1000011939 | 201 |
| 449 | 3300025242 | Ga0209258_100023 | Ga0209258_100023381 | 201 |
| 450 | 3300025254 | Ga0209148_1000003 | Ga0209148_10000031939 | 201 |
| 451 | 3300025254 | Ga0209148_1000029 | Ga0209148_1000029447 | 201 |
| 452 | 3300025256 | Ga0209759_1000037 | Ga0209759_1000037240 | 201 |
| 453 | 3300025256 | Ga0209759_1000175 | Ga0209759_100017513 | 201 |
| 454 | 3300025256 | Ga0209759_1000649 | Ga0209759_100064933 | 201 |
| 455 | 3300025261 | Ga0209233_1000123 | Ga0209233_1000123152 | 201 |
| 456 | 3300025263 | Ga0209565_1018119 | Ga0209565_10181192 | 201 |
| 457 | 3300025272 | Ga0209455_1000001 | Ga0209455_10000011939 | 201 |
| 458 | 3300025272 | Ga0209455_1000064 | Ga0209455_1000064176 | 201 |
| 459 | 3300025273 | Ga0209673_1000084 | Ga0209673_1000084171 | 201 |
| 460 | 3300025295 | Ga0209564_1002711 | Ga0209564_10027119 | 201 |
| 461 | 3300025302 | Ga0207426_1003361 | Ga0207426_10033618 | 201 |
| 462 | 3300025735 | Ga0207713_1031275 | Ga0207713_10312752 | 201 |
| 463 | 3300025904 | Ga0207647_10011776 | Ga0207647_100117765 | 201 |
| 464 | 3300025919 | Ga0207657_10067166 | Ga0207657_100671662 | 201 |
| 465 | 3300025927 | Ga0207687_10432405 | Ga0207687_104324052 | 201 |
| 466 | 3300025931 | Ga0207644_10617556 | Ga0207644_106175562 | 201 |
| 467 | 3300025949 | Ga0207667_10506810 | Ga0207667_105068102 | 201 |
| 468 | 3300026067 | Ga0207678_10044383 | Ga0207678_100443834 | 201 |
| 469 | 3300026067 | Ga0207678_10155596 | Ga0207678_101555962 | 201 |
| 470 | 3300027312 | Ga0209371_1000160 | Ga0209371_100016071 | 201 |
| 471 | 3300027312 | Ga0209371_1001668 | Ga0209371_100166815 | 201 |
| 472 | 3300030500 | Ga0268256_1000132 | Ga0268256_100013233 | 201 |
| 473 | 3300030500 | Ga0268256_1001457 | Ga0268256_100145715 | 201 |
| 474 | 3300030863 | Ga0265766_1000743 | Ga0265766_10007431 | 201 |
| 475 | 3300030888 | Ga0265769_104049 | Ga0265769_1040491 | 201 |
| 476 | 3300031911 | Ga0307412_10000014 | Ga0307412_10000014141 | 201 |
| 477 | 3300037418 | Ga0395900_0000057 | Ga0395900_0000057_24231_24842 | 201 |
| 478 | 3300037471 | Ga0395905_0018267 | Ga0395905_0018267_5856_6473 | 201 |
| 479 | 3300039447 | Ga0436361_0762421 | Ga0436361_0762421_491_1105 | 201 |
| 480 | 3300044656 | Ga0466969_0000396 | Ga0466969_0000396_19868_20491 | 201 |
| 481 | 3300044683 | Ga0466965_0000909 | Ga0466965_0000909_6124_6747 | 201 |
| 482 | 3300044683 | Ga0466965_0222614 | Ga0466965_0222614_159_776 | 201 |
| 483 | 3300044684 | Ga0466966_0048187 | Ga0466966_0048187_1501_2118 | 201 |
| 484 | 3300044693 | Ga0466961_0019264 | Ga0466961_0019264_850_1473 | 201 |
| 485 | 3300044694 | Ga0466963_0000828 | Ga0466963_0000828_2548_3171 | 201 |
| 486 | 3300044706 | Ga0466964_0026561 | Ga0466964_0026561_1071_1694 | 201 |
| 487 | 3300044719 | Ga0466971_0007013 | Ga0466971_0007013_2590_3213 | 201 |
| 488 | 3300044719 | Ga0466971_0103264 | Ga0466971_0103264_93_698 | 201 |
| 489 | 3300044735 | Ga0466968_0062794 | Ga0466968_0062794_243_866 | 201 |
| 490 | 3300044765 | Ga0466970_0009250 | Ga0466970_0009250_3579_4202 | 201 |
| 491 | 3300044842 | Ga0466957_0068577 | Ga0466957_0068577_906_1520 | 201 |
| 492 | 3300044842 | Ga0466957_0226919 | Ga0466957_0226919_565_1182 | 201 |
| 493 | 3300045049 | Ga0466959_0031486 | Ga0466959_0031486_1513_2136 | 201 |
| 494 | 3300045976 | Ga0466967_0313178 | Ga0466967_0313178_92_709 | 201 |
| 495 | 3300045976 | Ga0466967_0508282 | Ga0466967_0508282_507_1124 | 201 |
| 496 | 3300046455 | Ga0495603_0024167 | Ga0495603_0024167_1472_2089 | 201 |
| 497 | 3300046457 | Ga0495590_0014919 | Ga0495590_0014919_452_1072 | 201 |
| 498 | 3300046459 | Ga0495629_0027184 | Ga0495629_0027184_57_674 | 201 |
| 499 | 3300046459 | Ga0495629_0033751 | Ga0495629_0033751_180_797 | 201 |
| 500 | 3300046461 | Ga0495641_0013831 | Ga0495641_0013831_2494_3111 | 201 |
| 501 | 3300046463 | Ga0495653_0112901 | Ga0495653_0112901_784_1401 | 201 |
| 502 | 3300046463 | Ga0495653_0311867 | Ga0495653_0311867_178_798 | 201 |
| 503 | 3300046474 | Ga0495605_0014364 | Ga0495605_0014364_2588_3205 | 201 |
| 504 | 3300046477 | Ga0495664_0000322 | Ga0495664_0000322_9674_10294 | 201 |
| 505 | 3300046477 | Ga0495664_0016121 | Ga0495664_0016121_1706_2323 | 201 |
| 506 | 3300046477 | Ga0495664_0171882 | Ga0495664_0171882_216_851 | 201 |
| 507 | 3300046491 | Ga0495584_0107186 | Ga0495584_0107186_626_1243 | 201 |
| 508 | 3300046491 | Ga0495584_0231350 | Ga0495584_0231350_18_638 | 201 |
| 509 | 3300046500 | Ga0495596_0022942 | Ga0495596_0022942_944_1561 | 201 |
| 510 | 3300046507 | Ga0495606_0005895 | Ga0495606_0005895_8860_9480 | 201 |
| 511 | 3300046512 | Ga0495610_0041979 | Ga0495610_0041979_675_1292 | 201 |
| 512 | 3300046514 | Ga0495618_0011397 | Ga0495618_0011397_695_1312 | 201 |
| 513 | 3300046515 | Ga0495620_0050120 | Ga0495620_0050120_659_1279 | 201 |
| 514 | 3300046516 | Ga0495628_0002241 | Ga0495628_0002241_8926_9543 | 201 |
| 515 | 3300046516 | Ga0495628_0101891 | Ga0495628_0101891_640_1260 | 201 |
| 516 | 3300046516 | Ga0495628_0180987 | Ga0495628_0180987_728_1345 | 201 |
| 517 | 3300046517 | Ga0495630_0119088 | Ga0495630_0119088_256_873 | 201 |
| 518 | 3300046522 | Ga0495643_0289574 | Ga0495643_0289574_101_718 | 201 |
| 519 | 3300046526 | Ga0495666_0037013 | Ga0495666_0037013_716_1333 | 201 |
| 520 | 3300046528 | Ga0495642_0012144 | Ga0495642_0012144_1753_2373 | 201 |
| 521 | 3300046528 | Ga0495642_0014713 | Ga0495642_0014713_944_1561 | 201 |
| 522 | 3300046529 | Ga0495652_0028132 | Ga0495652_0028132_1372_1989 | 201 |
| 523 | 3300046529 | Ga0495652_0040219 | Ga0495652_0040219_609_1229 | 201 |
| 524 | 3300046531 | Ga0495665_0019441 | Ga0495665_0019441_2331_2951 | 201 |
| 525 | 3300046531 | Ga0495665_0024081 | Ga0495665_0024081_1600_2217 | 201 |
| 526 | 3300046535 | Ga0495586_0052371 | Ga0495586_0052371_1219_1839 | 201 |
| 527 | 3300046536 | Ga0495587_0008118 | Ga0495587_0008118_1077_1694 | 201 |
| 528 | 3300046542 | Ga0495597_0008217 | Ga0495597_0008217_1353_1973 | 201 |
| 529 | 3300046543 | Ga0495645_0000279 | Ga0495645_0000279_7833_8450 | 201 |
| 530 | 3300046543 | Ga0495645_0007946 | Ga0495645_0007946_2080_2703 | 201 |
| 531 | 3300046543 | Ga0495645_0023746 | Ga0495645_0023746_606_1226 | 201 |
| 532 | 3300046663 | Ga0495635_0004906 | Ga0495635_0004906_1176_1793 | 201 |
| 533 | 3300046663 | Ga0495635_0059985 | Ga0495635_0059985_1813_2433 | 201 |
| 534 | 3300046665 | Ga0495661_0016604 | Ga0495661_0016604_2945_3562 | 201 |
| 535 | 3300046675 | Ga0495657_0080549 | Ga0495657_0080549_923_1540 | 201 |
| 536 | 3300046679 | Ga0495623_0044486 | Ga0495623_0044486_1500_2120 | 201 |
| 537 | 3300046679 | Ga0495623_0115579 | Ga0495623_0115579_16_633 | 201 |
| 538 | 3300046680 | Ga0495646_0004119 | Ga0495646_0004119_2794_3411 | 201 |
| 539 | 3300046680 | Ga0495646_0014508 | Ga0495646_0014508_3221_3838 | 201 |
| 540 | 3300046680 | Ga0495646_0040978 | Ga0495646_0040978_175_795 | 201 |
| 541 | 3300046684 | Ga0495669_0035818 | Ga0495669_0035818_1010_1630 | 201 |
| 542 | 3300046689 | Ga0495613_0009641 | Ga0495613_0009641_3717_4334 | 201 |
| 543 | 3300046690 | Ga0495624_0006559 | Ga0495624_0006559_2962_3579 | 201 |
| 544 | 3300046690 | Ga0495624_0008020 | Ga0495624_0008020_5118_5738 | 201 |
| 545 | 3300046694 | Ga0495649_0007008 | Ga0495649_0007008_2744_3361 | 201 |
| 546 | 3300046694 | Ga0495649_0241755 | Ga0495649_0241755_102_722 | 201 |
| 547 | 3300046794 | Ga0495589_0030616 | Ga0495589_0030616_600_1217 | 201 |
| 548 | 3300046794 | Ga0495589_0099880 | Ga0495589_0099880_298_918 | 201 |
| 549 | 3300046810 | Ga0495660_0074718 | Ga0495660_0074718_18_635 | 201 |
| 550 | 3300047317 | Ga0495604_0021636 | Ga0495604_0021636_1086_1703 | 201 |
| 551 | 3300047317 | Ga0495604_0226293 | Ga0495604_0226293_124_744 | 201 |
| 552 | 3300047319 | Ga0495674_0016538 | Ga0495674_0016538_2607_3227 | 201 |
| 553 | 3300047319 | Ga0495674_0054418 | Ga0495674_0054418_1600_2217 | 201 |
| 554 | 3300047319 | Ga0495674_0270376 | Ga0495674_0270376_656_1273 | 201 |
| 555 | 3300047321 | Ga0495676_0007295 | Ga0495676_0007295_7938_8555 | 201 |
| 556 | 3300047321 | Ga0495676_0099540 | Ga0495676_0099540_18_635 | 201 |
| 557 | 3300047322 | Ga0495680_0003867 | Ga0495680_0003867_7942_8559 | 201 |
| 558 | 3300047323 | Ga0495683_0022416 | Ga0495683_0022416_1293_1910 | 201 |
| 559 | 3300047323 | Ga0495683_0084549 | Ga0495683_0084549_13_633 | 201 |
| 560 | 3300047446 | Ga0495679_001911 | Ga0495679_001911_1422_2039 | 201 |
| 561 | 3300047447 | Ga0495685_098361 | Ga0495685_098361_305_922 | 201 |
| 562 | 3300047472 | Ga0495686_0065065 | Ga0495686_0065065_1181_1804 | 201 |
| 563 | 3300047673 | Ga0495593_0028703 | Ga0495593_0028703_1782_2399 | 201 |
| 564 | 3300047673 | Ga0495593_0040811 | Ga0495593_0040811_97_717 | 201 |
| 565 | 3300048089 | Ga0495614_0003774 | Ga0495614_0003774_2610_3227 | 201 |
| 566 | 3300048091 | Ga0495626_0041950 | Ga0495626_0041950_707_1327 | 201 |
| 567 | 3300048903 | Ga0496100_0213160 | Ga0496100_0213160_436_1056 | 201 |
| 568 | 3300048905 | Ga0496102_0065372 | Ga0496102_0065372_2439_3071 | 201 |
| 569 | 3300048906 | Ga0496103_0004929 | Ga0496103_0004929_5582_6202 | 201 |
| 570 | 3300048907 | Ga0496104_0007782 | Ga0496104_0007782_4655_5275 | 201 |
| 571 | 3300048908 | Ga0496105_0055930 | Ga0496105_0055930_2032_2652 | 201 |
| 572 | 3300048911 | Ga0496108_0206721 | Ga0496108_0206721_662_1282 | 201 |
| 573 | 3300048913 | Ga0496110_0010435 | Ga0496110_0010435_4596_5216 | 201 |
| 574 | 3300048915 | Ga0496112_0004021 | Ga0496112_0004021_2153_2773 | 201 |
| 575 | 3300048917 | Ga0496114_0510647 | Ga0496114_0510647_283_903 | 201 |
| 576 | 3300048918 | Ga0496115_0104925 | Ga0496115_0104925_1179_1799 | 201 |
| 577 | 3300048919 | Ga0496116_0008846 | Ga0496116_0008846_1926_2546 | 201 |
| 578 | 3300048920 | Ga0496117_0003482 | Ga0496117_0003482_3586_4206 | 201 |
| 579 | 3300048920 | Ga0496117_0026468 | Ga0496117_0026468_103_720 | 201 |
| 580 | 3300048921 | Ga0496118_0014797 | Ga0496118_0014797_2816_3436 | 201 |
| 581 | 3300048921 | Ga0496118_0052070 | Ga0496118_0052070_940_1557 | 201 |
| 582 | 3300048921 | Ga0496118_0156726 | Ga0496118_0156726_317_940 | 201 |
| 583 | 3300048922 | Ga0496119_0204803 | Ga0496119_0204803_194_814 | 201 |
| 584 | 3300048924 | Ga0496121_0000333 | Ga0496121_0000333_82416_83030 | 201 |
| 585 | 3300048924 | Ga0496121_0017772 | Ga0496121_0017772_4562_5182 | 201 |
| 586 | 3300048926 | Ga0496123_0105432 | Ga0496123_0105432_299_919 | 201 |
| 587 | 3300048927 | Ga0496124_0151004 | Ga0496124_0151004_827_1447 | 201 |
| 588 | 3300048928 | Ga0496125_0052026 | Ga0496125_0052026_424_1044 | 201 |
| 589 | 3300048929 | Ga0496126_0002413 | Ga0496126_0002413_13920_14534 | 201 |
| 590 | 3300048929 | Ga0496126_0027437 | Ga0496126_0027437_2419_3039 | 201 |
| 591 | 3300059492 | Ga0587073_0102713 | Ga0587073_0102713_102_710 | 201 |
| 592 | 3300059504 | Ga0587082_053293 | Ga0587082_053293_142_753 | 201 |
| 593 | 3300059510 | Ga0587090_031471 | Ga0587090_031471_21_638 | 201 |
| 594 | 3300059646 | Ga0587078_029348 | Ga0587078_029348_17_634 | 201 |
| 595 | 3300059647 | Ga0587079_047612 | Ga0587079_047612_253_867 | 201 |
| 596 | 3300061719 | Ga0466962_0000412 | Ga0466962_0000412_12571_13194 | 201 |
| 597 | 3300061719 | Ga0466962_0173559 | Ga0466962_0173559_386_991 | 201 |
| 598 | 3300001904 | JGI24736J21556_1032396 | JGI24736J21556_10323961 | 202 |
| 599 | 3300001915 | JGI24741J21665_1020862 | JGI24741J21665_10208622 | 202 |
| 600 | 3300001979 | JGI24740J21852_10008433 | JGI24740J21852_100084333 | 202 |
| 601 | 3300001989 | JGI24739J22299_10015759 | JGI24739J22299_100157593 | 202 |
| 602 | 3300001989 | JGI24739J22299_10053645 | JGI24739J22299_100536451 | 202 |
| 603 | 3300002067 | JGI24735J21928_10002039 | JGI24735J21928_100020397 | 202 |
| 604 | 3300002067 | JGI24735J21928_10010740 | JGI24735J21928_100107405 | 202 |
| 605 | 3300005339 | Ga0070660_100001282 | Ga0070660_10000128212 | 202 |
| 606 | 3300005339 | Ga0070660_100002463 | Ga0070660_10000246312 | 202 |
| 607 | 3300005366 | Ga0070659_100000941 | Ga0070659_1000009418 | 202 |
| 608 | 3300005455 | Ga0070663_100000078 | Ga0070663_10000007827 | 202 |
| 609 | 3300005563 | Ga0068855_100002445 | Ga0068855_10000244525 | 202 |
| 610 | 3300005563 | Ga0068855_100024592 | Ga0068855_1000245928 | 202 |
| 611 | 3300005564 | Ga0070664_100018288 | Ga0070664_1000182881 | 202 |
| 612 | 3300005614 | Ga0068856_100798596 | Ga0068856_1007985961 | 202 |
| 613 | 3300005616 | Ga0068852_100209858 | Ga0068852_1002098582 | 202 |
| 614 | 3300009092 | Ga0105250_10001544 | Ga0105250_100015448 | 202 |
| 615 | 3300009093 | Ga0105240_10002069 | Ga0105240_1000206920 | 202 |
| 616 | 3300009093 | Ga0105240_10109589 | Ga0105240_101095894 | 202 |
| 617 | 3300009093 | Ga0105240_10143016 | Ga0105240_101430163 | 202 |
| 618 | 3300009545 | Ga0105237_10003905 | Ga0105237_100039053 | 202 |
| 619 | 3300009545 | Ga0105237_10014560 | Ga0105237_100145603 | 202 |
| 620 | 3300009551 | Ga0105238_10011579 | Ga0105238_100115798 | 202 |
| 621 | 3300009551 | Ga0105238_10159615 | Ga0105238_101596151 | 202 |
| 622 | 3300010375 | Ga0105239_10796970 | Ga0105239_107969701 | 202 |
| 623 | 3300013100 | Ga0157373_10050130 | Ga0157373_100501303 | 202 |
| 624 | 3300013100 | Ga0157373_10050698 | Ga0157373_100506982 | 202 |
| 625 | 3300013104 | Ga0157370_10219901 | Ga0157370_102199013 | 202 |
| 626 | 3300013104 | Ga0157370_10583055 | Ga0157370_105830552 | 202 |
| 627 | 3300013105 | Ga0157369_10029387 | Ga0157369_100293873 | 202 |
| 628 | 3300013105 | Ga0157369_10133483 | Ga0157369_101334834 | 202 |
| 629 | 3300013296 | Ga0157374_10000230 | Ga0157374_1000023044 | 202 |
| 630 | 3300013307 | Ga0157372_10003271 | Ga0157372_1000327114 | 202 |
| 631 | 3300013307 | Ga0157372_10127335 | Ga0157372_101273354 | 202 |
| 632 | 3300013308 | Ga0157375_10178118 | Ga0157375_101781181 | 202 |
| 633 | 3300015261 | Ga0182006_1061327 | Ga0182006_10613272 | 202 |
| 634 | 3300015261 | Ga0182006_1072622 | Ga0182006_10726221 | 202 |
| 635 | 3300015262 | Ga0182007_10086619 | Ga0182007_100866191 | 202 |
| 636 | 3300015265 | Ga0182005_1004296 | Ga0182005_10042966 | 202 |
| 637 | 3300020069 | Ga0197907_11270793 | Ga0197907_112707932 | 202 |
| 638 | 3300020076 | Ga0206355_1492387 | Ga0206355_14923874 | 202 |
| 639 | 3300025228 | Ga0209672_100088 | Ga0209672_10008885 | 202 |
| 640 | 3300025228 | Ga0209672_100289 | Ga0209672_10028934 | 202 |
| 641 | 3300025229 | Ga0209147_100130 | Ga0209147_10013085 | 202 |
| 642 | 3300025242 | Ga0209258_100204 | Ga0209258_10020485 | 202 |
| 643 | 3300025256 | Ga0209759_1003128 | Ga0209759_10031287 | 202 |
| 644 | 3300025256 | Ga0209759_1007337 | Ga0209759_10073374 | 202 |
| 645 | 3300025711 | Ga0207696_1005257 | Ga0207696_10052576 | 202 |
| 646 | 3300025904 | Ga0207647_10000161 | Ga0207647_1000016154 | 202 |
| 647 | 3300025904 | Ga0207647_10001999 | Ga0207647_1000199912 | 202 |
| 648 | 3300025909 | Ga0207705_10325384 | Ga0207705_103253841 | 202 |
| 649 | 3300025913 | Ga0207695_10005494 | Ga0207695_1000549412 | 202 |
| 650 | 3300025913 | Ga0207695_10008360 | Ga0207695_100083603 | 202 |
| 651 | 3300025913 | Ga0207695_10100894 | Ga0207695_101008944 | 202 |
| 652 | 3300025914 | Ga0207671_10008949 | Ga0207671_100089493 | 202 |
| 653 | 3300025914 | Ga0207671_10010980 | Ga0207671_100109808 | 202 |
| 654 | 3300025914 | Ga0207671_10294312 | Ga0207671_102943122 | 202 |
| 655 | 3300025919 | Ga0207657_10000022 | Ga0207657_100000228 | 202 |
| 656 | 3300025919 | Ga0207657_10021113 | Ga0207657_100211137 | 202 |
| 657 | 3300025924 | Ga0207694_10051653 | Ga0207694_100516535 | 202 |
| 658 | 3300025932 | Ga0207690_10000010 | Ga0207690_10000010303 | 202 |
| 659 | 3300025945 | Ga0207679_10056462 | Ga0207679_100564621 | 202 |
| 660 | 3300025949 | Ga0207667_10018019 | Ga0207667_100180197 | 202 |
| 661 | 3300025949 | Ga0207667_10052254 | Ga0207667_100522542 | 202 |
| 662 | 3300026035 | Ga0207703_10212184 | Ga0207703_102121841 | 202 |
| 663 | 3300026067 | Ga0207678_10000226 | Ga0207678_1000022632 | 202 |
| 664 | 3300026078 | Ga0207702_10418981 | Ga0207702_104189812 | 202 |
| 665 | 3300026142 | Ga0207698_10087208 | Ga0207698_100872082 | 202 |
| 666 | 3300028800 | Ga0265338_10000133 | Ga0265338_1000013356 | 202 |
| 667 | 3300030836 | Ga0265767_105182 | Ga0265767_1051821 | 202 |
| 668 | 3300037418 | Ga0395900_0118493 | Ga0395900_0118493_62_679 | 202 |
| 669 | 3300037466 | Ga0395898_0005183 | Ga0395898_0005183_4870_5484 | 202 |
| 670 | 3300037466 | Ga0395898_0383212 | Ga0395898_0383212_559_1176 | 202 |
| 671 | 3300042005 | Ga0439448_0000242 | Ga0439448_0000242_2923_3540 | 202 |
| 672 | 3300044658 | Ga0466972_0109688 | Ga0466972_0109688_604_1212 | 202 |
| 673 | 3300044673 | Ga0453683_0145506 | Ga0453683_0145506_760_1395 | 202 |
| 674 | 3300044683 | Ga0466965_0043811 | Ga0466965_0043811_1492_2100 | 202 |
| 675 | 3300044693 | Ga0466961_0067405 | Ga0466961_0067405_1388_1996 | 202 |
| 676 | 3300044765 | Ga0466970_0099096 | Ga0466970_0099096_165_773 | 202 |
| 677 | 3300044842 | Ga0466957_0067358 | Ga0466957_0067358_127_735 | 202 |
| 678 | 3300044901 | Ga0466960_0029954 | Ga0466960_0029954_1611_2219 | 202 |
| 679 | 3300046455 | Ga0495603_0016288 | Ga0495603_0016288_3361_3981 | 202 |
| 680 | 3300046458 | Ga0495591_005442 | Ga0495591_005442_2447_3067 | 202 |
| 681 | 3300046459 | Ga0495629_0001348 | Ga0495629_0001348_5823_6443 | 202 |
| 682 | 3300046462 | Ga0495651_0201333 | Ga0495651_0201333_543_1163 | 202 |
| 683 | 3300046471 | Ga0495650_0002161 | Ga0495650_0002161_13174_13794 | 202 |
| 684 | 3300046472 | Ga0495580_0024823 | Ga0495580_0024823_815_1438 | 202 |
| 685 | 3300046472 | Ga0495580_0034640 | Ga0495580_0034640_2724_3344 | 202 |
| 686 | 3300046473 | Ga0495582_0022261 | Ga0495582_0022261_957_1577 | 202 |
| 687 | 3300046507 | Ga0495606_0010464 | Ga0495606_0010464_5741_6361 | 202 |
| 688 | 3300046517 | Ga0495630_0035456 | Ga0495630_0035456_1222_1842 | 202 |
| 689 | 3300046518 | Ga0495631_0126571 | Ga0495631_0126571_241_870 | 202 |
| 690 | 3300046530 | Ga0495654_0063029 | Ga0495654_0063029_1043_1663 | 202 |
| 691 | 3300046543 | Ga0495645_0002307 | Ga0495645_0002307_8028_8648 | 202 |
| 692 | 3300046559 | Ga0495667_0124783 | Ga0495667_0124783_669_1289 | 202 |
| 693 | 3300046680 | Ga0495646_0147398 | Ga0495646_0147398_85_705 | 202 |
| 694 | 3300046689 | Ga0495613_0146088 | Ga0495613_0146088_169_789 | 202 |
| 695 | 3300046694 | Ga0495649_0010030 | Ga0495649_0010030_4408_5028 | 202 |
| 696 | 3300046809 | Ga0495600_0032604 | Ga0495600_0032604_25_645 | 202 |
| 697 | 3300047315 | Ga0495581_0008129 | Ga0495581_0008129_4442_5062 | 202 |
| 698 | 3300047320 | Ga0495672_0002712 | Ga0495672_0002712_269_901 | 202 |
| 699 | 3300047323 | Ga0495683_0140661 | Ga0495683_0140661_361_987 | 202 |
| 700 | 3300047443 | Ga0495687_007490 | Ga0495687_007490_4474_5091 | 202 |
| 701 | 3300047445 | Ga0495677_0065460 | Ga0495677_0065460_132_752 | 202 |
| 702 | 3300047469 | Ga0495673_0105101 | Ga0495673_0105101_241_873 | 202 |
| 703 | 3300048903 | Ga0496100_0234325 | Ga0496100_0234325_216_836 | 202 |
| 704 | 3300048903 | Ga0496100_0248364 | Ga0496100_0248364_499_1119 | 202 |
| 705 | 3300048904 | Ga0496101_0098202 | Ga0496101_0098202_916_1536 | 202 |
| 706 | 3300048904 | Ga0496101_0397191 | Ga0496101_0397191_234_854 | 202 |
| 707 | 3300048907 | Ga0496104_0092598 | Ga0496104_0092598_1659_2279 | 202 |
| 708 | 3300048907 | Ga0496104_0425582 | Ga0496104_0425582_215_835 | 202 |
| 709 | 3300048908 | Ga0496105_0095642 | Ga0496105_0095642_221_841 | 202 |
| 710 | 3300048908 | Ga0496105_0247082 | Ga0496105_0247082_185_805 | 202 |
| 711 | 3300048909 | Ga0496106_0389787 | Ga0496106_0389787_463_1083 | 202 |
| 712 | 3300048912 | Ga0496109_0471080 | Ga0496109_0471080_475_1095 | 202 |
| 713 | 3300048915 | Ga0496112_0144155 | Ga0496112_0144155_1521_2141 | 202 |
| 714 | 3300048917 | Ga0496114_0001303 | Ga0496114_0001303_5366_5986 | 202 |
| 715 | 3300048917 | Ga0496114_0355961 | Ga0496114_0355961_345_974 | 202 |
| 716 | 3300048919 | Ga0496116_0146119 | Ga0496116_0146119_454_1074 | 202 |
| 717 | 3300048920 | Ga0496117_0006043 | Ga0496117_0006043_1815_2444 | 202 |
| 718 | 3300048920 | Ga0496117_0152051 | Ga0496117_0152051_467_1087 | 202 |
| 719 | 3300048921 | Ga0496118_0009107 | Ga0496118_0009107_1815_2444 | 202 |
| 720 | 3300048921 | Ga0496118_0134601 | Ga0496118_0134601_783_1403 | 202 |
| 721 | 3300048922 | Ga0496119_0099868 | Ga0496119_0099868_789_1409 | 202 |
| 722 | 3300048924 | Ga0496121_0262167 | Ga0496121_0262167_282_902 | 202 |
| 723 | 3300048925 | Ga0496122_0068277 | Ga0496122_0068277_204_824 | 202 |
| 724 | 3300048926 | Ga0496123_0124646 | Ga0496123_0124646_453_1073 | 202 |
| 725 | 3300048928 | Ga0496125_0086639 | Ga0496125_0086639_163_783 | 202 |
| 726 | 3300048928 | Ga0496125_0284595 | Ga0496125_0284595_363_989 | 202 |
| 727 | 3300048929 | Ga0496126_0000088 | Ga0496126_0000088_61131_61760 | 202 |
| 728 | 3300048929 | Ga0496126_0005752 | Ga0496126_0005752_6473_7099 | 202 |
| 729 | 3300059503 | Ga0587080_005082 | Ga0587080_005082_18_638 | 202 |
| 730 | 3300059504 | Ga0587082_018637 | Ga0587082_018637_462_1082 | 202 |
| 731 | 3300059645 | Ga0587076_013093 | Ga0587076_013093_615_1235 | 202 |
| 732 | 3300059652 | Ga0587107_000692 | Ga0587107_000692_98_718 | 202 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6dnc-assembly1.cif.gz_Z | e.coli rf1 bound to e.coli 70s ribosome in response to uau sense a-site codon | 0.9575 | 2 | 93 |
| 6ysi-assembly1.cif.gz_R | acinetobacter baumannii ribosome-tigecycline complex - 50s subunit | 0.9523 | 2 | 93 |
| 7m4v-assembly1.cif.gz_U | a. baumannii ribosome-eravacycline complex: 50s | 0.9467 | 2 | 93 |
| 6ogg-assembly1.cif.gz_v | 70s termination complex with rf2 bound to the uga codon. rotated ribosome with rf2 bound (structure iv). | 0.9425 | 2 | 93 |
| 7unw-assembly1.cif.gz_X | pseudomonas aeruginosa 70s ribosome initiation complex bound to if2-gdpcp (structure ii-b) | 0.9303 | 2 | 186 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_F4JPA3_178_267_2.170.120.20 | Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain | 0.9329 | 99 | 186 | 2.170.120.20 |
| af_Q2G0S0_95_176_2.170.120.20 | Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain | 0.9151 | 94 | 167 | 2.170.120.20 |
| af_A0A0P0W059_2_141_2.40.240.10 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P | 0.908 | 2 | 94 | 2.40.240.10 |
| af_P9WHB5_5_98_2.40.240.10 | Mainly Beta;Beta Barrel;Ribosomal Protein L25; Chain P;Ribosomal Protein L25; Chain P | 0.8927 | 2 | 93 | 2.40.240.10 |
| 4rb6Z02 | Mainly Beta;Beta Complex;RNA Polymerase Alpha Subunit; Chain A, domain 2;Ribosomal protein L25, C-terminal domain | 0.8882 | 97 | 180 | 2.170.120.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A351NNR7-F1-model_v4 | deleted | 0.9836 | 25 | 93 |
|
| AF-A0A354Z455-F1-model_v4 | 50S ribosomal protein L25 | 0.9738 | 2 | 97 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A4P2SQK3-F1-model_v4 | deleted | 0.9711 | 1 | 92 |
|
| AF-E6KXM6-F1-model_v4 | Large ribosomal subunit protein bL25 | 0.9699 | 2 | 93 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
| AF-A0A2H9U0J8-F1-model_v4 | Large ribosomal subunit protein bL25 | 0.9662 | 2 | 93 |
GO:0003735
GO:0006412 GO:0008097 GO:0022625 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar