F477961

General Info

Members Datasets Scaffolds Average Seq Length
731 287 1386 524

Family's Representative Sequence

Representative Sequence 3300007265|Ga0099794_10024386|Ga0099794_100243862
Length 598
Sequence MASRMMRVIGHWEFLKRTRMHRLAALHKIIAKQKGRLVTALVALQNEFCAIHVARLQMLHGKPRKSHRRIRMMAFRNLILGSVAGLLAIGGVQAADLPVKAKAVEYVRICSLYGAGFFFIPGTDTCIKLGGYLRVDTTFNGGIQGQPAWNGDLGQQNRYRDYFASRSRMALTVDTRTATEYGVVRTFMQADFQFNTLGGSTFNPNSINVTSPVGGVQLLDTPGGGYVAVESVFIQFAGFTFGKSSSAYATPWNGFPGNISSYLLGGHNTDTGVNNVQYTAQFGNGVSGTIGLDDPTVWNRTAVYNLSLPLNATLNSGNAYAGVHAPDVVGNIRVDQAWGLFQISAAAHEVSGSYNVLNTAAVPAGATGLAGAAPTALSEINGHPETKWGGSVMAGLNIKNLPTGAGDDIKIDASYAKGDTKNVIATASTSPSFAMFSGTGRAGAYESIGFGATTDGVWLPAANGGDGAIHLTTAYGMRGAFNHNWDAHWSSSLFGSYSAVRYDNVAKTNICTNYTTPAKAVSADFTCNPDFNVSQLGVITRWAPVKNLTFSAELMWFHLDQKFTGAATLGATAPKPAAVYAFKDQDAISLQLRAQRNF

Samples

Sample ID Description Type Environment
1 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
2 3300003163 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
6 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
7 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
8 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
11 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
34 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
35 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
51 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
52 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
58 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
59 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
60 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
61 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
62 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
63 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
64 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
65 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
66 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
77 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
80 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
96 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
97 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
149 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
150 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
151 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
152 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
153 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
154 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
155 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
156 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
157 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
159 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
163 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
164 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
166 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
167 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
168 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
169 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
170 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
171 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
172 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
173 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
174 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
175 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
176 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
177 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
178 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
179 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
180 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
181 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
182 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
183 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
184 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
189 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
190 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
191 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
192 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
195 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
196 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
197 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
198 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
199 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
200 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
201 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
202 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
203 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
204 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
205 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
206 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
207 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
208 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
209 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
213 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
214 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
215 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
216 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
217 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
218 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
219 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
220 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
221 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
222 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
223 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
224 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
225 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
226 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
227 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
228 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
229 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
230 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
231 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
232 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
233 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
234 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
235 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
236 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
237 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
238 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
239 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
240 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
241 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
242 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
243 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
244 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
245 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
246 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
247 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
248 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
249 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
250 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
251 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
252 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
253 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
254 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
255 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
256 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
257 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
258 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
259 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
260 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
262 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
263 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
264 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
265 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
266 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
267 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
268 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
269 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
270 2791355199
271 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
272 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
273 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
274 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
275 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
276 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
277 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
278 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
279 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
280 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
281 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
282 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
283 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
284 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
285 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
286 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
287 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.64
Metatranscriptomes 2.34
Isolates 10.03

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 17.65
Nodule 7.8
Rhizoplane 3.42
Rhizosphere 60.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0099794_10024386 3300007265 Bacteria 2776
2 Ga0006759J45824_1014111 3300003163 Bacteria 1696
3 JGI25406J46586_10000006 3300003203 Bacteria 114937
4 JGI25406J46586_10016308 3300003203 Bacteria 3100
5 JGI25153J46596_10003035 3300003215 Bacteria 9489
6 JGI25153J46596_10005756 3300003215 Bacteria 6460
7 rootH2_10091315 3300003320 Bacteria 4859
8 rootH1_10017865 3300003323 Bacteria 4012
9 Ga0007410J51695_1029247 3300003574 Bacteria 1555
10 Ga0007409J51694_1011648 3300003575 Bacteria 1652
11 Ga0007409J51694_1017406 3300003575 Bacteria 1588
12 Ga0007409J51694_1034979 3300003575 Bacteria 1552
13 Ga0007416J51690_1019111 3300003577 Bacteria 1824
14 JGI25404J52841_10000143 3300003659 Bacteria 7751
15 JGI25404J52841_10000958 3300003659 Bacteria 4706
16 JGI25404J52841_10001663 3300003659 Bacteria 3992
17 JGI25404J52841_10002240 3300003659 Bacteria 3631
18 JGI25404J52841_10002994 3300003659 Bacteria 3284
19 JGI25404J52841_10003961 3300003659 Bacteria 2971
20 JGI25404J52841_10004171 3300003659 Bacteria 2910
21 JGI25404J52841_10004443 3300003659 Bacteria 2842
22 JGI25404J52841_10005004 3300003659 Bacteria 2723
23 JGI25404J52841_10006428 3300003659 Bacteria 2458
24 JGI25404J52841_10006984 3300003659 Bacteria 2375
25 Ga0058863_10061770 3300004799 Bacteria 1724
26 Ga0058862_12142271 3300004803 Bacteria 1977
27 Ga0070683_100000231 3300005329 Bacteria 38055
28 Ga0070683_100012503 3300005329 Bacteria 7379
29 Ga0070683_100053358 3300005329 Bacteria 3746
30 Ga0070683_100079179 3300005329 Bacteria 3075
31 Ga0070670_100060074 3300005331 Bacteria 3263
32 Ga0068869_100030039 3300005334 Bacteria 3811
33 Ga0068869_100044014 3300005334 Bacteria 3209
34 Ga0070680_100029259 3300005336 Bacteria 4424
35 Ga0070680_100030038 3300005336 Bacteria 4364
36 Ga0070682_100042753 3300005337 Bacteria 2800
37 Ga0068868_100011161 3300005338 Bacteria 6541
38 Ga0070668_100036165 3300005347 Bacteria 3768
39 Ga0070668_100070924 3300005347 Bacteria 2713
40 Ga0070668_100106641 3300005347 Bacteria 2226
41 Ga0070668_100156005 3300005347 Bacteria 1849
42 Ga0070668_100156354 3300005347 Bacteria 1847
43 Ga0070671_100020925 3300005355 Bacteria 5337
44 Ga0070671_100037298 3300005355 Bacteria 4030
45 Ga0070671_100065630 3300005355 Bacteria 3024
46 Ga0070674_100084176 3300005356 Bacteria 2280
47 Ga0070709_10000587 3300005434 Bacteria 21300
48 Ga0070709_10008074 3300005434 Bacteria 5775
49 Ga0070714_100027623 3300005435 Bacteria 4701
50 Ga0070714_100044894 3300005435 Bacteria 3743
51 Ga0070714_100076222 3300005435 Bacteria 2911
52 Ga0070713_100013919 3300005436 Bacteria 5956
53 Ga0070713_100016206 3300005436 Bacteria 5602
54 Ga0070713_100021072 3300005436 Bacteria 5006
55 Ga0070710_10000736 3300005437 Bacteria 15576
56 Ga0070663_100008935 3300005455 Bacteria 6188
57 Ga0070663_100012244 3300005455 Bacteria 5416
58 Ga0070663_100057736 3300005455 Bacteria 2785
59 Ga0070663_100085278 3300005455 Bacteria 2330
60 Ga0070678_100040810 3300005456 Bacteria 3286
61 Ga0070678_100110316 3300005456 Bacteria 2151
62 Ga0070681_10092689 3300005458 Bacteria 2969
63 Ga0070681_10116519 3300005458 Bacteria 2608
64 Ga0070681_10161296 3300005458 Bacteria 2166
65 Ga0070681_10254481 3300005458 Bacteria 1668
66 Ga0070698_100031556 3300005471 Bacteria 5492
67 Ga0070698_100036479 3300005471 Bacteria 5077
68 Ga0070698_100100522 3300005471 Bacteria 2864
69 Ga0070679_100039201 3300005530 Bacteria 4709
70 Ga0070679_100111671 3300005530 Bacteria 2720
71 Ga0070679_100149731 3300005530 Bacteria 2311
72 Ga0070684_100001996 3300005535 Bacteria 15009
73 Ga0070684_100015846 3300005535 Bacteria 6151
74 Ga0070697_100010345 3300005536 Bacteria 7275
75 Ga0068853_100018719 3300005539 Bacteria 5736
76 Ga0068853_100159716 3300005539 Bacteria 2033
77 Ga0070695_100036684 3300005545 Bacteria 3085
78 Ga0070696_100050450 3300005546 Bacteria 2892
79 Ga0070693_100030832 3300005547 Bacteria 2935
80 Ga0070693_100056068 3300005547 Bacteria 2273
81 Ga0070693_100070802 3300005547 Bacteria 2053
82 Ga0070665_100004023 3300005548 Bacteria 15479
83 Ga0070665_100022114 3300005548 Bacteria 6397
84 Ga0070665_100033585 3300005548 Bacteria 5162
85 Ga0070665_100038775 3300005548 Bacteria 4789
86 Ga0070665_100044051 3300005548 Bacteria 4482
87 Ga0070665_100071396 3300005548 Bacteria 3478
88 Ga0070665_100087921 3300005548 Bacteria 3113
89 Ga0070665_100091041 3300005548 Bacteria 3055
90 Ga0070665_100141955 3300005548 Bacteria 2405
91 Ga0070665_100232560 3300005548 Bacteria 1843
92 Ga0068855_100032505 3300005563 Bacteria 6229
93 Ga0068855_100042520 3300005563 Bacteria 5384
94 Ga0068855_100045274 3300005563 Bacteria 5204
95 Ga0068855_100091001 3300005563 Bacteria 3519
96 Ga0068857_100047726 3300005577 Bacteria 3802
97 Ga0068856_100024638 3300005614 Bacteria 5858
98 Ga0070702_100026773 3300005615 Bacteria 3103
99 Ga0068859_100055447 3300005617 Bacteria 3988
100 Ga0068864_100024549 3300005618 Bacteria 5072
101 Ga0068864_100030025 3300005618 Bacteria 4607
102 Ga0068866_10051271 3300005718 Bacteria 2100
103 Ga0068861_100070570 3300005719 Bacteria 2705
104 Ga0068870_10054092 3300005840 Bacteria 2134
105 Ga0068858_100022369 3300005842 Bacteria 5901
106 Ga0068860_100007304 3300005843 Bacteria 11046
107 Ga0068860_100053172 3300005843 Bacteria 3851
108 Ga0068860_100065183 3300005843 Bacteria 3459
109 Ga0068860_100247149 3300005843 Bacteria 1736
110 Ga0068862_100016189 3300005844 Bacteria 6202
111 Ga0068862_100024231 3300005844 Bacteria 5091
112 Ga0068862_100031482 3300005844 Bacteria 4479
113 Ga0068862_100078211 3300005844 Bacteria 2866
114 Ga0081455_10001818 3300005937 Bacteria 25693
115 Ga0081455_10001871 3300005937 Bacteria 25308
116 Ga0081455_10004903 3300005937 Bacteria 14832
117 Ga0081455_10008395 3300005937 Bacteria 10741
118 Ga0081455_10009237 3300005937 Bacteria 10161
119 Ga0081455_10009607 3300005937 Bacteria 9934
120 Ga0081455_10016182 3300005937 Bacteria 7211
121 Ga0081455_10022880 3300005937 Bacteria 5828
122 Ga0081455_10023631 3300005937 Bacteria 5715
123 Ga0081455_10033823 3300005937 Bacteria 4588
124 Ga0081455_10054609 3300005937 Bacteria 3403
125 Ga0081455_10060536 3300005937 Bacteria 3192
126 Ga0081455_10077335 3300005937 Bacteria 2738
127 Ga0081455_10103122 3300005937 Bacteria 2285
128 Ga0081538_10039562 3300005981 Bacteria 3023
129 Ga0081540_1000248 3300005983 Bacteria 56862
130 Ga0081540_1000423 3300005983 Bacteria 41829
131 Ga0081540_1000829 3300005983 Bacteria 28195
132 Ga0081540_1001277 3300005983 Bacteria 21964
133 Ga0081540_1001791 3300005983 Bacteria 18013
134 Ga0081540_1002606 3300005983 Bacteria 14657
135 Ga0081540_1002762 3300005983 Bacteria 14248
136 Ga0081540_1003475 3300005983 Bacteria 12435
137 Ga0081540_1003978 3300005983 Bacteria 11465
138 Ga0081540_1004440 3300005983 Bacteria 10699
139 Ga0081540_1005366 3300005983 Bacteria 9590
140 Ga0081540_1005698 3300005983 Bacteria 9243
141 Ga0081540_1005953 3300005983 Bacteria 8994
142 Ga0081540_1006177 3300005983 Bacteria 8782
143 Ga0081540_1006649 3300005983 Bacteria 8372
144 Ga0081540_1008540 3300005983 Bacteria 7148
145 Ga0081540_1012096 3300005983 Bacteria 5709
146 Ga0081540_1013758 3300005983 Bacteria 5242
147 Ga0081540_1014517 3300005983 Bacteria 5040
148 Ga0081540_1014531 3300005983 Bacteria 5035
149 Ga0081540_1018687 3300005983 Bacteria 4243
150 Ga0081540_1022075 3300005983 Bacteria 3767
151 Ga0081540_1022779 3300005983 Bacteria 3690
152 Ga0081540_1027520 3300005983 Bacteria 3219
153 Ga0081540_1028440 3300005983 Bacteria 3140
154 Ga0081540_1030104 3300005983 Bacteria 3013
155 Ga0081540_1032184 3300005983 Bacteria 2868
156 Ga0081540_1033414 3300005983 Bacteria 2793
157 Ga0081540_1053552 3300005983 Bacteria 1978
158 Ga0081540_1056342 3300005983 Bacteria 1909
159 Ga0081539_10000176 3300005985 Bacteria 150292
160 Ga0081539_10000231 3300005985 Bacteria 131197
161 Ga0081539_10000530 3300005985 Bacteria 79454
162 Ga0081539_10002526 3300005985 Bacteria 25557
163 Ga0081539_10016768 3300005985 Bacteria 5199
164 Ga0081539_10019177 3300005985 Bacteria 4694
165 Ga0081539_10020869 3300005985 Bacteria 4400
166 Ga0070717_10017525 3300006028 Bacteria 5575
167 Ga0070717_10074420 3300006028 Bacteria 2839
168 Ga0075365_10078357 3300006038 Bacteria 2234
169 Ga0075365_10125816 3300006038 Bacteria 1771
170 Ga0075368_10029780 3300006042 Bacteria 2111
171 Ga0075363_100012252 3300006048 Bacteria 4128
172 Ga0075363_100021078 3300006048 Bacteria 3277
173 Ga0075363_100034947 3300006048 Bacteria 2626
174 Ga0075363_100050533 3300006048 Bacteria 2215
175 Ga0075363_100084816 3300006048 Bacteria 1737
176 Ga0075364_10019035 3300006051 Bacteria 4307
177 Ga0075364_10042916 3300006051 Bacteria 2939
178 Ga0070716_100001786 3300006173 Bacteria 9742
179 Ga0070712_100002881 3300006175 Bacteria 10664
180 Ga0070712_100032044 3300006175 Bacteria 3547
181 Ga0075362_10003353 3300006177 Bacteria 5581
182 Ga0075362_10029861 3300006177 Bacteria 2352
183 Ga0075362_10037030 3300006177 Bacteria 2137
184 Ga0075367_10004842 3300006178 Bacteria 6634
185 Ga0075367_10015210 3300006178 Bacteria 4177
186 Ga0075367_10044041 3300006178 Bacteria 2614
187 Ga0075367_10060398 3300006178 Bacteria 2260
188 Ga0075369_10005989 3300006186 Bacteria 4576
189 Ga0075369_10021608 3300006186 Bacteria 2646
190 Ga0075366_10024670 3300006195 Bacteria 3507
191 Ga0075366_10050320 3300006195 Bacteria 2474
192 Ga0097621_100080158 3300006237 Bacteria 2715
193 Ga0075370_10015830 3300006353 Bacteria 4046
194 Ga0075370_10031577 3300006353 Bacteria 2957
195 Ga0075370_10041788 3300006353 Bacteria 2589
196 Ga0075370_10055339 3300006353 Bacteria 2254
197 Ga0075370_10060397 3300006353 Bacteria 2159
198 Ga0068871_100033602 3300006358 Bacteria 4063
199 Ga0068871_100138848 3300006358 Bacteria 2065
200 Ga0075428_100116410 3300006844 Bacteria 2911
201 Ga0075434_100093121 3300006871 Bacteria 3016
202 Ga0075434_100106156 3300006871 Bacteria 2818
203 Ga0075434_100148663 3300006871 Bacteria 2362
204 Ga0097620_100055449 3300006931 Bacteria 3988
205 Ga0075435_100207083 3300007076 Bacteria 1663
206 Ga0099794_10003949 3300007265 Bacteria 5752
207 Ga0099794_10005746 3300007265 Bacteria 4998
208 Ga0099794_10028555 3300007265 Bacteria 2595
209 Ga0099794_10049136 3300007265 Bacteria 2026
210 Ga0105245_10016651 3300009098 Bacteria 6419
211 Ga0105245_10033205 3300009098 Bacteria 4573
212 Ga0105245_10083753 3300009098 Bacteria 2920
213 Ga0105247_10045260 3300009101 Bacteria 2699
214 Ga0105247_10053069 3300009101 Bacteria 2500
215 Ga0105247_10075850 3300009101 Bacteria 2110
216 Ga0114129_10063938 3300009147 Bacteria 5135
217 Ga0105241_10039297 3300009174 Bacteria 3569
218 Ga0105241_10044508 3300009174 Bacteria 3364
219 Ga0105248_10034450 3300009177 Bacteria 5662
220 Ga0105248_10230216 3300009177 Bacteria 2086
221 Ga0105237_10010079 3300009545 Bacteria 10079
222 Ga0105237_10013984 3300009545 Bacteria 8399
223 Ga0105237_10029085 3300009545 Bacteria 5620
224 Ga0105237_10122154 3300009545 Bacteria 2599
225 Ga0105237_10213732 3300009545 Bacteria 1928
226 Ga0105237_10226197 3300009545 Bacteria 1871
227 Ga0105238_10013570 3300009551 Bacteria 8226
228 Ga0105238_10026716 3300009551 Bacteria 5885
229 Ga0105238_10072787 3300009551 Bacteria 3431
230 Ga0105239_10017670 3300010375 Bacteria 7890
231 Ga0105239_10068554 3300010375 Bacteria 3898
232 Ga0105239_10177259 3300010375 Bacteria 2384
233 Ga0105246_10054504 3300011119 Bacteria 2756
234 Ga0105246_10056178 3300011119 Bacteria 2720
235 Ga0105246_10164398 3300011119 Bacteria 1694
236 Ga0157370_10087808 3300013104 Bacteria 2921
237 Ga0157370_10148214 3300013104 Bacteria 2184
238 Ga0157369_10005375 3300013105 Bacteria 14913
239 Ga0157369_10014657 3300013105 Bacteria 8845
240 Ga0157369_10282962 3300013105 Bacteria 1727
241 Ga0157369_10294928 3300013105 Bacteria 1688
242 Ga0157378_10031055 3300013297 Bacteria 4718
243 Ga0157378_10061966 3300013297 Bacteria 3340
244 Ga0157378_10368077 3300013297 Bacteria 1408
245 Ga0163162_10010924 3300013306 Bacteria 8839
246 Ga0163162_10049707 3300013306 Bacteria 4203
247 Ga0163162_10065440 3300013306 Bacteria 3682
248 Ga0163162_10082130 3300013306 Bacteria 3294
249 Ga0163162_10094221 3300013306 Bacteria 3080
250 Ga0157372_10086216 3300013307 Bacteria 3563
251 Ga0157372_10094769 3300013307 Bacteria 3400
252 Ga0157372_10188233 3300013307 Bacteria 2390
253 Ga0157375_10016474 3300013308 Bacteria 6643
254 Ga0157375_10288107 3300013308 Bacteria 1805
255 Ga0163163_10049831 3300014325 Bacteria 4122
256 Ga0163163_10087464 3300014325 Bacteria 3126
257 Ga0157380_10036675 3300014326 Bacteria 3795
258 Ga0157377_10071495 3300014745 Bacteria 2006
259 Ga0157379_10011266 3300014968 Bacteria 7792
260 Ga0157376_10011205 3300014969 Bacteria 6598
261 Ga0206352_10142119 3300020078 Bacteria 1884
262 Ga0206354_11702451 3300020081 Bacteria 2114
263 Ga0213872_10036505 3300021361 Bacteria 2246
264 Ga0213876_10005609 3300021384 Bacteria 6889
265 Ga0209758_1004101 3300025297 Bacteria 12486
266 Ga0209758_1006382 3300025297 Bacteria 8513
267 Ga0209758_1008259 3300025297 Bacteria 6814
268 Ga0209758_1011810 3300025297 Bacteria 4992
269 Ga0207692_10014434 3300025898 Bacteria 3451
270 Ga0207710_10012956 3300025900 Bacteria 3512
271 Ga0207688_10010295 3300025901 Bacteria 5090
272 Ga0207699_10023842 3300025906 Bacteria 3336
273 Ga0207699_10038727 3300025906 Bacteria 2735
274 Ga0207645_10028620 3300025907 Bacteria 3596
275 Ga0207643_10038000 3300025908 Bacteria 2703
276 Ga0207684_10036703 3300025910 Bacteria 4159
277 Ga0207684_10209229 3300025910 Bacteria 1683
278 Ga0207654_10023046 3300025911 Bacteria 3331
279 Ga0207654_10059400 3300025911 Bacteria 2230
280 Ga0207707_10004663 3300025912 Bacteria 12038
281 Ga0207707_10006506 3300025912 Bacteria 10204
282 Ga0207707_10010189 3300025912 Bacteria 8158
283 Ga0207671_10011065 3300025914 Bacteria 7383
284 Ga0207693_10004006 3300025915 Bacteria 12520
285 Ga0207693_10015164 3300025915 Bacteria 6185
286 Ga0207693_10018708 3300025915 Bacteria 5514
287 Ga0207663_10012954 3300025916 Bacteria 4522
288 Ga0207660_10054326 3300025917 Bacteria 2858
289 Ga0207657_10121189 3300025919 Bacteria 2152
290 Ga0207652_10010356 3300025921 Bacteria 7509
291 Ga0207652_10047310 3300025921 Bacteria 3674
292 Ga0207652_10067320 3300025921 Bacteria 3105
293 Ga0207694_10007778 3300025924 Bacteria 8116
294 Ga0207694_10023641 3300025924 Bacteria 4666
295 Ga0207694_10108001 3300025924 Bacteria 2211
296 Ga0207694_10119140 3300025924 Bacteria 2106
297 Ga0207650_10126106 3300025925 Bacteria 1998
298 Ga0207659_10074312 3300025926 Bacteria 2491
299 Ga0207659_10123272 3300025926 Bacteria 1989
300 Ga0207687_10014547 3300025927 Bacteria 5151
301 Ga0207687_10096338 3300025927 Bacteria 2168
302 Ga0207700_10006403 3300025928 Bacteria 7104
303 Ga0207700_10015209 3300025928 Bacteria 5065
304 Ga0207700_10024881 3300025928 Bacteria 4150
305 Ga0207664_10060684 3300025929 Bacteria 3015
306 Ga0207664_10091822 3300025929 Bacteria 2491
307 Ga0207664_10122774 3300025929 Bacteria 2176
308 Ga0207644_10057258 3300025931 Bacteria 2814
309 Ga0207644_10061913 3300025931 Bacteria 2712
310 Ga0207706_10021052 3300025933 Bacteria 5858
311 Ga0207706_10146069 3300025933 Bacteria 2080
312 Ga0207709_10030666 3300025935 Bacteria 3130
313 Ga0207709_10109817 3300025935 Bacteria 1842
314 Ga0207670_10129113 3300025936 Bacteria 1849
315 Ga0207704_10115290 3300025938 Bacteria 1826
316 Ga0207665_10002151 3300025939 Bacteria 13341
317 Ga0207665_10017860 3300025939 Bacteria 4663
318 Ga0207665_10046553 3300025939 Bacteria 2906
319 Ga0207711_10046526 3300025941 Bacteria 3708
320 Ga0207711_10066767 3300025941 Bacteria 3111
321 Ga0207689_10036732 3300025942 Bacteria 4066
322 Ga0207689_10122768 3300025942 Bacteria 2136
323 Ga0207661_10000171 3300025944 Bacteria 41708
324 Ga0207661_10003747 3300025944 Bacteria 10589
325 Ga0207661_10006281 3300025944 Bacteria 8403
326 Ga0207661_10028618 3300025944 Bacteria 4269
327 Ga0207679_10190433 3300025945 Bacteria 1705
328 Ga0207667_10068594 3300025949 Bacteria 3692
329 Ga0207667_10078632 3300025949 Bacteria 3418
330 Ga0207667_10082096 3300025949 Bacteria 3339
331 Ga0207668_10012639 3300025972 Bacteria 5174
332 Ga0207668_10021506 3300025972 Bacteria 4114
333 Ga0207668_10025172 3300025972 Bacteria 3848
334 Ga0207640_10120315 3300025981 Bacteria 1880
335 Ga0207677_10053542 3300026023 Bacteria 2748
336 Ga0207677_10090498 3300026023 Bacteria 2224
337 Ga0207703_10010777 3300026035 Bacteria 7132
338 Ga0207703_10020853 3300026035 Bacteria 5127
339 Ga0207639_10022921 3300026041 Bacteria 4503
340 Ga0207639_10053986 3300026041 Bacteria 3069
341 Ga0207639_10099144 3300026041 Bacteria 2350
342 Ga0207678_10005830 3300026067 Bacteria 10978
343 Ga0207678_10020913 3300026067 Bacteria 5736
344 Ga0207678_10034642 3300026067 Bacteria 4397
345 Ga0207708_10026144 3300026075 Bacteria 4416
346 Ga0207702_10020557 3300026078 Bacteria 5464
347 Ga0207641_10104967 3300026088 Bacteria 2495
348 Ga0207641_10125254 3300026088 Bacteria 2299
349 Ga0207676_10056786 3300026095 Bacteria 3079
350 Ga0207676_10072677 3300026095 Bacteria 2765
351 Ga0207674_10062863 3300026116 Bacteria 3749
352 Ga0207674_10117732 3300026116 Bacteria 2627
353 Ga0207674_10129104 3300026116 Bacteria 2492
354 Ga0207675_100053448 3300026118 Bacteria 3769
355 Ga0207683_10053897 3300026121 Bacteria 3527
356 Ga0207683_10201931 3300026121 Bacteria 1807
357 Ga0207698_10068311 3300026142 Bacteria 2806
358 Ga0209588_1005174 3300027671 Bacteria 3721
359 Ga0207428_10132642 3300027907 Bacteria 1905
360 Ga0268266_10001870 3300028379 Bacteria 23767
361 Ga0268266_10008300 3300028379 Bacteria 9253
362 Ga0268266_10009648 3300028379 Bacteria 8489
363 Ga0268266_10027619 3300028379 Bacteria 4824
364 Ga0268266_10043930 3300028379 Bacteria 3819
365 Ga0268266_10088504 3300028379 Bacteria 2710
366 Ga0268266_10173292 3300028379 Bacteria 1959
367 Ga0268265_10013626 3300028380 Bacteria 5528
368 Ga0268265_10029721 3300028380 Bacteria 3927
369 Ga0268265_10076032 3300028380 Bacteria 2633
370 Ga0268264_10000377 3300028381 Bacteria 65413
371 Ga0268264_10096767 3300028381 Bacteria 2557
372 Ga0307517_10000124 3300028786 Bacteria 115570
373 Ga0307517_10002371 3300028786 Bacteria 30326
374 Ga0307515_10031012 3300028794 Bacteria 8941
375 Ga0307515_10062161 3300028794 Bacteria 5281
376 Ga0307513_10085449 3300031456 Bacteria 3238
377 Ga0307509_10073582 3300031507 Bacteria 3557
378 Ga0307509_10087891 3300031507 Bacteria 3191
379 Ga0307509_10160909 3300031507 Bacteria 2143
380 Ga0307509_10165170 3300031507 Bacteria 2104
381 Ga0307508_10000378 3300031616 Bacteria 53801
382 Ga0307508_10071026 3300031616 Bacteria 3055
383 Ga0307516_10057713 3300031730 Bacteria 3780
384 Ga0307516_10068101 3300031730 Bacteria 3429
385 Ga0307516_10158268 3300031730 Bacteria 2018
386 Ga0307507_10092635 3300033179 Bacteria 2578
387 Ga0307510_10065088 3300033180 Bacteria 3696
388 Ga0307510_10120596 3300033180 Bacteria 2329
389 Ga0315911_1000107 3300033442 Bacteria 10549
390 Ga0373936_0073335 3300035113 Bacteria 1415
391 Ga0373946_0045403 3300035171 Bacteria 1818
392 Ga0373935_0014976 3300035692 Bacteria 4683
393 Ga0373927_0032196 3300035695 Bacteria 3414
394 Ga0373927_0041000 3300035695 Bacteria 3003
395 Ga0373927_0074996 3300035695 Bacteria 2190
396 Ga0373933_0003692 3300035724 Bacteria 8467
397 Ga0373933_0043451 3300035724 Bacteria 2659
398 Ga0373947_0025828 3300035725 Bacteria 3427
399 Ga0310104_01295 3300036242 Bacteria 1971
400 Ga0265778_002400 3300036457 Bacteria 1804
401 Ga0265778_002442 3300036457 Bacteria 1792
402 Ga0373925_0018250 3300037068 Bacteria 5098
403 Ga0373925_0065559 3300037068 Bacteria 2736
404 Ga0395900_0046210 3300037418 Bacteria 4484
405 Ga0395898_0067179 3300037466 Bacteria 3472
406 Ga0395898_0256718 3300037466 Bacteria 1667
407 Ga0395905_0034856 3300037471 Bacteria 4725
408 Ga0395905_0113359 3300037471 Bacteria 2547
409 Ga0395905_0215484 3300037471 Bacteria 1798
410 Ga0436364_0780655 3300037853 Bacteria 3338
411 Ga0436365_1238998 3300039437 Bacteria 17352
412 Ga0436360_0310426 3300039438 Bacteria 25508
413 Ga0436361_0764431 3300039447 Bacteria 9266
414 Ga0436361_0887955 3300039447 Bacteria 6578
415 Ga0436361_0895325 3300039447 Bacteria 4991
416 Ga0436361_1022339 3300039447 Bacteria 20890
417 Ga0436361_1134910 3300039447 Bacteria 2690
418 Ga0436363_0555836 3300039450 Bacteria 2045
419 Ga0466966_0069353 3300044684 Bacteria 2212
420 Ga0466966_0081513 3300044684 Bacteria 2015
421 Ga0466967_0191235 3300045976 Bacteria 1934
422 Ga0495603_0001480 3300046455 Bacteria 13683
423 Ga0495603_0013390 3300046455 Bacteria 4962
424 Ga0495603_0025163 3300046455 Bacteria 3599
425 Ga0495603_0072103 3300046455 Bacteria 2029
426 Ga0495629_0025937 3300046459 Bacteria 4164
427 Ga0495638_0070041 3300046460 Bacteria 2148
428 Ga0495580_0027220 3300046472 Bacteria 4161
429 Ga0495580_0029423 3300046472 Bacteria 3987
430 Ga0495582_0001176 3300046473 Bacteria 14741
431 Ga0495662_0011346 3300046476 Bacteria 4355
432 Ga0495594_0009072 3300046499 Bacteria 5133
433 Ga0495606_0005580 3300046507 Bacteria 11983
434 Ga0495632_0048886 3300046519 Bacteria 2092
435 Ga0495648_0002980 3300046524 Bacteria 15193
436 Ga0495648_0003683 3300046524 Bacteria 13395
437 Ga0495665_0020666 3300046531 Bacteria 3535
438 Ga0495640_0013114 3300046533 Bacteria 6308
439 Ga0495640_0047416 3300046533 Bacteria 2974
440 Ga0495597_0077441 3300046542 Bacteria 1425
441 Ga0495622_0028125 3300046557 Bacteria 2625
442 Ga0495622_0043688 3300046557 Bacteria 2083
443 Ga0495668_0064767 3300046616 Bacteria 2012
444 Ga0495634_0028011 3300046642 Bacteria 3914
445 Ga0495625_0105197 3300046660 Bacteria 1934
446 Ga0495635_0054809 3300046663 Bacteria 2746
447 Ga0495669_0046232 3300046684 Bacteria 1942
448 Ga0495581_0003049 3300047315 Bacteria 9597
449 Ga0495581_0072108 3300047315 Bacteria 1998
450 Ga0495674_0027629 3300047319 Bacteria 5183
451 Ga0495672_0027214 3300047320 Bacteria 3636
452 Ga0495672_0033263 3300047320 Bacteria 3196
453 Ga0495676_0077184 3300047321 Bacteria 2541
454 Ga0495673_0015144 3300047469 Bacteria 3983
455 Ga0495686_0022329 3300047472 Bacteria 4188
456 Ga0495686_0026723 3300047472 Bacteria 3776
457 Ga0495593_0002569 3300047673 Bacteria 10905
458 Ga0495593_0015493 3300047673 Bacteria 4316
459 Ga0496101_0024385 3300048904 Bacteria 4186
460 Ga0496101_0123097 3300048904 Bacteria 1963
461 Ga0496102_0012643 3300048905 Bacteria 7310
462 Ga0496102_0174711 3300048905 Bacteria 2022
463 Ga0496104_0193102 3300048907 Bacteria 1948
464 Ga0496105_0032452 3300048908 Bacteria 4285
465 Ga0496106_0035055 3300048909 Bacteria 3750
466 Ga0496106_0056585 3300048909 Bacteria 2965
467 Ga0496108_0022398 3300048911 Bacteria 5192
468 Ga0496108_0049573 3300048911 Bacteria 3512
469 Ga0496108_0070379 3300048911 Bacteria 2952
470 Ga0496109_0056899 3300048912 Bacteria 3568
471 Ga0496109_0111608 3300048912 Bacteria 2542
472 Ga0496110_0009242 3300048913 Bacteria 7965
473 Ga0496110_0160464 3300048913 Bacteria 2038
474 Ga0496112_0000004 3300048915 Bacteria 553294
475 Ga0496112_0071005 3300048915 Bacteria 3441
476 Ga0496112_0077051 3300048915 Bacteria 3297
477 Ga0496113_0049652 3300048916 Bacteria 3125
478 Ga0496113_0126331 3300048916 Bacteria 2003
479 Ga0496113_0136779 3300048916 Bacteria 1925
480 Ga0496115_0001685 3300048918 Bacteria 15874
481 Ga0496117_0013369 3300048920 Bacteria 7165
482 Ga0496118_0006071 3300048921 Bacteria 13446
483 Ga0496119_0023800 3300048922 Bacteria 4330
484 Ga0496121_0000091 3300048924 Bacteria 216685
485 Ga0496121_0003703 3300048924 Bacteria 21450
486 Ga0496121_0004207 3300048924 Bacteria 19640
487 Ga0496121_0021849 3300048924 Bacteria 6248
488 Ga0496121_0022999 3300048924 Bacteria 6021
489 Ga0496121_0033754 3300048924 Bacteria 4623
490 Ga0496121_0044282 3300048924 Bacteria 3841
491 Ga0496121_0068856 3300048924 Bacteria 2860
492 Ga0496121_0075127 3300048924 Bacteria 2701
493 Ga0496121_0095936 3300048924 Bacteria 2303
494 Ga0496121_0101245 3300048924 Bacteria 2222
495 Ga0496121_0113208 3300048924 Bacteria 2065
496 Ga0496122_0013492 3300048925 Bacteria 7994
497 Ga0496122_0017056 3300048925 Bacteria 6817
498 Ga0496123_0056370 3300048926 Bacteria 2569
499 Ga0496124_0009503 3300048927 Bacteria 10006
500 Ga0496124_0132238 3300048927 Bacteria 1981
501 Ga0496125_0047655 3300048928 Bacteria 3581
502 Ga0496126_0009714 3300048929 Bacteria 10191
503 Ga0496126_0011356 3300048929 Bacteria 9233
504 Ga0496126_0017288 3300048929 Bacteria 7187
505 Ga0496126_0019884 3300048929 Bacteria 6602
506 Ga0496126_0021610 3300048929 Bacteria 6283
507 Ga0496126_0029335 3300048929 Bacteria 5226
508 Ga0496126_0033976 3300048929 Bacteria 4795
509 Ga0496126_0037235 3300048929 Bacteria 4541
510 Ga0496126_0054139 3300048929 Bacteria 3636
511 Ga0496126_0069559 3300048929 Bacteria 3139
512 Ga0496126_0074891 3300048929 Bacteria 3005
513 Ga0496126_0118486 3300048929 Bacteria 2298
514 Ga0496126_0145143 3300048929 Bacteria 2039
515 Ga0501047_0204884 3300049581 Bacteria 1832
516 Ga0501080_0110669 3300049742 Bacteria 2545
517 Ga0501044_0119607 3300049823 Bacteria 2636
518 nmdc:mga03683_27556_c1 3300050489 Bacteria 2251
519 nmdc:mga03n38_19194_c1 3300050490 Bacteria 2712
520 nmdc:mga03n38_29732_c1 3300050490 Bacteria 2289
521 nmdc:mga00v17_64304_c1 3300050491 Bacteria 2261
522 nmdc:mga00v17_74793_c1 3300050491 Bacteria 2106
523 nmdc:mga0yw44_17827_c1 3300050492 Bacteria 3874
524 nmdc:mga0yw44_29044_c1 3300050492 Bacteria 3188
525 nmdc:mga0yw44_63306_c1 3300050492 Bacteria 2274
526 nmdc:mga0yw44_66090_c1 3300050492 Bacteria 2231
527 nmdc:mga0yw44_75539_c1 3300050492 Bacteria 2101
528 nmdc:mga0yw44_8648_c1 3300050492 Bacteria 5088
529 nmdc:mga0k408_30185_c1 3300050493 Bacteria 3090
530 nmdc:mga0k408_38031_c1 3300050493 Bacteria 2763
531 nmdc:mga0k408_55980_c1 3300050493 Bacteria 2288
532 nmdc:mga0k408_67688_c1 3300050493 Bacteria 2081
533 nmdc:mga0k408_74731_c1 3300050493 Bacteria 1980
534 nmdc:mga0k408_8355_c1 3300050493 Bacteria 5556
535 nmdc:mga06z11_13126_c1 3300050494 Bacteria 3627
536 nmdc:mga06z11_68657_c1 3300050494 Bacteria 1869
537 nmdc:mga04h51_7701_c1 3300050495 Bacteria 2854
538 nmdc:mga07m45_34756_c1 3300050496 Bacteria 2802
539 nmdc:mga07m45_39045_c1 3300050496 Bacteria 2652
540 nmdc:mga07m45_4727_c1 3300050496 Bacteria 6687
541 nmdc:mga07m45_70150_c1 3300050496 Bacteria 1993
542 nmdc:mga05p37_157090_c1 3300050507 Bacteria 2779
543 nmdc:mga0rr50_114045_c1 3300050513 Bacteria 2142
544 nmdc:mga0sz30_15384_c1 3300050516 Bacteria 3023
545 nmdc:mga0sz30_33692_c1 3300050516 Bacteria 2130
546 nmdc:mga0sz30_36945_c1 3300050516 Bacteria 2043
547 nmdc:mga0sz30_42627_c1 3300050516 Bacteria 1910
548 nmdc:mga0sz30_8449_c1 3300050516 Bacteria 3889
549 Ga0500635_0016740 3300053080 Bacteria 2185
550 Ga0500647_0013961 3300053091 Bacteria 3642
551 Ga0500566_0000048 3300053094 Bacteria 58542
552 Ga0500566_0000085 3300053094 Bacteria 46377
553 Ga0500566_0000845 3300053094 Bacteria 17472
554 Ga0500566_0005045 3300053094 Bacteria 7868
555 Ga0500566_0056416 3300053094 Bacteria 2234
556 Ga0500640_003345 3300053095 Bacteria 5575
557 Ga0500641_0007877 3300053096 Bacteria 3798
558 Ga0500641_0024446 3300053096 Bacteria 2329
559 Ga0500641_0027093 3300053096 Bacteria 2230
560 Ga0500641_0036124 3300053096 Bacteria 1975
561 Ga0500554_000433 3300053102 Bacteria 8808
562 Ga0500554_000625 3300053102 Bacteria 7190
563 Ga0500554_001199 3300053102 Bacteria 5028
564 Ga0500572_000436 3300053111 Bacteria 14664
565 Ga0500572_000526 3300053111 Bacteria 13074
566 Ga0500572_001079 3300053111 Bacteria 8044
567 Ga0500572_002202 3300053111 Bacteria 4777
568 Ga0500591_003487 3300053115 Bacteria 6698
569 Ga0500595_001063 3300053119 Bacteria 15288
570 Ga0500595_002252 3300053119 Bacteria 9775
571 Ga0500595_004049 3300053119 Bacteria 6669
572 Ga0500595_013593 3300053119 Bacteria 3115
573 Ga0500595_025935 3300053119 Bacteria 2024
574 Ga0500614_001830 3300053123 Bacteria 4918
575 Ga0500614_003295 3300053123 Bacteria 3494
576 Ga0500658_0029289 3300053134 Bacteria 2140
577 Ga0500559_0001740 3300053136 Bacteria 11945
578 Ga0500559_0005234 3300053136 Bacteria 5978
579 Ga0500559_0005512 3300053136 Bacteria 5819
580 Ga0500559_0012412 3300053136 Bacteria 3621
581 Ga0500559_0013648 3300053136 Bacteria 3437
582 Ga0500577_0011120 3300053142 Bacteria 2674
583 Ga0500589_025746 3300053147 Bacteria 2727
584 Ga0500603_000041 3300053150 Bacteria 30524
585 Ga0500603_000063 3300053150 Bacteria 24913
586 Ga0500603_000326 3300053150 Bacteria 12455
587 Ga0500603_002212 3300053150 Bacteria 4287
588 Ga0500622_0015994 3300053156 Bacteria 4013
589 Ga0500630_000339 3300053159 Bacteria 19545
590 Ga0500630_001914 3300053159 Bacteria 10003
591 Ga0500638_000156 3300053162 Bacteria 13278
592 Ga0500638_001640 3300053162 Bacteria 7215
593 Ga0500639_000004 3300053163 Bacteria 216921
594 Ga0500639_000165 3300053163 Bacteria 32213
595 Ga0500639_000228 3300053163 Bacteria 27840
596 Ga0500639_019917 3300053163 Bacteria 3537
597 Ga0500637_0000157 3300053178 Bacteria 24963
598 Ga0500637_0000555 3300053178 Bacteria 14632
599 Ga0500637_0000978 3300053178 Bacteria 11648
600 Ga0500637_0012100 3300053178 Bacteria 4488
601 Ga0500637_0014538 3300053178 Bacteria 4152
602 Ga0500637_0015560 3300053178 Bacteria 4034
603 Ga0500637_0036228 3300053178 Bacteria 2769
604 Ga0500637_0042747 3300053178 Bacteria 2562
605 Ga0500637_0062812 3300053178 Bacteria 2128
606 Ga0500645_007397 3300053730 Bacteria 3826
607 Ga0500645_017026 3300053730 Bacteria 2282
608 Ga0500596_000072 3300053735 Bacteria 13655
609 Ga0500596_002779 3300053735 Bacteria 3424
610 Ga0500596_005389 3300053735 Bacteria 2258
611 Ga0500661_000059 3300055283 Bacteria 17356
612 Ga0500661_000154 3300055283 Bacteria 11794
613 Ga0500661_004069 3300055283 Bacteria 2734
614 Ga0587066_004207 3300059490 Bacteria 1753
615 Ga0587094_003020 3300059513 Bacteria 1795
616 Ga0587109_006085 3300059624 Bacteria 1765
617 Ga0587109_006166 3300059624 Bacteria 1758
618 2508540691 2508501009 Bacteria 7784016
619 2509149646 2508501128 Bacteria 8613869
620 2509153284 2508501128 Bacteria 8613869
621 2513670833 2513237098 Bacteria 9902361
622 2513672389 2513237098 Bacteria 9902361
623 2513674146 2513237098 Bacteria 9902361
624 2513676211 2513237098 Bacteria 9902361
625 2513676438 2513237098 Bacteria 9902361
626 2513676723 2513237098 Bacteria 9902361
627 2513678833 2513237098 Bacteria 9902361
628 2513679938 2513237098 Bacteria 9902361
629 2513680092 2513237098 Bacteria 9902361
630 2513695761 2513237101 Bacteria 7952346
631 2513696010 2513237101 Bacteria 7952346
632 2513718912 2513237104 Bacteria 10034502
633 2513892045 2513237141 Bacteria 8496279
634 2513894254 2513237141 Bacteria 8496279
635 2524467912 2524023210 Bacteria 9029266
636 2524469789 2524023210 Bacteria 9029266
637 2524469867 2524023210 Bacteria 9029266
638 2524470038 2524023210 Bacteria 9029266
639 2524470128 2524023210 Bacteria 9029266
640 2524471101 2524023210 Bacteria 9029266
641 2524471287 2524023210 Bacteria 9029266
642 2723845901 2721755755 Bacteria 8322773
643 2723846244 2721755755 Bacteria 8322773
644 2723847208 2721755755 Bacteria 8322773
645 2793080544
646 2793082709
647 2793084185
648 2874609454 2874604998 Bacteria 7834745
649 2874610794 2874604998 Bacteria 7834745
650 2876815549 2876808645 Bacteria 8824342
651 2879110322 2879110137 Bacteria 8907982
652 2879110324 2879110137 Bacteria 8907982
653 2879118875 2879110137 Bacteria 8907982
654 2885384342 2885383462 Bacteria 9473874
655 2885387028 2885383462 Bacteria 9473874
656 2885387667 2885383462 Bacteria 9473874
657 2885387750 2885383462 Bacteria 9473874
658 2885389603 2885383462 Bacteria 9473874
659 2885389856 2885383462 Bacteria 9473874
660 2885392356 2885383462 Bacteria 9473874
661 2889038165 2889033259 Bacteria 9099371
662 2889039312 2889033259 Bacteria 9099371
663 2903755016 2903748898 Bacteria 9972761
664 2903769056 2903768456 Bacteria 9749579
665 2903769880 2903768456 Bacteria 9749579
666 2903772384 2903768456 Bacteria 9749579
667 2903773542 2903768456 Bacteria 9749579
668 2903776066 2903768456 Bacteria 9749579
669 2903777539 2903768456 Bacteria 9749579
670 2922362047 2922361189 Bacteria 7436256
671 2922367842 2922361189 Bacteria 7436256
672 2922368538 2922361189 Bacteria 7436256
673 2922387486 2922386360 Bacteria 7017218
674 2922388185 2922386360 Bacteria 7017218
675 2922392257 2922386360 Bacteria 7017218
676 8006968419 8006964411 Bacteria 8966052
677 8006968682 8006964411 Bacteria 8966052
678 8006991182 8006984368 Bacteria 9651211
679 8006994855 8006994254 Bacteria 8309700
680 8006996336 8006994254 Bacteria 8309700
681 8006999963 8006994254 Bacteria 8309700
682 8019628778 8019619141 Bacteria 9218857
683 8019664150 8019659431 Bacteria 8577854
684 8019678179 8019668869 Bacteria 8791617
685 8056677535 8056673599 Bacteria 7871253
686 8056677536 8056673599 Bacteria 7871253
687 8056680379 8056673599 Bacteria 7871253
688 8056681431 8056681323 Bacteria 8472857
689 8056683039 8056681323 Bacteria 8472857
690 8056684942 8056681323 Bacteria 8472857
691 8056685103 8056681323 Bacteria 8472857
692 8056688642 8056681323 Bacteria 8472857
693 8056689503 8056681323 Bacteria 8472857
694 Ga0099794_10024386
695 Ga0006759J45824_1014111
696 JGI25406J46586_10000006
697 JGI25406J46586_10016308
698 JGI25153J46596_10003035
699 JGI25153J46596_10005756
700 rootH2_10091315
701 rootH1_10017865
702 Ga0007410J51695_1029247
703 Ga0007409J51694_1011648
704 Ga0007409J51694_1017406
705 Ga0007409J51694_1034979
706 Ga0007416J51690_1019111
707 JGI25404J52841_10000143
708 JGI25404J52841_10000958
709 JGI25404J52841_10001663
710 JGI25404J52841_10002240
711 JGI25404J52841_10002994
712 JGI25404J52841_10003961
713 JGI25404J52841_10004171
714 JGI25404J52841_10004443
715 JGI25404J52841_10005004
716 JGI25404J52841_10006428
717 JGI25404J52841_10006984
718 Ga0058863_10061770
719 Ga0058862_12142271
720 Ga0070683_100000231
721 Ga0070683_100012503
722 Ga0070683_100053358
723 Ga0070683_100079179
724 Ga0070670_100060074
725 Ga0068869_100030039
726 Ga0068869_100044014
727 Ga0070680_100029259
728 Ga0070680_100030038
729 Ga0070682_100042753
730 Ga0068868_100011161
731 Ga0070668_100036165
732 Ga0070668_100070924
733 Ga0070668_100106641
734 Ga0070668_100156005
735 Ga0070668_100156354
736 Ga0070671_100020925
737 Ga0070671_100037298
738 Ga0070671_100065630
739 Ga0070674_100084176
740 Ga0070709_10000587
741 Ga0070709_10008074
742 Ga0070714_100027623
743 Ga0070714_100044894
744 Ga0070714_100076222
745 Ga0070713_100013919
746 Ga0070713_100016206
747 Ga0070713_100021072
748 Ga0070710_10000736
749 Ga0070663_100008935
750 Ga0070663_100012244
751 Ga0070663_100057736
752 Ga0070663_100085278
753 Ga0070678_100040810
754 Ga0070678_100110316
755 Ga0070681_10092689
756 Ga0070681_10116519
757 Ga0070681_10161296
758 Ga0070681_10254481
759 Ga0070698_100031556
760 Ga0070698_100036479
761 Ga0070698_100100522
762 Ga0070679_100039201
763 Ga0070679_100111671
764 Ga0070679_100149731
765 Ga0070684_100001996
766 Ga0070684_100015846
767 Ga0070697_100010345
768 Ga0068853_100018719
769 Ga0068853_100159716
770 Ga0070695_100036684
771 Ga0070696_100050450
772 Ga0070693_100030832
773 Ga0070693_100056068
774 Ga0070693_100070802
775 Ga0070665_100004023
776 Ga0070665_100022114
777 Ga0070665_100033585
778 Ga0070665_100038775
779 Ga0070665_100044051
780 Ga0070665_100071396
781 Ga0070665_100087921
782 Ga0070665_100091041
783 Ga0070665_100141955
784 Ga0070665_100232560
785 Ga0068855_100032505
786 Ga0068855_100042520
787 Ga0068855_100045274
788 Ga0068855_100091001
789 Ga0068857_100047726
790 Ga0068856_100024638
791 Ga0070702_100026773
792 Ga0068859_100055447
793 Ga0068864_100024549
794 Ga0068864_100030025
795 Ga0068866_10051271
796 Ga0068861_100070570
797 Ga0068870_10054092
798 Ga0068858_100022369
799 Ga0068860_100007304
800 Ga0068860_100053172
801 Ga0068860_100065183
802 Ga0068860_100247149
803 Ga0068862_100016189
804 Ga0068862_100024231
805 Ga0068862_100031482
806 Ga0068862_100078211
807 Ga0081455_10001818
808 Ga0081455_10001871
809 Ga0081455_10004903
810 Ga0081455_10008395
811 Ga0081455_10009237
812 Ga0081455_10009607
813 Ga0081455_10016182
814 Ga0081455_10022880
815 Ga0081455_10023631
816 Ga0081455_10033823
817 Ga0081455_10054609
818 Ga0081455_10060536
819 Ga0081455_10077335
820 Ga0081455_10103122
821 Ga0081538_10039562
822 Ga0081540_1000248
823 Ga0081540_1000423
824 Ga0081540_1000829
825 Ga0081540_1001277
826 Ga0081540_1001791
827 Ga0081540_1002606
828 Ga0081540_1002762
829 Ga0081540_1003475
830 Ga0081540_1003978
831 Ga0081540_1004440
832 Ga0081540_1005366
833 Ga0081540_1005698
834 Ga0081540_1005953
835 Ga0081540_1006177
836 Ga0081540_1006649
837 Ga0081540_1008540
838 Ga0081540_1012096
839 Ga0081540_1013758
840 Ga0081540_1014517
841 Ga0081540_1014531
842 Ga0081540_1018687
843 Ga0081540_1022075
844 Ga0081540_1022779
845 Ga0081540_1027520
846 Ga0081540_1028440
847 Ga0081540_1030104
848 Ga0081540_1032184
849 Ga0081540_1033414
850 Ga0081540_1053552
851 Ga0081540_1056342
852 Ga0081539_10000176
853 Ga0081539_10000231
854 Ga0081539_10000530
855 Ga0081539_10002526
856 Ga0081539_10016768
857 Ga0081539_10019177
858 Ga0081539_10020869
859 Ga0070717_10017525
860 Ga0070717_10074420
861 Ga0075365_10078357
862 Ga0075365_10125816
863 Ga0075368_10029780
864 Ga0075363_100012252
865 Ga0075363_100021078
866 Ga0075363_100034947
867 Ga0075363_100050533
868 Ga0075363_100084816
869 Ga0075364_10019035
870 Ga0075364_10042916
871 Ga0070716_100001786
872 Ga0070712_100002881
873 Ga0070712_100032044
874 Ga0075362_10003353
875 Ga0075362_10029861
876 Ga0075362_10037030
877 Ga0075367_10004842
878 Ga0075367_10015210
879 Ga0075367_10044041
880 Ga0075367_10060398
881 Ga0075369_10005989
882 Ga0075369_10021608
883 Ga0075366_10024670
884 Ga0075366_10050320
885 Ga0097621_100080158
886 Ga0075370_10015830
887 Ga0075370_10031577
888 Ga0075370_10041788
889 Ga0075370_10055339
890 Ga0075370_10060397
891 Ga0068871_100033602
892 Ga0068871_100138848
893 Ga0075428_100116410
894 Ga0075434_100093121
895 Ga0075434_100106156
896 Ga0075434_100148663
897 Ga0097620_100055449
898 Ga0075435_100207083
899 Ga0099794_10003949
900 Ga0099794_10005746
901 Ga0099794_10028555
902 Ga0099794_10049136
903 Ga0105245_10016651
904 Ga0105245_10033205
905 Ga0105245_10083753
906 Ga0105247_10045260
907 Ga0105247_10053069
908 Ga0105247_10075850
909 Ga0114129_10063938
910 Ga0105241_10039297
911 Ga0105241_10044508
912 Ga0105248_10034450
913 Ga0105248_10230216
914 Ga0105237_10010079
915 Ga0105237_10013984
916 Ga0105237_10029085
917 Ga0105237_10122154
918 Ga0105237_10213732
919 Ga0105237_10226197
920 Ga0105238_10013570
921 Ga0105238_10026716
922 Ga0105238_10072787
923 Ga0105239_10017670
924 Ga0105239_10068554
925 Ga0105239_10177259
926 Ga0105246_10054504
927 Ga0105246_10056178
928 Ga0105246_10164398
929 Ga0157370_10087808
930 Ga0157370_10148214
931 Ga0157369_10005375
932 Ga0157369_10014657
933 Ga0157369_10282962
934 Ga0157369_10294928
935 Ga0157378_10031055
936 Ga0157378_10061966
937 Ga0157378_10368077
938 Ga0163162_10010924
939 Ga0163162_10049707
940 Ga0163162_10065440
941 Ga0163162_10082130
942 Ga0163162_10094221
943 Ga0157372_10086216
944 Ga0157372_10094769
945 Ga0157372_10188233
946 Ga0157375_10016474
947 Ga0157375_10288107
948 Ga0163163_10049831
949 Ga0163163_10087464
950 Ga0157380_10036675
951 Ga0157377_10071495
952 Ga0157379_10011266
953 Ga0157376_10011205
954 Ga0206352_10142119
955 Ga0206354_11702451
956 Ga0213872_10036505
957 Ga0213876_10005609
958 Ga0209758_1004101
959 Ga0209758_1006382
960 Ga0209758_1008259
961 Ga0209758_1011810
962 Ga0207692_10014434
963 Ga0207710_10012956
964 Ga0207688_10010295
965 Ga0207699_10023842
966 Ga0207699_10038727
967 Ga0207645_10028620
968 Ga0207643_10038000
969 Ga0207684_10036703
970 Ga0207684_10209229
971 Ga0207654_10023046
972 Ga0207654_10059400
973 Ga0207707_10004663
974 Ga0207707_10006506
975 Ga0207707_10010189
976 Ga0207671_10011065
977 Ga0207693_10004006
978 Ga0207693_10015164
979 Ga0207693_10018708
980 Ga0207663_10012954
981 Ga0207660_10054326
982 Ga0207657_10121189
983 Ga0207652_10010356
984 Ga0207652_10047310
985 Ga0207652_10067320
986 Ga0207694_10007778
987 Ga0207694_10023641
988 Ga0207694_10108001
989 Ga0207694_10119140
990 Ga0207650_10126106
991 Ga0207659_10074312
992 Ga0207659_10123272
993 Ga0207687_10014547
994 Ga0207687_10096338
995 Ga0207700_10006403
996 Ga0207700_10015209
997 Ga0207700_10024881
998 Ga0207664_10060684
999 Ga0207664_10091822
1000 Ga0207664_10122774
1001 Ga0207644_10057258
1002 Ga0207644_10061913
1003 Ga0207706_10021052
1004 Ga0207706_10146069
1005 Ga0207709_10030666
1006 Ga0207709_10109817
1007 Ga0207670_10129113
1008 Ga0207704_10115290
1009 Ga0207665_10002151
1010 Ga0207665_10017860
1011 Ga0207665_10046553
1012 Ga0207711_10046526
1013 Ga0207711_10066767
1014 Ga0207689_10036732
1015 Ga0207689_10122768
1016 Ga0207661_10000171
1017 Ga0207661_10003747
1018 Ga0207661_10006281
1019 Ga0207661_10028618
1020 Ga0207679_10190433
1021 Ga0207667_10068594
1022 Ga0207667_10078632
1023 Ga0207667_10082096
1024 Ga0207668_10012639
1025 Ga0207668_10021506
1026 Ga0207668_10025172
1027 Ga0207640_10120315
1028 Ga0207677_10053542
1029 Ga0207677_10090498
1030 Ga0207703_10010777
1031 Ga0207703_10020853
1032 Ga0207639_10022921
1033 Ga0207639_10053986
1034 Ga0207639_10099144
1035 Ga0207678_10005830
1036 Ga0207678_10020913
1037 Ga0207678_10034642
1038 Ga0207708_10026144
1039 Ga0207702_10020557
1040 Ga0207641_10104967
1041 Ga0207641_10125254
1042 Ga0207676_10056786
1043 Ga0207676_10072677
1044 Ga0207674_10062863
1045 Ga0207674_10117732
1046 Ga0207674_10129104
1047 Ga0207675_100053448
1048 Ga0207683_10053897
1049 Ga0207683_10201931
1050 Ga0207698_10068311
1051 Ga0209588_1005174
1052 Ga0207428_10132642
1053 Ga0268266_10001870
1054 Ga0268266_10008300
1055 Ga0268266_10009648
1056 Ga0268266_10027619
1057 Ga0268266_10043930
1058 Ga0268266_10088504
1059 Ga0268266_10173292
1060 Ga0268265_10013626
1061 Ga0268265_10029721
1062 Ga0268265_10076032
1063 Ga0268264_10000377
1064 Ga0268264_10096767
1065 Ga0307517_10000124
1066 Ga0307517_10002371
1067 Ga0307515_10031012
1068 Ga0307515_10062161
1069 Ga0307513_10085449
1070 Ga0307509_10073582
1071 Ga0307509_10087891
1072 Ga0307509_10160909
1073 Ga0307509_10165170
1074 Ga0307508_10000378
1075 Ga0307508_10071026
1076 Ga0307516_10057713
1077 Ga0307516_10068101
1078 Ga0307516_10158268
1079 Ga0307507_10092635
1080 Ga0307510_10065088
1081 Ga0307510_10120596
1082 Ga0315911_1000107
1083 Ga0373936_0073335
1084 Ga0373946_0045403
1085 Ga0373935_0014976
1086 Ga0373927_0032196
1087 Ga0373927_0041000
1088 Ga0373927_0074996
1089 Ga0373933_0003692
1090 Ga0373933_0043451
1091 Ga0373947_0025828
1092 Ga0310104_01295
1093 Ga0265778_002400
1094 Ga0265778_002442
1095 Ga0373925_0018250
1096 Ga0373925_0065559
1097 Ga0395900_0046210
1098 Ga0395898_0067179
1099 Ga0395898_0256718
1100 Ga0395905_0034856
1101 Ga0395905_0113359
1102 Ga0395905_0215484
1103 Ga0436364_0780655
1104 Ga0436365_1238998
1105 Ga0436360_0310426
1106 Ga0436361_0764431
1107 Ga0436361_0887955
1108 Ga0436361_0895325
1109 Ga0436361_1022339
1110 Ga0436361_1134910
1111 Ga0436363_0555836
1112 Ga0466966_0069353
1113 Ga0466966_0081513
1114 Ga0466967_0191235
1115 Ga0495603_0001480
1116 Ga0495603_0013390
1117 Ga0495603_0025163
1118 Ga0495603_0072103
1119 Ga0495629_0025937
1120 Ga0495638_0070041
1121 Ga0495580_0027220
1122 Ga0495580_0029423
1123 Ga0495582_0001176
1124 Ga0495662_0011346
1125 Ga0495594_0009072
1126 Ga0495606_0005580
1127 Ga0495632_0048886
1128 Ga0495648_0002980
1129 Ga0495648_0003683
1130 Ga0495665_0020666
1131 Ga0495640_0013114
1132 Ga0495640_0047416
1133 Ga0495597_0077441
1134 Ga0495622_0028125
1135 Ga0495622_0043688
1136 Ga0495668_0064767
1137 Ga0495634_0028011
1138 Ga0495625_0105197
1139 Ga0495635_0054809
1140 Ga0495669_0046232
1141 Ga0495581_0003049
1142 Ga0495581_0072108
1143 Ga0495674_0027629
1144 Ga0495672_0027214
1145 Ga0495672_0033263
1146 Ga0495676_0077184
1147 Ga0495673_0015144
1148 Ga0495686_0022329
1149 Ga0495686_0026723
1150 Ga0495593_0002569
1151 Ga0495593_0015493
1152 Ga0496101_0024385
1153 Ga0496101_0123097
1154 Ga0496102_0012643
1155 Ga0496102_0174711
1156 Ga0496104_0193102
1157 Ga0496105_0032452
1158 Ga0496106_0035055
1159 Ga0496106_0056585
1160 Ga0496108_0022398
1161 Ga0496108_0049573
1162 Ga0496108_0070379
1163 Ga0496109_0056899
1164 Ga0496109_0111608
1165 Ga0496110_0009242
1166 Ga0496110_0160464
1167 Ga0496112_0000004
1168 Ga0496112_0071005
1169 Ga0496112_0077051
1170 Ga0496113_0049652
1171 Ga0496113_0126331
1172 Ga0496113_0136779
1173 Ga0496115_0001685
1174 Ga0496117_0013369
1175 Ga0496118_0006071
1176 Ga0496119_0023800
1177 Ga0496121_0000091
1178 Ga0496121_0003703
1179 Ga0496121_0004207
1180 Ga0496121_0021849
1181 Ga0496121_0022999
1182 Ga0496121_0033754
1183 Ga0496121_0044282
1184 Ga0496121_0068856
1185 Ga0496121_0075127
1186 Ga0496121_0095936
1187 Ga0496121_0101245
1188 Ga0496121_0113208
1189 Ga0496122_0013492
1190 Ga0496122_0017056
1191 Ga0496123_0056370
1192 Ga0496124_0009503
1193 Ga0496124_0132238
1194 Ga0496125_0047655
1195 Ga0496126_0009714
1196 Ga0496126_0011356
1197 Ga0496126_0017288
1198 Ga0496126_0019884
1199 Ga0496126_0021610
1200 Ga0496126_0029335
1201 Ga0496126_0033976
1202 Ga0496126_0037235
1203 Ga0496126_0054139
1204 Ga0496126_0069559
1205 Ga0496126_0074891
1206 Ga0496126_0118486
1207 Ga0496126_0145143
1208 Ga0501047_0204884
1209 Ga0501080_0110669
1210 Ga0501044_0119607
1211 nmdc:mga03683_27556_c1
1212 nmdc:mga03n38_19194_c1
1213 nmdc:mga03n38_29732_c1
1214 nmdc:mga00v17_64304_c1
1215 nmdc:mga00v17_74793_c1
1216 nmdc:mga0yw44_17827_c1
1217 nmdc:mga0yw44_29044_c1
1218 nmdc:mga0yw44_63306_c1
1219 nmdc:mga0yw44_66090_c1
1220 nmdc:mga0yw44_75539_c1
1221 nmdc:mga0yw44_8648_c1
1222 nmdc:mga0k408_30185_c1
1223 nmdc:mga0k408_38031_c1
1224 nmdc:mga0k408_55980_c1
1225 nmdc:mga0k408_67688_c1
1226 nmdc:mga0k408_74731_c1
1227 nmdc:mga0k408_8355_c1
1228 nmdc:mga06z11_13126_c1
1229 nmdc:mga06z11_68657_c1
1230 nmdc:mga04h51_7701_c1
1231 nmdc:mga07m45_34756_c1
1232 nmdc:mga07m45_39045_c1
1233 nmdc:mga07m45_4727_c1
1234 nmdc:mga07m45_70150_c1
1235 nmdc:mga05p37_157090_c1
1236 nmdc:mga0rr50_114045_c1
1237 nmdc:mga0sz30_15384_c1
1238 nmdc:mga0sz30_33692_c1
1239 nmdc:mga0sz30_36945_c1
1240 nmdc:mga0sz30_42627_c1
1241 nmdc:mga0sz30_8449_c1
1242 Ga0500635_0016740
1243 Ga0500647_0013961
1244 Ga0500566_0000048
1245 Ga0500566_0000085
1246 Ga0500566_0000845
1247 Ga0500566_0005045
1248 Ga0500566_0056416
1249 Ga0500640_003345
1250 Ga0500641_0007877
1251 Ga0500641_0024446
1252 Ga0500641_0027093
1253 Ga0500641_0036124
1254 Ga0500554_000433
1255 Ga0500554_000625
1256 Ga0500554_001199
1257 Ga0500572_000436
1258 Ga0500572_000526
1259 Ga0500572_001079
1260 Ga0500572_002202
1261 Ga0500591_003487
1262 Ga0500595_001063
1263 Ga0500595_002252
1264 Ga0500595_004049
1265 Ga0500595_013593
1266 Ga0500595_025935
1267 Ga0500614_001830
1268 Ga0500614_003295
1269 Ga0500658_0029289
1270 Ga0500559_0001740
1271 Ga0500559_0005234
1272 Ga0500559_0005512
1273 Ga0500559_0012412
1274 Ga0500559_0013648
1275 Ga0500577_0011120
1276 Ga0500589_025746
1277 Ga0500603_000041
1278 Ga0500603_000063
1279 Ga0500603_000326
1280 Ga0500603_002212
1281 Ga0500622_0015994
1282 Ga0500630_000339
1283 Ga0500630_001914
1284 Ga0500638_000156
1285 Ga0500638_001640
1286 Ga0500639_000004
1287 Ga0500639_000165
1288 Ga0500639_000228
1289 Ga0500639_019917
1290 Ga0500637_0000157
1291 Ga0500637_0000555
1292 Ga0500637_0000978
1293 Ga0500637_0012100
1294 Ga0500637_0014538
1295 Ga0500637_0015560
1296 Ga0500637_0036228
1297 Ga0500637_0042747
1298 Ga0500637_0062812
1299 Ga0500645_007397
1300 Ga0500645_017026
1301 Ga0500596_000072
1302 Ga0500596_002779
1303 Ga0500596_005389
1304 Ga0500661_000059
1305 Ga0500661_000154
1306 Ga0500661_004069
1307 Ga0587066_004207
1308 Ga0587094_003020
1309 Ga0587109_006085
1310 Ga0587109_006166
1311 2508540691
1312 2509149646
1313 2509153284
1314 2513670833
1315 2513672389
1316 2513674146
1317 2513676211
1318 2513676438
1319 2513676723
1320 2513678833
1321 2513679938
1322 2513680092
1323 2513695761
1324 2513696010
1325 2513718912
1326 2513892045
1327 2513894254
1328 2524467912
1329 2524469789
1330 2524469867
1331 2524470038
1332 2524470128
1333 2524471101
1334 2524471287
1335 2723845901
1336 2723846244
1337 2723847208
1338 2793080544
1339 2793082709
1340 2793084185
1341 2874609454
1342 2874610794
1343 2876815549
1344 2879110322
1345 2879110324
1346 2879118875
1347 2885384342
1348 2885387028
1349 2885387667
1350 2885387750
1351 2885389603
1352 2885389856
1353 2885392356
1354 2889038165
1355 2889039312
1356 2903755016
1357 2903769056
1358 2903769880
1359 2903772384
1360 2903773542
1361 2903776066
1362 2903777539
1363 2922362047
1364 2922367842
1365 2922368538
1366 2922387486
1367 2922388185
1368 2922392257
1369 8006968419
1370 8006968682
1371 8006991182
1372 8006994855
1373 8006996336
1374 8006999963
1375 8019628778
1376 8019664150
1377 8019678179
1378 8056677535
1379 8056677536
1380 8056680379
1381 8056681431
1382 8056683039
1383 8056684942
1384 8056685103
1385 8056688642
1386 8056689503

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02530

Porin_2

Porin subfamily

96

591

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
6eus-assembly2.cif.gz_E crystal structure of the outer membrane channel dcap of acinetobacter baumannii 0.8441 54 495
6eus-assembly2.cif.gz_E crystal structure of the outer membrane channel dcap of acinetobacter baumannii 0.8212 54 495
7szi-assembly1.cif.gz_A cryo-em structure of ompk36-tran mating pair stabilization proteins from carbapenem-resistant klebsiella pneumoniae 0.6875 44 495
6ehe-assembly1.cif.gz_A omptdeltal8 (loop l8 deletion mutant of ompt), an outer membrane protein of vibrio cholerae 0.6873 53 495
7szi-assembly1.cif.gz_A cryo-em structure of ompk36-tran mating pair stabilization proteins from carbapenem-resistant klebsiella pneumoniae 0.6858 44 495
ID Description Score Start End Superfamily
3uu2B00 Mainly Beta;Beta Barrel;Porin;Porin 0.6677 49 495 2.40.160.10
3uu2B00 Mainly Beta;Beta Barrel;Porin;Porin 0.6603 49 495 2.40.160.10
1e54A00 Mainly Beta;Beta Barrel;Porin;Porin 0.6194 56 495 2.40.160.10
1e54A00 Mainly Beta;Beta Barrel;Porin;Porin 0.6145 56 495 2.40.160.10
4auiC00 Mainly Beta;Beta Barrel;Porin;Porin 0.6112 56 495 2.40.160.10

Map