F477961
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 731 | 287 | 1386 | 524 |
Family's Representative Sequence
| Representative Sequence | 3300007265|Ga0099794_10024386|Ga0099794_100243862 |
| Length | 598 |
| Sequence | MASRMMRVIGHWEFLKRTRMHRLAALHKIIAKQKGRLVTALVALQNEFCAIHVARLQMLHGKPRKSHRRIRMMAFRNLILGSVAGLLAIGGVQAADLPVKAKAVEYVRICSLYGAGFFFIPGTDTCIKLGGYLRVDTTFNGGIQGQPAWNGDLGQQNRYRDYFASRSRMALTVDTRTATEYGVVRTFMQADFQFNTLGGSTFNPNSINVTSPVGGVQLLDTPGGGYVAVESVFIQFAGFTFGKSSSAYATPWNGFPGNISSYLLGGHNTDTGVNNVQYTAQFGNGVSGTIGLDDPTVWNRTAVYNLSLPLNATLNSGNAYAGVHAPDVVGNIRVDQAWGLFQISAAAHEVSGSYNVLNTAAVPAGATGLAGAAPTALSEINGHPETKWGGSVMAGLNIKNLPTGAGDDIKIDASYAKGDTKNVIATASTSPSFAMFSGTGRAGAYESIGFGATTDGVWLPAANGGDGAIHLTTAYGMRGAFNHNWDAHWSSSLFGSYSAVRYDNVAKTNICTNYTTPAKAVSADFTCNPDFNVSQLGVITRWAPVKNLTFSAELMWFHLDQKFTGAATLGATAPKPAAVYAFKDQDAISLQLRAQRNF |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 2 | 3300003163 | Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 6 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 7 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 8 | 3300003575 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 9 | 3300003577 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 10 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 11 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 12 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 13 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 23 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 26 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 29 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 32 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 34 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 39 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 47 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 48 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 49 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 50 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 51 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 52 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 53 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 54 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 56 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 57 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 58 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 59 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 61 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 62 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 63 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 64 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 65 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 66 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 67 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 68 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 69 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 70 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 72 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 73 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 74 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 76 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 78 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 80 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 87 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 88 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 93 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 94 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 95 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 96 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 145 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 149 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 150 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 151 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 152 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 153 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 154 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 155 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 156 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 157 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 158 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 159 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 160 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 161 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 162 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 163 | 3300036242 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 164 | 3300036457 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 165 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 166 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 167 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 168 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 169 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 170 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 171 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 172 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 173 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 174 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 175 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 176 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 178 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 181 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 182 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 183 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 184 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 185 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 186 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 187 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 188 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 189 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 190 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 191 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 192 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 193 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 194 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 195 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 203 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 204 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 205 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 206 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 207 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 208 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 209 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 210 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 211 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 212 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 213 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 214 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 215 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 216 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 217 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 218 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 219 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 220 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 221 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 222 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 223 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 224 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 225 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 226 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 227 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 228 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 229 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 230 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 231 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 232 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 233 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 234 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 235 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 236 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 237 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 238 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 239 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 240 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 241 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 242 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 243 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 244 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 245 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 246 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 247 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 248 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 249 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 250 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 251 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 252 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 253 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 254 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 255 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 256 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 257 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 258 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 259 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 260 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 261 | 3300059624 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 262 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 263 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 264 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 265 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 266 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 267 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 268 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 269 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 270 | 2791355199 | |||
| 271 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 272 | 2876808645 | Bradyrhizobium algeriense RST89 | Isolate | Unclassified |
| 273 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 274 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 275 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 276 | 2903748898 | Bradyrhizobium uaiense UFLA 03-164 | Isolate | Nodule |
| 277 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 278 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 279 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 280 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 281 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 282 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 283 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 284 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 285 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 286 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 287 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.64 |
| Metatranscriptomes | 2.34 |
| Isolates | 10.03 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 17.65 |
| Nodule | 7.8 |
| Rhizoplane | 3.42 |
| Rhizosphere | 60.05 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0099794_10024386 | 3300007265 | Bacteria | 2776 |
| 2 | Ga0006759J45824_1014111 | 3300003163 | Bacteria | 1696 |
| 3 | JGI25406J46586_10000006 | 3300003203 | Bacteria | 114937 |
| 4 | JGI25406J46586_10016308 | 3300003203 | Bacteria | 3100 |
| 5 | JGI25153J46596_10003035 | 3300003215 | Bacteria | 9489 |
| 6 | JGI25153J46596_10005756 | 3300003215 | Bacteria | 6460 |
| 7 | rootH2_10091315 | 3300003320 | Bacteria | 4859 |
| 8 | rootH1_10017865 | 3300003323 | Bacteria | 4012 |
| 9 | Ga0007410J51695_1029247 | 3300003574 | Bacteria | 1555 |
| 10 | Ga0007409J51694_1011648 | 3300003575 | Bacteria | 1652 |
| 11 | Ga0007409J51694_1017406 | 3300003575 | Bacteria | 1588 |
| 12 | Ga0007409J51694_1034979 | 3300003575 | Bacteria | 1552 |
| 13 | Ga0007416J51690_1019111 | 3300003577 | Bacteria | 1824 |
| 14 | JGI25404J52841_10000143 | 3300003659 | Bacteria | 7751 |
| 15 | JGI25404J52841_10000958 | 3300003659 | Bacteria | 4706 |
| 16 | JGI25404J52841_10001663 | 3300003659 | Bacteria | 3992 |
| 17 | JGI25404J52841_10002240 | 3300003659 | Bacteria | 3631 |
| 18 | JGI25404J52841_10002994 | 3300003659 | Bacteria | 3284 |
| 19 | JGI25404J52841_10003961 | 3300003659 | Bacteria | 2971 |
| 20 | JGI25404J52841_10004171 | 3300003659 | Bacteria | 2910 |
| 21 | JGI25404J52841_10004443 | 3300003659 | Bacteria | 2842 |
| 22 | JGI25404J52841_10005004 | 3300003659 | Bacteria | 2723 |
| 23 | JGI25404J52841_10006428 | 3300003659 | Bacteria | 2458 |
| 24 | JGI25404J52841_10006984 | 3300003659 | Bacteria | 2375 |
| 25 | Ga0058863_10061770 | 3300004799 | Bacteria | 1724 |
| 26 | Ga0058862_12142271 | 3300004803 | Bacteria | 1977 |
| 27 | Ga0070683_100000231 | 3300005329 | Bacteria | 38055 |
| 28 | Ga0070683_100012503 | 3300005329 | Bacteria | 7379 |
| 29 | Ga0070683_100053358 | 3300005329 | Bacteria | 3746 |
| 30 | Ga0070683_100079179 | 3300005329 | Bacteria | 3075 |
| 31 | Ga0070670_100060074 | 3300005331 | Bacteria | 3263 |
| 32 | Ga0068869_100030039 | 3300005334 | Bacteria | 3811 |
| 33 | Ga0068869_100044014 | 3300005334 | Bacteria | 3209 |
| 34 | Ga0070680_100029259 | 3300005336 | Bacteria | 4424 |
| 35 | Ga0070680_100030038 | 3300005336 | Bacteria | 4364 |
| 36 | Ga0070682_100042753 | 3300005337 | Bacteria | 2800 |
| 37 | Ga0068868_100011161 | 3300005338 | Bacteria | 6541 |
| 38 | Ga0070668_100036165 | 3300005347 | Bacteria | 3768 |
| 39 | Ga0070668_100070924 | 3300005347 | Bacteria | 2713 |
| 40 | Ga0070668_100106641 | 3300005347 | Bacteria | 2226 |
| 41 | Ga0070668_100156005 | 3300005347 | Bacteria | 1849 |
| 42 | Ga0070668_100156354 | 3300005347 | Bacteria | 1847 |
| 43 | Ga0070671_100020925 | 3300005355 | Bacteria | 5337 |
| 44 | Ga0070671_100037298 | 3300005355 | Bacteria | 4030 |
| 45 | Ga0070671_100065630 | 3300005355 | Bacteria | 3024 |
| 46 | Ga0070674_100084176 | 3300005356 | Bacteria | 2280 |
| 47 | Ga0070709_10000587 | 3300005434 | Bacteria | 21300 |
| 48 | Ga0070709_10008074 | 3300005434 | Bacteria | 5775 |
| 49 | Ga0070714_100027623 | 3300005435 | Bacteria | 4701 |
| 50 | Ga0070714_100044894 | 3300005435 | Bacteria | 3743 |
| 51 | Ga0070714_100076222 | 3300005435 | Bacteria | 2911 |
| 52 | Ga0070713_100013919 | 3300005436 | Bacteria | 5956 |
| 53 | Ga0070713_100016206 | 3300005436 | Bacteria | 5602 |
| 54 | Ga0070713_100021072 | 3300005436 | Bacteria | 5006 |
| 55 | Ga0070710_10000736 | 3300005437 | Bacteria | 15576 |
| 56 | Ga0070663_100008935 | 3300005455 | Bacteria | 6188 |
| 57 | Ga0070663_100012244 | 3300005455 | Bacteria | 5416 |
| 58 | Ga0070663_100057736 | 3300005455 | Bacteria | 2785 |
| 59 | Ga0070663_100085278 | 3300005455 | Bacteria | 2330 |
| 60 | Ga0070678_100040810 | 3300005456 | Bacteria | 3286 |
| 61 | Ga0070678_100110316 | 3300005456 | Bacteria | 2151 |
| 62 | Ga0070681_10092689 | 3300005458 | Bacteria | 2969 |
| 63 | Ga0070681_10116519 | 3300005458 | Bacteria | 2608 |
| 64 | Ga0070681_10161296 | 3300005458 | Bacteria | 2166 |
| 65 | Ga0070681_10254481 | 3300005458 | Bacteria | 1668 |
| 66 | Ga0070698_100031556 | 3300005471 | Bacteria | 5492 |
| 67 | Ga0070698_100036479 | 3300005471 | Bacteria | 5077 |
| 68 | Ga0070698_100100522 | 3300005471 | Bacteria | 2864 |
| 69 | Ga0070679_100039201 | 3300005530 | Bacteria | 4709 |
| 70 | Ga0070679_100111671 | 3300005530 | Bacteria | 2720 |
| 71 | Ga0070679_100149731 | 3300005530 | Bacteria | 2311 |
| 72 | Ga0070684_100001996 | 3300005535 | Bacteria | 15009 |
| 73 | Ga0070684_100015846 | 3300005535 | Bacteria | 6151 |
| 74 | Ga0070697_100010345 | 3300005536 | Bacteria | 7275 |
| 75 | Ga0068853_100018719 | 3300005539 | Bacteria | 5736 |
| 76 | Ga0068853_100159716 | 3300005539 | Bacteria | 2033 |
| 77 | Ga0070695_100036684 | 3300005545 | Bacteria | 3085 |
| 78 | Ga0070696_100050450 | 3300005546 | Bacteria | 2892 |
| 79 | Ga0070693_100030832 | 3300005547 | Bacteria | 2935 |
| 80 | Ga0070693_100056068 | 3300005547 | Bacteria | 2273 |
| 81 | Ga0070693_100070802 | 3300005547 | Bacteria | 2053 |
| 82 | Ga0070665_100004023 | 3300005548 | Bacteria | 15479 |
| 83 | Ga0070665_100022114 | 3300005548 | Bacteria | 6397 |
| 84 | Ga0070665_100033585 | 3300005548 | Bacteria | 5162 |
| 85 | Ga0070665_100038775 | 3300005548 | Bacteria | 4789 |
| 86 | Ga0070665_100044051 | 3300005548 | Bacteria | 4482 |
| 87 | Ga0070665_100071396 | 3300005548 | Bacteria | 3478 |
| 88 | Ga0070665_100087921 | 3300005548 | Bacteria | 3113 |
| 89 | Ga0070665_100091041 | 3300005548 | Bacteria | 3055 |
| 90 | Ga0070665_100141955 | 3300005548 | Bacteria | 2405 |
| 91 | Ga0070665_100232560 | 3300005548 | Bacteria | 1843 |
| 92 | Ga0068855_100032505 | 3300005563 | Bacteria | 6229 |
| 93 | Ga0068855_100042520 | 3300005563 | Bacteria | 5384 |
| 94 | Ga0068855_100045274 | 3300005563 | Bacteria | 5204 |
| 95 | Ga0068855_100091001 | 3300005563 | Bacteria | 3519 |
| 96 | Ga0068857_100047726 | 3300005577 | Bacteria | 3802 |
| 97 | Ga0068856_100024638 | 3300005614 | Bacteria | 5858 |
| 98 | Ga0070702_100026773 | 3300005615 | Bacteria | 3103 |
| 99 | Ga0068859_100055447 | 3300005617 | Bacteria | 3988 |
| 100 | Ga0068864_100024549 | 3300005618 | Bacteria | 5072 |
| 101 | Ga0068864_100030025 | 3300005618 | Bacteria | 4607 |
| 102 | Ga0068866_10051271 | 3300005718 | Bacteria | 2100 |
| 103 | Ga0068861_100070570 | 3300005719 | Bacteria | 2705 |
| 104 | Ga0068870_10054092 | 3300005840 | Bacteria | 2134 |
| 105 | Ga0068858_100022369 | 3300005842 | Bacteria | 5901 |
| 106 | Ga0068860_100007304 | 3300005843 | Bacteria | 11046 |
| 107 | Ga0068860_100053172 | 3300005843 | Bacteria | 3851 |
| 108 | Ga0068860_100065183 | 3300005843 | Bacteria | 3459 |
| 109 | Ga0068860_100247149 | 3300005843 | Bacteria | 1736 |
| 110 | Ga0068862_100016189 | 3300005844 | Bacteria | 6202 |
| 111 | Ga0068862_100024231 | 3300005844 | Bacteria | 5091 |
| 112 | Ga0068862_100031482 | 3300005844 | Bacteria | 4479 |
| 113 | Ga0068862_100078211 | 3300005844 | Bacteria | 2866 |
| 114 | Ga0081455_10001818 | 3300005937 | Bacteria | 25693 |
| 115 | Ga0081455_10001871 | 3300005937 | Bacteria | 25308 |
| 116 | Ga0081455_10004903 | 3300005937 | Bacteria | 14832 |
| 117 | Ga0081455_10008395 | 3300005937 | Bacteria | 10741 |
| 118 | Ga0081455_10009237 | 3300005937 | Bacteria | 10161 |
| 119 | Ga0081455_10009607 | 3300005937 | Bacteria | 9934 |
| 120 | Ga0081455_10016182 | 3300005937 | Bacteria | 7211 |
| 121 | Ga0081455_10022880 | 3300005937 | Bacteria | 5828 |
| 122 | Ga0081455_10023631 | 3300005937 | Bacteria | 5715 |
| 123 | Ga0081455_10033823 | 3300005937 | Bacteria | 4588 |
| 124 | Ga0081455_10054609 | 3300005937 | Bacteria | 3403 |
| 125 | Ga0081455_10060536 | 3300005937 | Bacteria | 3192 |
| 126 | Ga0081455_10077335 | 3300005937 | Bacteria | 2738 |
| 127 | Ga0081455_10103122 | 3300005937 | Bacteria | 2285 |
| 128 | Ga0081538_10039562 | 3300005981 | Bacteria | 3023 |
| 129 | Ga0081540_1000248 | 3300005983 | Bacteria | 56862 |
| 130 | Ga0081540_1000423 | 3300005983 | Bacteria | 41829 |
| 131 | Ga0081540_1000829 | 3300005983 | Bacteria | 28195 |
| 132 | Ga0081540_1001277 | 3300005983 | Bacteria | 21964 |
| 133 | Ga0081540_1001791 | 3300005983 | Bacteria | 18013 |
| 134 | Ga0081540_1002606 | 3300005983 | Bacteria | 14657 |
| 135 | Ga0081540_1002762 | 3300005983 | Bacteria | 14248 |
| 136 | Ga0081540_1003475 | 3300005983 | Bacteria | 12435 |
| 137 | Ga0081540_1003978 | 3300005983 | Bacteria | 11465 |
| 138 | Ga0081540_1004440 | 3300005983 | Bacteria | 10699 |
| 139 | Ga0081540_1005366 | 3300005983 | Bacteria | 9590 |
| 140 | Ga0081540_1005698 | 3300005983 | Bacteria | 9243 |
| 141 | Ga0081540_1005953 | 3300005983 | Bacteria | 8994 |
| 142 | Ga0081540_1006177 | 3300005983 | Bacteria | 8782 |
| 143 | Ga0081540_1006649 | 3300005983 | Bacteria | 8372 |
| 144 | Ga0081540_1008540 | 3300005983 | Bacteria | 7148 |
| 145 | Ga0081540_1012096 | 3300005983 | Bacteria | 5709 |
| 146 | Ga0081540_1013758 | 3300005983 | Bacteria | 5242 |
| 147 | Ga0081540_1014517 | 3300005983 | Bacteria | 5040 |
| 148 | Ga0081540_1014531 | 3300005983 | Bacteria | 5035 |
| 149 | Ga0081540_1018687 | 3300005983 | Bacteria | 4243 |
| 150 | Ga0081540_1022075 | 3300005983 | Bacteria | 3767 |
| 151 | Ga0081540_1022779 | 3300005983 | Bacteria | 3690 |
| 152 | Ga0081540_1027520 | 3300005983 | Bacteria | 3219 |
| 153 | Ga0081540_1028440 | 3300005983 | Bacteria | 3140 |
| 154 | Ga0081540_1030104 | 3300005983 | Bacteria | 3013 |
| 155 | Ga0081540_1032184 | 3300005983 | Bacteria | 2868 |
| 156 | Ga0081540_1033414 | 3300005983 | Bacteria | 2793 |
| 157 | Ga0081540_1053552 | 3300005983 | Bacteria | 1978 |
| 158 | Ga0081540_1056342 | 3300005983 | Bacteria | 1909 |
| 159 | Ga0081539_10000176 | 3300005985 | Bacteria | 150292 |
| 160 | Ga0081539_10000231 | 3300005985 | Bacteria | 131197 |
| 161 | Ga0081539_10000530 | 3300005985 | Bacteria | 79454 |
| 162 | Ga0081539_10002526 | 3300005985 | Bacteria | 25557 |
| 163 | Ga0081539_10016768 | 3300005985 | Bacteria | 5199 |
| 164 | Ga0081539_10019177 | 3300005985 | Bacteria | 4694 |
| 165 | Ga0081539_10020869 | 3300005985 | Bacteria | 4400 |
| 166 | Ga0070717_10017525 | 3300006028 | Bacteria | 5575 |
| 167 | Ga0070717_10074420 | 3300006028 | Bacteria | 2839 |
| 168 | Ga0075365_10078357 | 3300006038 | Bacteria | 2234 |
| 169 | Ga0075365_10125816 | 3300006038 | Bacteria | 1771 |
| 170 | Ga0075368_10029780 | 3300006042 | Bacteria | 2111 |
| 171 | Ga0075363_100012252 | 3300006048 | Bacteria | 4128 |
| 172 | Ga0075363_100021078 | 3300006048 | Bacteria | 3277 |
| 173 | Ga0075363_100034947 | 3300006048 | Bacteria | 2626 |
| 174 | Ga0075363_100050533 | 3300006048 | Bacteria | 2215 |
| 175 | Ga0075363_100084816 | 3300006048 | Bacteria | 1737 |
| 176 | Ga0075364_10019035 | 3300006051 | Bacteria | 4307 |
| 177 | Ga0075364_10042916 | 3300006051 | Bacteria | 2939 |
| 178 | Ga0070716_100001786 | 3300006173 | Bacteria | 9742 |
| 179 | Ga0070712_100002881 | 3300006175 | Bacteria | 10664 |
| 180 | Ga0070712_100032044 | 3300006175 | Bacteria | 3547 |
| 181 | Ga0075362_10003353 | 3300006177 | Bacteria | 5581 |
| 182 | Ga0075362_10029861 | 3300006177 | Bacteria | 2352 |
| 183 | Ga0075362_10037030 | 3300006177 | Bacteria | 2137 |
| 184 | Ga0075367_10004842 | 3300006178 | Bacteria | 6634 |
| 185 | Ga0075367_10015210 | 3300006178 | Bacteria | 4177 |
| 186 | Ga0075367_10044041 | 3300006178 | Bacteria | 2614 |
| 187 | Ga0075367_10060398 | 3300006178 | Bacteria | 2260 |
| 188 | Ga0075369_10005989 | 3300006186 | Bacteria | 4576 |
| 189 | Ga0075369_10021608 | 3300006186 | Bacteria | 2646 |
| 190 | Ga0075366_10024670 | 3300006195 | Bacteria | 3507 |
| 191 | Ga0075366_10050320 | 3300006195 | Bacteria | 2474 |
| 192 | Ga0097621_100080158 | 3300006237 | Bacteria | 2715 |
| 193 | Ga0075370_10015830 | 3300006353 | Bacteria | 4046 |
| 194 | Ga0075370_10031577 | 3300006353 | Bacteria | 2957 |
| 195 | Ga0075370_10041788 | 3300006353 | Bacteria | 2589 |
| 196 | Ga0075370_10055339 | 3300006353 | Bacteria | 2254 |
| 197 | Ga0075370_10060397 | 3300006353 | Bacteria | 2159 |
| 198 | Ga0068871_100033602 | 3300006358 | Bacteria | 4063 |
| 199 | Ga0068871_100138848 | 3300006358 | Bacteria | 2065 |
| 200 | Ga0075428_100116410 | 3300006844 | Bacteria | 2911 |
| 201 | Ga0075434_100093121 | 3300006871 | Bacteria | 3016 |
| 202 | Ga0075434_100106156 | 3300006871 | Bacteria | 2818 |
| 203 | Ga0075434_100148663 | 3300006871 | Bacteria | 2362 |
| 204 | Ga0097620_100055449 | 3300006931 | Bacteria | 3988 |
| 205 | Ga0075435_100207083 | 3300007076 | Bacteria | 1663 |
| 206 | Ga0099794_10003949 | 3300007265 | Bacteria | 5752 |
| 207 | Ga0099794_10005746 | 3300007265 | Bacteria | 4998 |
| 208 | Ga0099794_10028555 | 3300007265 | Bacteria | 2595 |
| 209 | Ga0099794_10049136 | 3300007265 | Bacteria | 2026 |
| 210 | Ga0105245_10016651 | 3300009098 | Bacteria | 6419 |
| 211 | Ga0105245_10033205 | 3300009098 | Bacteria | 4573 |
| 212 | Ga0105245_10083753 | 3300009098 | Bacteria | 2920 |
| 213 | Ga0105247_10045260 | 3300009101 | Bacteria | 2699 |
| 214 | Ga0105247_10053069 | 3300009101 | Bacteria | 2500 |
| 215 | Ga0105247_10075850 | 3300009101 | Bacteria | 2110 |
| 216 | Ga0114129_10063938 | 3300009147 | Bacteria | 5135 |
| 217 | Ga0105241_10039297 | 3300009174 | Bacteria | 3569 |
| 218 | Ga0105241_10044508 | 3300009174 | Bacteria | 3364 |
| 219 | Ga0105248_10034450 | 3300009177 | Bacteria | 5662 |
| 220 | Ga0105248_10230216 | 3300009177 | Bacteria | 2086 |
| 221 | Ga0105237_10010079 | 3300009545 | Bacteria | 10079 |
| 222 | Ga0105237_10013984 | 3300009545 | Bacteria | 8399 |
| 223 | Ga0105237_10029085 | 3300009545 | Bacteria | 5620 |
| 224 | Ga0105237_10122154 | 3300009545 | Bacteria | 2599 |
| 225 | Ga0105237_10213732 | 3300009545 | Bacteria | 1928 |
| 226 | Ga0105237_10226197 | 3300009545 | Bacteria | 1871 |
| 227 | Ga0105238_10013570 | 3300009551 | Bacteria | 8226 |
| 228 | Ga0105238_10026716 | 3300009551 | Bacteria | 5885 |
| 229 | Ga0105238_10072787 | 3300009551 | Bacteria | 3431 |
| 230 | Ga0105239_10017670 | 3300010375 | Bacteria | 7890 |
| 231 | Ga0105239_10068554 | 3300010375 | Bacteria | 3898 |
| 232 | Ga0105239_10177259 | 3300010375 | Bacteria | 2384 |
| 233 | Ga0105246_10054504 | 3300011119 | Bacteria | 2756 |
| 234 | Ga0105246_10056178 | 3300011119 | Bacteria | 2720 |
| 235 | Ga0105246_10164398 | 3300011119 | Bacteria | 1694 |
| 236 | Ga0157370_10087808 | 3300013104 | Bacteria | 2921 |
| 237 | Ga0157370_10148214 | 3300013104 | Bacteria | 2184 |
| 238 | Ga0157369_10005375 | 3300013105 | Bacteria | 14913 |
| 239 | Ga0157369_10014657 | 3300013105 | Bacteria | 8845 |
| 240 | Ga0157369_10282962 | 3300013105 | Bacteria | 1727 |
| 241 | Ga0157369_10294928 | 3300013105 | Bacteria | 1688 |
| 242 | Ga0157378_10031055 | 3300013297 | Bacteria | 4718 |
| 243 | Ga0157378_10061966 | 3300013297 | Bacteria | 3340 |
| 244 | Ga0157378_10368077 | 3300013297 | Bacteria | 1408 |
| 245 | Ga0163162_10010924 | 3300013306 | Bacteria | 8839 |
| 246 | Ga0163162_10049707 | 3300013306 | Bacteria | 4203 |
| 247 | Ga0163162_10065440 | 3300013306 | Bacteria | 3682 |
| 248 | Ga0163162_10082130 | 3300013306 | Bacteria | 3294 |
| 249 | Ga0163162_10094221 | 3300013306 | Bacteria | 3080 |
| 250 | Ga0157372_10086216 | 3300013307 | Bacteria | 3563 |
| 251 | Ga0157372_10094769 | 3300013307 | Bacteria | 3400 |
| 252 | Ga0157372_10188233 | 3300013307 | Bacteria | 2390 |
| 253 | Ga0157375_10016474 | 3300013308 | Bacteria | 6643 |
| 254 | Ga0157375_10288107 | 3300013308 | Bacteria | 1805 |
| 255 | Ga0163163_10049831 | 3300014325 | Bacteria | 4122 |
| 256 | Ga0163163_10087464 | 3300014325 | Bacteria | 3126 |
| 257 | Ga0157380_10036675 | 3300014326 | Bacteria | 3795 |
| 258 | Ga0157377_10071495 | 3300014745 | Bacteria | 2006 |
| 259 | Ga0157379_10011266 | 3300014968 | Bacteria | 7792 |
| 260 | Ga0157376_10011205 | 3300014969 | Bacteria | 6598 |
| 261 | Ga0206352_10142119 | 3300020078 | Bacteria | 1884 |
| 262 | Ga0206354_11702451 | 3300020081 | Bacteria | 2114 |
| 263 | Ga0213872_10036505 | 3300021361 | Bacteria | 2246 |
| 264 | Ga0213876_10005609 | 3300021384 | Bacteria | 6889 |
| 265 | Ga0209758_1004101 | 3300025297 | Bacteria | 12486 |
| 266 | Ga0209758_1006382 | 3300025297 | Bacteria | 8513 |
| 267 | Ga0209758_1008259 | 3300025297 | Bacteria | 6814 |
| 268 | Ga0209758_1011810 | 3300025297 | Bacteria | 4992 |
| 269 | Ga0207692_10014434 | 3300025898 | Bacteria | 3451 |
| 270 | Ga0207710_10012956 | 3300025900 | Bacteria | 3512 |
| 271 | Ga0207688_10010295 | 3300025901 | Bacteria | 5090 |
| 272 | Ga0207699_10023842 | 3300025906 | Bacteria | 3336 |
| 273 | Ga0207699_10038727 | 3300025906 | Bacteria | 2735 |
| 274 | Ga0207645_10028620 | 3300025907 | Bacteria | 3596 |
| 275 | Ga0207643_10038000 | 3300025908 | Bacteria | 2703 |
| 276 | Ga0207684_10036703 | 3300025910 | Bacteria | 4159 |
| 277 | Ga0207684_10209229 | 3300025910 | Bacteria | 1683 |
| 278 | Ga0207654_10023046 | 3300025911 | Bacteria | 3331 |
| 279 | Ga0207654_10059400 | 3300025911 | Bacteria | 2230 |
| 280 | Ga0207707_10004663 | 3300025912 | Bacteria | 12038 |
| 281 | Ga0207707_10006506 | 3300025912 | Bacteria | 10204 |
| 282 | Ga0207707_10010189 | 3300025912 | Bacteria | 8158 |
| 283 | Ga0207671_10011065 | 3300025914 | Bacteria | 7383 |
| 284 | Ga0207693_10004006 | 3300025915 | Bacteria | 12520 |
| 285 | Ga0207693_10015164 | 3300025915 | Bacteria | 6185 |
| 286 | Ga0207693_10018708 | 3300025915 | Bacteria | 5514 |
| 287 | Ga0207663_10012954 | 3300025916 | Bacteria | 4522 |
| 288 | Ga0207660_10054326 | 3300025917 | Bacteria | 2858 |
| 289 | Ga0207657_10121189 | 3300025919 | Bacteria | 2152 |
| 290 | Ga0207652_10010356 | 3300025921 | Bacteria | 7509 |
| 291 | Ga0207652_10047310 | 3300025921 | Bacteria | 3674 |
| 292 | Ga0207652_10067320 | 3300025921 | Bacteria | 3105 |
| 293 | Ga0207694_10007778 | 3300025924 | Bacteria | 8116 |
| 294 | Ga0207694_10023641 | 3300025924 | Bacteria | 4666 |
| 295 | Ga0207694_10108001 | 3300025924 | Bacteria | 2211 |
| 296 | Ga0207694_10119140 | 3300025924 | Bacteria | 2106 |
| 297 | Ga0207650_10126106 | 3300025925 | Bacteria | 1998 |
| 298 | Ga0207659_10074312 | 3300025926 | Bacteria | 2491 |
| 299 | Ga0207659_10123272 | 3300025926 | Bacteria | 1989 |
| 300 | Ga0207687_10014547 | 3300025927 | Bacteria | 5151 |
| 301 | Ga0207687_10096338 | 3300025927 | Bacteria | 2168 |
| 302 | Ga0207700_10006403 | 3300025928 | Bacteria | 7104 |
| 303 | Ga0207700_10015209 | 3300025928 | Bacteria | 5065 |
| 304 | Ga0207700_10024881 | 3300025928 | Bacteria | 4150 |
| 305 | Ga0207664_10060684 | 3300025929 | Bacteria | 3015 |
| 306 | Ga0207664_10091822 | 3300025929 | Bacteria | 2491 |
| 307 | Ga0207664_10122774 | 3300025929 | Bacteria | 2176 |
| 308 | Ga0207644_10057258 | 3300025931 | Bacteria | 2814 |
| 309 | Ga0207644_10061913 | 3300025931 | Bacteria | 2712 |
| 310 | Ga0207706_10021052 | 3300025933 | Bacteria | 5858 |
| 311 | Ga0207706_10146069 | 3300025933 | Bacteria | 2080 |
| 312 | Ga0207709_10030666 | 3300025935 | Bacteria | 3130 |
| 313 | Ga0207709_10109817 | 3300025935 | Bacteria | 1842 |
| 314 | Ga0207670_10129113 | 3300025936 | Bacteria | 1849 |
| 315 | Ga0207704_10115290 | 3300025938 | Bacteria | 1826 |
| 316 | Ga0207665_10002151 | 3300025939 | Bacteria | 13341 |
| 317 | Ga0207665_10017860 | 3300025939 | Bacteria | 4663 |
| 318 | Ga0207665_10046553 | 3300025939 | Bacteria | 2906 |
| 319 | Ga0207711_10046526 | 3300025941 | Bacteria | 3708 |
| 320 | Ga0207711_10066767 | 3300025941 | Bacteria | 3111 |
| 321 | Ga0207689_10036732 | 3300025942 | Bacteria | 4066 |
| 322 | Ga0207689_10122768 | 3300025942 | Bacteria | 2136 |
| 323 | Ga0207661_10000171 | 3300025944 | Bacteria | 41708 |
| 324 | Ga0207661_10003747 | 3300025944 | Bacteria | 10589 |
| 325 | Ga0207661_10006281 | 3300025944 | Bacteria | 8403 |
| 326 | Ga0207661_10028618 | 3300025944 | Bacteria | 4269 |
| 327 | Ga0207679_10190433 | 3300025945 | Bacteria | 1705 |
| 328 | Ga0207667_10068594 | 3300025949 | Bacteria | 3692 |
| 329 | Ga0207667_10078632 | 3300025949 | Bacteria | 3418 |
| 330 | Ga0207667_10082096 | 3300025949 | Bacteria | 3339 |
| 331 | Ga0207668_10012639 | 3300025972 | Bacteria | 5174 |
| 332 | Ga0207668_10021506 | 3300025972 | Bacteria | 4114 |
| 333 | Ga0207668_10025172 | 3300025972 | Bacteria | 3848 |
| 334 | Ga0207640_10120315 | 3300025981 | Bacteria | 1880 |
| 335 | Ga0207677_10053542 | 3300026023 | Bacteria | 2748 |
| 336 | Ga0207677_10090498 | 3300026023 | Bacteria | 2224 |
| 337 | Ga0207703_10010777 | 3300026035 | Bacteria | 7132 |
| 338 | Ga0207703_10020853 | 3300026035 | Bacteria | 5127 |
| 339 | Ga0207639_10022921 | 3300026041 | Bacteria | 4503 |
| 340 | Ga0207639_10053986 | 3300026041 | Bacteria | 3069 |
| 341 | Ga0207639_10099144 | 3300026041 | Bacteria | 2350 |
| 342 | Ga0207678_10005830 | 3300026067 | Bacteria | 10978 |
| 343 | Ga0207678_10020913 | 3300026067 | Bacteria | 5736 |
| 344 | Ga0207678_10034642 | 3300026067 | Bacteria | 4397 |
| 345 | Ga0207708_10026144 | 3300026075 | Bacteria | 4416 |
| 346 | Ga0207702_10020557 | 3300026078 | Bacteria | 5464 |
| 347 | Ga0207641_10104967 | 3300026088 | Bacteria | 2495 |
| 348 | Ga0207641_10125254 | 3300026088 | Bacteria | 2299 |
| 349 | Ga0207676_10056786 | 3300026095 | Bacteria | 3079 |
| 350 | Ga0207676_10072677 | 3300026095 | Bacteria | 2765 |
| 351 | Ga0207674_10062863 | 3300026116 | Bacteria | 3749 |
| 352 | Ga0207674_10117732 | 3300026116 | Bacteria | 2627 |
| 353 | Ga0207674_10129104 | 3300026116 | Bacteria | 2492 |
| 354 | Ga0207675_100053448 | 3300026118 | Bacteria | 3769 |
| 355 | Ga0207683_10053897 | 3300026121 | Bacteria | 3527 |
| 356 | Ga0207683_10201931 | 3300026121 | Bacteria | 1807 |
| 357 | Ga0207698_10068311 | 3300026142 | Bacteria | 2806 |
| 358 | Ga0209588_1005174 | 3300027671 | Bacteria | 3721 |
| 359 | Ga0207428_10132642 | 3300027907 | Bacteria | 1905 |
| 360 | Ga0268266_10001870 | 3300028379 | Bacteria | 23767 |
| 361 | Ga0268266_10008300 | 3300028379 | Bacteria | 9253 |
| 362 | Ga0268266_10009648 | 3300028379 | Bacteria | 8489 |
| 363 | Ga0268266_10027619 | 3300028379 | Bacteria | 4824 |
| 364 | Ga0268266_10043930 | 3300028379 | Bacteria | 3819 |
| 365 | Ga0268266_10088504 | 3300028379 | Bacteria | 2710 |
| 366 | Ga0268266_10173292 | 3300028379 | Bacteria | 1959 |
| 367 | Ga0268265_10013626 | 3300028380 | Bacteria | 5528 |
| 368 | Ga0268265_10029721 | 3300028380 | Bacteria | 3927 |
| 369 | Ga0268265_10076032 | 3300028380 | Bacteria | 2633 |
| 370 | Ga0268264_10000377 | 3300028381 | Bacteria | 65413 |
| 371 | Ga0268264_10096767 | 3300028381 | Bacteria | 2557 |
| 372 | Ga0307517_10000124 | 3300028786 | Bacteria | 115570 |
| 373 | Ga0307517_10002371 | 3300028786 | Bacteria | 30326 |
| 374 | Ga0307515_10031012 | 3300028794 | Bacteria | 8941 |
| 375 | Ga0307515_10062161 | 3300028794 | Bacteria | 5281 |
| 376 | Ga0307513_10085449 | 3300031456 | Bacteria | 3238 |
| 377 | Ga0307509_10073582 | 3300031507 | Bacteria | 3557 |
| 378 | Ga0307509_10087891 | 3300031507 | Bacteria | 3191 |
| 379 | Ga0307509_10160909 | 3300031507 | Bacteria | 2143 |
| 380 | Ga0307509_10165170 | 3300031507 | Bacteria | 2104 |
| 381 | Ga0307508_10000378 | 3300031616 | Bacteria | 53801 |
| 382 | Ga0307508_10071026 | 3300031616 | Bacteria | 3055 |
| 383 | Ga0307516_10057713 | 3300031730 | Bacteria | 3780 |
| 384 | Ga0307516_10068101 | 3300031730 | Bacteria | 3429 |
| 385 | Ga0307516_10158268 | 3300031730 | Bacteria | 2018 |
| 386 | Ga0307507_10092635 | 3300033179 | Bacteria | 2578 |
| 387 | Ga0307510_10065088 | 3300033180 | Bacteria | 3696 |
| 388 | Ga0307510_10120596 | 3300033180 | Bacteria | 2329 |
| 389 | Ga0315911_1000107 | 3300033442 | Bacteria | 10549 |
| 390 | Ga0373936_0073335 | 3300035113 | Bacteria | 1415 |
| 391 | Ga0373946_0045403 | 3300035171 | Bacteria | 1818 |
| 392 | Ga0373935_0014976 | 3300035692 | Bacteria | 4683 |
| 393 | Ga0373927_0032196 | 3300035695 | Bacteria | 3414 |
| 394 | Ga0373927_0041000 | 3300035695 | Bacteria | 3003 |
| 395 | Ga0373927_0074996 | 3300035695 | Bacteria | 2190 |
| 396 | Ga0373933_0003692 | 3300035724 | Bacteria | 8467 |
| 397 | Ga0373933_0043451 | 3300035724 | Bacteria | 2659 |
| 398 | Ga0373947_0025828 | 3300035725 | Bacteria | 3427 |
| 399 | Ga0310104_01295 | 3300036242 | Bacteria | 1971 |
| 400 | Ga0265778_002400 | 3300036457 | Bacteria | 1804 |
| 401 | Ga0265778_002442 | 3300036457 | Bacteria | 1792 |
| 402 | Ga0373925_0018250 | 3300037068 | Bacteria | 5098 |
| 403 | Ga0373925_0065559 | 3300037068 | Bacteria | 2736 |
| 404 | Ga0395900_0046210 | 3300037418 | Bacteria | 4484 |
| 405 | Ga0395898_0067179 | 3300037466 | Bacteria | 3472 |
| 406 | Ga0395898_0256718 | 3300037466 | Bacteria | 1667 |
| 407 | Ga0395905_0034856 | 3300037471 | Bacteria | 4725 |
| 408 | Ga0395905_0113359 | 3300037471 | Bacteria | 2547 |
| 409 | Ga0395905_0215484 | 3300037471 | Bacteria | 1798 |
| 410 | Ga0436364_0780655 | 3300037853 | Bacteria | 3338 |
| 411 | Ga0436365_1238998 | 3300039437 | Bacteria | 17352 |
| 412 | Ga0436360_0310426 | 3300039438 | Bacteria | 25508 |
| 413 | Ga0436361_0764431 | 3300039447 | Bacteria | 9266 |
| 414 | Ga0436361_0887955 | 3300039447 | Bacteria | 6578 |
| 415 | Ga0436361_0895325 | 3300039447 | Bacteria | 4991 |
| 416 | Ga0436361_1022339 | 3300039447 | Bacteria | 20890 |
| 417 | Ga0436361_1134910 | 3300039447 | Bacteria | 2690 |
| 418 | Ga0436363_0555836 | 3300039450 | Bacteria | 2045 |
| 419 | Ga0466966_0069353 | 3300044684 | Bacteria | 2212 |
| 420 | Ga0466966_0081513 | 3300044684 | Bacteria | 2015 |
| 421 | Ga0466967_0191235 | 3300045976 | Bacteria | 1934 |
| 422 | Ga0495603_0001480 | 3300046455 | Bacteria | 13683 |
| 423 | Ga0495603_0013390 | 3300046455 | Bacteria | 4962 |
| 424 | Ga0495603_0025163 | 3300046455 | Bacteria | 3599 |
| 425 | Ga0495603_0072103 | 3300046455 | Bacteria | 2029 |
| 426 | Ga0495629_0025937 | 3300046459 | Bacteria | 4164 |
| 427 | Ga0495638_0070041 | 3300046460 | Bacteria | 2148 |
| 428 | Ga0495580_0027220 | 3300046472 | Bacteria | 4161 |
| 429 | Ga0495580_0029423 | 3300046472 | Bacteria | 3987 |
| 430 | Ga0495582_0001176 | 3300046473 | Bacteria | 14741 |
| 431 | Ga0495662_0011346 | 3300046476 | Bacteria | 4355 |
| 432 | Ga0495594_0009072 | 3300046499 | Bacteria | 5133 |
| 433 | Ga0495606_0005580 | 3300046507 | Bacteria | 11983 |
| 434 | Ga0495632_0048886 | 3300046519 | Bacteria | 2092 |
| 435 | Ga0495648_0002980 | 3300046524 | Bacteria | 15193 |
| 436 | Ga0495648_0003683 | 3300046524 | Bacteria | 13395 |
| 437 | Ga0495665_0020666 | 3300046531 | Bacteria | 3535 |
| 438 | Ga0495640_0013114 | 3300046533 | Bacteria | 6308 |
| 439 | Ga0495640_0047416 | 3300046533 | Bacteria | 2974 |
| 440 | Ga0495597_0077441 | 3300046542 | Bacteria | 1425 |
| 441 | Ga0495622_0028125 | 3300046557 | Bacteria | 2625 |
| 442 | Ga0495622_0043688 | 3300046557 | Bacteria | 2083 |
| 443 | Ga0495668_0064767 | 3300046616 | Bacteria | 2012 |
| 444 | Ga0495634_0028011 | 3300046642 | Bacteria | 3914 |
| 445 | Ga0495625_0105197 | 3300046660 | Bacteria | 1934 |
| 446 | Ga0495635_0054809 | 3300046663 | Bacteria | 2746 |
| 447 | Ga0495669_0046232 | 3300046684 | Bacteria | 1942 |
| 448 | Ga0495581_0003049 | 3300047315 | Bacteria | 9597 |
| 449 | Ga0495581_0072108 | 3300047315 | Bacteria | 1998 |
| 450 | Ga0495674_0027629 | 3300047319 | Bacteria | 5183 |
| 451 | Ga0495672_0027214 | 3300047320 | Bacteria | 3636 |
| 452 | Ga0495672_0033263 | 3300047320 | Bacteria | 3196 |
| 453 | Ga0495676_0077184 | 3300047321 | Bacteria | 2541 |
| 454 | Ga0495673_0015144 | 3300047469 | Bacteria | 3983 |
| 455 | Ga0495686_0022329 | 3300047472 | Bacteria | 4188 |
| 456 | Ga0495686_0026723 | 3300047472 | Bacteria | 3776 |
| 457 | Ga0495593_0002569 | 3300047673 | Bacteria | 10905 |
| 458 | Ga0495593_0015493 | 3300047673 | Bacteria | 4316 |
| 459 | Ga0496101_0024385 | 3300048904 | Bacteria | 4186 |
| 460 | Ga0496101_0123097 | 3300048904 | Bacteria | 1963 |
| 461 | Ga0496102_0012643 | 3300048905 | Bacteria | 7310 |
| 462 | Ga0496102_0174711 | 3300048905 | Bacteria | 2022 |
| 463 | Ga0496104_0193102 | 3300048907 | Bacteria | 1948 |
| 464 | Ga0496105_0032452 | 3300048908 | Bacteria | 4285 |
| 465 | Ga0496106_0035055 | 3300048909 | Bacteria | 3750 |
| 466 | Ga0496106_0056585 | 3300048909 | Bacteria | 2965 |
| 467 | Ga0496108_0022398 | 3300048911 | Bacteria | 5192 |
| 468 | Ga0496108_0049573 | 3300048911 | Bacteria | 3512 |
| 469 | Ga0496108_0070379 | 3300048911 | Bacteria | 2952 |
| 470 | Ga0496109_0056899 | 3300048912 | Bacteria | 3568 |
| 471 | Ga0496109_0111608 | 3300048912 | Bacteria | 2542 |
| 472 | Ga0496110_0009242 | 3300048913 | Bacteria | 7965 |
| 473 | Ga0496110_0160464 | 3300048913 | Bacteria | 2038 |
| 474 | Ga0496112_0000004 | 3300048915 | Bacteria | 553294 |
| 475 | Ga0496112_0071005 | 3300048915 | Bacteria | 3441 |
| 476 | Ga0496112_0077051 | 3300048915 | Bacteria | 3297 |
| 477 | Ga0496113_0049652 | 3300048916 | Bacteria | 3125 |
| 478 | Ga0496113_0126331 | 3300048916 | Bacteria | 2003 |
| 479 | Ga0496113_0136779 | 3300048916 | Bacteria | 1925 |
| 480 | Ga0496115_0001685 | 3300048918 | Bacteria | 15874 |
| 481 | Ga0496117_0013369 | 3300048920 | Bacteria | 7165 |
| 482 | Ga0496118_0006071 | 3300048921 | Bacteria | 13446 |
| 483 | Ga0496119_0023800 | 3300048922 | Bacteria | 4330 |
| 484 | Ga0496121_0000091 | 3300048924 | Bacteria | 216685 |
| 485 | Ga0496121_0003703 | 3300048924 | Bacteria | 21450 |
| 486 | Ga0496121_0004207 | 3300048924 | Bacteria | 19640 |
| 487 | Ga0496121_0021849 | 3300048924 | Bacteria | 6248 |
| 488 | Ga0496121_0022999 | 3300048924 | Bacteria | 6021 |
| 489 | Ga0496121_0033754 | 3300048924 | Bacteria | 4623 |
| 490 | Ga0496121_0044282 | 3300048924 | Bacteria | 3841 |
| 491 | Ga0496121_0068856 | 3300048924 | Bacteria | 2860 |
| 492 | Ga0496121_0075127 | 3300048924 | Bacteria | 2701 |
| 493 | Ga0496121_0095936 | 3300048924 | Bacteria | 2303 |
| 494 | Ga0496121_0101245 | 3300048924 | Bacteria | 2222 |
| 495 | Ga0496121_0113208 | 3300048924 | Bacteria | 2065 |
| 496 | Ga0496122_0013492 | 3300048925 | Bacteria | 7994 |
| 497 | Ga0496122_0017056 | 3300048925 | Bacteria | 6817 |
| 498 | Ga0496123_0056370 | 3300048926 | Bacteria | 2569 |
| 499 | Ga0496124_0009503 | 3300048927 | Bacteria | 10006 |
| 500 | Ga0496124_0132238 | 3300048927 | Bacteria | 1981 |
| 501 | Ga0496125_0047655 | 3300048928 | Bacteria | 3581 |
| 502 | Ga0496126_0009714 | 3300048929 | Bacteria | 10191 |
| 503 | Ga0496126_0011356 | 3300048929 | Bacteria | 9233 |
| 504 | Ga0496126_0017288 | 3300048929 | Bacteria | 7187 |
| 505 | Ga0496126_0019884 | 3300048929 | Bacteria | 6602 |
| 506 | Ga0496126_0021610 | 3300048929 | Bacteria | 6283 |
| 507 | Ga0496126_0029335 | 3300048929 | Bacteria | 5226 |
| 508 | Ga0496126_0033976 | 3300048929 | Bacteria | 4795 |
| 509 | Ga0496126_0037235 | 3300048929 | Bacteria | 4541 |
| 510 | Ga0496126_0054139 | 3300048929 | Bacteria | 3636 |
| 511 | Ga0496126_0069559 | 3300048929 | Bacteria | 3139 |
| 512 | Ga0496126_0074891 | 3300048929 | Bacteria | 3005 |
| 513 | Ga0496126_0118486 | 3300048929 | Bacteria | 2298 |
| 514 | Ga0496126_0145143 | 3300048929 | Bacteria | 2039 |
| 515 | Ga0501047_0204884 | 3300049581 | Bacteria | 1832 |
| 516 | Ga0501080_0110669 | 3300049742 | Bacteria | 2545 |
| 517 | Ga0501044_0119607 | 3300049823 | Bacteria | 2636 |
| 518 | nmdc:mga03683_27556_c1 | 3300050489 | Bacteria | 2251 |
| 519 | nmdc:mga03n38_19194_c1 | 3300050490 | Bacteria | 2712 |
| 520 | nmdc:mga03n38_29732_c1 | 3300050490 | Bacteria | 2289 |
| 521 | nmdc:mga00v17_64304_c1 | 3300050491 | Bacteria | 2261 |
| 522 | nmdc:mga00v17_74793_c1 | 3300050491 | Bacteria | 2106 |
| 523 | nmdc:mga0yw44_17827_c1 | 3300050492 | Bacteria | 3874 |
| 524 | nmdc:mga0yw44_29044_c1 | 3300050492 | Bacteria | 3188 |
| 525 | nmdc:mga0yw44_63306_c1 | 3300050492 | Bacteria | 2274 |
| 526 | nmdc:mga0yw44_66090_c1 | 3300050492 | Bacteria | 2231 |
| 527 | nmdc:mga0yw44_75539_c1 | 3300050492 | Bacteria | 2101 |
| 528 | nmdc:mga0yw44_8648_c1 | 3300050492 | Bacteria | 5088 |
| 529 | nmdc:mga0k408_30185_c1 | 3300050493 | Bacteria | 3090 |
| 530 | nmdc:mga0k408_38031_c1 | 3300050493 | Bacteria | 2763 |
| 531 | nmdc:mga0k408_55980_c1 | 3300050493 | Bacteria | 2288 |
| 532 | nmdc:mga0k408_67688_c1 | 3300050493 | Bacteria | 2081 |
| 533 | nmdc:mga0k408_74731_c1 | 3300050493 | Bacteria | 1980 |
| 534 | nmdc:mga0k408_8355_c1 | 3300050493 | Bacteria | 5556 |
| 535 | nmdc:mga06z11_13126_c1 | 3300050494 | Bacteria | 3627 |
| 536 | nmdc:mga06z11_68657_c1 | 3300050494 | Bacteria | 1869 |
| 537 | nmdc:mga04h51_7701_c1 | 3300050495 | Bacteria | 2854 |
| 538 | nmdc:mga07m45_34756_c1 | 3300050496 | Bacteria | 2802 |
| 539 | nmdc:mga07m45_39045_c1 | 3300050496 | Bacteria | 2652 |
| 540 | nmdc:mga07m45_4727_c1 | 3300050496 | Bacteria | 6687 |
| 541 | nmdc:mga07m45_70150_c1 | 3300050496 | Bacteria | 1993 |
| 542 | nmdc:mga05p37_157090_c1 | 3300050507 | Bacteria | 2779 |
| 543 | nmdc:mga0rr50_114045_c1 | 3300050513 | Bacteria | 2142 |
| 544 | nmdc:mga0sz30_15384_c1 | 3300050516 | Bacteria | 3023 |
| 545 | nmdc:mga0sz30_33692_c1 | 3300050516 | Bacteria | 2130 |
| 546 | nmdc:mga0sz30_36945_c1 | 3300050516 | Bacteria | 2043 |
| 547 | nmdc:mga0sz30_42627_c1 | 3300050516 | Bacteria | 1910 |
| 548 | nmdc:mga0sz30_8449_c1 | 3300050516 | Bacteria | 3889 |
| 549 | Ga0500635_0016740 | 3300053080 | Bacteria | 2185 |
| 550 | Ga0500647_0013961 | 3300053091 | Bacteria | 3642 |
| 551 | Ga0500566_0000048 | 3300053094 | Bacteria | 58542 |
| 552 | Ga0500566_0000085 | 3300053094 | Bacteria | 46377 |
| 553 | Ga0500566_0000845 | 3300053094 | Bacteria | 17472 |
| 554 | Ga0500566_0005045 | 3300053094 | Bacteria | 7868 |
| 555 | Ga0500566_0056416 | 3300053094 | Bacteria | 2234 |
| 556 | Ga0500640_003345 | 3300053095 | Bacteria | 5575 |
| 557 | Ga0500641_0007877 | 3300053096 | Bacteria | 3798 |
| 558 | Ga0500641_0024446 | 3300053096 | Bacteria | 2329 |
| 559 | Ga0500641_0027093 | 3300053096 | Bacteria | 2230 |
| 560 | Ga0500641_0036124 | 3300053096 | Bacteria | 1975 |
| 561 | Ga0500554_000433 | 3300053102 | Bacteria | 8808 |
| 562 | Ga0500554_000625 | 3300053102 | Bacteria | 7190 |
| 563 | Ga0500554_001199 | 3300053102 | Bacteria | 5028 |
| 564 | Ga0500572_000436 | 3300053111 | Bacteria | 14664 |
| 565 | Ga0500572_000526 | 3300053111 | Bacteria | 13074 |
| 566 | Ga0500572_001079 | 3300053111 | Bacteria | 8044 |
| 567 | Ga0500572_002202 | 3300053111 | Bacteria | 4777 |
| 568 | Ga0500591_003487 | 3300053115 | Bacteria | 6698 |
| 569 | Ga0500595_001063 | 3300053119 | Bacteria | 15288 |
| 570 | Ga0500595_002252 | 3300053119 | Bacteria | 9775 |
| 571 | Ga0500595_004049 | 3300053119 | Bacteria | 6669 |
| 572 | Ga0500595_013593 | 3300053119 | Bacteria | 3115 |
| 573 | Ga0500595_025935 | 3300053119 | Bacteria | 2024 |
| 574 | Ga0500614_001830 | 3300053123 | Bacteria | 4918 |
| 575 | Ga0500614_003295 | 3300053123 | Bacteria | 3494 |
| 576 | Ga0500658_0029289 | 3300053134 | Bacteria | 2140 |
| 577 | Ga0500559_0001740 | 3300053136 | Bacteria | 11945 |
| 578 | Ga0500559_0005234 | 3300053136 | Bacteria | 5978 |
| 579 | Ga0500559_0005512 | 3300053136 | Bacteria | 5819 |
| 580 | Ga0500559_0012412 | 3300053136 | Bacteria | 3621 |
| 581 | Ga0500559_0013648 | 3300053136 | Bacteria | 3437 |
| 582 | Ga0500577_0011120 | 3300053142 | Bacteria | 2674 |
| 583 | Ga0500589_025746 | 3300053147 | Bacteria | 2727 |
| 584 | Ga0500603_000041 | 3300053150 | Bacteria | 30524 |
| 585 | Ga0500603_000063 | 3300053150 | Bacteria | 24913 |
| 586 | Ga0500603_000326 | 3300053150 | Bacteria | 12455 |
| 587 | Ga0500603_002212 | 3300053150 | Bacteria | 4287 |
| 588 | Ga0500622_0015994 | 3300053156 | Bacteria | 4013 |
| 589 | Ga0500630_000339 | 3300053159 | Bacteria | 19545 |
| 590 | Ga0500630_001914 | 3300053159 | Bacteria | 10003 |
| 591 | Ga0500638_000156 | 3300053162 | Bacteria | 13278 |
| 592 | Ga0500638_001640 | 3300053162 | Bacteria | 7215 |
| 593 | Ga0500639_000004 | 3300053163 | Bacteria | 216921 |
| 594 | Ga0500639_000165 | 3300053163 | Bacteria | 32213 |
| 595 | Ga0500639_000228 | 3300053163 | Bacteria | 27840 |
| 596 | Ga0500639_019917 | 3300053163 | Bacteria | 3537 |
| 597 | Ga0500637_0000157 | 3300053178 | Bacteria | 24963 |
| 598 | Ga0500637_0000555 | 3300053178 | Bacteria | 14632 |
| 599 | Ga0500637_0000978 | 3300053178 | Bacteria | 11648 |
| 600 | Ga0500637_0012100 | 3300053178 | Bacteria | 4488 |
| 601 | Ga0500637_0014538 | 3300053178 | Bacteria | 4152 |
| 602 | Ga0500637_0015560 | 3300053178 | Bacteria | 4034 |
| 603 | Ga0500637_0036228 | 3300053178 | Bacteria | 2769 |
| 604 | Ga0500637_0042747 | 3300053178 | Bacteria | 2562 |
| 605 | Ga0500637_0062812 | 3300053178 | Bacteria | 2128 |
| 606 | Ga0500645_007397 | 3300053730 | Bacteria | 3826 |
| 607 | Ga0500645_017026 | 3300053730 | Bacteria | 2282 |
| 608 | Ga0500596_000072 | 3300053735 | Bacteria | 13655 |
| 609 | Ga0500596_002779 | 3300053735 | Bacteria | 3424 |
| 610 | Ga0500596_005389 | 3300053735 | Bacteria | 2258 |
| 611 | Ga0500661_000059 | 3300055283 | Bacteria | 17356 |
| 612 | Ga0500661_000154 | 3300055283 | Bacteria | 11794 |
| 613 | Ga0500661_004069 | 3300055283 | Bacteria | 2734 |
| 614 | Ga0587066_004207 | 3300059490 | Bacteria | 1753 |
| 615 | Ga0587094_003020 | 3300059513 | Bacteria | 1795 |
| 616 | Ga0587109_006085 | 3300059624 | Bacteria | 1765 |
| 617 | Ga0587109_006166 | 3300059624 | Bacteria | 1758 |
| 618 | 2508540691 | 2508501009 | Bacteria | 7784016 |
| 619 | 2509149646 | 2508501128 | Bacteria | 8613869 |
| 620 | 2509153284 | 2508501128 | Bacteria | 8613869 |
| 621 | 2513670833 | 2513237098 | Bacteria | 9902361 |
| 622 | 2513672389 | 2513237098 | Bacteria | 9902361 |
| 623 | 2513674146 | 2513237098 | Bacteria | 9902361 |
| 624 | 2513676211 | 2513237098 | Bacteria | 9902361 |
| 625 | 2513676438 | 2513237098 | Bacteria | 9902361 |
| 626 | 2513676723 | 2513237098 | Bacteria | 9902361 |
| 627 | 2513678833 | 2513237098 | Bacteria | 9902361 |
| 628 | 2513679938 | 2513237098 | Bacteria | 9902361 |
| 629 | 2513680092 | 2513237098 | Bacteria | 9902361 |
| 630 | 2513695761 | 2513237101 | Bacteria | 7952346 |
| 631 | 2513696010 | 2513237101 | Bacteria | 7952346 |
| 632 | 2513718912 | 2513237104 | Bacteria | 10034502 |
| 633 | 2513892045 | 2513237141 | Bacteria | 8496279 |
| 634 | 2513894254 | 2513237141 | Bacteria | 8496279 |
| 635 | 2524467912 | 2524023210 | Bacteria | 9029266 |
| 636 | 2524469789 | 2524023210 | Bacteria | 9029266 |
| 637 | 2524469867 | 2524023210 | Bacteria | 9029266 |
| 638 | 2524470038 | 2524023210 | Bacteria | 9029266 |
| 639 | 2524470128 | 2524023210 | Bacteria | 9029266 |
| 640 | 2524471101 | 2524023210 | Bacteria | 9029266 |
| 641 | 2524471287 | 2524023210 | Bacteria | 9029266 |
| 642 | 2723845901 | 2721755755 | Bacteria | 8322773 |
| 643 | 2723846244 | 2721755755 | Bacteria | 8322773 |
| 644 | 2723847208 | 2721755755 | Bacteria | 8322773 |
| 645 | 2793080544 | |||
| 646 | 2793082709 | |||
| 647 | 2793084185 | |||
| 648 | 2874609454 | 2874604998 | Bacteria | 7834745 |
| 649 | 2874610794 | 2874604998 | Bacteria | 7834745 |
| 650 | 2876815549 | 2876808645 | Bacteria | 8824342 |
| 651 | 2879110322 | 2879110137 | Bacteria | 8907982 |
| 652 | 2879110324 | 2879110137 | Bacteria | 8907982 |
| 653 | 2879118875 | 2879110137 | Bacteria | 8907982 |
| 654 | 2885384342 | 2885383462 | Bacteria | 9473874 |
| 655 | 2885387028 | 2885383462 | Bacteria | 9473874 |
| 656 | 2885387667 | 2885383462 | Bacteria | 9473874 |
| 657 | 2885387750 | 2885383462 | Bacteria | 9473874 |
| 658 | 2885389603 | 2885383462 | Bacteria | 9473874 |
| 659 | 2885389856 | 2885383462 | Bacteria | 9473874 |
| 660 | 2885392356 | 2885383462 | Bacteria | 9473874 |
| 661 | 2889038165 | 2889033259 | Bacteria | 9099371 |
| 662 | 2889039312 | 2889033259 | Bacteria | 9099371 |
| 663 | 2903755016 | 2903748898 | Bacteria | 9972761 |
| 664 | 2903769056 | 2903768456 | Bacteria | 9749579 |
| 665 | 2903769880 | 2903768456 | Bacteria | 9749579 |
| 666 | 2903772384 | 2903768456 | Bacteria | 9749579 |
| 667 | 2903773542 | 2903768456 | Bacteria | 9749579 |
| 668 | 2903776066 | 2903768456 | Bacteria | 9749579 |
| 669 | 2903777539 | 2903768456 | Bacteria | 9749579 |
| 670 | 2922362047 | 2922361189 | Bacteria | 7436256 |
| 671 | 2922367842 | 2922361189 | Bacteria | 7436256 |
| 672 | 2922368538 | 2922361189 | Bacteria | 7436256 |
| 673 | 2922387486 | 2922386360 | Bacteria | 7017218 |
| 674 | 2922388185 | 2922386360 | Bacteria | 7017218 |
| 675 | 2922392257 | 2922386360 | Bacteria | 7017218 |
| 676 | 8006968419 | 8006964411 | Bacteria | 8966052 |
| 677 | 8006968682 | 8006964411 | Bacteria | 8966052 |
| 678 | 8006991182 | 8006984368 | Bacteria | 9651211 |
| 679 | 8006994855 | 8006994254 | Bacteria | 8309700 |
| 680 | 8006996336 | 8006994254 | Bacteria | 8309700 |
| 681 | 8006999963 | 8006994254 | Bacteria | 8309700 |
| 682 | 8019628778 | 8019619141 | Bacteria | 9218857 |
| 683 | 8019664150 | 8019659431 | Bacteria | 8577854 |
| 684 | 8019678179 | 8019668869 | Bacteria | 8791617 |
| 685 | 8056677535 | 8056673599 | Bacteria | 7871253 |
| 686 | 8056677536 | 8056673599 | Bacteria | 7871253 |
| 687 | 8056680379 | 8056673599 | Bacteria | 7871253 |
| 688 | 8056681431 | 8056681323 | Bacteria | 8472857 |
| 689 | 8056683039 | 8056681323 | Bacteria | 8472857 |
| 690 | 8056684942 | 8056681323 | Bacteria | 8472857 |
| 691 | 8056685103 | 8056681323 | Bacteria | 8472857 |
| 692 | 8056688642 | 8056681323 | Bacteria | 8472857 |
| 693 | 8056689503 | 8056681323 | Bacteria | 8472857 |
| 694 | Ga0099794_10024386 | |||
| 695 | Ga0006759J45824_1014111 | |||
| 696 | JGI25406J46586_10000006 | |||
| 697 | JGI25406J46586_10016308 | |||
| 698 | JGI25153J46596_10003035 | |||
| 699 | JGI25153J46596_10005756 | |||
| 700 | rootH2_10091315 | |||
| 701 | rootH1_10017865 | |||
| 702 | Ga0007410J51695_1029247 | |||
| 703 | Ga0007409J51694_1011648 | |||
| 704 | Ga0007409J51694_1017406 | |||
| 705 | Ga0007409J51694_1034979 | |||
| 706 | Ga0007416J51690_1019111 | |||
| 707 | JGI25404J52841_10000143 | |||
| 708 | JGI25404J52841_10000958 | |||
| 709 | JGI25404J52841_10001663 | |||
| 710 | JGI25404J52841_10002240 | |||
| 711 | JGI25404J52841_10002994 | |||
| 712 | JGI25404J52841_10003961 | |||
| 713 | JGI25404J52841_10004171 | |||
| 714 | JGI25404J52841_10004443 | |||
| 715 | JGI25404J52841_10005004 | |||
| 716 | JGI25404J52841_10006428 | |||
| 717 | JGI25404J52841_10006984 | |||
| 718 | Ga0058863_10061770 | |||
| 719 | Ga0058862_12142271 | |||
| 720 | Ga0070683_100000231 | |||
| 721 | Ga0070683_100012503 | |||
| 722 | Ga0070683_100053358 | |||
| 723 | Ga0070683_100079179 | |||
| 724 | Ga0070670_100060074 | |||
| 725 | Ga0068869_100030039 | |||
| 726 | Ga0068869_100044014 | |||
| 727 | Ga0070680_100029259 | |||
| 728 | Ga0070680_100030038 | |||
| 729 | Ga0070682_100042753 | |||
| 730 | Ga0068868_100011161 | |||
| 731 | Ga0070668_100036165 | |||
| 732 | Ga0070668_100070924 | |||
| 733 | Ga0070668_100106641 | |||
| 734 | Ga0070668_100156005 | |||
| 735 | Ga0070668_100156354 | |||
| 736 | Ga0070671_100020925 | |||
| 737 | Ga0070671_100037298 | |||
| 738 | Ga0070671_100065630 | |||
| 739 | Ga0070674_100084176 | |||
| 740 | Ga0070709_10000587 | |||
| 741 | Ga0070709_10008074 | |||
| 742 | Ga0070714_100027623 | |||
| 743 | Ga0070714_100044894 | |||
| 744 | Ga0070714_100076222 | |||
| 745 | Ga0070713_100013919 | |||
| 746 | Ga0070713_100016206 | |||
| 747 | Ga0070713_100021072 | |||
| 748 | Ga0070710_10000736 | |||
| 749 | Ga0070663_100008935 | |||
| 750 | Ga0070663_100012244 | |||
| 751 | Ga0070663_100057736 | |||
| 752 | Ga0070663_100085278 | |||
| 753 | Ga0070678_100040810 | |||
| 754 | Ga0070678_100110316 | |||
| 755 | Ga0070681_10092689 | |||
| 756 | Ga0070681_10116519 | |||
| 757 | Ga0070681_10161296 | |||
| 758 | Ga0070681_10254481 | |||
| 759 | Ga0070698_100031556 | |||
| 760 | Ga0070698_100036479 | |||
| 761 | Ga0070698_100100522 | |||
| 762 | Ga0070679_100039201 | |||
| 763 | Ga0070679_100111671 | |||
| 764 | Ga0070679_100149731 | |||
| 765 | Ga0070684_100001996 | |||
| 766 | Ga0070684_100015846 | |||
| 767 | Ga0070697_100010345 | |||
| 768 | Ga0068853_100018719 | |||
| 769 | Ga0068853_100159716 | |||
| 770 | Ga0070695_100036684 | |||
| 771 | Ga0070696_100050450 | |||
| 772 | Ga0070693_100030832 | |||
| 773 | Ga0070693_100056068 | |||
| 774 | Ga0070693_100070802 | |||
| 775 | Ga0070665_100004023 | |||
| 776 | Ga0070665_100022114 | |||
| 777 | Ga0070665_100033585 | |||
| 778 | Ga0070665_100038775 | |||
| 779 | Ga0070665_100044051 | |||
| 780 | Ga0070665_100071396 | |||
| 781 | Ga0070665_100087921 | |||
| 782 | Ga0070665_100091041 | |||
| 783 | Ga0070665_100141955 | |||
| 784 | Ga0070665_100232560 | |||
| 785 | Ga0068855_100032505 | |||
| 786 | Ga0068855_100042520 | |||
| 787 | Ga0068855_100045274 | |||
| 788 | Ga0068855_100091001 | |||
| 789 | Ga0068857_100047726 | |||
| 790 | Ga0068856_100024638 | |||
| 791 | Ga0070702_100026773 | |||
| 792 | Ga0068859_100055447 | |||
| 793 | Ga0068864_100024549 | |||
| 794 | Ga0068864_100030025 | |||
| 795 | Ga0068866_10051271 | |||
| 796 | Ga0068861_100070570 | |||
| 797 | Ga0068870_10054092 | |||
| 798 | Ga0068858_100022369 | |||
| 799 | Ga0068860_100007304 | |||
| 800 | Ga0068860_100053172 | |||
| 801 | Ga0068860_100065183 | |||
| 802 | Ga0068860_100247149 | |||
| 803 | Ga0068862_100016189 | |||
| 804 | Ga0068862_100024231 | |||
| 805 | Ga0068862_100031482 | |||
| 806 | Ga0068862_100078211 | |||
| 807 | Ga0081455_10001818 | |||
| 808 | Ga0081455_10001871 | |||
| 809 | Ga0081455_10004903 | |||
| 810 | Ga0081455_10008395 | |||
| 811 | Ga0081455_10009237 | |||
| 812 | Ga0081455_10009607 | |||
| 813 | Ga0081455_10016182 | |||
| 814 | Ga0081455_10022880 | |||
| 815 | Ga0081455_10023631 | |||
| 816 | Ga0081455_10033823 | |||
| 817 | Ga0081455_10054609 | |||
| 818 | Ga0081455_10060536 | |||
| 819 | Ga0081455_10077335 | |||
| 820 | Ga0081455_10103122 | |||
| 821 | Ga0081538_10039562 | |||
| 822 | Ga0081540_1000248 | |||
| 823 | Ga0081540_1000423 | |||
| 824 | Ga0081540_1000829 | |||
| 825 | Ga0081540_1001277 | |||
| 826 | Ga0081540_1001791 | |||
| 827 | Ga0081540_1002606 | |||
| 828 | Ga0081540_1002762 | |||
| 829 | Ga0081540_1003475 | |||
| 830 | Ga0081540_1003978 | |||
| 831 | Ga0081540_1004440 | |||
| 832 | Ga0081540_1005366 | |||
| 833 | Ga0081540_1005698 | |||
| 834 | Ga0081540_1005953 | |||
| 835 | Ga0081540_1006177 | |||
| 836 | Ga0081540_1006649 | |||
| 837 | Ga0081540_1008540 | |||
| 838 | Ga0081540_1012096 | |||
| 839 | Ga0081540_1013758 | |||
| 840 | Ga0081540_1014517 | |||
| 841 | Ga0081540_1014531 | |||
| 842 | Ga0081540_1018687 | |||
| 843 | Ga0081540_1022075 | |||
| 844 | Ga0081540_1022779 | |||
| 845 | Ga0081540_1027520 | |||
| 846 | Ga0081540_1028440 | |||
| 847 | Ga0081540_1030104 | |||
| 848 | Ga0081540_1032184 | |||
| 849 | Ga0081540_1033414 | |||
| 850 | Ga0081540_1053552 | |||
| 851 | Ga0081540_1056342 | |||
| 852 | Ga0081539_10000176 | |||
| 853 | Ga0081539_10000231 | |||
| 854 | Ga0081539_10000530 | |||
| 855 | Ga0081539_10002526 | |||
| 856 | Ga0081539_10016768 | |||
| 857 | Ga0081539_10019177 | |||
| 858 | Ga0081539_10020869 | |||
| 859 | Ga0070717_10017525 | |||
| 860 | Ga0070717_10074420 | |||
| 861 | Ga0075365_10078357 | |||
| 862 | Ga0075365_10125816 | |||
| 863 | Ga0075368_10029780 | |||
| 864 | Ga0075363_100012252 | |||
| 865 | Ga0075363_100021078 | |||
| 866 | Ga0075363_100034947 | |||
| 867 | Ga0075363_100050533 | |||
| 868 | Ga0075363_100084816 | |||
| 869 | Ga0075364_10019035 | |||
| 870 | Ga0075364_10042916 | |||
| 871 | Ga0070716_100001786 | |||
| 872 | Ga0070712_100002881 | |||
| 873 | Ga0070712_100032044 | |||
| 874 | Ga0075362_10003353 | |||
| 875 | Ga0075362_10029861 | |||
| 876 | Ga0075362_10037030 | |||
| 877 | Ga0075367_10004842 | |||
| 878 | Ga0075367_10015210 | |||
| 879 | Ga0075367_10044041 | |||
| 880 | Ga0075367_10060398 | |||
| 881 | Ga0075369_10005989 | |||
| 882 | Ga0075369_10021608 | |||
| 883 | Ga0075366_10024670 | |||
| 884 | Ga0075366_10050320 | |||
| 885 | Ga0097621_100080158 | |||
| 886 | Ga0075370_10015830 | |||
| 887 | Ga0075370_10031577 | |||
| 888 | Ga0075370_10041788 | |||
| 889 | Ga0075370_10055339 | |||
| 890 | Ga0075370_10060397 | |||
| 891 | Ga0068871_100033602 | |||
| 892 | Ga0068871_100138848 | |||
| 893 | Ga0075428_100116410 | |||
| 894 | Ga0075434_100093121 | |||
| 895 | Ga0075434_100106156 | |||
| 896 | Ga0075434_100148663 | |||
| 897 | Ga0097620_100055449 | |||
| 898 | Ga0075435_100207083 | |||
| 899 | Ga0099794_10003949 | |||
| 900 | Ga0099794_10005746 | |||
| 901 | Ga0099794_10028555 | |||
| 902 | Ga0099794_10049136 | |||
| 903 | Ga0105245_10016651 | |||
| 904 | Ga0105245_10033205 | |||
| 905 | Ga0105245_10083753 | |||
| 906 | Ga0105247_10045260 | |||
| 907 | Ga0105247_10053069 | |||
| 908 | Ga0105247_10075850 | |||
| 909 | Ga0114129_10063938 | |||
| 910 | Ga0105241_10039297 | |||
| 911 | Ga0105241_10044508 | |||
| 912 | Ga0105248_10034450 | |||
| 913 | Ga0105248_10230216 | |||
| 914 | Ga0105237_10010079 | |||
| 915 | Ga0105237_10013984 | |||
| 916 | Ga0105237_10029085 | |||
| 917 | Ga0105237_10122154 | |||
| 918 | Ga0105237_10213732 | |||
| 919 | Ga0105237_10226197 | |||
| 920 | Ga0105238_10013570 | |||
| 921 | Ga0105238_10026716 | |||
| 922 | Ga0105238_10072787 | |||
| 923 | Ga0105239_10017670 | |||
| 924 | Ga0105239_10068554 | |||
| 925 | Ga0105239_10177259 | |||
| 926 | Ga0105246_10054504 | |||
| 927 | Ga0105246_10056178 | |||
| 928 | Ga0105246_10164398 | |||
| 929 | Ga0157370_10087808 | |||
| 930 | Ga0157370_10148214 | |||
| 931 | Ga0157369_10005375 | |||
| 932 | Ga0157369_10014657 | |||
| 933 | Ga0157369_10282962 | |||
| 934 | Ga0157369_10294928 | |||
| 935 | Ga0157378_10031055 | |||
| 936 | Ga0157378_10061966 | |||
| 937 | Ga0157378_10368077 | |||
| 938 | Ga0163162_10010924 | |||
| 939 | Ga0163162_10049707 | |||
| 940 | Ga0163162_10065440 | |||
| 941 | Ga0163162_10082130 | |||
| 942 | Ga0163162_10094221 | |||
| 943 | Ga0157372_10086216 | |||
| 944 | Ga0157372_10094769 | |||
| 945 | Ga0157372_10188233 | |||
| 946 | Ga0157375_10016474 | |||
| 947 | Ga0157375_10288107 | |||
| 948 | Ga0163163_10049831 | |||
| 949 | Ga0163163_10087464 | |||
| 950 | Ga0157380_10036675 | |||
| 951 | Ga0157377_10071495 | |||
| 952 | Ga0157379_10011266 | |||
| 953 | Ga0157376_10011205 | |||
| 954 | Ga0206352_10142119 | |||
| 955 | Ga0206354_11702451 | |||
| 956 | Ga0213872_10036505 | |||
| 957 | Ga0213876_10005609 | |||
| 958 | Ga0209758_1004101 | |||
| 959 | Ga0209758_1006382 | |||
| 960 | Ga0209758_1008259 | |||
| 961 | Ga0209758_1011810 | |||
| 962 | Ga0207692_10014434 | |||
| 963 | Ga0207710_10012956 | |||
| 964 | Ga0207688_10010295 | |||
| 965 | Ga0207699_10023842 | |||
| 966 | Ga0207699_10038727 | |||
| 967 | Ga0207645_10028620 | |||
| 968 | Ga0207643_10038000 | |||
| 969 | Ga0207684_10036703 | |||
| 970 | Ga0207684_10209229 | |||
| 971 | Ga0207654_10023046 | |||
| 972 | Ga0207654_10059400 | |||
| 973 | Ga0207707_10004663 | |||
| 974 | Ga0207707_10006506 | |||
| 975 | Ga0207707_10010189 | |||
| 976 | Ga0207671_10011065 | |||
| 977 | Ga0207693_10004006 | |||
| 978 | Ga0207693_10015164 | |||
| 979 | Ga0207693_10018708 | |||
| 980 | Ga0207663_10012954 | |||
| 981 | Ga0207660_10054326 | |||
| 982 | Ga0207657_10121189 | |||
| 983 | Ga0207652_10010356 | |||
| 984 | Ga0207652_10047310 | |||
| 985 | Ga0207652_10067320 | |||
| 986 | Ga0207694_10007778 | |||
| 987 | Ga0207694_10023641 | |||
| 988 | Ga0207694_10108001 | |||
| 989 | Ga0207694_10119140 | |||
| 990 | Ga0207650_10126106 | |||
| 991 | Ga0207659_10074312 | |||
| 992 | Ga0207659_10123272 | |||
| 993 | Ga0207687_10014547 | |||
| 994 | Ga0207687_10096338 | |||
| 995 | Ga0207700_10006403 | |||
| 996 | Ga0207700_10015209 | |||
| 997 | Ga0207700_10024881 | |||
| 998 | Ga0207664_10060684 | |||
| 999 | Ga0207664_10091822 | |||
| 1000 | Ga0207664_10122774 | |||
| 1001 | Ga0207644_10057258 | |||
| 1002 | Ga0207644_10061913 | |||
| 1003 | Ga0207706_10021052 | |||
| 1004 | Ga0207706_10146069 | |||
| 1005 | Ga0207709_10030666 | |||
| 1006 | Ga0207709_10109817 | |||
| 1007 | Ga0207670_10129113 | |||
| 1008 | Ga0207704_10115290 | |||
| 1009 | Ga0207665_10002151 | |||
| 1010 | Ga0207665_10017860 | |||
| 1011 | Ga0207665_10046553 | |||
| 1012 | Ga0207711_10046526 | |||
| 1013 | Ga0207711_10066767 | |||
| 1014 | Ga0207689_10036732 | |||
| 1015 | Ga0207689_10122768 | |||
| 1016 | Ga0207661_10000171 | |||
| 1017 | Ga0207661_10003747 | |||
| 1018 | Ga0207661_10006281 | |||
| 1019 | Ga0207661_10028618 | |||
| 1020 | Ga0207679_10190433 | |||
| 1021 | Ga0207667_10068594 | |||
| 1022 | Ga0207667_10078632 | |||
| 1023 | Ga0207667_10082096 | |||
| 1024 | Ga0207668_10012639 | |||
| 1025 | Ga0207668_10021506 | |||
| 1026 | Ga0207668_10025172 | |||
| 1027 | Ga0207640_10120315 | |||
| 1028 | Ga0207677_10053542 | |||
| 1029 | Ga0207677_10090498 | |||
| 1030 | Ga0207703_10010777 | |||
| 1031 | Ga0207703_10020853 | |||
| 1032 | Ga0207639_10022921 | |||
| 1033 | Ga0207639_10053986 | |||
| 1034 | Ga0207639_10099144 | |||
| 1035 | Ga0207678_10005830 | |||
| 1036 | Ga0207678_10020913 | |||
| 1037 | Ga0207678_10034642 | |||
| 1038 | Ga0207708_10026144 | |||
| 1039 | Ga0207702_10020557 | |||
| 1040 | Ga0207641_10104967 | |||
| 1041 | Ga0207641_10125254 | |||
| 1042 | Ga0207676_10056786 | |||
| 1043 | Ga0207676_10072677 | |||
| 1044 | Ga0207674_10062863 | |||
| 1045 | Ga0207674_10117732 | |||
| 1046 | Ga0207674_10129104 | |||
| 1047 | Ga0207675_100053448 | |||
| 1048 | Ga0207683_10053897 | |||
| 1049 | Ga0207683_10201931 | |||
| 1050 | Ga0207698_10068311 | |||
| 1051 | Ga0209588_1005174 | |||
| 1052 | Ga0207428_10132642 | |||
| 1053 | Ga0268266_10001870 | |||
| 1054 | Ga0268266_10008300 | |||
| 1055 | Ga0268266_10009648 | |||
| 1056 | Ga0268266_10027619 | |||
| 1057 | Ga0268266_10043930 | |||
| 1058 | Ga0268266_10088504 | |||
| 1059 | Ga0268266_10173292 | |||
| 1060 | Ga0268265_10013626 | |||
| 1061 | Ga0268265_10029721 | |||
| 1062 | Ga0268265_10076032 | |||
| 1063 | Ga0268264_10000377 | |||
| 1064 | Ga0268264_10096767 | |||
| 1065 | Ga0307517_10000124 | |||
| 1066 | Ga0307517_10002371 | |||
| 1067 | Ga0307515_10031012 | |||
| 1068 | Ga0307515_10062161 | |||
| 1069 | Ga0307513_10085449 | |||
| 1070 | Ga0307509_10073582 | |||
| 1071 | Ga0307509_10087891 | |||
| 1072 | Ga0307509_10160909 | |||
| 1073 | Ga0307509_10165170 | |||
| 1074 | Ga0307508_10000378 | |||
| 1075 | Ga0307508_10071026 | |||
| 1076 | Ga0307516_10057713 | |||
| 1077 | Ga0307516_10068101 | |||
| 1078 | Ga0307516_10158268 | |||
| 1079 | Ga0307507_10092635 | |||
| 1080 | Ga0307510_10065088 | |||
| 1081 | Ga0307510_10120596 | |||
| 1082 | Ga0315911_1000107 | |||
| 1083 | Ga0373936_0073335 | |||
| 1084 | Ga0373946_0045403 | |||
| 1085 | Ga0373935_0014976 | |||
| 1086 | Ga0373927_0032196 | |||
| 1087 | Ga0373927_0041000 | |||
| 1088 | Ga0373927_0074996 | |||
| 1089 | Ga0373933_0003692 | |||
| 1090 | Ga0373933_0043451 | |||
| 1091 | Ga0373947_0025828 | |||
| 1092 | Ga0310104_01295 | |||
| 1093 | Ga0265778_002400 | |||
| 1094 | Ga0265778_002442 | |||
| 1095 | Ga0373925_0018250 | |||
| 1096 | Ga0373925_0065559 | |||
| 1097 | Ga0395900_0046210 | |||
| 1098 | Ga0395898_0067179 | |||
| 1099 | Ga0395898_0256718 | |||
| 1100 | Ga0395905_0034856 | |||
| 1101 | Ga0395905_0113359 | |||
| 1102 | Ga0395905_0215484 | |||
| 1103 | Ga0436364_0780655 | |||
| 1104 | Ga0436365_1238998 | |||
| 1105 | Ga0436360_0310426 | |||
| 1106 | Ga0436361_0764431 | |||
| 1107 | Ga0436361_0887955 | |||
| 1108 | Ga0436361_0895325 | |||
| 1109 | Ga0436361_1022339 | |||
| 1110 | Ga0436361_1134910 | |||
| 1111 | Ga0436363_0555836 | |||
| 1112 | Ga0466966_0069353 | |||
| 1113 | Ga0466966_0081513 | |||
| 1114 | Ga0466967_0191235 | |||
| 1115 | Ga0495603_0001480 | |||
| 1116 | Ga0495603_0013390 | |||
| 1117 | Ga0495603_0025163 | |||
| 1118 | Ga0495603_0072103 | |||
| 1119 | Ga0495629_0025937 | |||
| 1120 | Ga0495638_0070041 | |||
| 1121 | Ga0495580_0027220 | |||
| 1122 | Ga0495580_0029423 | |||
| 1123 | Ga0495582_0001176 | |||
| 1124 | Ga0495662_0011346 | |||
| 1125 | Ga0495594_0009072 | |||
| 1126 | Ga0495606_0005580 | |||
| 1127 | Ga0495632_0048886 | |||
| 1128 | Ga0495648_0002980 | |||
| 1129 | Ga0495648_0003683 | |||
| 1130 | Ga0495665_0020666 | |||
| 1131 | Ga0495640_0013114 | |||
| 1132 | Ga0495640_0047416 | |||
| 1133 | Ga0495597_0077441 | |||
| 1134 | Ga0495622_0028125 | |||
| 1135 | Ga0495622_0043688 | |||
| 1136 | Ga0495668_0064767 | |||
| 1137 | Ga0495634_0028011 | |||
| 1138 | Ga0495625_0105197 | |||
| 1139 | Ga0495635_0054809 | |||
| 1140 | Ga0495669_0046232 | |||
| 1141 | Ga0495581_0003049 | |||
| 1142 | Ga0495581_0072108 | |||
| 1143 | Ga0495674_0027629 | |||
| 1144 | Ga0495672_0027214 | |||
| 1145 | Ga0495672_0033263 | |||
| 1146 | Ga0495676_0077184 | |||
| 1147 | Ga0495673_0015144 | |||
| 1148 | Ga0495686_0022329 | |||
| 1149 | Ga0495686_0026723 | |||
| 1150 | Ga0495593_0002569 | |||
| 1151 | Ga0495593_0015493 | |||
| 1152 | Ga0496101_0024385 | |||
| 1153 | Ga0496101_0123097 | |||
| 1154 | Ga0496102_0012643 | |||
| 1155 | Ga0496102_0174711 | |||
| 1156 | Ga0496104_0193102 | |||
| 1157 | Ga0496105_0032452 | |||
| 1158 | Ga0496106_0035055 | |||
| 1159 | Ga0496106_0056585 | |||
| 1160 | Ga0496108_0022398 | |||
| 1161 | Ga0496108_0049573 | |||
| 1162 | Ga0496108_0070379 | |||
| 1163 | Ga0496109_0056899 | |||
| 1164 | Ga0496109_0111608 | |||
| 1165 | Ga0496110_0009242 | |||
| 1166 | Ga0496110_0160464 | |||
| 1167 | Ga0496112_0000004 | |||
| 1168 | Ga0496112_0071005 | |||
| 1169 | Ga0496112_0077051 | |||
| 1170 | Ga0496113_0049652 | |||
| 1171 | Ga0496113_0126331 | |||
| 1172 | Ga0496113_0136779 | |||
| 1173 | Ga0496115_0001685 | |||
| 1174 | Ga0496117_0013369 | |||
| 1175 | Ga0496118_0006071 | |||
| 1176 | Ga0496119_0023800 | |||
| 1177 | Ga0496121_0000091 | |||
| 1178 | Ga0496121_0003703 | |||
| 1179 | Ga0496121_0004207 | |||
| 1180 | Ga0496121_0021849 | |||
| 1181 | Ga0496121_0022999 | |||
| 1182 | Ga0496121_0033754 | |||
| 1183 | Ga0496121_0044282 | |||
| 1184 | Ga0496121_0068856 | |||
| 1185 | Ga0496121_0075127 | |||
| 1186 | Ga0496121_0095936 | |||
| 1187 | Ga0496121_0101245 | |||
| 1188 | Ga0496121_0113208 | |||
| 1189 | Ga0496122_0013492 | |||
| 1190 | Ga0496122_0017056 | |||
| 1191 | Ga0496123_0056370 | |||
| 1192 | Ga0496124_0009503 | |||
| 1193 | Ga0496124_0132238 | |||
| 1194 | Ga0496125_0047655 | |||
| 1195 | Ga0496126_0009714 | |||
| 1196 | Ga0496126_0011356 | |||
| 1197 | Ga0496126_0017288 | |||
| 1198 | Ga0496126_0019884 | |||
| 1199 | Ga0496126_0021610 | |||
| 1200 | Ga0496126_0029335 | |||
| 1201 | Ga0496126_0033976 | |||
| 1202 | Ga0496126_0037235 | |||
| 1203 | Ga0496126_0054139 | |||
| 1204 | Ga0496126_0069559 | |||
| 1205 | Ga0496126_0074891 | |||
| 1206 | Ga0496126_0118486 | |||
| 1207 | Ga0496126_0145143 | |||
| 1208 | Ga0501047_0204884 | |||
| 1209 | Ga0501080_0110669 | |||
| 1210 | Ga0501044_0119607 | |||
| 1211 | nmdc:mga03683_27556_c1 | |||
| 1212 | nmdc:mga03n38_19194_c1 | |||
| 1213 | nmdc:mga03n38_29732_c1 | |||
| 1214 | nmdc:mga00v17_64304_c1 | |||
| 1215 | nmdc:mga00v17_74793_c1 | |||
| 1216 | nmdc:mga0yw44_17827_c1 | |||
| 1217 | nmdc:mga0yw44_29044_c1 | |||
| 1218 | nmdc:mga0yw44_63306_c1 | |||
| 1219 | nmdc:mga0yw44_66090_c1 | |||
| 1220 | nmdc:mga0yw44_75539_c1 | |||
| 1221 | nmdc:mga0yw44_8648_c1 | |||
| 1222 | nmdc:mga0k408_30185_c1 | |||
| 1223 | nmdc:mga0k408_38031_c1 | |||
| 1224 | nmdc:mga0k408_55980_c1 | |||
| 1225 | nmdc:mga0k408_67688_c1 | |||
| 1226 | nmdc:mga0k408_74731_c1 | |||
| 1227 | nmdc:mga0k408_8355_c1 | |||
| 1228 | nmdc:mga06z11_13126_c1 | |||
| 1229 | nmdc:mga06z11_68657_c1 | |||
| 1230 | nmdc:mga04h51_7701_c1 | |||
| 1231 | nmdc:mga07m45_34756_c1 | |||
| 1232 | nmdc:mga07m45_39045_c1 | |||
| 1233 | nmdc:mga07m45_4727_c1 | |||
| 1234 | nmdc:mga07m45_70150_c1 | |||
| 1235 | nmdc:mga05p37_157090_c1 | |||
| 1236 | nmdc:mga0rr50_114045_c1 | |||
| 1237 | nmdc:mga0sz30_15384_c1 | |||
| 1238 | nmdc:mga0sz30_33692_c1 | |||
| 1239 | nmdc:mga0sz30_36945_c1 | |||
| 1240 | nmdc:mga0sz30_42627_c1 | |||
| 1241 | nmdc:mga0sz30_8449_c1 | |||
| 1242 | Ga0500635_0016740 | |||
| 1243 | Ga0500647_0013961 | |||
| 1244 | Ga0500566_0000048 | |||
| 1245 | Ga0500566_0000085 | |||
| 1246 | Ga0500566_0000845 | |||
| 1247 | Ga0500566_0005045 | |||
| 1248 | Ga0500566_0056416 | |||
| 1249 | Ga0500640_003345 | |||
| 1250 | Ga0500641_0007877 | |||
| 1251 | Ga0500641_0024446 | |||
| 1252 | Ga0500641_0027093 | |||
| 1253 | Ga0500641_0036124 | |||
| 1254 | Ga0500554_000433 | |||
| 1255 | Ga0500554_000625 | |||
| 1256 | Ga0500554_001199 | |||
| 1257 | Ga0500572_000436 | |||
| 1258 | Ga0500572_000526 | |||
| 1259 | Ga0500572_001079 | |||
| 1260 | Ga0500572_002202 | |||
| 1261 | Ga0500591_003487 | |||
| 1262 | Ga0500595_001063 | |||
| 1263 | Ga0500595_002252 | |||
| 1264 | Ga0500595_004049 | |||
| 1265 | Ga0500595_013593 | |||
| 1266 | Ga0500595_025935 | |||
| 1267 | Ga0500614_001830 | |||
| 1268 | Ga0500614_003295 | |||
| 1269 | Ga0500658_0029289 | |||
| 1270 | Ga0500559_0001740 | |||
| 1271 | Ga0500559_0005234 | |||
| 1272 | Ga0500559_0005512 | |||
| 1273 | Ga0500559_0012412 | |||
| 1274 | Ga0500559_0013648 | |||
| 1275 | Ga0500577_0011120 | |||
| 1276 | Ga0500589_025746 | |||
| 1277 | Ga0500603_000041 | |||
| 1278 | Ga0500603_000063 | |||
| 1279 | Ga0500603_000326 | |||
| 1280 | Ga0500603_002212 | |||
| 1281 | Ga0500622_0015994 | |||
| 1282 | Ga0500630_000339 | |||
| 1283 | Ga0500630_001914 | |||
| 1284 | Ga0500638_000156 | |||
| 1285 | Ga0500638_001640 | |||
| 1286 | Ga0500639_000004 | |||
| 1287 | Ga0500639_000165 | |||
| 1288 | Ga0500639_000228 | |||
| 1289 | Ga0500639_019917 | |||
| 1290 | Ga0500637_0000157 | |||
| 1291 | Ga0500637_0000555 | |||
| 1292 | Ga0500637_0000978 | |||
| 1293 | Ga0500637_0012100 | |||
| 1294 | Ga0500637_0014538 | |||
| 1295 | Ga0500637_0015560 | |||
| 1296 | Ga0500637_0036228 | |||
| 1297 | Ga0500637_0042747 | |||
| 1298 | Ga0500637_0062812 | |||
| 1299 | Ga0500645_007397 | |||
| 1300 | Ga0500645_017026 | |||
| 1301 | Ga0500596_000072 | |||
| 1302 | Ga0500596_002779 | |||
| 1303 | Ga0500596_005389 | |||
| 1304 | Ga0500661_000059 | |||
| 1305 | Ga0500661_000154 | |||
| 1306 | Ga0500661_004069 | |||
| 1307 | Ga0587066_004207 | |||
| 1308 | Ga0587094_003020 | |||
| 1309 | Ga0587109_006085 | |||
| 1310 | Ga0587109_006166 | |||
| 1311 | 2508540691 | |||
| 1312 | 2509149646 | |||
| 1313 | 2509153284 | |||
| 1314 | 2513670833 | |||
| 1315 | 2513672389 | |||
| 1316 | 2513674146 | |||
| 1317 | 2513676211 | |||
| 1318 | 2513676438 | |||
| 1319 | 2513676723 | |||
| 1320 | 2513678833 | |||
| 1321 | 2513679938 | |||
| 1322 | 2513680092 | |||
| 1323 | 2513695761 | |||
| 1324 | 2513696010 | |||
| 1325 | 2513718912 | |||
| 1326 | 2513892045 | |||
| 1327 | 2513894254 | |||
| 1328 | 2524467912 | |||
| 1329 | 2524469789 | |||
| 1330 | 2524469867 | |||
| 1331 | 2524470038 | |||
| 1332 | 2524470128 | |||
| 1333 | 2524471101 | |||
| 1334 | 2524471287 | |||
| 1335 | 2723845901 | |||
| 1336 | 2723846244 | |||
| 1337 | 2723847208 | |||
| 1338 | 2793080544 | |||
| 1339 | 2793082709 | |||
| 1340 | 2793084185 | |||
| 1341 | 2874609454 | |||
| 1342 | 2874610794 | |||
| 1343 | 2876815549 | |||
| 1344 | 2879110322 | |||
| 1345 | 2879110324 | |||
| 1346 | 2879118875 | |||
| 1347 | 2885384342 | |||
| 1348 | 2885387028 | |||
| 1349 | 2885387667 | |||
| 1350 | 2885387750 | |||
| 1351 | 2885389603 | |||
| 1352 | 2885389856 | |||
| 1353 | 2885392356 | |||
| 1354 | 2889038165 | |||
| 1355 | 2889039312 | |||
| 1356 | 2903755016 | |||
| 1357 | 2903769056 | |||
| 1358 | 2903769880 | |||
| 1359 | 2903772384 | |||
| 1360 | 2903773542 | |||
| 1361 | 2903776066 | |||
| 1362 | 2903777539 | |||
| 1363 | 2922362047 | |||
| 1364 | 2922367842 | |||
| 1365 | 2922368538 | |||
| 1366 | 2922387486 | |||
| 1367 | 2922388185 | |||
| 1368 | 2922392257 | |||
| 1369 | 8006968419 | |||
| 1370 | 8006968682 | |||
| 1371 | 8006991182 | |||
| 1372 | 8006994855 | |||
| 1373 | 8006996336 | |||
| 1374 | 8006999963 | |||
| 1375 | 8019628778 | |||
| 1376 | 8019664150 | |||
| 1377 | 8019678179 | |||
| 1378 | 8056677535 | |||
| 1379 | 8056677536 | |||
| 1380 | 8056680379 | |||
| 1381 | 8056681431 | |||
| 1382 | 8056683039 | |||
| 1383 | 8056684942 | |||
| 1384 | 8056685103 | |||
| 1385 | 8056688642 | |||
| 1386 | 8056689503 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6eus-assembly2.cif.gz_E | crystal structure of the outer membrane channel dcap of acinetobacter baumannii | 0.8441 | 54 | 495 |
| 6eus-assembly2.cif.gz_E | crystal structure of the outer membrane channel dcap of acinetobacter baumannii | 0.8212 | 54 | 495 |
| 7szi-assembly1.cif.gz_A | cryo-em structure of ompk36-tran mating pair stabilization proteins from carbapenem-resistant klebsiella pneumoniae | 0.6875 | 44 | 495 |
| 6ehe-assembly1.cif.gz_A | omptdeltal8 (loop l8 deletion mutant of ompt), an outer membrane protein of vibrio cholerae | 0.6873 | 53 | 495 |
| 7szi-assembly1.cif.gz_A | cryo-em structure of ompk36-tran mating pair stabilization proteins from carbapenem-resistant klebsiella pneumoniae | 0.6858 | 44 | 495 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3uu2B00 | Mainly Beta;Beta Barrel;Porin;Porin | 0.6677 | 49 | 495 | 2.40.160.10 |
| 3uu2B00 | Mainly Beta;Beta Barrel;Porin;Porin | 0.6603 | 49 | 495 | 2.40.160.10 |
| 1e54A00 | Mainly Beta;Beta Barrel;Porin;Porin | 0.6194 | 56 | 495 | 2.40.160.10 |
| 1e54A00 | Mainly Beta;Beta Barrel;Porin;Porin | 0.6145 | 56 | 495 | 2.40.160.10 |
| 4auiC00 | Mainly Beta;Beta Barrel;Porin;Porin | 0.6112 | 56 | 495 | 2.40.160.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7T7Z6Q2-F1-model_v4 | deleted | 0.9159 | 40 | 495 |
|
| AF-A0A7Y4GZ44-F1-model_v4 | Porin | 0.9078 | 59 | 495 |
GO:0006811
GO:0009279 GO:0015288 GO:0046930 |
| AF-A0A345ZTN6-F1-model_v4 | Porin | 0.9014 | 37 | 495 |
GO:0006811
GO:0009279 GO:0015288 GO:0046930 |
| AF-A0A5C8DWJ9-F1-model_v4 | Porin | 0.8977 | 1 | 495 |
GO:0006811
GO:0009279 GO:0015288 GO:0046930 |
| AF-A0A0C1XBB1-F1-model_v4 | deleted | 0.8963 | 39 | 495 |
|