F477923

General Info

Members Datasets Scaffolds Average Seq Length
730 403 716 83

Family's Representative Sequence

Representative Sequence 3300031691|Ga0316579_10378930|Ga0316579_103789302
Length 98
Sequence MYSTAFCPYCIRARALLDSKGVSYRDIRIDIESQFRVEMERRSGRTSVPQIFVGDTHVGGFDDMYALERRGTLDALLRSAAPGEAAVQCNLPHPAMKE

Samples

Sample ID Description Type Environment
1 2599185299 Pantoea ananatis NFR11 Isolate Rhizoplane
2 2648501693 Pantoea ananatis B1-9 Isolate Rhizosphere
3 2684622997 Pantoea ananatis NFIX48 Isolate Rhizoplane
4 2808606414 Pantoea sp. SJZ147 Isolate Rhizosphere
5 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
6 2844528606 Pantoea sp. R-72498 v. 2 Isolate Unclassified
7 2847797336 Pantoea ananatis NN08200 Isolate Unclassified
8 2865014394 Pantoea sp. R-71966 Isolate Unclassified
9 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
10 2939602548 Pantoea dispersa 1175 Isolate Rhizosphere
11 2945951305 Pantoea agglomerans W2I1 Isolate Rhizosphere
12 2984494565 Pantoea ananatis SORGH_AS197 Isolate Aerial Root
13 2990261002 Pantoea ananatis SORGH_AS213 Isolate Aerial Root
14 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
15 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
16 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
17 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
18 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
28 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
70 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
71 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
72 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
73 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
74 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
75 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
83 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
84 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
85 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
96 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
97 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
108 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
109 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
110 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
111 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
122 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
123 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
124 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
125 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
126 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
130 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
134 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
189 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
195 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
196 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
197 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
198 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
199 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
200 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
201 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
202 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
203 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
204 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
205 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
206 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
207 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
208 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
209 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
210 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
211 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
212 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
215 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
216 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
217 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
218 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
219 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
220 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
221 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
224 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
225 3300032168 Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
227 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
228 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
229 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
230 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
231 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
234 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
235 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
236 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
237 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
238 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
239 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
240 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
241 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
242 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
243 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
244 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
245 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
246 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
247 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
248 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
249 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
250 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
251 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
252 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
253 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
254 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
255 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
256 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
257 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
258 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
259 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
260 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
261 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
262 3300042130 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 Metagenome Rhizosphere
263 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
264 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
265 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
266 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
267 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
268 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
269 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
270 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
271 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
272 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
273 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
274 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
275 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
276 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
277 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
278 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
279 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
280 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
281 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
282 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
283 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
284 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
285 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
286 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
287 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
288 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
289 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
290 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
291 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
292 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
295 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
296 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
299 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
300 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
301 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
302 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
303 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
304 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
305 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
306 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
307 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
308 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
309 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
310 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
311 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
312 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
313 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
314 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
315 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
316 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
317 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
318 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
319 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
323 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
324 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
325 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
326 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
327 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
328 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
329 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
330 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
331 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
332 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
333 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
334 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
335 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
336 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
337 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
338 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
339 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
340 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
341 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
342 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
343 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
344 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
345 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
346 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
347 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
348 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
349 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
350 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
351 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
352 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
353 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
354 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
355 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
356 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
360 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
363 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
371 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
372 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
373 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
374 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
375 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
376 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
377 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
378 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
379 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
380 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
381 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
382 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
383 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
384 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
385 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
386 3300049851 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought Metagenome Rhizosphere
387 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
388 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
389 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
390 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
391 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
392 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
393 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
394 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
395 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
396 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
397 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
398 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
399 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
400 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
401 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
402 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
403 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 96.44
Metatranscriptomes 1.64
Isolates 1.92

Biome Distribution

Category Percentage (%)
Aerial Root 0.27
Bulb 0
Endosphere 0.96
Nodule 0.27
Rhizoplane 5.07
Rhizosphere 88.77
Stem 0
Stem Tuber 0
Unclassified 4.66

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1058514 3300001977 Bacteria 549
2 JGI24739J22299_10000283 3300001989 Bacteria 17041
3 JGI24737J22298_10025257 3300001990 Bacteria 1879
4 Ga0058692_1002795 3300003856 Bacteria 5734
5 Ga0058692_1037455 3300003856 Bacteria 871
6 Ga0070658_10438177 3300005327 Bacteria 1125
7 Ga0070683_100029800 3300005329 Bacteria 4945
8 Ga0070683_100073626 3300005329 Bacteria 3189
9 Ga0070683_100709401 3300005329 Bacteria 963
10 Ga0070690_101437737 3300005330 Bacteria 556
11 Ga0070670_100394451 3300005331 Unclassified 1221
12 Ga0070670_100406116 3300005331 Bacteria 1203
13 Ga0068869_100272185 3300005334 Bacteria 1359
14 Ga0068869_100333026 3300005334 Bacteria 1234
15 Ga0070680_100122146 3300005336 Bacteria 2175
16 Ga0070680_100130580 3300005336 Bacteria 2102
17 Ga0070680_100393420 3300005336 Bacteria 1181
18 Ga0070680_100492402 3300005336 Bacteria 1048
19 Ga0070680_100847820 3300005336 Bacteria 788
20 Ga0070682_102005442 3300005337 Unclassified 509
21 Ga0070660_100006354 3300005339 Bacteria 8187
22 Ga0070660_100428559 3300005339 Bacteria 1096
23 Ga0070660_100755048 3300005339 Bacteria 817
24 Ga0070660_101265839 3300005339 Unclassified 626
25 Ga0070691_10063178 3300005341 Bacteria 1784
26 Ga0070661_100040281 3300005344 Bacteria 3408
27 Ga0070661_100061491 3300005344 Bacteria 2757
28 Ga0070661_100566336 3300005344 Bacteria 916
29 Ga0070668_100012549 3300005347 Bacteria 6310
30 Ga0070675_100112421 3300005354 Bacteria 2306
31 Ga0070675_100267290 3300005354 Bacteria 1500
32 Ga0070671_101903262 3300005355 Bacteria 529
33 Ga0070674_100145246 3300005356 Bacteria 1785
34 Ga0070673_100511073 3300005364 Bacteria 1088
35 Ga0070688_100036002 3300005365 Bacteria 3009
36 Ga0070659_100161739 3300005366 Bacteria 1831
37 Ga0070659_100261155 3300005366 Bacteria 1437
38 Ga0070667_100217408 3300005367 Bacteria 1700
39 Ga0070709_10062059 3300005434 Bacteria 2382
40 Ga0070714_100014073 3300005435 Bacteria 6420
41 Ga0070714_100213003 3300005435 Bacteria 1772
42 Ga0070714_100280213 3300005435 Unclassified 1548
43 Ga0070713_101143222 3300005436 Bacteria 753
44 Ga0070701_10809212 3300005438 Bacteria 640
45 Ga0070711_101945637 3300005439 Bacteria 517
46 Ga0070705_100401888 3300005440 Bacteria 1015
47 Ga0070705_101418814 3300005440 Bacteria 579
48 Ga0070700_100028625 3300005441 Bacteria 3316
49 Ga0070700_100260899 3300005441 Bacteria 1248
50 Ga0070694_100282629 3300005444 Bacteria 1266
51 Ga0070694_100762237 3300005444 Bacteria 791
52 Ga0070708_100208609 3300005445 Bacteria 1830
53 Ga0070708_100279249 3300005445 Bacteria 1572
54 Ga0070678_100297595 3300005456 Bacteria 1370
55 Ga0070678_100412325 3300005456 Unclassified 1176
56 Ga0070678_100614098 3300005456 Bacteria 972
57 Ga0070662_100000583 3300005457 Bacteria 22202
58 Ga0070662_100122522 3300005457 Bacteria 1994
59 Ga0070662_100658423 3300005457 Bacteria 884
60 Ga0070681_10026332 3300005458 Bacteria 5846
61 Ga0070681_10063954 3300005458 Bacteria 3651
62 Ga0070681_10757258 3300005458 Bacteria 888
63 Ga0070681_11045938 3300005458 Bacteria 737
64 Ga0068867_100100912 3300005459 Bacteria 2204
65 Ga0068867_100135245 3300005459 Unclassified 1921
66 Ga0070685_10056717 3300005466 Bacteria 2278
67 Ga0070706_100422510 3300005467 Bacteria 1240
68 Ga0070707_100034911 3300005468 Bacteria 4795
69 Ga0070699_100014492 3300005518 Bacteria 6779
70 Ga0070679_100235833 3300005530 Bacteria 1788
71 Ga0070679_100397913 3300005530 Bacteria 1323
72 Ga0070679_100637111 3300005530 Bacteria 1009
73 Ga0070679_101996008 3300005530 Unclassified 529
74 Ga0070684_100061758 3300005535 Bacteria 3280
75 Ga0070684_100553290 3300005535 Unclassified 1068
76 Ga0070684_100969609 3300005535 Bacteria 798
77 Ga0070684_101120189 3300005535 Bacteria 740
78 Ga0070684_101765697 3300005535 Bacteria 584
79 Ga0068853_100511976 3300005539 Bacteria 1134
80 Ga0070672_100296036 3300005543 Bacteria 1371
81 Ga0070672_100378321 3300005543 Bacteria 1211
82 Ga0070686_100153526 3300005544 Bacteria 1614
83 Ga0070686_100185569 3300005544 Bacteria 1481
84 Ga0070695_100205059 3300005545 Bacteria 1412
85 Ga0070695_101324058 3300005545 Bacteria 595
86 Ga0070696_101053725 3300005546 Bacteria 682
87 Ga0070693_100045777 3300005547 Bacteria 2482
88 Ga0070693_101599224 3300005547 Bacteria 512
89 Ga0070665_100025626 3300005548 Bacteria 5941
90 Ga0070665_101949515 3300005548 Unclassified 593
91 Ga0070665_102409774 3300005548 Bacteria 528
92 Ga0070704_100241704 3300005549 Bacteria 1478
93 Ga0068855_100053717 3300005563 Bacteria 4738
94 Ga0068855_100053997 3300005563 Bacteria 4725
95 Ga0068855_100360618 3300005563 Bacteria 1599
96 Ga0068855_100558565 3300005563 Unclassified 1238
97 Ga0068855_101753660 3300005563 Bacteria 632
98 Ga0070664_100063340 3300005564 Bacteria 3153
99 Ga0070664_101714905 3300005564 Bacteria 595
100 Ga0068857_100000015 3300005577 Bacteria 98770
101 Ga0068857_100000499 3300005577 Bacteria 28113
102 Ga0068857_100169924 3300005577 Bacteria 1981
103 Ga0068857_100178538 3300005577 Bacteria 1932
104 Ga0068857_101795359 3300005577 Unclassified 600
105 Ga0068854_100306953 3300005578 Bacteria 1286
106 Ga0068856_101420122 3300005614 Bacteria 708
107 Ga0068856_101538945 3300005614 Bacteria 679
108 Ga0068856_102246368 3300005614 Unclassified 554
109 Ga0070702_100670725 3300005615 Bacteria 787
110 Ga0070702_101265094 3300005615 Bacteria 598
111 Ga0068852_100067986 3300005616 Bacteria 3116
112 Ga0068852_100753921 3300005616 Bacteria 986
113 Ga0068852_101342931 3300005616 Bacteria 737
114 Ga0068852_101373980 3300005616 Bacteria 728
115 Ga0068859_100216044 3300005617 Bacteria 2005
116 Ga0068864_100535064 3300005618 Bacteria 1131
117 Ga0068866_10192567 3300005718 Bacteria 1212
118 Ga0068866_11407839 3300005718 Bacteria 510
119 Ga0068861_100216065 3300005719 Bacteria 1618
120 Ga0068861_102190785 3300005719 Bacteria 554
121 Ga0068851_10001471 3300005834 Bacteria 10326
122 Ga0068851_10293926 3300005834 Bacteria 932
123 Ga0068863_100288730 3300005841 Bacteria 1590
124 Ga0068858_100375593 3300005842 Bacteria 1364
125 Ga0068862_100701895 3300005844 Bacteria 980
126 Ga0068862_102044956 3300005844 Bacteria 584
127 Ga0081455_10003895 3300005937 Bacteria 16994
128 Ga0081455_10263195 3300005937 Bacteria 1255
129 Ga0081538_10326066 3300005981 Unclassified 559
130 Ga0075364_10426563 3300006051 Bacteria 905
131 Ga0075432_10085423 3300006058 Bacteria 1149
132 Ga0070715_10008667 3300006163 Bacteria 3553
133 Ga0075369_10046641 3300006186 Bacteria 1866
134 Ga0075366_10007989 3300006195 Bacteria 5860
135 Ga0097621_100525381 3300006237 Bacteria 1075
136 Ga0068871_101556192 3300006358 Bacteria 625
137 Ga0075428_100159732 3300006844 Bacteria 2447
138 Ga0075431_101064808 3300006847 Bacteria 774
139 Ga0075429_100310215 3300006880 Bacteria 1381
140 Ga0068865_100148510 3300006881 Bacteria 1775
141 Ga0068865_100369488 3300006881 Bacteria 1167
142 Ga0097620_100216040 3300006931 Bacteria 2005
143 Ga0079104_1000172 3300006946 Bacteria 92160
144 Ga0079104_1007460 3300006946 Bacteria 3961
145 Ga0075435_100084508 3300007076 Bacteria 2611
146 Ga0105251_10000234 3300009011 Bacteria 55844
147 Ga0105251_10191698 3300009011 Bacteria 921
148 Ga0105244_10002167 3300009036 Bacteria 15053
149 Ga0105244_10002274 3300009036 Bacteria 14607
150 Ga0105244_10002611 3300009036 Bacteria 13502
151 Ga0105244_10010141 3300009036 Bacteria 5732
152 Ga0105244_10016612 3300009036 Bacteria 4187
153 Ga0105244_10020509 3300009036 Bacteria 3670
154 Ga0105244_10048846 3300009036 Bacteria 2164
155 Ga0105244_10068461 3300009036 Bacteria 1774
156 Ga0105244_10246549 3300009036 Bacteria 833
157 Ga0105250_10000012 3300009092 Bacteria 274899
158 Ga0105250_10001974 3300009092 Bacteria 10617
159 Ga0105250_10036270 3300009092 Bacteria 1979
160 Ga0105250_10097189 3300009092 Bacteria 1201
161 Ga0105250_10113388 3300009092 Bacteria 1111
162 Ga0105240_10065139 3300009093 Bacteria 4524
163 Ga0105240_10068856 3300009093 Bacteria 4382
164 Ga0105240_10164944 3300009093 Bacteria 2628
165 Ga0105240_10563181 3300009093 Bacteria 1259
166 Ga0111539_10009131 3300009094 Bacteria 12545
167 Ga0111539_10040195 3300009094 Bacteria 5632
168 Ga0111539_10074492 3300009094 Bacteria 4000
169 Ga0111539_10683961 3300009094 Bacteria 1194
170 Ga0105245_10120739 3300009098 Bacteria 2448
171 Ga0105245_10295861 3300009098 Bacteria 1587
172 Ga0105245_11292833 3300009098 Bacteria 778
173 Ga0105245_12148494 3300009098 Bacteria 612
174 Ga0105247_10167719 3300009101 Bacteria 1458
175 Ga0114129_10095892 3300009147 Bacteria 4108
176 Ga0114129_10218064 3300009147 Bacteria 2576
177 Ga0105243_10000094 3300009148 Bacteria 101031
178 Ga0105243_10037198 3300009148 Bacteria 3781
179 Ga0105243_10163990 3300009148 Bacteria 1919
180 Ga0105243_11033305 3300009148 Bacteria 826
181 Ga0105243_11160990 3300009148 Bacteria 783
182 Ga0105242_10168080 3300009176 Bacteria 1925
183 Ga0105248_10555845 3300009177 Bacteria 1295
184 Ga0105237_10821396 3300009545 Bacteria 936
185 Ga0105237_11993251 3300009545 Bacteria 589
186 Ga0105249_10291677 3300009553 Bacteria 1633
187 Ga0105249_11035982 3300009553 Bacteria 890
188 Ga0105249_12018115 3300009553 Bacteria 649
189 Ga0105239_10398025 3300010375 Bacteria 1558
190 Ga0105239_10683216 3300010375 Bacteria 1173
191 Ga0105239_10689438 3300010375 Bacteria 1168
192 Ga0105239_10752211 3300010375 Bacteria 1116
193 Ga0105239_11853621 3300010375 Bacteria 699
194 Ga0105246_10480342 3300011119 Bacteria 1051
195 Ga0105246_10678812 3300011119 Bacteria 900
196 Ga0157373_10054022 3300013100 Bacteria 2855
197 Ga0157373_10055716 3300013100 Bacteria 2808
198 Ga0157373_10184517 3300013100 Unclassified 1469
199 Ga0157373_10242675 3300013100 Bacteria 1273
200 Ga0157373_10974196 3300013100 Unclassified 632
201 Ga0157371_10000957 3300013102 Bacteria 32068
202 Ga0157371_10005015 3300013102 Bacteria 11346
203 Ga0157371_10143320 3300013102 Bacteria 1702
204 Ga0157371_10622095 3300013102 Bacteria 804
205 Ga0157370_10002299 3300013104 Bacteria 23148
206 Ga0157370_10022195 3300013104 Bacteria 6317
207 Ga0157370_10032663 3300013104 Bacteria 5081
208 Ga0157370_10328080 3300013104 Bacteria 1411
209 Ga0157369_10159116 3300013105 Bacteria 2385
210 Ga0157369_10352439 3300013105 Bacteria 1529
211 Ga0157369_11543071 3300013105 Bacteria 675
212 Ga0157374_11642422 3300013296 Bacteria 667
213 Ga0157378_10802571 3300013297 Bacteria 967
214 Ga0157378_11624136 3300013297 Bacteria 693
215 Ga0163162_10041125 3300013306 Bacteria 4624
216 Ga0163162_10153577 3300013306 Bacteria 2421
217 Ga0163162_10503678 3300013306 Bacteria 1341
218 Ga0163162_10933063 3300013306 Bacteria 980
219 Ga0157372_10014550 3300013307 Bacteria 8418
220 Ga0157372_10020586 3300013307 Bacteria 7120
221 Ga0157372_10088962 3300013307 Bacteria 3507
222 Ga0157372_10586544 3300013307 Bacteria 1299
223 Ga0157372_11420355 3300013307 Bacteria 800
224 Ga0157372_11622289 3300013307 Bacteria 744
225 Ga0157372_11761561 3300013307 Bacteria 712
226 Ga0157375_10101127 3300013308 Bacteria 2965
227 Ga0163163_12465741 3300014325 Unclassified 578
228 Ga0157380_11983174 3300014326 Bacteria 644
229 Ga0157380_12166150 3300014326 Bacteria 619
230 Ga0182008_10297617 3300014497 Bacteria 843
231 Ga0157377_10106473 3300014745 Bacteria 1679
232 Ga0157377_11138737 3300014745 Bacteria 600
233 Ga0157379_10736474 3300014968 Bacteria 927
234 Ga0157376_11430456 3300014969 Bacteria 723
235 Ga0182006_1001057 3300015261 Bacteria 17773
236 Ga0182006_1005498 3300015261 Bacteria 6029
237 Ga0182006_1063654 3300015261 Bacteria 1385
238 Ga0182006_1121984 3300015261 Bacteria 904
239 Ga0182007_10010004 3300015262 Bacteria 3778
240 Ga0163161_10016748 3300017792 Bacteria 5122
241 Ga0163161_11633173 3300017792 Bacteria 569
242 Ga0206356_10385242 3300020070 Bacteria 1776
243 Ga0206356_11168965 3300020070 Bacteria 673
244 Ga0206355_1549020 3300020076 Unclassified 579
245 Ga0206350_10323036 3300020080 Bacteria 1013
246 Ga0206350_10563812 3300020080 Bacteria 940
247 Ga0206354_10413687 3300020081 Bacteria 3641
248 Ga0206354_11642342 3300020081 Bacteria 3072
249 Ga0206353_10122185 3300020082 Bacteria 1014
250 Ga0206353_10127771 3300020082 Bacteria 5538
251 Ga0206353_11390648 3300020082 Bacteria 1435
252 Ga0154015_1474078 3300020610 Bacteria 730
253 Ga0207696_1000237 3300025711 Bacteria 76707
254 Ga0207655_1000178 3300025728 Bacteria 113749
255 Ga0207655_1002439 3300025728 Bacteria 15111
256 Ga0207655_1006667 3300025728 Bacteria 7609
257 Ga0207713_1004567 3300025735 Bacteria 8959
258 Ga0207642_10326856 3300025899 Unclassified 897
259 Ga0207642_10716363 3300025899 Bacteria 631
260 Ga0207688_10034113 3300025901 Bacteria 2817
261 Ga0207688_10256250 3300025901 Bacteria 1061
262 Ga0207647_10657492 3300025904 Bacteria 574
263 Ga0207685_10028322 3300025905 Bacteria 1972
264 Ga0207699_10132800 3300025906 Bacteria 1626
265 Ga0207645_10051414 3300025907 Bacteria 2633
266 Ga0207643_10325438 3300025908 Bacteria 961
267 Ga0207705_10143539 3300025909 Bacteria 1784
268 Ga0207705_10351623 3300025909 Bacteria 1135
269 Ga0207705_10523876 3300025909 Bacteria 921
270 Ga0207705_10555669 3300025909 Bacteria 892
271 Ga0207707_10033821 3300025912 Bacteria 4474
272 Ga0207707_10099760 3300025912 Bacteria 2538
273 Ga0207707_10478197 3300025912 Bacteria 1064
274 Ga0207707_10576191 3300025912 Bacteria 954
275 Ga0207707_11336988 3300025912 Bacteria 574
276 Ga0207695_10125153 3300025913 Bacteria 2534
277 Ga0207695_10312295 3300025913 Bacteria 1462
278 Ga0207660_10015478 3300025917 Bacteria 5035
279 Ga0207660_10246673 3300025917 Bacteria 1409
280 Ga0207660_10267851 3300025917 Bacteria 1353
281 Ga0207660_10896771 3300025917 Bacteria 724
282 Ga0207657_10000054 3300025919 Bacteria 106767
283 Ga0207657_10006406 3300025919 Bacteria 12215
284 Ga0207657_10007679 3300025919 Bacteria 11024
285 Ga0207657_10130964 3300025919 Bacteria 2055
286 Ga0207657_10166159 3300025919 Bacteria 1790
287 Ga0207657_10462043 3300025919 Bacteria 996
288 Ga0207649_10237178 3300025920 Unclassified 1307
289 Ga0207649_10306114 3300025920 Bacteria 1163
290 Ga0207652_10130638 3300025921 Unclassified 2240
291 Ga0207652_10172795 3300025921 Bacteria 1939
292 Ga0207652_10365305 3300025921 Bacteria 1303
293 Ga0207652_10589986 3300025921 Bacteria 997
294 Ga0207652_10602307 3300025921 Bacteria 985
295 Ga0207652_10609556 3300025921 Bacteria 978
296 Ga0207652_11354912 3300025921 Bacteria 615
297 Ga0207646_10006668 3300025922 Bacteria 11903
298 Ga0207646_10045099 3300025922 Bacteria 3958
299 Ga0207694_10713851 3300025924 Bacteria 846
300 Ga0207694_11550883 3300025924 Bacteria 559
301 Ga0207650_11164700 3300025925 Bacteria 656
302 Ga0207650_11187015 3300025925 Bacteria 650
303 Ga0207659_10422882 3300025926 Bacteria 1118
304 Ga0207687_10009952 3300025927 Bacteria 6224
305 Ga0207687_10983432 3300025927 Bacteria 723
306 Ga0207687_11020091 3300025927 Bacteria 710
307 Ga0207700_10299650 3300025928 Bacteria 1388
308 Ga0207700_11024219 3300025928 Bacteria 739
309 Ga0207664_10005768 3300025929 Bacteria 8470
310 Ga0207664_10285088 3300025929 Unclassified 1450
311 Ga0207664_10934943 3300025929 Bacteria 778
312 Ga0207644_11617899 3300025931 Bacteria 543
313 Ga0207690_10195927 3300025932 Unclassified 1531
314 Ga0207706_10001654 3300025933 Bacteria 22047
315 Ga0207706_10073062 3300025933 Bacteria 3016
316 Ga0207706_11261636 3300025933 Bacteria 612
317 Ga0207709_10047161 3300025935 Bacteria 2618
318 Ga0207669_10256942 3300025937 Bacteria 1304
319 Ga0207704_10068645 3300025938 Bacteria 2236
320 Ga0207704_11672388 3300025938 Bacteria 547
321 Ga0207665_10497180 3300025939 Unclassified 942
322 Ga0207691_10151026 3300025940 Bacteria 2042
323 Ga0207691_10771282 3300025940 Unclassified 809
324 Ga0207711_11511811 3300025941 Unclassified 614
325 Ga0207689_10142791 3300025942 Bacteria 1972
326 Ga0207689_10400019 3300025942 Unclassified 1145
327 Ga0207689_10564021 3300025942 Bacteria 957
328 Ga0207661_10034427 3300025944 Bacteria 3939
329 Ga0207661_10182726 3300025944 Bacteria 1833
330 Ga0207661_10331548 3300025944 Bacteria 1370
331 Ga0207661_10807954 3300025944 Bacteria 863
332 Ga0207661_10859782 3300025944 Bacteria 835
333 Ga0207661_11928679 3300025944 Unclassified 536
334 Ga0207679_10068215 3300025945 Bacteria 2671
335 Ga0207679_10174752 3300025945 Bacteria 1772
336 Ga0207667_10177022 3300025949 Bacteria 2191
337 Ga0207667_10196213 3300025949 Bacteria 2071
338 Ga0207667_10592641 3300025949 Bacteria 1118
339 Ga0207667_11973796 3300025949 Bacteria 544
340 Ga0207651_11269751 3300025960 Bacteria 662
341 Ga0207712_10194601 3300025961 Bacteria 1603
342 Ga0207712_11308047 3300025961 Bacteria 648
343 Ga0207668_10011566 3300025972 Bacteria 5368
344 Ga0207668_10172260 3300025972 Bacteria 1699
345 Ga0207640_10093499 3300025981 Bacteria 2089
346 Ga0207640_10922976 3300025981 Unclassified 764
347 Ga0207658_10439556 3300025986 Bacteria 1153
348 Ga0207703_10198494 3300026035 Bacteria 1781
349 Ga0207639_10697919 3300026041 Bacteria 941
350 Ga0207678_10086130 3300026067 Bacteria 2685
351 Ga0207678_10566767 3300026067 Bacteria 994
352 Ga0207708_10027360 3300026075 Bacteria 4317
353 Ga0207708_10090469 3300026075 Bacteria 2359
354 Ga0207702_10463845 3300026078 Bacteria 1231
355 Ga0207702_10907218 3300026078 Bacteria 873
356 Ga0207702_11073427 3300026078 Bacteria 799
357 Ga0207702_11991711 3300026078 Unclassified 571
358 Ga0207641_10220207 3300026088 Bacteria 1760
359 Ga0207641_12536463 3300026088 Bacteria 511
360 Ga0207648_10062399 3300026089 Bacteria 3249
361 Ga0207676_10757013 3300026095 Bacteria 945
362 Ga0207676_12238277 3300026095 Bacteria 544
363 Ga0207674_10003054 3300026116 Bacteria 20712
364 Ga0207674_10091638 3300026116 Bacteria 3029
365 Ga0207674_10092847 3300026116 Bacteria 3007
366 Ga0207674_11257613 3300026116 Unclassified 710
367 Ga0207675_100087900 3300026118 Bacteria 2919
368 Ga0207675_100585770 3300026118 Bacteria 1117
369 Ga0207683_10262765 3300026121 Bacteria 1576
370 Ga0207683_10390286 3300026121 Bacteria 1280
371 Ga0207683_10460081 3300026121 Bacteria 1173
372 Ga0207698_10129089 3300026142 Bacteria 2156
373 Ga0207698_10536824 3300026142 Bacteria 1144
374 Ga0207698_11748024 3300026142 Bacteria 637
375 Ga0209371_1000071 3300027312 Bacteria 200748
376 Ga0209371_1000078 3300027312 Bacteria 190779
377 Ga0209371_1000154 3300027312 Bacteria 108161
378 Ga0209371_1000238 3300027312 Bacteria 69012
379 Ga0209371_1003313 3300027312 Bacteria 7956
380 Ga0209999_1038993 3300027543 Bacteria 889
381 Ga0207428_10128630 3300027907 Bacteria 1939
382 Ga0207428_10181259 3300027907 Unclassified 1591
383 Ga0268266_10026166 3300028379 Bacteria 4965
384 Ga0268266_10365819 3300028379 Unclassified 1358
385 Ga0268265_10859914 3300028380 Bacteria 888
386 Ga0268265_11806639 3300028380 Bacteria 618
387 Ga0268264_11251977 3300028381 Bacteria 752
388 Ga0265334_10038961 3300028573 Bacteria 1867
389 Ga0265338_10008043 3300028800 Bacteria 12897
390 Ga0265324_10051358 3300029957 Bacteria 1417
391 Ga0268256_1000070 3300030500 Bacteria 189040
392 Ga0268256_1000198 3300030500 Bacteria 68968
393 Ga0268256_1000237 3300030500 Bacteria 57957
394 Ga0268256_1000828 3300030500 Bacteria 22035
395 Ga0268256_1003012 3300030500 Bacteria 7956
396 Ga0316179_1100387 3300030734 Bacteria 715
397 Ga0316183_1070363 3300030742 Bacteria 1302
398 Ga0316181_1247714 3300030744 Bacteria 5166
399 Ga0316182_1025437 3300030745 Bacteria 1682
400 Ga0265330_10020394 3300031235 Bacteria 3029
401 Ga0265332_10078495 3300031238 Bacteria 1402
402 Ga0265325_10011190 3300031241 Bacteria 5164
403 Ga0265329_10065986 3300031242 Bacteria 1145
404 Ga0265339_10030156 3300031249 Bacteria 3073
405 Ga0265331_10039309 3300031250 Bacteria 2308
406 Ga0265327_10014468 3300031251 Bacteria 5158
407 Ga0265316_10006730 3300031344 Bacteria 10953
408 Ga0307408_100130576 3300031548 Bacteria 1959
409 Ga0307408_100184910 3300031548 Bacteria 1674
410 Ga0316579_10378930 3300031691 Unclassified 684
411 Ga0265314_10001092 3300031711 Bacteria 31362
412 Ga0265342_10131561 3300031712 Bacteria 1401
413 Ga0316578_10064532 3300031728 Unclassified 2161
414 Ga0307405_10124223 3300031731 Unclassified 1772
415 Ga0307410_10123091 3300031852 Bacteria 1894
416 Ga0307406_10279616 3300031901 Bacteria 1272
417 Ga0307406_11509670 3300031901 Unclassified 591
418 Ga0307407_11089715 3300031903 Bacteria 620
419 Ga0307412_11033320 3300031911 Bacteria 728
420 Ga0307409_100120162 3300031995 Bacteria 2223
421 Ga0307409_100879437 3300031995 Unclassified 908
422 Ga0307416_100033266 3300032002 Bacteria 3906
423 Ga0307416_100152016 3300032002 Bacteria 2124
424 Ga0307414_10419074 3300032004 Bacteria 1167
425 Ga0307411_11076329 3300032005 Bacteria 723
426 Ga0307415_100036289 3300032126 Bacteria 3228
427 Ga0307415_101311422 3300032126 Bacteria 686
428 Ga0316593_10055678 3300032168 Bacteria 1344
429 Ga0373958_0023546 3300034819 Bacteria 1159
430 Ga0373951_0222178 3300035091 Bacteria 558
431 Ga0373939_0241341 3300035114 Bacteria 700
432 Ga0373941_0067871 3300035115 Bacteria 1177
433 Ga0373962_0073388 3300035242 Bacteria 1027
434 Ga0316574_0401048 3300035398 Unclassified 864
435 Ga0373931_0403098 3300035691 Unclassified 866
436 Ga0316582_0082994 3300036647 Bacteria 2096
437 Ga0395899_0616581 3300037312 Bacteria 689
438 Ga0395900_0025546 3300037418 Bacteria 6046
439 Ga0395900_0174066 3300037418 Bacteria 2190
440 Ga0395900_0212298 3300037418 Bacteria 1954
441 Ga0395900_0391386 3300037418 Bacteria 1356
442 Ga0395900_0742795 3300037418 Bacteria 912
443 Ga0395900_0990400 3300037418 Bacteria 761
444 Ga0395898_0007790 3300037466 Bacteria 11368
445 Ga0395898_0181891 3300037466 Bacteria 2009
446 Ga0395898_0467993 3300037466 Bacteria 1200
447 Ga0395898_0471038 3300037466 Bacteria 1195
448 Ga0395898_0795423 3300037466 Bacteria 886
449 Ga0395898_1595481 3300037466 Bacteria 577
450 Ga0395905_0005133 3300037471 Bacteria 13443
451 Ga0395905_1660174 3300037471 Bacteria 544
452 Ga0395905_1901100 3300037471 Bacteria 501
453 Ga0395901_0000858 3300038443 Bacteria 33469
454 Ga0395901_0067100 3300038443 Bacteria 3736
455 Ga0395901_0220757 3300038443 Bacteria 1981
456 Ga0395901_0327517 3300038443 Bacteria 1584
457 Ga0395901_0696226 3300038443 Bacteria 1014
458 Ga0395901_0993850 3300038443 Bacteria 815
459 Ga0395901_1246900 3300038443 Bacteria 707
460 Ga0436365_0516539 3300039437 Bacteria 716
461 Ga0436365_1307869 3300039437 Bacteria 2039
462 Ga0439438_040678 3300041405 Bacteria 1207
463 Ga0439447_013860 3300041407 Bacteria 2276
464 Ga0439466_0000015 3300041411 Bacteria 114576
465 Ga0439466_0125499 3300041411 Bacteria 791
466 Ga0451787_541019 3300041441 Unclassified 520
467 Ga0451793_0693422 3300041452 Bacteria 3259
468 Ga0451797_0246926 3300041453 Bacteria 821
469 Ga0451835_0393426 3300041492 Bacteria 510
470 Ga0451837_1561292 3300041494 Bacteria 610
471 Ga0451847_0004397 3300041503 Bacteria 601
472 Ga0451843_1341141 3300041509 Bacteria 647
473 Ga0451853_1119058 3300041512 Bacteria 654
474 Ga0451853_2077639 3300041512 Unclassified 733
475 Ga0439431_0013547 3300041997 Bacteria 1883
476 Ga0439431_0133921 3300041997 Bacteria 697
477 Ga0439437_000445 3300042000 Bacteria 4029
478 Ga0439443_062992 3300042003 Bacteria 666
479 Ga0439448_0009474 3300042005 Bacteria 2872
480 Ga0439432_003873 3300042006 Bacteria 5513
481 Ga0439432_063541 3300042006 Bacteria 1134
482 Ga0439432_101413 3300042006 Bacteria 860
483 Ga0439452_000050 3300042010 Bacteria 121019
484 Ga0439452_078004 3300042010 Bacteria 724
485 Ga0439455_0132121 3300042012 Bacteria 704
486 Ga0439456_023624 3300042013 Bacteria 1303
487 Ga0439463_001954 3300042016 Bacteria 5363
488 Ga0439463_038918 3300042016 Bacteria 1207
489 Ga0450911_000003 3300042115 Bacteria 237055
490 Ga0450919_018808 3300042121 Bacteria 780
491 Ga0450892_010248 3300042130 Bacteria 819
492 Ga0450902_081209 3300042137 Bacteria 570
493 Ga0450903_042055 3300042138 Bacteria 675
494 Ga0450904_000051 3300042139 Bacteria 26256
495 Ga0450907_000033 3300042146 Bacteria 63179
496 Ga0450907_015075 3300042146 Bacteria 1289
497 Ga0439446_0024710 3300042156 Bacteria 1715
498 Ga0450909_038568 3300042185 Bacteria 733
499 Ga0439434_0011383 3300042435 Unclassified 2630
500 Ga0439459_0006732 3300042438 Bacteria 1924
501 Ga0439464_0001474 3300042439 Bacteria 5561
502 Ga0439464_0067851 3300042439 Bacteria 1052
503 Ga0439464_0074493 3300042439 Bacteria 1007
504 Ga0450916_001523 3300042530 Bacteria 2326
505 Ga0450918_011794 3300042531 Bacteria 1522
506 Ga0450901_020289 3300042533 Bacteria 711
507 Ga0466966_0072294 3300044684 Bacteria 2160
508 Ga0466966_0074790 3300044684 Unclassified 2117
509 Ga0466964_0073005 3300044706 Bacteria 1455
510 Ga0466968_0278051 3300044735 Bacteria 800
511 Ga0466960_0032280 3300044901 Bacteria 2423
512 Ga0466960_0203959 3300044901 Unclassified 1081
513 Ga0466960_0298179 3300044901 Bacteria 908
514 Ga0466958_0647930 3300045836 Bacteria 688
515 Ga0466967_0053959 3300045976 Bacteria 3535
516 Ga0466967_0077380 3300045976 Bacteria 2995
517 Ga0466967_0122312 3300045976 Unclassified 2407
518 Ga0466967_0155186 3300045976 Bacteria 2143
519 Ga0466967_0962013 3300045976 Bacteria 850
520 Ga0495627_016902 3300046453 Bacteria 2490
521 Ga0495592_0290424 3300046454 Bacteria 1066
522 Ga0495590_0376074 3300046457 Bacteria 542
523 Ga0495651_0403042 3300046462 Bacteria 893
524 Ga0495653_0339128 3300046463 Bacteria 969
525 Ga0495650_0003645 3300046471 Bacteria 11060
526 Ga0495605_0000620 3300046474 Bacteria 27429
527 Ga0495605_0188176 3300046474 Bacteria 905
528 Ga0495584_0047606 3300046491 Bacteria 2162
529 Ga0495585_0007122 3300046492 Bacteria 6871
530 Ga0495596_0096247 3300046500 Bacteria 1149
531 Ga0495607_0060488 3300046501 Bacteria 2155
532 Ga0495607_0239497 3300046501 Bacteria 878
533 Ga0495583_0001861 3300046506 Bacteria 19645
534 Ga0495583_0008307 3300046506 Bacteria 6366
535 Ga0495608_0232988 3300046511 Bacteria 1152
536 Ga0495620_0098419 3300046515 Bacteria 1168
537 Ga0495628_0280416 3300046516 Bacteria 1238
538 Ga0495628_0469087 3300046516 Bacteria 912
539 Ga0495632_0004658 3300046519 Bacteria 9261
540 Ga0495632_0175908 3300046519 Bacteria 982
541 Ga0495637_0066311 3300046520 Bacteria 1467
542 Ga0495643_0019080 3300046522 Bacteria 3970
543 Ga0495663_0023711 3300046525 Bacteria 1779
544 Ga0495642_0201191 3300046528 Bacteria 868
545 Ga0495642_0544938 3300046528 Bacteria 514
546 Ga0495598_0003842 3300046537 Bacteria 3217
547 Ga0495598_0321145 3300046537 Bacteria 590
548 Ga0495609_0000023 3300046538 Bacteria 269702
549 Ga0495609_0051735 3300046538 Bacteria 1828
550 Ga0495609_0139924 3300046538 Bacteria 1033
551 Ga0495609_0275962 3300046538 Bacteria 688
552 Ga0495621_0067695 3300046539 Bacteria 1309
553 Ga0495645_0055038 3300046543 Bacteria 2889
554 Ga0495633_0096823 3300046558 Bacteria 1371
555 Ga0495656_0368244 3300046615 Unclassified 747
556 Ga0495656_0498609 3300046615 Bacteria 645
557 Ga0495668_0267016 3300046616 Bacteria 937
558 Ga0495611_0187276 3300046648 Unclassified 966
559 Ga0495625_0393787 3300046660 Bacteria 867
560 Ga0495659_0122975 3300046664 Unclassified 1023
561 Ga0495659_0130291 3300046664 Bacteria 997
562 Ga0495661_0000072 3300046665 Bacteria 120743
563 Ga0495661_0048198 3300046665 Bacteria 2590
564 Ga0495661_0127704 3300046665 Bacteria 1397
565 Ga0495669_0398976 3300046684 Bacteria 666
566 Ga0495624_0146370 3300046690 Bacteria 1446
567 Ga0495670_0111165 3300046691 Bacteria 1418
568 Ga0495671_0252608 3300046692 Bacteria 851
569 Ga0495671_0270452 3300046692 Bacteria 819
570 Ga0495671_0408986 3300046692 Bacteria 649
571 Ga0495589_0093307 3300046794 Bacteria 1461
572 Ga0495589_0253359 3300046794 Bacteria 822
573 Ga0495660_0007318 3300046810 Bacteria 6486
574 Ga0495660_0150832 3300046810 Bacteria 1148
575 Ga0495674_0589997 3300047319 Bacteria 881
576 Ga0495672_0000128 3300047320 Bacteria 116418
577 Ga0495676_0248982 3300047321 Bacteria 1213
578 Ga0495680_0601790 3300047322 Bacteria 735
579 Ga0495683_0040364 3300047323 Bacteria 2358
580 Ga0495677_0390423 3300047445 Bacteria 550
581 Ga0495679_008321 3300047446 Bacteria 4227
582 Ga0495679_047846 3300047446 Bacteria 1296
583 Ga0495685_030227 3300047447 Bacteria 1863
584 Ga0495673_0016101 3300047469 Bacteria 3832
585 Ga0495673_0246572 3300047469 Bacteria 653
586 Ga0495681_0116750 3300047470 Bacteria 1150
587 Ga0495681_0252984 3300047470 Bacteria 695
588 Ga0495684_0251365 3300047471 Bacteria 1286
589 Ga0495615_0081009 3300048090 Bacteria 890
590 Ga0495626_0051652 3300048091 Bacteria 1896
591 Ga0496100_0015942 3300048903 Bacteria 4401
592 Ga0496100_0666725 3300048903 Bacteria 811
593 Ga0496101_0519818 3300048904 Bacteria 941
594 Ga0496102_0026366 3300048905 Bacteria 5183
595 Ga0496102_0057966 3300048905 Bacteria 3538
596 Ga0496102_0361606 3300048905 Bacteria 1366
597 Ga0496102_0447118 3300048905 Bacteria 1212
598 Ga0496102_1640291 3300048905 Archaea 561
599 Ga0496103_0049425 3300048906 Bacteria 2600
600 Ga0496103_0199167 3300048906 Bacteria 1288
601 Ga0496105_0730731 3300048908 Bacteria 758
602 Ga0496107_0231499 3300048910 Bacteria 1375
603 Ga0496107_1295836 3300048910 Bacteria 521
604 Ga0496108_0056899 3300048911 Bacteria 3286
605 Ga0496108_0321424 3300048911 Unclassified 1349
606 Ga0496109_0004156 3300048912 Bacteria 12085
607 Ga0496109_1404587 3300048912 Bacteria 634
608 Ga0496110_0076937 3300048913 Bacteria 2967
609 Ga0496110_0134373 3300048913 Bacteria 2235
610 Ga0496110_1662894 3300048913 Bacteria 548
611 Ga0496110_1754178 3300048913 Bacteria 531
612 Ga0496111_0021446 3300048914 Bacteria 4511
613 Ga0496112_0109287 3300048915 Bacteria 2735
614 Ga0496112_0124794 3300048915 Bacteria 2545
615 Ga0496112_0318901 3300048915 Unclassified 1498
616 Ga0496113_0044155 3300048916 Bacteria 3301
617 Ga0496113_0366941 3300048916 Bacteria 1155
618 Ga0496113_0815486 3300048916 Bacteria 741
619 Ga0496114_0244660 3300048917 Bacteria 1578
620 Ga0496114_1493279 3300048917 Unclassified 564
621 Ga0496115_1274877 3300048918 Unclassified 549
622 Ga0496115_1419957 3300048918 Unclassified 512
623 Ga0496116_0000209 3300048919 Bacteria 111028
624 Ga0496116_0003465 3300048919 Bacteria 15555
625 Ga0496116_0018485 3300048919 Bacteria 5372
626 Ga0496117_0001785 3300048920 Bacteria 29443
627 Ga0496117_0002590 3300048920 Bacteria 22495
628 Ga0496118_0002610 3300048921 Bacteria 23939
629 Ga0496118_0010048 3300048921 Bacteria 9431
630 Ga0496119_0000259 3300048922 Bacteria 75018
631 Ga0496119_0000294 3300048922 Bacteria 69996
632 Ga0496119_0002336 3300048922 Bacteria 20880
633 Ga0496120_0000314 3300048923 Bacteria 80307
634 Ga0496120_0000482 3300048923 Bacteria 62533
635 Ga0496121_0000244 3300048924 Bacteria 116655
636 Ga0496122_0182722 3300048925 Bacteria 1248
637 Ga0496123_0099034 3300048926 Bacteria 1702
638 Ga0496123_0255390 3300048926 Bacteria 862
639 Ga0496124_0000295 3300048927 Bacteria 92650
640 Ga0496124_0011703 3300048927 Bacteria 8753
641 Ga0496124_0013215 3300048927 Bacteria 8075
642 Ga0496125_0001070 3300048928 Bacteria 42218
643 Ga0496126_0026475 3300048929 Bacteria 5560
644 Ga0501031_0033752 3300049568 Bacteria 3340
645 Ga0501031_0040753 3300049568 Bacteria 3032
646 Ga0501032_0066804 3300049569 Bacteria 2403
647 Ga0501033_0152539 3300049570 Unclassified 1666
648 Ga0501034_0339714 3300049571 Bacteria 1432
649 Ga0501036_0026923 3300049572 Bacteria 4859
650 Ga0501036_0033071 3300049572 Bacteria 4373
651 Ga0501037_0045395 3300049573 Bacteria 3226
652 Ga0501037_0110276 3300049573 Bacteria 1983
653 Ga0501038_0059358 3300049574 Bacteria 3277
654 Ga0501039_0049253 3300049575 Bacteria 3257
655 Ga0501039_0311800 3300049575 Bacteria 1237
656 Ga0501040_0029879 3300049576 Bacteria 3678
657 Ga0501040_0179540 3300049576 Bacteria 1500
658 Ga0501041_0118225 3300049577 Bacteria 1646
659 Ga0501041_0294868 3300049577 Bacteria 1021
660 Ga0501042_0010968 3300049578 Bacteria 6100
661 Ga0501042_0063944 3300049578 Bacteria 2629
662 Ga0501043_0164229 3300049579 Unclassified 1734
663 Ga0501046_0109882 3300049580 Bacteria 2107
664 Ga0501048_0006003 3300049582 Bacteria 9248
665 Ga0501048_0199152 3300049582 Bacteria 1419
666 Ga0501068_0223682 3300049584 Bacteria 1196
667 Ga0501071_0004938 3300049587 Bacteria 8517
668 Ga0501071_0063774 3300049587 Bacteria 2672
669 Ga0501072_0001670 3300049588 Bacteria 16511
670 Ga0501072_0007342 3300049588 Bacteria 8360
671 Ga0501073_0100750 3300049589 Bacteria 2006
672 Ga0501074_0023214 3300049590 Bacteria 4511
673 Ga0501074_0234290 3300049590 Bacteria 1307
674 Ga0501075_0135913 3300049591 Bacteria 1873
675 Ga0501075_0151799 3300049591 Bacteria 1765
676 Ga0501076_0045598 3300049592 Bacteria 3461
677 Ga0501076_0195628 3300049592 Bacteria 1650
678 Ga0501077_0320310 3300049593 Bacteria 988
679 Ga0501209_100040 3300049656 Bacteria 850
680 Ga0501217_251894 3300049661 Bacteria 569
681 Ga0501079_0012586 3300049741 Bacteria 6461
682 Ga0501079_0183427 3300049741 Bacteria 1633
683 Ga0501080_0141479 3300049742 Bacteria 2224
684 Ga0501080_0942560 3300049742 Bacteria 751
685 Ga0501081_0027220 3300049743 Bacteria 3858
686 Ga0501081_0034258 3300049743 Bacteria 3454
687 Ga0501083_0198971 3300049744 Bacteria 1307
688 Ga0501035_0104709 3300049822 Bacteria 2481
689 Ga0501045_0005511 3300049824 Bacteria 8756
690 Ga0501045_0073662 3300049824 Bacteria 2515
691 Ga0501212_028918 3300049851 Bacteria 887
692 Ga0501226_000065 3300049853 Bacteria 34452
693 nmdc:mga00v17_211280_c2 3300050491 Bacteria 750
694 nmdc:mga05p37_355444_c1 3300050507 Bacteria 1724
695 nmdc:mga05p37_469091_c1 3300050507 Unclassified 1453
696 nmdc:mga05p37_473816_c1 3300050507 Bacteria 1444
697 nmdc:mga09592_504848_c1 3300050508 Bacteria 1041
698 nmdc:mga0qj67_376832_c1 3300050509 Bacteria 1146
699 nmdc:mga08y16_105171_c1 3300050511 Bacteria 2939
700 nmdc:mga08y16_1899369_c1 3300050511 Bacteria 546
701 nmdc:mga08y16_662711_c1 3300050511 Bacteria 1047
702 nmdc:mga0rr50_83642_c1 3300050513 Bacteria 2468
703 nmdc:mga08x19_141269_c1 3300050514 Bacteria 1626
704 nmdc:mga0sz30_178924_c1 3300050516 Bacteria 941
705 Ga0495601_0740473 3300053077 Bacteria 626
706 Ga0495655_0099948 3300053083 Bacteria 857
707 Ga0495595_0279910 3300053084 Bacteria 837
708 Ga0500642_0092368 3300053130 Bacteria 1400
709 Ga0500577_0203057 3300053142 Bacteria 855
710 Ga0501084_0119462 3300054114 Bacteria 2215
711 Ga0501084_0695319 3300054114 Bacteria 857
712 Ga0501082_0007164 3300060353 Bacteria 9614
713 Ga0501082_0133015 3300060353 Bacteria 2158
714 Ga0501082_0885649 3300060353 Bacteria 781
715 Ga0530510_0067453 3300061734 Bacteria 2595
716 Ga0530510_0491577 3300061734 Bacteria 930

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005434 Ga0070709_10062059 Ga0070709_100620594 77
2 3300007076 Ga0075435_100084508 Ga0075435_1000845081 77
3 3300025906 Ga0207699_10132800 Ga0207699_101328002 77
4 3300037418 Ga0395900_0990400 Ga0395900_0990400_472_708 77
5 3300039437 Ga0436365_0516539 Ga0436365_0516539_465_701 77
6 3300046665 Ga0495661_0048198 Ga0495661_0048198_1071_1307 77
7 3300048910 Ga0496107_0231499 Ga0496107_0231499_179_415 77
8 3300048913 Ga0496110_0134373 Ga0496110_0134373_1416_1652 77
9 3300048916 Ga0496113_0815486 Ga0496113_0815486_299_535 77
10 3300048918 Ga0496115_1419957 Ga0496115_1419957_241_477 77
11 3300050513 nmdc:mga0rr50_83642_c1 nmdc:mga0rr50_83642_c1_1849_2085 77
12 3300050514 nmdc:mga08x19_141269_c1 nmdc:mga08x19_141269_c1_843_1079 77
13 3300005329 Ga0070683_100029800 Ga0070683_1000298006 78
14 3300005329 Ga0070683_100073626 Ga0070683_1000736263 78
15 3300005329 Ga0070683_100709401 Ga0070683_1007094012 78
16 3300005336 Ga0070680_100122146 Ga0070680_1001221462 78
17 3300005344 Ga0070661_100040281 Ga0070661_1000402815 78
18 3300005344 Ga0070661_100061491 Ga0070661_1000614913 78
19 3300005365 Ga0070688_100036002 Ga0070688_1000360022 78
20 3300005435 Ga0070714_100213003 Ga0070714_1002130033 78
21 3300005436 Ga0070713_101143222 Ga0070713_1011432222 78
22 3300005440 Ga0070705_101418814 Ga0070705_1014188142 78
23 3300005445 Ga0070708_100279249 Ga0070708_1002792492 78
24 3300005466 Ga0070685_10056717 Ga0070685_100567173 78
25 3300005543 Ga0070672_100296036 Ga0070672_1002960362 78
26 3300005543 Ga0070672_100378321 Ga0070672_1003783212 78
27 3300005563 Ga0068855_100558565 Ga0068855_1005585652 78
28 3300005577 Ga0068857_100169924 Ga0068857_1001699243 78
29 3300005578 Ga0068854_100306953 Ga0068854_1003069533 78
30 3300005614 Ga0068856_101538945 Ga0068856_1015389452 78
31 3300005616 Ga0068852_100753921 Ga0068852_1007539212 78
32 3300005718 Ga0068866_11407839 Ga0068866_114078392 78
33 3300005719 Ga0068861_100216065 Ga0068861_1002160652 78
34 3300005834 Ga0068851_10293926 Ga0068851_102939262 78
35 3300005842 Ga0068858_100375593 Ga0068858_1003755932 78
36 3300005844 Ga0068862_100701895 Ga0068862_1007018952 78
37 3300005937 Ga0081455_10003895 Ga0081455_1000389512 78
38 3300006237 Ga0097621_100525381 Ga0097621_1005253812 78
39 3300006881 Ga0068865_100148510 Ga0068865_1001485103 78
40 3300006881 Ga0068865_100369488 Ga0068865_1003694882 78
41 3300009093 Ga0105240_10068856 Ga0105240_100688563 78
42 3300009094 Ga0111539_10040195 Ga0111539_100401954 78
43 3300009177 Ga0105248_10555845 Ga0105248_105558452 78
44 3300009545 Ga0105237_10821396 Ga0105237_108213962 78
45 3300010375 Ga0105239_10752211 Ga0105239_107522112 78
46 3300013104 Ga0157370_10022195 Ga0157370_100221954 78
47 3300013105 Ga0157369_10352439 Ga0157369_103524392 78
48 3300013306 Ga0163162_10153577 Ga0163162_101535772 78
49 3300014969 Ga0157376_11430456 Ga0157376_114304562 78
50 3300020070 Ga0206356_10385242 Ga0206356_103852422 78
51 3300020080 Ga0206350_10323036 Ga0206350_103230362 78
52 3300020080 Ga0206350_10563812 Ga0206350_105638122 78
53 3300020081 Ga0206354_10413687 Ga0206354_104136872 78
54 3300020082 Ga0206353_10127771 Ga0206353_101277713 78
55 3300020610 Ga0154015_1474078 Ga0154015_14740781 78
56 3300025899 Ga0207642_10716363 Ga0207642_107163632 78
57 3300025901 Ga0207688_10034113 Ga0207688_100341134 78
58 3300025901 Ga0207688_10256250 Ga0207688_102562502 78
59 3300025904 Ga0207647_10657492 Ga0207647_106574921 78
60 3300025907 Ga0207645_10051414 Ga0207645_100514144 78
61 3300025908 Ga0207643_10325438 Ga0207643_103254382 78
62 3300025909 Ga0207705_10143539 Ga0207705_101435393 78
63 3300025909 Ga0207705_10351623 Ga0207705_103516232 78
64 3300025912 Ga0207707_10033821 Ga0207707_100338216 78
65 3300025912 Ga0207707_10576191 Ga0207707_105761912 78
66 3300025912 Ga0207707_11336988 Ga0207707_113369882 78
67 3300025913 Ga0207695_10125153 Ga0207695_101251532 78
68 3300025917 Ga0207660_10015478 Ga0207660_100154782 78
69 3300025919 Ga0207657_10000054 Ga0207657_10000054105 78
70 3300025919 Ga0207657_10007679 Ga0207657_1000767911 78
71 3300025919 Ga0207657_10166159 Ga0207657_101661592 78
72 3300025920 Ga0207649_10237178 Ga0207649_102371783 78
73 3300025920 Ga0207649_10306114 Ga0207649_103061142 78
74 3300025921 Ga0207652_10172795 Ga0207652_101727952 78
75 3300025921 Ga0207652_10365305 Ga0207652_103653052 78
76 3300025921 Ga0207652_10589986 Ga0207652_105899862 78
77 3300025921 Ga0207652_10602307 Ga0207652_106023071 78
78 3300025922 Ga0207646_10006668 Ga0207646_1000666812 78
79 3300025924 Ga0207694_10713851 Ga0207694_107138512 78
80 3300025926 Ga0207659_10422882 Ga0207659_104228822 78
81 3300025927 Ga0207687_10009952 Ga0207687_100099527 78
82 3300025927 Ga0207687_11020091 Ga0207687_110200912 78
83 3300025929 Ga0207664_10934943 Ga0207664_109349432 78
84 3300025931 Ga0207644_11617899 Ga0207644_116178992 78
85 3300025933 Ga0207706_10073062 Ga0207706_100730623 78
86 3300025935 Ga0207709_10047161 Ga0207709_100471612 78
87 3300025937 Ga0207669_10256942 Ga0207669_102569423 78
88 3300025938 Ga0207704_11672388 Ga0207704_116723882 78
89 3300025940 Ga0207691_10151026 Ga0207691_101510262 78
90 3300025940 Ga0207691_10771282 Ga0207691_107712821 78
91 3300025941 Ga0207711_11511811 Ga0207711_115118111 78
92 3300025942 Ga0207689_10400019 Ga0207689_104000191 78
93 3300025944 Ga0207661_10034427 Ga0207661_100344274 78
94 3300025944 Ga0207661_10807954 Ga0207661_108079541 78
95 3300025945 Ga0207679_10068215 Ga0207679_100682153 78
96 3300025949 Ga0207667_10177022 Ga0207667_101770223 78
97 3300025960 Ga0207651_11269751 Ga0207651_112697512 78
98 3300025961 Ga0207712_10194601 Ga0207712_101946012 78
99 3300025981 Ga0207640_10093499 Ga0207640_100934992 78
100 3300026041 Ga0207639_10697919 Ga0207639_106979192 78
101 3300026075 Ga0207708_10027360 Ga0207708_100273605 78
102 3300026078 Ga0207702_10907218 Ga0207702_109072182 78
103 3300026088 Ga0207641_10220207 Ga0207641_102202072 78
104 3300026089 Ga0207648_10062399 Ga0207648_100623992 78
105 3300026095 Ga0207676_12238277 Ga0207676_122382771 78
106 3300026116 Ga0207674_10091638 Ga0207674_100916385 78
107 3300026116 Ga0207674_10092847 Ga0207674_100928472 78
108 3300026118 Ga0207675_100087900 Ga0207675_1000879003 78
109 3300026121 Ga0207683_10262765 Ga0207683_102627652 78
110 3300026121 Ga0207683_10390286 Ga0207683_103902862 78
111 3300026142 Ga0207698_10129089 Ga0207698_101290893 78
112 3300026142 Ga0207698_10536824 Ga0207698_105368242 78
113 3300027543 Ga0209999_1038993 Ga0209999_10389932 78
114 3300028380 Ga0268265_10859914 Ga0268265_108599142 78
115 3300028381 Ga0268264_11251977 Ga0268264_112519772 78
116 3300028573 Ga0265334_10038961 Ga0265334_100389612 78
117 3300028800 Ga0265338_10008043 Ga0265338_1000804310 78
118 3300031235 Ga0265330_10020394 Ga0265330_100203943 78
119 3300031238 Ga0265332_10078495 Ga0265332_100784952 78
120 3300031241 Ga0265325_10011190 Ga0265325_100111905 78
121 3300031242 Ga0265329_10065986 Ga0265329_100659862 78
122 3300031249 Ga0265339_10030156 Ga0265339_100301561 78
123 3300031250 Ga0265331_10039309 Ga0265331_100393094 78
124 3300031251 Ga0265327_10014468 Ga0265327_100144681 78
125 3300031344 Ga0265316_10006730 Ga0265316_1000673012 78
126 3300031548 Ga0307408_100130576 Ga0307408_1001305763 78
127 3300031691 Ga0316579_10378930 Ga0316579_103789302 78
128 3300031711 Ga0265314_10001092 Ga0265314_1000109230 78
129 3300031712 Ga0265342_10131561 Ga0265342_101315612 78
130 3300031728 Ga0316578_10064532 Ga0316578_100645322 78
131 3300031852 Ga0307410_10123091 Ga0307410_101230913 78
132 3300031901 Ga0307406_10279616 Ga0307406_102796162 78
133 3300031901 Ga0307406_11509670 Ga0307406_115096702 78
134 3300031903 Ga0307407_11089715 Ga0307407_110897151 78
135 3300031995 Ga0307409_100120162 Ga0307409_1001201623 78
136 3300032002 Ga0307416_100152016 Ga0307416_1001520163 78
137 3300032004 Ga0307414_10419074 Ga0307414_104190742 78
138 3300032005 Ga0307411_11076329 Ga0307411_110763292 78
139 3300032126 Ga0307415_100036289 Ga0307415_1000362894 78
140 3300032168 Ga0316593_10055678 Ga0316593_100556783 78
141 3300035114 Ga0373939_0241341 Ga0373939_0241341_259_495 78
142 3300035115 Ga0373941_0067871 Ga0373941_0067871_808_1044 78
143 3300035398 Ga0316574_0401048 Ga0316574_0401048_524_820 78
144 3300036647 Ga0316582_0082994 Ga0316582_0082994_211_507 78
145 3300037312 Ga0395899_0616581 Ga0395899_0616581_140_379 78
146 3300037418 Ga0395900_0025546 Ga0395900_0025546_5329_5568 78
147 3300037418 Ga0395900_0174066 Ga0395900_0174066_1910_2149 78
148 3300037418 Ga0395900_0391386 Ga0395900_0391386_714_950 78
149 3300037466 Ga0395898_0007790 Ga0395898_0007790_9404_9643 78
150 3300037466 Ga0395898_0471038 Ga0395898_0471038_771_1007 78
151 3300037466 Ga0395898_1595481 Ga0395898_1595481_308_547 78
152 3300037471 Ga0395905_0005133 Ga0395905_0005133_11966_12205 78
153 3300037471 Ga0395905_1901100 Ga0395905_1901100_195_434 78
154 3300038443 Ga0395901_0000858 Ga0395901_0000858_20656_20895 78
155 3300039437 Ga0436365_1307869 Ga0436365_1307869_814_1062 78
156 3300041492 Ga0451835_0393426 Ga0451835_0393426_10_249 78
157 3300041512 Ga0451853_2077639 Ga0451853_2077639_395_634 78
158 3300041997 Ga0439431_0133921 Ga0439431_0133921_85_324 78
159 3300042005 Ga0439448_0009474 Ga0439448_0009474_692_928 78
160 3300042439 Ga0439464_0067851 Ga0439464_0067851_176_412 78
161 3300044735 Ga0466968_0278051 Ga0466968_0278051_529_768 78
162 3300044901 Ga0466960_0203959 Ga0466960_0203959_65_304 78
163 3300045836 Ga0466958_0647930 Ga0466958_0647930_80_319 78
164 3300045976 Ga0466967_0122312 Ga0466967_0122312_1234_1473 78
165 3300045976 Ga0466967_0155186 Ga0466967_0155186_866_1105 78
166 3300045976 Ga0466967_0962013 Ga0466967_0962013_507_746 78
167 3300046453 Ga0495627_016902 Ga0495627_016902_1305_1541 78
168 3300046457 Ga0495590_0376074 Ga0495590_0376074_183_419 78
169 3300046491 Ga0495584_0047606 Ga0495584_0047606_441_677 78
170 3300046500 Ga0495596_0096247 Ga0495596_0096247_128_364 78
171 3300046515 Ga0495620_0098419 Ga0495620_0098419_568_804 78
172 3300046519 Ga0495632_0175908 Ga0495632_0175908_92_328 78
173 3300046520 Ga0495637_0066311 Ga0495637_0066311_490_726 78
174 3300046525 Ga0495663_0023711 Ga0495663_0023711_307_543 78
175 3300046528 Ga0495642_0201191 Ga0495642_0201191_64_300 78
176 3300046528 Ga0495642_0544938 Ga0495642_0544938_24_260 78
177 3300046537 Ga0495598_0003842 Ga0495598_0003842_1010_1246 78
178 3300046538 Ga0495609_0051735 Ga0495609_0051735_568_804 78
179 3300046539 Ga0495621_0067695 Ga0495621_0067695_663_899 78
180 3300046558 Ga0495633_0096823 Ga0495633_0096823_692_928 78
181 3300046615 Ga0495656_0498609 Ga0495656_0498609_226_462 78
182 3300046616 Ga0495668_0267016 Ga0495668_0267016_74_310 78
183 3300046648 Ga0495611_0187276 Ga0495611_0187276_490_726 78
184 3300046660 Ga0495625_0393787 Ga0495625_0393787_494_730 78
185 3300046664 Ga0495659_0122975 Ga0495659_0122975_692_928 78
186 3300046665 Ga0495661_0127704 Ga0495661_0127704_971_1207 78
187 3300046684 Ga0495669_0398976 Ga0495669_0398976_290_526 78
188 3300046690 Ga0495624_0146370 Ga0495624_0146370_429_668 78
189 3300046692 Ga0495671_0270452 Ga0495671_0270452_113_349 78
190 3300046692 Ga0495671_0408986 Ga0495671_0408986_120_356 78
191 3300046794 Ga0495589_0093307 Ga0495589_0093307_247_483 78
192 3300046794 Ga0495589_0253359 Ga0495589_0253359_128_364 78
193 3300046810 Ga0495660_0150832 Ga0495660_0150832_380_616 78
194 3300047323 Ga0495683_0040364 Ga0495683_0040364_537_773 78
195 3300047445 Ga0495677_0390423 Ga0495677_0390423_300_536 78
196 3300047446 Ga0495679_047846 Ga0495679_047846_794_1030 78
197 3300047447 Ga0495685_030227 Ga0495685_030227_210_446 78
198 3300047470 Ga0495681_0116750 Ga0495681_0116750_604_840 78
199 3300048090 Ga0495615_0081009 Ga0495615_0081009_273_509 78
200 3300048091 Ga0495626_0051652 Ga0495626_0051652_100_336 78
201 3300048904 Ga0496101_0519818 Ga0496101_0519818_187_423 78
202 3300048905 Ga0496102_0026366 Ga0496102_0026366_231_467 78
203 3300048905 Ga0496102_1640291 Ga0496102_1640291_181_420 78
204 3300048910 Ga0496107_1295836 Ga0496107_1295836_87_323 78
205 3300048911 Ga0496108_0056899 Ga0496108_0056899_182_418 78
206 3300048912 Ga0496109_0004156 Ga0496109_0004156_1114_1350 78
207 3300048913 Ga0496110_0076937 Ga0496110_0076937_997_1233 78
208 3300048914 Ga0496111_0021446 Ga0496111_0021446_1472_1708 78
209 3300048916 Ga0496113_0044155 Ga0496113_0044155_1714_1950 78
210 3300048917 Ga0496114_0244660 Ga0496114_0244660_1243_1482 78
211 3300049656 Ga0501209_100040 Ga0501209_100040_540_776 78
212 3300049661 Ga0501217_251894 Ga0501217_251894_222_458 78
213 3300049851 Ga0501212_028918 Ga0501212_028918_159_395 78
214 3300050507 nmdc:mga05p37_469091_c1 nmdc:mga05p37_469091_c1_351_587 78
215 3300050508 nmdc:mga09592_504848_c1 nmdc:mga09592_504848_c1_20_256 78
216 3300050511 nmdc:mga08y16_105171_c1 nmdc:mga08y16_105171_c1_983_1219 78
217 3300053083 Ga0495655_0099948 Ga0495655_0099948_304_540 78
218 3300060353 Ga0501082_0885649 Ga0501082_0885649_334_573 78
219 iso_pu_bacteria 2599185299 2599929561 79
220 iso_pu_bacteria 2648501693 2650899948 79
221 iso_pu_bacteria 2684622997 2686356682 79
222 iso_pu_bacteria 2808606414 2809127796 79
223 iso_pu_bacteria 2811994881 2812370084 79
224 iso_pu_bacteria 2844528606 2844532840 79
225 iso_pu_bacteria 2847797336 2847797498 79
226 iso_pu_bacteria 2865014394 2865017881 79
227 iso_pu_bacteria 2923519811 2923524170 79
228 iso_pu_bacteria 2939602548 2939604983 79
229 iso_pu_bacteria 2945951305 2945955069 79
230 iso_pu_bacteria 2984494565 2984498922 79
231 iso_pu_bacteria 2990261002 2990264820 79
232 iso_pu_bacteria 3007315729 3007316815 79
233 3300032126 Ga0307415_101311422 Ga0307415_1013114221 80
234 3300038443 Ga0395901_0220757 Ga0395901_0220757_1310_1552 80
235 3300038443 Ga0395901_0993850 Ga0395901_0993850_181_423 80
236 3300050507 nmdc:mga05p37_355444_c1 nmdc:mga05p37_355444_c1_1197_1439 80
237 3300050509 nmdc:mga0qj67_376832_c1 nmdc:mga0qj67_376832_c1_144_386 80
238 3300026088 Ga0207641_12536463 Ga0207641_125364631 82
239 3300041512 Ga0451853_1119058 Ga0451853_1119058_259_507 82
240 3300046474 Ga0495605_0188176 Ga0495605_0188176_54_305 82
241 3300046537 Ga0495598_0321145 Ga0495598_0321145_327_578 82
242 3300046538 Ga0495609_0275962 Ga0495609_0275962_228_479 82
243 3300046615 Ga0495656_0368244 Ga0495656_0368244_228_479 82
244 3300046664 Ga0495659_0130291 Ga0495659_0130291_561_812 82
245 3300046691 Ga0495670_0111165 Ga0495670_0111165_397_648 82
246 3300048903 Ga0496100_0666725 Ga0496100_0666725_466_717 82
247 3300001977 JGI24746J21847_1058514 JGI24746J21847_10585141 83
248 3300001989 JGI24739J22299_10000283 JGI24739J22299_1000028312 83
249 3300001990 JGI24737J22298_10025257 JGI24737J22298_100252572 83
250 3300003856 Ga0058692_1002795 Ga0058692_10027952 83
251 3300003856 Ga0058692_1037455 Ga0058692_10374552 83
252 3300005327 Ga0070658_10438177 Ga0070658_104381772 83
253 3300005330 Ga0070690_101437737 Ga0070690_1014377371 83
254 3300005331 Ga0070670_100394451 Ga0070670_1003944512 83
255 3300005331 Ga0070670_100406116 Ga0070670_1004061162 83
256 3300005334 Ga0068869_100272185 Ga0068869_1002721852 83
257 3300005334 Ga0068869_100333026 Ga0068869_1003330262 83
258 3300005336 Ga0070680_100130580 Ga0070680_1001305803 83
259 3300005336 Ga0070680_100393420 Ga0070680_1003934202 83
260 3300005336 Ga0070680_100492402 Ga0070680_1004924022 83
261 3300005336 Ga0070680_100847820 Ga0070680_1008478202 83
262 3300005337 Ga0070682_102005442 Ga0070682_1020054421 83
263 3300005339 Ga0070660_100006354 Ga0070660_1000063546 83
264 3300005339 Ga0070660_100428559 Ga0070660_1004285592 83
265 3300005339 Ga0070660_100755048 Ga0070660_1007550482 83
266 3300005339 Ga0070660_101265839 Ga0070660_1012658392 83
267 3300005341 Ga0070691_10063178 Ga0070691_100631783 83
268 3300005344 Ga0070661_100566336 Ga0070661_1005663362 83
269 3300005347 Ga0070668_100012549 Ga0070668_1000125496 83
270 3300005354 Ga0070675_100112421 Ga0070675_1001124213 83
271 3300005354 Ga0070675_100267290 Ga0070675_1002672902 83
272 3300005355 Ga0070671_101903262 Ga0070671_1019032621 83
273 3300005356 Ga0070674_100145246 Ga0070674_1001452462 83
274 3300005364 Ga0070673_100511073 Ga0070673_1005110732 83
275 3300005366 Ga0070659_100161739 Ga0070659_1001617393 83
276 3300005366 Ga0070659_100261155 Ga0070659_1002611552 83
277 3300005367 Ga0070667_100217408 Ga0070667_1002174083 83
278 3300005435 Ga0070714_100014073 Ga0070714_1000140737 83
279 3300005435 Ga0070714_100280213 Ga0070714_1002802132 83
280 3300005438 Ga0070701_10809212 Ga0070701_108092122 83
281 3300005439 Ga0070711_101945637 Ga0070711_1019456371 83
282 3300005440 Ga0070705_100401888 Ga0070705_1004018882 83
283 3300005441 Ga0070700_100028625 Ga0070700_1000286252 83
284 3300005441 Ga0070700_100260899 Ga0070700_1002608991 83
285 3300005444 Ga0070694_100282629 Ga0070694_1002826292 83
286 3300005444 Ga0070694_100762237 Ga0070694_1007622372 83
287 3300005445 Ga0070708_100208609 Ga0070708_1002086092 83
288 3300005456 Ga0070678_100297595 Ga0070678_1002975952 83
289 3300005456 Ga0070678_100412325 Ga0070678_1004123252 83
290 3300005456 Ga0070678_100614098 Ga0070678_1006140982 83
291 3300005457 Ga0070662_100000583 Ga0070662_10000058313 83
292 3300005457 Ga0070662_100122522 Ga0070662_1001225222 83
293 3300005457 Ga0070662_100658423 Ga0070662_1006584232 83
294 3300005458 Ga0070681_10026332 Ga0070681_100263324 83
295 3300005458 Ga0070681_10063954 Ga0070681_100639545 83
296 3300005458 Ga0070681_10757258 Ga0070681_107572582 83
297 3300005458 Ga0070681_11045938 Ga0070681_110459382 83
298 3300005459 Ga0068867_100100912 Ga0068867_1001009123 83
299 3300005459 Ga0068867_100135245 Ga0068867_1001352452 83
300 3300005467 Ga0070706_100422510 Ga0070706_1004225102 83
301 3300005468 Ga0070707_100034911 Ga0070707_1000349113 83
302 3300005518 Ga0070699_100014492 Ga0070699_1000144925 83
303 3300005530 Ga0070679_100235833 Ga0070679_1002358331 83
304 3300005530 Ga0070679_100397913 Ga0070679_1003979131 83
305 3300005530 Ga0070679_100637111 Ga0070679_1006371112 83
306 3300005530 Ga0070679_101996008 Ga0070679_1019960082 83
307 3300005535 Ga0070684_100061758 Ga0070684_1000617583 83
308 3300005535 Ga0070684_100553290 Ga0070684_1005532902 83
309 3300005535 Ga0070684_100969609 Ga0070684_1009696091 83
310 3300005535 Ga0070684_101120189 Ga0070684_1011201892 83
311 3300005535 Ga0070684_101765697 Ga0070684_1017656972 83
312 3300005539 Ga0068853_100511976 Ga0068853_1005119762 83
313 3300005544 Ga0070686_100153526 Ga0070686_1001535262 83
314 3300005544 Ga0070686_100185569 Ga0070686_1001855692 83
315 3300005545 Ga0070695_100205059 Ga0070695_1002050592 83
316 3300005545 Ga0070695_101324058 Ga0070695_1013240581 83
317 3300005546 Ga0070696_101053725 Ga0070696_1010537252 83
318 3300005547 Ga0070693_100045777 Ga0070693_1000457772 83
319 3300005547 Ga0070693_101599224 Ga0070693_1015992241 83
320 3300005548 Ga0070665_100025626 Ga0070665_1000256264 83
321 3300005548 Ga0070665_101949515 Ga0070665_1019495152 83
322 3300005548 Ga0070665_102409774 Ga0070665_1024097742 83
323 3300005549 Ga0070704_100241704 Ga0070704_1002417043 83
324 3300005563 Ga0068855_100053717 Ga0068855_1000537175 83
325 3300005563 Ga0068855_100053997 Ga0068855_1000539973 83
326 3300005563 Ga0068855_100360618 Ga0068855_1003606182 83
327 3300005563 Ga0068855_101753660 Ga0068855_1017536602 83
328 3300005564 Ga0070664_100063340 Ga0070664_1000633402 83
329 3300005564 Ga0070664_101714905 Ga0070664_1017149052 83
330 3300005577 Ga0068857_100000015 Ga0068857_10000001571 83
331 3300005577 Ga0068857_100000499 Ga0068857_1000004998 83
332 3300005577 Ga0068857_100178538 Ga0068857_1001785381 83
333 3300005577 Ga0068857_101795359 Ga0068857_1017953592 83
334 3300005614 Ga0068856_101420122 Ga0068856_1014201222 83
335 3300005614 Ga0068856_102246368 Ga0068856_1022463681 83
336 3300005615 Ga0070702_100670725 Ga0070702_1006707251 83
337 3300005615 Ga0070702_101265094 Ga0070702_1012650942 83
338 3300005616 Ga0068852_100067986 Ga0068852_1000679862 83
339 3300005616 Ga0068852_101342931 Ga0068852_1013429311 83
340 3300005616 Ga0068852_101373980 Ga0068852_1013739802 83
341 3300005617 Ga0068859_100216044 Ga0068859_1002160443 83
342 3300005618 Ga0068864_100535064 Ga0068864_1005350642 83
343 3300005718 Ga0068866_10192567 Ga0068866_101925672 83
344 3300005719 Ga0068861_102190785 Ga0068861_1021907851 83
345 3300005834 Ga0068851_10001471 Ga0068851_100014718 83
346 3300005841 Ga0068863_100288730 Ga0068863_1002887302 83
347 3300005844 Ga0068862_102044956 Ga0068862_1020449562 83
348 3300005937 Ga0081455_10263195 Ga0081455_102631952 83
349 3300005981 Ga0081538_10326066 Ga0081538_103260661 83
350 3300006051 Ga0075364_10426563 Ga0075364_104265632 83
351 3300006058 Ga0075432_10085423 Ga0075432_100854232 83
352 3300006163 Ga0070715_10008667 Ga0070715_100086672 83
353 3300006186 Ga0075369_10046641 Ga0075369_100466412 83
354 3300006195 Ga0075366_10007989 Ga0075366_100079896 83
355 3300006358 Ga0068871_101556192 Ga0068871_1015561921 83
356 3300006844 Ga0075428_100159732 Ga0075428_1001597324 83
357 3300006847 Ga0075431_101064808 Ga0075431_1010648082 83
358 3300006880 Ga0075429_100310215 Ga0075429_1003102152 83
359 3300006931 Ga0097620_100216040 Ga0097620_1002160403 83
360 3300006946 Ga0079104_1000172 Ga0079104_100017227 83
361 3300006946 Ga0079104_1007460 Ga0079104_10074603 83
362 3300009011 Ga0105251_10000234 Ga0105251_1000023425 83
363 3300009011 Ga0105251_10191698 Ga0105251_101916982 83
364 3300009036 Ga0105244_10002167 Ga0105244_100021679 83
365 3300009036 Ga0105244_10002274 Ga0105244_100022744 83
366 3300009036 Ga0105244_10002611 Ga0105244_100026118 83
367 3300009036 Ga0105244_10010141 Ga0105244_100101417 83
368 3300009036 Ga0105244_10016612 Ga0105244_100166124 83
369 3300009036 Ga0105244_10020509 Ga0105244_100205095 83
370 3300009036 Ga0105244_10048846 Ga0105244_100488463 83
371 3300009036 Ga0105244_10068461 Ga0105244_100684612 83
372 3300009036 Ga0105244_10246549 Ga0105244_102465492 83
373 3300009092 Ga0105250_10000012 Ga0105250_10000012218 83
374 3300009092 Ga0105250_10001974 Ga0105250_100019744 83
375 3300009092 Ga0105250_10036270 Ga0105250_100362702 83
376 3300009092 Ga0105250_10097189 Ga0105250_100971892 83
377 3300009092 Ga0105250_10113388 Ga0105250_101133882 83
378 3300009093 Ga0105240_10065139 Ga0105240_100651392 83
379 3300009093 Ga0105240_10164944 Ga0105240_101649443 83
380 3300009093 Ga0105240_10563181 Ga0105240_105631812 83
381 3300009094 Ga0111539_10009131 Ga0111539_100091317 83
382 3300009094 Ga0111539_10074492 Ga0111539_100744923 83
383 3300009094 Ga0111539_10683961 Ga0111539_106839612 83
384 3300009098 Ga0105245_10120739 Ga0105245_101207392 83
385 3300009098 Ga0105245_10295861 Ga0105245_102958612 83
386 3300009098 Ga0105245_11292833 Ga0105245_112928332 83
387 3300009098 Ga0105245_12148494 Ga0105245_121484942 83
388 3300009101 Ga0105247_10167719 Ga0105247_101677192 83
389 3300009147 Ga0114129_10095892 Ga0114129_100958923 83
390 3300009147 Ga0114129_10218064 Ga0114129_102180644 83
391 3300009148 Ga0105243_10000094 Ga0105243_1000009424 83
392 3300009148 Ga0105243_10037198 Ga0105243_100371983 83
393 3300009148 Ga0105243_10163990 Ga0105243_101639902 83
394 3300009148 Ga0105243_11033305 Ga0105243_110333052 83
395 3300009148 Ga0105243_11160990 Ga0105243_111609902 83
396 3300009176 Ga0105242_10168080 Ga0105242_101680802 83
397 3300009545 Ga0105237_11993251 Ga0105237_119932511 83
398 3300009553 Ga0105249_10291677 Ga0105249_102916772 83
399 3300009553 Ga0105249_11035982 Ga0105249_110359822 83
400 3300009553 Ga0105249_12018115 Ga0105249_120181152 83
401 3300010375 Ga0105239_10398025 Ga0105239_103980251 83
402 3300010375 Ga0105239_10683216 Ga0105239_106832162 83
403 3300010375 Ga0105239_10689438 Ga0105239_106894382 83
404 3300010375 Ga0105239_11853621 Ga0105239_118536211 83
405 3300011119 Ga0105246_10480342 Ga0105246_104803422 83
406 3300011119 Ga0105246_10678812 Ga0105246_106788122 83
407 3300013100 Ga0157373_10054022 Ga0157373_100540223 83
408 3300013100 Ga0157373_10055716 Ga0157373_100557164 83
409 3300013100 Ga0157373_10184517 Ga0157373_101845171 83
410 3300013100 Ga0157373_10242675 Ga0157373_102426752 83
411 3300013100 Ga0157373_10974196 Ga0157373_109741962 83
412 3300013102 Ga0157371_10000957 Ga0157371_1000095736 83
413 3300013102 Ga0157371_10005015 Ga0157371_1000501513 83
414 3300013102 Ga0157371_10143320 Ga0157371_101433202 83
415 3300013102 Ga0157371_10622095 Ga0157371_106220951 83
416 3300013104 Ga0157370_10002299 Ga0157370_1000229924 83
417 3300013104 Ga0157370_10032663 Ga0157370_100326636 83
418 3300013104 Ga0157370_10328080 Ga0157370_103280802 83
419 3300013105 Ga0157369_10159116 Ga0157369_101591164 83
420 3300013105 Ga0157369_11543071 Ga0157369_115430711 83
421 3300013296 Ga0157374_11642422 Ga0157374_116424221 83
422 3300013297 Ga0157378_10802571 Ga0157378_108025712 83
423 3300013297 Ga0157378_11624136 Ga0157378_116241362 83
424 3300013306 Ga0163162_10041125 Ga0163162_100411254 83
425 3300013306 Ga0163162_10503678 Ga0163162_105036782 83
426 3300013306 Ga0163162_10933063 Ga0163162_109330633 83
427 3300013307 Ga0157372_10014550 Ga0157372_100145506 83
428 3300013307 Ga0157372_10020586 Ga0157372_100205867 83
429 3300013307 Ga0157372_10088962 Ga0157372_100889625 83
430 3300013307 Ga0157372_10586544 Ga0157372_105865442 83
431 3300013307 Ga0157372_11420355 Ga0157372_114203552 83
432 3300013307 Ga0157372_11622289 Ga0157372_116222891 83
433 3300013307 Ga0157372_11761561 Ga0157372_117615611 83
434 3300013308 Ga0157375_10101127 Ga0157375_101011273 83
435 3300014325 Ga0163163_12465741 Ga0163163_124657411 83
436 3300014326 Ga0157380_11983174 Ga0157380_119831742 83
437 3300014326 Ga0157380_12166150 Ga0157380_121661502 83
438 3300014497 Ga0182008_10297617 Ga0182008_102976172 83
439 3300014745 Ga0157377_10106473 Ga0157377_101064731 83
440 3300014745 Ga0157377_11138737 Ga0157377_111387371 83
441 3300014968 Ga0157379_10736474 Ga0157379_107364741 83
442 3300015261 Ga0182006_1001057 Ga0182006_10010576 83
443 3300015261 Ga0182006_1005498 Ga0182006_10054985 83
444 3300015261 Ga0182006_1063654 Ga0182006_10636543 83
445 3300015261 Ga0182006_1121984 Ga0182006_11219842 83
446 3300015262 Ga0182007_10010004 Ga0182007_100100044 83
447 3300017792 Ga0163161_10016748 Ga0163161_100167485 83
448 3300017792 Ga0163161_11633173 Ga0163161_116331731 83
449 3300020070 Ga0206356_11168965 Ga0206356_111689652 83
450 3300020076 Ga0206355_1549020 Ga0206355_15490201 83
451 3300020081 Ga0206354_11642342 Ga0206354_116423422 83
452 3300020082 Ga0206353_10122185 Ga0206353_101221851 83
453 3300020082 Ga0206353_11390648 Ga0206353_113906482 83
454 3300025711 Ga0207696_1000237 Ga0207696_100023731 83
455 3300025728 Ga0207655_1000178 Ga0207655_100017844 83
456 3300025728 Ga0207655_1002439 Ga0207655_10024396 83
457 3300025728 Ga0207655_1006667 Ga0207655_10066676 83
458 3300025735 Ga0207713_1004567 Ga0207713_10045675 83
459 3300025899 Ga0207642_10326856 Ga0207642_103268562 83
460 3300025905 Ga0207685_10028322 Ga0207685_100283223 83
461 3300025909 Ga0207705_10523876 Ga0207705_105238762 83
462 3300025909 Ga0207705_10555669 Ga0207705_105556691 83
463 3300025912 Ga0207707_10099760 Ga0207707_100997601 83
464 3300025912 Ga0207707_10478197 Ga0207707_104781972 83
465 3300025913 Ga0207695_10312295 Ga0207695_103122952 83
466 3300025917 Ga0207660_10246673 Ga0207660_102466732 83
467 3300025917 Ga0207660_10267851 Ga0207660_102678513 83
468 3300025917 Ga0207660_10896771 Ga0207660_108967711 83
469 3300025919 Ga0207657_10006406 Ga0207657_100064063 83
470 3300025919 Ga0207657_10130964 Ga0207657_101309642 83
471 3300025919 Ga0207657_10462043 Ga0207657_104620432 83
472 3300025921 Ga0207652_10130638 Ga0207652_101306385 83
473 3300025921 Ga0207652_10609556 Ga0207652_106095561 83
474 3300025921 Ga0207652_11354912 Ga0207652_113549121 83
475 3300025922 Ga0207646_10045099 Ga0207646_100450993 83
476 3300025924 Ga0207694_11550883 Ga0207694_115508831 83
477 3300025925 Ga0207650_11164700 Ga0207650_111647002 83
478 3300025925 Ga0207650_11187015 Ga0207650_111870152 83
479 3300025927 Ga0207687_10983432 Ga0207687_109834321 83
480 3300025928 Ga0207700_10299650 Ga0207700_102996501 83
481 3300025928 Ga0207700_11024219 Ga0207700_110242192 83
482 3300025929 Ga0207664_10005768 Ga0207664_100057683 83
483 3300025929 Ga0207664_10285088 Ga0207664_102850882 83
484 3300025932 Ga0207690_10195927 Ga0207690_101959273 83
485 3300025933 Ga0207706_10001654 Ga0207706_1000165412 83
486 3300025933 Ga0207706_11261636 Ga0207706_112616361 83
487 3300025938 Ga0207704_10068645 Ga0207704_100686452 83
488 3300025939 Ga0207665_10497180 Ga0207665_104971801 83
489 3300025942 Ga0207689_10142791 Ga0207689_101427913 83
490 3300025942 Ga0207689_10564021 Ga0207689_105640212 83
491 3300025944 Ga0207661_10182726 Ga0207661_101827262 83
492 3300025944 Ga0207661_10331548 Ga0207661_103315483 83
493 3300025944 Ga0207661_10859782 Ga0207661_108597822 83
494 3300025944 Ga0207661_11928679 Ga0207661_119286791 83
495 3300025945 Ga0207679_10174752 Ga0207679_101747523 83
496 3300025949 Ga0207667_10196213 Ga0207667_101962132 83
497 3300025949 Ga0207667_10592641 Ga0207667_105926412 83
498 3300025949 Ga0207667_11973796 Ga0207667_119737962 83
499 3300025961 Ga0207712_11308047 Ga0207712_113080472 83
500 3300025972 Ga0207668_10011566 Ga0207668_100115665 83
501 3300025972 Ga0207668_10172260 Ga0207668_101722602 83
502 3300025981 Ga0207640_10922976 Ga0207640_109229761 83
503 3300025986 Ga0207658_10439556 Ga0207658_104395562 83
504 3300026035 Ga0207703_10198494 Ga0207703_101984942 83
505 3300026067 Ga0207678_10086130 Ga0207678_100861303 83
506 3300026067 Ga0207678_10566767 Ga0207678_105667672 83
507 3300026075 Ga0207708_10090469 Ga0207708_100904693 83
508 3300026078 Ga0207702_10463845 Ga0207702_104638452 83
509 3300026078 Ga0207702_11073427 Ga0207702_110734272 83
510 3300026078 Ga0207702_11991711 Ga0207702_119917111 83
511 3300026095 Ga0207676_10757013 Ga0207676_107570132 83
512 3300026116 Ga0207674_10003054 Ga0207674_100030545 83
513 3300026116 Ga0207674_11257613 Ga0207674_112576132 83
514 3300026118 Ga0207675_100585770 Ga0207675_1005857702 83
515 3300026121 Ga0207683_10460081 Ga0207683_104600812 83
516 3300026142 Ga0207698_11748024 Ga0207698_117480242 83
517 3300027312 Ga0209371_1000071 Ga0209371_1000071141 83
518 3300027312 Ga0209371_1000078 Ga0209371_100007854 83
519 3300027312 Ga0209371_1000154 Ga0209371_100015476 83
520 3300027312 Ga0209371_1000238 Ga0209371_100023844 83
521 3300027312 Ga0209371_1003313 Ga0209371_10033133 83
522 3300027907 Ga0207428_10128630 Ga0207428_101286302 83
523 3300027907 Ga0207428_10181259 Ga0207428_101812592 83
524 3300028379 Ga0268266_10026166 Ga0268266_100261664 83
525 3300028379 Ga0268266_10365819 Ga0268266_103658192 83
526 3300028380 Ga0268265_11806639 Ga0268265_118066391 83
527 3300029957 Ga0265324_10051358 Ga0265324_100513583 83
528 3300030500 Ga0268256_1000070 Ga0268256_1000070138 83
529 3300030500 Ga0268256_1000198 Ga0268256_100019822 83
530 3300030500 Ga0268256_1000237 Ga0268256_100023730 83
531 3300030500 Ga0268256_1000828 Ga0268256_10008282 83
532 3300030500 Ga0268256_1003012 Ga0268256_10030128 83
533 3300030734 Ga0316179_1100387 Ga0316179_11003871 83
534 3300030742 Ga0316183_1070363 Ga0316183_10703633 83
535 3300030744 Ga0316181_1247714 Ga0316181_12477145 83
536 3300030745 Ga0316182_1025437 Ga0316182_10254372 83
537 3300031548 Ga0307408_100184910 Ga0307408_1001849102 83
538 3300031731 Ga0307405_10124223 Ga0307405_101242232 83
539 3300031911 Ga0307412_11033320 Ga0307412_110333202 83
540 3300031995 Ga0307409_100879437 Ga0307409_1008794372 83
541 3300032002 Ga0307416_100033266 Ga0307416_1000332664 83
542 3300034819 Ga0373958_0023546 Ga0373958_0023546_760_1017 83
543 3300035091 Ga0373951_0222178 Ga0373951_0222178_93_344 83
544 3300035242 Ga0373962_0073388 Ga0373962_0073388_29_280 83
545 3300035691 Ga0373931_0403098 Ga0373931_0403098_543_797 83
546 3300037418 Ga0395900_0212298 Ga0395900_0212298_862_1122 83
547 3300037418 Ga0395900_0742795 Ga0395900_0742795_584_838 83
548 3300037466 Ga0395898_0181891 Ga0395898_0181891_902_1162 83
549 3300037466 Ga0395898_0467993 Ga0395898_0467993_721_975 83
550 3300037466 Ga0395898_0795423 Ga0395898_0795423_27_278 83
551 3300037471 Ga0395905_1660174 Ga0395905_1660174_162_416 83
552 3300038443 Ga0395901_0067100 Ga0395901_0067100_725_985 83
553 3300038443 Ga0395901_0327517 Ga0395901_0327517_962_1216 83
554 3300038443 Ga0395901_0696226 Ga0395901_0696226_153_404 83
555 3300038443 Ga0395901_1246900 Ga0395901_1246900_394_648 83
556 3300041405 Ga0439438_040678 Ga0439438_040678_829_1083 83
557 3300041407 Ga0439447_013860 Ga0439447_013860_1440_1694 83
558 3300041411 Ga0439466_0000015 Ga0439466_0000015_64360_64614 83
559 3300041411 Ga0439466_0125499 Ga0439466_0125499_221_475 83
560 3300041441 Ga0451787_541019 Ga0451787_541019_130_384 83
561 3300041452 Ga0451793_0693422 Ga0451793_0693422_184_438 83
562 3300041453 Ga0451797_0246926 Ga0451797_0246926_517_771 83
563 3300041494 Ga0451837_1561292 Ga0451837_1561292_132_386 83
564 3300041503 Ga0451847_0004397 Ga0451847_0004397_39_293 83
565 3300041509 Ga0451843_1341141 Ga0451843_1341141_39_293 83
566 3300041997 Ga0439431_0013547 Ga0439431_0013547_751_1005 83
567 3300042000 Ga0439437_000445 Ga0439437_000445_2796_3050 83
568 3300042003 Ga0439443_062992 Ga0439443_062992_122_376 83
569 3300042006 Ga0439432_003873 Ga0439432_003873_4899_5153 83
570 3300042006 Ga0439432_063541 Ga0439432_063541_27_281 83
571 3300042006 Ga0439432_101413 Ga0439432_101413_302_556 83
572 3300042010 Ga0439452_000050 Ga0439452_000050_69161_69415 83
573 3300042010 Ga0439452_078004 Ga0439452_078004_395_649 83
574 3300042012 Ga0439455_0132121 Ga0439455_0132121_56_310 83
575 3300042013 Ga0439456_023624 Ga0439456_023624_146_400 83
576 3300042016 Ga0439463_001954 Ga0439463_001954_3927_4181 83
577 3300042016 Ga0439463_038918 Ga0439463_038918_182_436 83
578 3300042115 Ga0450911_000003 Ga0450911_000003_146053_146307 83
579 3300042121 Ga0450919_018808 Ga0450919_018808_82_336 83
580 3300042130 Ga0450892_010248 Ga0450892_010248_524_778 83
581 3300042137 Ga0450902_081209 Ga0450902_081209_233_487 83
582 3300042138 Ga0450903_042055 Ga0450903_042055_245_499 83
583 3300042139 Ga0450904_000051 Ga0450904_000051_24904_25158 83
584 3300042146 Ga0450907_000033 Ga0450907_000033_42560_42814 83
585 3300042146 Ga0450907_015075 Ga0450907_015075_335_589 83
586 3300042156 Ga0439446_0024710 Ga0439446_0024710_762_1016 83
587 3300042185 Ga0450909_038568 Ga0450909_038568_440_694 83
588 3300042435 Ga0439434_0011383 Ga0439434_0011383_1492_1746 83
589 3300042438 Ga0439459_0006732 Ga0439459_0006732_971_1225 83
590 3300042439 Ga0439464_0001474 Ga0439464_0001474_3236_3490 83
591 3300042439 Ga0439464_0074493 Ga0439464_0074493_530_784 83
592 3300042530 Ga0450916_001523 Ga0450916_001523_205_459 83
593 3300042531 Ga0450918_011794 Ga0450918_011794_757_1011 83
594 3300042533 Ga0450901_020289 Ga0450901_020289_385_639 83
595 3300044684 Ga0466966_0072294 Ga0466966_0072294_960_1214 83
596 3300044684 Ga0466966_0074790 Ga0466966_0074790_67_321 83
597 3300044706 Ga0466964_0073005 Ga0466964_0073005_108_380 83
598 3300044901 Ga0466960_0032280 Ga0466960_0032280_1914_2168 83
599 3300044901 Ga0466960_0298179 Ga0466960_0298179_469_726 83
600 3300045976 Ga0466967_0053959 Ga0466967_0053959_662_916 83
601 3300045976 Ga0466967_0077380 Ga0466967_0077380_2210_2467 83
602 3300046454 Ga0495592_0290424 Ga0495592_0290424_346_600 83
603 3300046462 Ga0495651_0403042 Ga0495651_0403042_95_349 83
604 3300046463 Ga0495653_0339128 Ga0495653_0339128_376_630 83
605 3300046471 Ga0495650_0003645 Ga0495650_0003645_820_1074 83
606 3300046474 Ga0495605_0000620 Ga0495605_0000620_12706_12960 83
607 3300046492 Ga0495585_0007122 Ga0495585_0007122_3462_3716 83
608 3300046501 Ga0495607_0060488 Ga0495607_0060488_1464_1718 83
609 3300046501 Ga0495607_0239497 Ga0495607_0239497_163_417 83
610 3300046506 Ga0495583_0001861 Ga0495583_0001861_15755_16009 83
611 3300046506 Ga0495583_0008307 Ga0495583_0008307_1722_1976 83
612 3300046511 Ga0495608_0232988 Ga0495608_0232988_202_456 83
613 3300046516 Ga0495628_0280416 Ga0495628_0280416_487_741 83
614 3300046516 Ga0495628_0469087 Ga0495628_0469087_273_527 83
615 3300046519 Ga0495632_0004658 Ga0495632_0004658_6915_7169 83
616 3300046522 Ga0495643_0019080 Ga0495643_0019080_2905_3159 83
617 3300046538 Ga0495609_0000023 Ga0495609_0000023_191117_191371 83
618 3300046538 Ga0495609_0139924 Ga0495609_0139924_545_799 83
619 3300046543 Ga0495645_0055038 Ga0495645_0055038_121_375 83
620 3300046665 Ga0495661_0000072 Ga0495661_0000072_105777_106031 83
621 3300046692 Ga0495671_0252608 Ga0495671_0252608_264_518 83
622 3300046810 Ga0495660_0007318 Ga0495660_0007318_3492_3746 83
623 3300047319 Ga0495674_0589997 Ga0495674_0589997_132_386 83
624 3300047320 Ga0495672_0000128 Ga0495672_0000128_49960_50214 83
625 3300047321 Ga0495676_0248982 Ga0495676_0248982_632_886 83
626 3300047322 Ga0495680_0601790 Ga0495680_0601790_210_464 83
627 3300047446 Ga0495679_008321 Ga0495679_008321_235_489 83
628 3300047469 Ga0495673_0016101 Ga0495673_0016101_2470_2724 83
629 3300047469 Ga0495673_0246572 Ga0495673_0246572_75_329 83
630 3300047470 Ga0495681_0252984 Ga0495681_0252984_252_506 83
631 3300047471 Ga0495684_0251365 Ga0495684_0251365_577_831 83
632 3300048903 Ga0496100_0015942 Ga0496100_0015942_3888_4142 83
633 3300048905 Ga0496102_0057966 Ga0496102_0057966_449_703 83
634 3300048905 Ga0496102_0361606 Ga0496102_0361606_842_1096 83
635 3300048905 Ga0496102_0447118 Ga0496102_0447118_234_485 83
636 3300048906 Ga0496103_0049425 Ga0496103_0049425_1675_1926 83
637 3300048906 Ga0496103_0199167 Ga0496103_0199167_329_583 83
638 3300048908 Ga0496105_0730731 Ga0496105_0730731_380_634 83
639 3300048911 Ga0496108_0321424 Ga0496108_0321424_1009_1263 83
640 3300048912 Ga0496109_1404587 Ga0496109_1404587_99_353 83
641 3300048913 Ga0496110_1662894 Ga0496110_1662894_89_343 83
642 3300048913 Ga0496110_1754178 Ga0496110_1754178_45_299 83
643 3300048915 Ga0496112_0109287 Ga0496112_0109287_444_713 83
644 3300048915 Ga0496112_0124794 Ga0496112_0124794_1140_1394 83
645 3300048915 Ga0496112_0318901 Ga0496112_0318901_277_531 83
646 3300048916 Ga0496113_0366941 Ga0496113_0366941_453_707 83
647 3300048917 Ga0496114_1493279 Ga0496114_1493279_100_354 83
648 3300048918 Ga0496115_1274877 Ga0496115_1274877_160_414 83
649 3300048919 Ga0496116_0000209 Ga0496116_0000209_59178_59432 83
650 3300048919 Ga0496116_0003465 Ga0496116_0003465_346_600 83
651 3300048919 Ga0496116_0018485 Ga0496116_0018485_843_1097 83
652 3300048920 Ga0496117_0001785 Ga0496117_0001785_1396_1650 83
653 3300048920 Ga0496117_0002590 Ga0496117_0002590_2396_2650 83
654 3300048921 Ga0496118_0002610 Ga0496118_0002610_17195_17449 83
655 3300048921 Ga0496118_0010048 Ga0496118_0010048_6058_6312 83
656 3300048922 Ga0496119_0000259 Ga0496119_0000259_54822_55076 83
657 3300048922 Ga0496119_0000294 Ga0496119_0000294_19940_20194 83
658 3300048922 Ga0496119_0002336 Ga0496119_0002336_11221_11475 83
659 3300048923 Ga0496120_0000314 Ga0496120_0000314_58795_59049 83
660 3300048923 Ga0496120_0000482 Ga0496120_0000482_54822_55076 83
661 3300048924 Ga0496121_0000244 Ga0496121_0000244_49960_50214 83
662 3300048925 Ga0496122_0182722 Ga0496122_0182722_412_666 83
663 3300048926 Ga0496123_0099034 Ga0496123_0099034_1147_1401 83
664 3300048926 Ga0496123_0255390 Ga0496123_0255390_61_315 83
665 3300048927 Ga0496124_0000295 Ga0496124_0000295_49993_50247 83
666 3300048927 Ga0496124_0011703 Ga0496124_0011703_2837_3091 83
667 3300048927 Ga0496124_0013215 Ga0496124_0013215_2944_3198 83
668 3300048928 Ga0496125_0001070 Ga0496125_0001070_3462_3716 83
669 3300048929 Ga0496126_0026475 Ga0496126_0026475_3935_4189 83
670 3300049568 Ga0501031_0033752 Ga0501031_0033752_1575_1829 83
671 3300049568 Ga0501031_0040753 Ga0501031_0040753_1880_2131 83
672 3300049569 Ga0501032_0066804 Ga0501032_0066804_1154_1408 83
673 3300049570 Ga0501033_0152539 Ga0501033_0152539_1131_1385 83
674 3300049571 Ga0501034_0339714 Ga0501034_0339714_570_824 83
675 3300049572 Ga0501036_0026923 Ga0501036_0026923_2294_2545 83
676 3300049572 Ga0501036_0033071 Ga0501036_0033071_2713_2967 83
677 3300049573 Ga0501037_0045395 Ga0501037_0045395_1289_1543 83
678 3300049573 Ga0501037_0110276 Ga0501037_0110276_1522_1773 83
679 3300049574 Ga0501038_0059358 Ga0501038_0059358_1152_1406 83
680 3300049575 Ga0501039_0049253 Ga0501039_0049253_1341_1595 83
681 3300049575 Ga0501039_0311800 Ga0501039_0311800_395_646 83
682 3300049576 Ga0501040_0029879 Ga0501040_0029879_863_1117 83
683 3300049576 Ga0501040_0179540 Ga0501040_0179540_658_909 83
684 3300049577 Ga0501041_0118225 Ga0501041_0118225_868_1122 83
685 3300049577 Ga0501041_0294868 Ga0501041_0294868_728_979 83
686 3300049578 Ga0501042_0010968 Ga0501042_0010968_4192_4446 83
687 3300049578 Ga0501042_0063944 Ga0501042_0063944_838_1089 83
688 3300049579 Ga0501043_0164229 Ga0501043_0164229_1428_1682 83
689 3300049580 Ga0501046_0109882 Ga0501046_0109882_1503_1757 83
690 3300049582 Ga0501048_0006003 Ga0501048_0006003_7210_7464 83
691 3300049582 Ga0501048_0199152 Ga0501048_0199152_204_455 83
692 3300049584 Ga0501068_0223682 Ga0501068_0223682_375_629 83
693 3300049587 Ga0501071_0004938 Ga0501071_0004938_1202_1456 83
694 3300049587 Ga0501071_0063774 Ga0501071_0063774_259_510 83
695 3300049588 Ga0501072_0001670 Ga0501072_0001670_4801_5055 83
696 3300049588 Ga0501072_0007342 Ga0501072_0007342_1848_2099 83
697 3300049589 Ga0501073_0100750 Ga0501073_0100750_514_768 83
698 3300049590 Ga0501074_0023214 Ga0501074_0023214_3247_3501 83
699 3300049590 Ga0501074_0234290 Ga0501074_0234290_737_988 83
700 3300049591 Ga0501075_0135913 Ga0501075_0135913_592_843 83
701 3300049591 Ga0501075_0151799 Ga0501075_0151799_428_682 83
702 3300049592 Ga0501076_0045598 Ga0501076_0045598_1240_1491 83
703 3300049592 Ga0501076_0195628 Ga0501076_0195628_1338_1592 83
704 3300049593 Ga0501077_0320310 Ga0501077_0320310_144_398 83
705 3300049741 Ga0501079_0012586 Ga0501079_0012586_5782_6036 83
706 3300049741 Ga0501079_0183427 Ga0501079_0183427_499_750 83
707 3300049742 Ga0501080_0141479 Ga0501080_0141479_1573_1827 83
708 3300049742 Ga0501080_0942560 Ga0501080_0942560_445_696 83
709 3300049743 Ga0501081_0027220 Ga0501081_0027220_1432_1683 83
710 3300049743 Ga0501081_0034258 Ga0501081_0034258_1167_1421 83
711 3300049744 Ga0501083_0198971 Ga0501083_0198971_466_717 83
712 3300049822 Ga0501035_0104709 Ga0501035_0104709_1275_1529 83
713 3300049824 Ga0501045_0005511 Ga0501045_0005511_7117_7371 83
714 3300049824 Ga0501045_0073662 Ga0501045_0073662_974_1225 83
715 3300049853 Ga0501226_000065 Ga0501226_000065_33255_33509 83
716 3300050491 nmdc:mga00v17_211280_c2 nmdc:mga00v17_211280_c2_174_428 83
717 3300050507 nmdc:mga05p37_473816_c1 nmdc:mga05p37_473816_c1_198_455 83
718 3300050511 nmdc:mga08y16_1899369_c1 nmdc:mga08y16_1899369_c1_98_352 83
719 3300050511 nmdc:mga08y16_662711_c1 nmdc:mga08y16_662711_c1_246_503 83
720 3300050516 nmdc:mga0sz30_178924_c1 nmdc:mga0sz30_178924_c1_337_591 83
721 3300053077 Ga0495601_0740473 Ga0495601_0740473_159_413 83
722 3300053084 Ga0495595_0279910 Ga0495595_0279910_445_699 83
723 3300053130 Ga0500642_0092368 Ga0500642_0092368_57_317 83
724 3300053142 Ga0500577_0203057 Ga0500577_0203057_11_265 83
725 3300054114 Ga0501084_0119462 Ga0501084_0119462_1122_1376 83
726 3300054114 Ga0501084_0695319 Ga0501084_0695319_509_760 83
727 3300060353 Ga0501082_0007164 Ga0501082_0007164_7028_7282 83
728 3300060353 Ga0501082_0133015 Ga0501082_0133015_470_721 83
729 3300061734 Ga0530510_0067453 Ga0530510_0067453_1503_1757 83
730 3300061734 Ga0530510_0491577 Ga0530510_0491577_370_621 83

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

1

58

0.98

PF13417

GST_N_3

Glutathione S-transferase, N-terminal domain

1

64

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ht9-assembly1.cif.gz_B the structure of dimeric human glutaredoxin 2 0.943 2 82
4tr1-assembly2.cif.gz_B crystal structure of gsh-bound cgrx2/c15s 0.9376 1 81
2e7p-assembly1.cif.gz_B crystal structure of the holo form of glutaredoxin c1 from populus tremula x tremuloides 0.9346 4 82
4tr0-assembly2.cif.gz_B crystal structure of gssg-bound cgrx2 0.9344 1 82
2fls-assembly1.cif.gz_A crystal structure of human glutaredoxin 2 complexed with glutathione 0.9331 2 82
ID Description Score Start End Superfamily
af_O36032_1_101_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9408 4 81 3.40.30.10
af_B6SN61_11_124_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9392 4 82 3.40.30.10
af_Q923X4_47_156_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9337 4 82 3.40.30.10
4tr0B00 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9329 1 82 3.40.30.10
af_Q9UTI2_1_108_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9273 4 82 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A538K841-F1-model_v4 Glutaredoxin 0.9961 1 83 GO:0005737
GO:0015038
GO:0034599
AF-A0A7M2YVS6-F1-model_v4 Glutaredoxin 0.9788 2 82 GO:0015035
AF-A0A672K3G4-F1-model_v4 Glutaredoxin-2, mitochondrial 0.9657 4 82 GO:0005739
GO:0015035
GO:0051537
AF-A0A177B921-F1-model_v4 Glutaredoxin-2, mitochondrial 0.9648 2 82 GO:0005739
GO:0015035
GO:0016020
AF-A0A101VDH8-F1-model_v4 Glutaredoxin domain-containing protein 0.964 1 82 GO:0005737
GO:0015038
GO:0034599

Feature Viewer

pLDDT pTM Quality
94.22 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map