F477923
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 730 | 403 | 716 | 83 |
Family's Representative Sequence
| Representative Sequence | 3300031691|Ga0316579_10378930|Ga0316579_103789302 |
| Length | 98 |
| Sequence | MYSTAFCPYCIRARALLDSKGVSYRDIRIDIESQFRVEMERRSGRTSVPQIFVGDTHVGGFDDMYALERRGTLDALLRSAAPGEAAVQCNLPHPAMKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2599185299 | Pantoea ananatis NFR11 | Isolate | Rhizoplane |
| 2 | 2648501693 | Pantoea ananatis B1-9 | Isolate | Rhizosphere |
| 3 | 2684622997 | Pantoea ananatis NFIX48 | Isolate | Rhizoplane |
| 4 | 2808606414 | Pantoea sp. SJZ147 | Isolate | Rhizosphere |
| 5 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 6 | 2844528606 | Pantoea sp. R-72498 v. 2 | Isolate | Unclassified |
| 7 | 2847797336 | Pantoea ananatis NN08200 | Isolate | Unclassified |
| 8 | 2865014394 | Pantoea sp. R-71966 | Isolate | Unclassified |
| 9 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 10 | 2939602548 | Pantoea dispersa 1175 | Isolate | Rhizosphere |
| 11 | 2945951305 | Pantoea agglomerans W2I1 | Isolate | Rhizosphere |
| 12 | 2984494565 | Pantoea ananatis SORGH_AS197 | Isolate | Aerial Root |
| 13 | 2990261002 | Pantoea ananatis SORGH_AS213 | Isolate | Aerial Root |
| 14 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 15 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 16 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 17 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 18 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 19 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 67 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 68 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 69 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 71 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 72 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 73 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 74 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 75 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 79 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 80 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 83 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 84 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 85 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 91 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 92 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 94 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 95 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 122 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 126 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 130 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 134 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 195 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 196 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 197 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 198 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 199 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 200 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 201 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 202 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 203 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 204 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 205 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 208 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 209 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 210 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 211 | 3300031691 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA | Metagenome | Rhizosphere |
| 212 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 214 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 215 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 216 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 217 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 218 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 219 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 220 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 221 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 224 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 225 | 3300032168 | Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 226 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 227 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 228 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 231 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 234 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 235 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 236 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 237 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 238 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 239 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 240 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 241 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 242 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 243 | 3300041441 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG | Metagenome | Rhizoplane |
| 244 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 245 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 247 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 248 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 249 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 250 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 251 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 252 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 253 | 3300042003 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 | Metagenome | Rhizosphere |
| 254 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 255 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 256 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 257 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 258 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 259 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 260 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 261 | 3300042121 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 | Metagenome | Rhizosphere |
| 262 | 3300042130 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030L_E14_070516_97 | Metagenome | Rhizosphere |
| 263 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 264 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 265 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 266 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 267 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 268 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 269 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 270 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 271 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 272 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 273 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 274 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 275 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 276 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 277 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 278 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 279 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 280 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 281 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 334 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 335 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 336 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 337 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 338 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 339 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 340 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 341 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 342 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 343 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 344 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 345 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 346 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 347 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 348 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 349 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 350 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 351 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 352 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 353 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 354 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 355 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 356 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049656 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought | Metagenome | Rhizosphere |
| 379 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 380 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 381 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 382 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 383 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049851 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_B_0_drought | Metagenome | Rhizosphere |
| 387 | 3300049853 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought | Metagenome | Rhizosphere |
| 388 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 389 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 396 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 399 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 400 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 401 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 402 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 403 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 96.44 |
| Metatranscriptomes | 1.64 |
| Isolates | 1.92 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.27 |
| Bulb | 0 |
| Endosphere | 0.96 |
| Nodule | 0.27 |
| Rhizoplane | 5.07 |
| Rhizosphere | 88.77 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24746J21847_1058514 | 3300001977 | Bacteria | 549 |
| 2 | JGI24739J22299_10000283 | 3300001989 | Bacteria | 17041 |
| 3 | JGI24737J22298_10025257 | 3300001990 | Bacteria | 1879 |
| 4 | Ga0058692_1002795 | 3300003856 | Bacteria | 5734 |
| 5 | Ga0058692_1037455 | 3300003856 | Bacteria | 871 |
| 6 | Ga0070658_10438177 | 3300005327 | Bacteria | 1125 |
| 7 | Ga0070683_100029800 | 3300005329 | Bacteria | 4945 |
| 8 | Ga0070683_100073626 | 3300005329 | Bacteria | 3189 |
| 9 | Ga0070683_100709401 | 3300005329 | Bacteria | 963 |
| 10 | Ga0070690_101437737 | 3300005330 | Bacteria | 556 |
| 11 | Ga0070670_100394451 | 3300005331 | Unclassified | 1221 |
| 12 | Ga0070670_100406116 | 3300005331 | Bacteria | 1203 |
| 13 | Ga0068869_100272185 | 3300005334 | Bacteria | 1359 |
| 14 | Ga0068869_100333026 | 3300005334 | Bacteria | 1234 |
| 15 | Ga0070680_100122146 | 3300005336 | Bacteria | 2175 |
| 16 | Ga0070680_100130580 | 3300005336 | Bacteria | 2102 |
| 17 | Ga0070680_100393420 | 3300005336 | Bacteria | 1181 |
| 18 | Ga0070680_100492402 | 3300005336 | Bacteria | 1048 |
| 19 | Ga0070680_100847820 | 3300005336 | Bacteria | 788 |
| 20 | Ga0070682_102005442 | 3300005337 | Unclassified | 509 |
| 21 | Ga0070660_100006354 | 3300005339 | Bacteria | 8187 |
| 22 | Ga0070660_100428559 | 3300005339 | Bacteria | 1096 |
| 23 | Ga0070660_100755048 | 3300005339 | Bacteria | 817 |
| 24 | Ga0070660_101265839 | 3300005339 | Unclassified | 626 |
| 25 | Ga0070691_10063178 | 3300005341 | Bacteria | 1784 |
| 26 | Ga0070661_100040281 | 3300005344 | Bacteria | 3408 |
| 27 | Ga0070661_100061491 | 3300005344 | Bacteria | 2757 |
| 28 | Ga0070661_100566336 | 3300005344 | Bacteria | 916 |
| 29 | Ga0070668_100012549 | 3300005347 | Bacteria | 6310 |
| 30 | Ga0070675_100112421 | 3300005354 | Bacteria | 2306 |
| 31 | Ga0070675_100267290 | 3300005354 | Bacteria | 1500 |
| 32 | Ga0070671_101903262 | 3300005355 | Bacteria | 529 |
| 33 | Ga0070674_100145246 | 3300005356 | Bacteria | 1785 |
| 34 | Ga0070673_100511073 | 3300005364 | Bacteria | 1088 |
| 35 | Ga0070688_100036002 | 3300005365 | Bacteria | 3009 |
| 36 | Ga0070659_100161739 | 3300005366 | Bacteria | 1831 |
| 37 | Ga0070659_100261155 | 3300005366 | Bacteria | 1437 |
| 38 | Ga0070667_100217408 | 3300005367 | Bacteria | 1700 |
| 39 | Ga0070709_10062059 | 3300005434 | Bacteria | 2382 |
| 40 | Ga0070714_100014073 | 3300005435 | Bacteria | 6420 |
| 41 | Ga0070714_100213003 | 3300005435 | Bacteria | 1772 |
| 42 | Ga0070714_100280213 | 3300005435 | Unclassified | 1548 |
| 43 | Ga0070713_101143222 | 3300005436 | Bacteria | 753 |
| 44 | Ga0070701_10809212 | 3300005438 | Bacteria | 640 |
| 45 | Ga0070711_101945637 | 3300005439 | Bacteria | 517 |
| 46 | Ga0070705_100401888 | 3300005440 | Bacteria | 1015 |
| 47 | Ga0070705_101418814 | 3300005440 | Bacteria | 579 |
| 48 | Ga0070700_100028625 | 3300005441 | Bacteria | 3316 |
| 49 | Ga0070700_100260899 | 3300005441 | Bacteria | 1248 |
| 50 | Ga0070694_100282629 | 3300005444 | Bacteria | 1266 |
| 51 | Ga0070694_100762237 | 3300005444 | Bacteria | 791 |
| 52 | Ga0070708_100208609 | 3300005445 | Bacteria | 1830 |
| 53 | Ga0070708_100279249 | 3300005445 | Bacteria | 1572 |
| 54 | Ga0070678_100297595 | 3300005456 | Bacteria | 1370 |
| 55 | Ga0070678_100412325 | 3300005456 | Unclassified | 1176 |
| 56 | Ga0070678_100614098 | 3300005456 | Bacteria | 972 |
| 57 | Ga0070662_100000583 | 3300005457 | Bacteria | 22202 |
| 58 | Ga0070662_100122522 | 3300005457 | Bacteria | 1994 |
| 59 | Ga0070662_100658423 | 3300005457 | Bacteria | 884 |
| 60 | Ga0070681_10026332 | 3300005458 | Bacteria | 5846 |
| 61 | Ga0070681_10063954 | 3300005458 | Bacteria | 3651 |
| 62 | Ga0070681_10757258 | 3300005458 | Bacteria | 888 |
| 63 | Ga0070681_11045938 | 3300005458 | Bacteria | 737 |
| 64 | Ga0068867_100100912 | 3300005459 | Bacteria | 2204 |
| 65 | Ga0068867_100135245 | 3300005459 | Unclassified | 1921 |
| 66 | Ga0070685_10056717 | 3300005466 | Bacteria | 2278 |
| 67 | Ga0070706_100422510 | 3300005467 | Bacteria | 1240 |
| 68 | Ga0070707_100034911 | 3300005468 | Bacteria | 4795 |
| 69 | Ga0070699_100014492 | 3300005518 | Bacteria | 6779 |
| 70 | Ga0070679_100235833 | 3300005530 | Bacteria | 1788 |
| 71 | Ga0070679_100397913 | 3300005530 | Bacteria | 1323 |
| 72 | Ga0070679_100637111 | 3300005530 | Bacteria | 1009 |
| 73 | Ga0070679_101996008 | 3300005530 | Unclassified | 529 |
| 74 | Ga0070684_100061758 | 3300005535 | Bacteria | 3280 |
| 75 | Ga0070684_100553290 | 3300005535 | Unclassified | 1068 |
| 76 | Ga0070684_100969609 | 3300005535 | Bacteria | 798 |
| 77 | Ga0070684_101120189 | 3300005535 | Bacteria | 740 |
| 78 | Ga0070684_101765697 | 3300005535 | Bacteria | 584 |
| 79 | Ga0068853_100511976 | 3300005539 | Bacteria | 1134 |
| 80 | Ga0070672_100296036 | 3300005543 | Bacteria | 1371 |
| 81 | Ga0070672_100378321 | 3300005543 | Bacteria | 1211 |
| 82 | Ga0070686_100153526 | 3300005544 | Bacteria | 1614 |
| 83 | Ga0070686_100185569 | 3300005544 | Bacteria | 1481 |
| 84 | Ga0070695_100205059 | 3300005545 | Bacteria | 1412 |
| 85 | Ga0070695_101324058 | 3300005545 | Bacteria | 595 |
| 86 | Ga0070696_101053725 | 3300005546 | Bacteria | 682 |
| 87 | Ga0070693_100045777 | 3300005547 | Bacteria | 2482 |
| 88 | Ga0070693_101599224 | 3300005547 | Bacteria | 512 |
| 89 | Ga0070665_100025626 | 3300005548 | Bacteria | 5941 |
| 90 | Ga0070665_101949515 | 3300005548 | Unclassified | 593 |
| 91 | Ga0070665_102409774 | 3300005548 | Bacteria | 528 |
| 92 | Ga0070704_100241704 | 3300005549 | Bacteria | 1478 |
| 93 | Ga0068855_100053717 | 3300005563 | Bacteria | 4738 |
| 94 | Ga0068855_100053997 | 3300005563 | Bacteria | 4725 |
| 95 | Ga0068855_100360618 | 3300005563 | Bacteria | 1599 |
| 96 | Ga0068855_100558565 | 3300005563 | Unclassified | 1238 |
| 97 | Ga0068855_101753660 | 3300005563 | Bacteria | 632 |
| 98 | Ga0070664_100063340 | 3300005564 | Bacteria | 3153 |
| 99 | Ga0070664_101714905 | 3300005564 | Bacteria | 595 |
| 100 | Ga0068857_100000015 | 3300005577 | Bacteria | 98770 |
| 101 | Ga0068857_100000499 | 3300005577 | Bacteria | 28113 |
| 102 | Ga0068857_100169924 | 3300005577 | Bacteria | 1981 |
| 103 | Ga0068857_100178538 | 3300005577 | Bacteria | 1932 |
| 104 | Ga0068857_101795359 | 3300005577 | Unclassified | 600 |
| 105 | Ga0068854_100306953 | 3300005578 | Bacteria | 1286 |
| 106 | Ga0068856_101420122 | 3300005614 | Bacteria | 708 |
| 107 | Ga0068856_101538945 | 3300005614 | Bacteria | 679 |
| 108 | Ga0068856_102246368 | 3300005614 | Unclassified | 554 |
| 109 | Ga0070702_100670725 | 3300005615 | Bacteria | 787 |
| 110 | Ga0070702_101265094 | 3300005615 | Bacteria | 598 |
| 111 | Ga0068852_100067986 | 3300005616 | Bacteria | 3116 |
| 112 | Ga0068852_100753921 | 3300005616 | Bacteria | 986 |
| 113 | Ga0068852_101342931 | 3300005616 | Bacteria | 737 |
| 114 | Ga0068852_101373980 | 3300005616 | Bacteria | 728 |
| 115 | Ga0068859_100216044 | 3300005617 | Bacteria | 2005 |
| 116 | Ga0068864_100535064 | 3300005618 | Bacteria | 1131 |
| 117 | Ga0068866_10192567 | 3300005718 | Bacteria | 1212 |
| 118 | Ga0068866_11407839 | 3300005718 | Bacteria | 510 |
| 119 | Ga0068861_100216065 | 3300005719 | Bacteria | 1618 |
| 120 | Ga0068861_102190785 | 3300005719 | Bacteria | 554 |
| 121 | Ga0068851_10001471 | 3300005834 | Bacteria | 10326 |
| 122 | Ga0068851_10293926 | 3300005834 | Bacteria | 932 |
| 123 | Ga0068863_100288730 | 3300005841 | Bacteria | 1590 |
| 124 | Ga0068858_100375593 | 3300005842 | Bacteria | 1364 |
| 125 | Ga0068862_100701895 | 3300005844 | Bacteria | 980 |
| 126 | Ga0068862_102044956 | 3300005844 | Bacteria | 584 |
| 127 | Ga0081455_10003895 | 3300005937 | Bacteria | 16994 |
| 128 | Ga0081455_10263195 | 3300005937 | Bacteria | 1255 |
| 129 | Ga0081538_10326066 | 3300005981 | Unclassified | 559 |
| 130 | Ga0075364_10426563 | 3300006051 | Bacteria | 905 |
| 131 | Ga0075432_10085423 | 3300006058 | Bacteria | 1149 |
| 132 | Ga0070715_10008667 | 3300006163 | Bacteria | 3553 |
| 133 | Ga0075369_10046641 | 3300006186 | Bacteria | 1866 |
| 134 | Ga0075366_10007989 | 3300006195 | Bacteria | 5860 |
| 135 | Ga0097621_100525381 | 3300006237 | Bacteria | 1075 |
| 136 | Ga0068871_101556192 | 3300006358 | Bacteria | 625 |
| 137 | Ga0075428_100159732 | 3300006844 | Bacteria | 2447 |
| 138 | Ga0075431_101064808 | 3300006847 | Bacteria | 774 |
| 139 | Ga0075429_100310215 | 3300006880 | Bacteria | 1381 |
| 140 | Ga0068865_100148510 | 3300006881 | Bacteria | 1775 |
| 141 | Ga0068865_100369488 | 3300006881 | Bacteria | 1167 |
| 142 | Ga0097620_100216040 | 3300006931 | Bacteria | 2005 |
| 143 | Ga0079104_1000172 | 3300006946 | Bacteria | 92160 |
| 144 | Ga0079104_1007460 | 3300006946 | Bacteria | 3961 |
| 145 | Ga0075435_100084508 | 3300007076 | Bacteria | 2611 |
| 146 | Ga0105251_10000234 | 3300009011 | Bacteria | 55844 |
| 147 | Ga0105251_10191698 | 3300009011 | Bacteria | 921 |
| 148 | Ga0105244_10002167 | 3300009036 | Bacteria | 15053 |
| 149 | Ga0105244_10002274 | 3300009036 | Bacteria | 14607 |
| 150 | Ga0105244_10002611 | 3300009036 | Bacteria | 13502 |
| 151 | Ga0105244_10010141 | 3300009036 | Bacteria | 5732 |
| 152 | Ga0105244_10016612 | 3300009036 | Bacteria | 4187 |
| 153 | Ga0105244_10020509 | 3300009036 | Bacteria | 3670 |
| 154 | Ga0105244_10048846 | 3300009036 | Bacteria | 2164 |
| 155 | Ga0105244_10068461 | 3300009036 | Bacteria | 1774 |
| 156 | Ga0105244_10246549 | 3300009036 | Bacteria | 833 |
| 157 | Ga0105250_10000012 | 3300009092 | Bacteria | 274899 |
| 158 | Ga0105250_10001974 | 3300009092 | Bacteria | 10617 |
| 159 | Ga0105250_10036270 | 3300009092 | Bacteria | 1979 |
| 160 | Ga0105250_10097189 | 3300009092 | Bacteria | 1201 |
| 161 | Ga0105250_10113388 | 3300009092 | Bacteria | 1111 |
| 162 | Ga0105240_10065139 | 3300009093 | Bacteria | 4524 |
| 163 | Ga0105240_10068856 | 3300009093 | Bacteria | 4382 |
| 164 | Ga0105240_10164944 | 3300009093 | Bacteria | 2628 |
| 165 | Ga0105240_10563181 | 3300009093 | Bacteria | 1259 |
| 166 | Ga0111539_10009131 | 3300009094 | Bacteria | 12545 |
| 167 | Ga0111539_10040195 | 3300009094 | Bacteria | 5632 |
| 168 | Ga0111539_10074492 | 3300009094 | Bacteria | 4000 |
| 169 | Ga0111539_10683961 | 3300009094 | Bacteria | 1194 |
| 170 | Ga0105245_10120739 | 3300009098 | Bacteria | 2448 |
| 171 | Ga0105245_10295861 | 3300009098 | Bacteria | 1587 |
| 172 | Ga0105245_11292833 | 3300009098 | Bacteria | 778 |
| 173 | Ga0105245_12148494 | 3300009098 | Bacteria | 612 |
| 174 | Ga0105247_10167719 | 3300009101 | Bacteria | 1458 |
| 175 | Ga0114129_10095892 | 3300009147 | Bacteria | 4108 |
| 176 | Ga0114129_10218064 | 3300009147 | Bacteria | 2576 |
| 177 | Ga0105243_10000094 | 3300009148 | Bacteria | 101031 |
| 178 | Ga0105243_10037198 | 3300009148 | Bacteria | 3781 |
| 179 | Ga0105243_10163990 | 3300009148 | Bacteria | 1919 |
| 180 | Ga0105243_11033305 | 3300009148 | Bacteria | 826 |
| 181 | Ga0105243_11160990 | 3300009148 | Bacteria | 783 |
| 182 | Ga0105242_10168080 | 3300009176 | Bacteria | 1925 |
| 183 | Ga0105248_10555845 | 3300009177 | Bacteria | 1295 |
| 184 | Ga0105237_10821396 | 3300009545 | Bacteria | 936 |
| 185 | Ga0105237_11993251 | 3300009545 | Bacteria | 589 |
| 186 | Ga0105249_10291677 | 3300009553 | Bacteria | 1633 |
| 187 | Ga0105249_11035982 | 3300009553 | Bacteria | 890 |
| 188 | Ga0105249_12018115 | 3300009553 | Bacteria | 649 |
| 189 | Ga0105239_10398025 | 3300010375 | Bacteria | 1558 |
| 190 | Ga0105239_10683216 | 3300010375 | Bacteria | 1173 |
| 191 | Ga0105239_10689438 | 3300010375 | Bacteria | 1168 |
| 192 | Ga0105239_10752211 | 3300010375 | Bacteria | 1116 |
| 193 | Ga0105239_11853621 | 3300010375 | Bacteria | 699 |
| 194 | Ga0105246_10480342 | 3300011119 | Bacteria | 1051 |
| 195 | Ga0105246_10678812 | 3300011119 | Bacteria | 900 |
| 196 | Ga0157373_10054022 | 3300013100 | Bacteria | 2855 |
| 197 | Ga0157373_10055716 | 3300013100 | Bacteria | 2808 |
| 198 | Ga0157373_10184517 | 3300013100 | Unclassified | 1469 |
| 199 | Ga0157373_10242675 | 3300013100 | Bacteria | 1273 |
| 200 | Ga0157373_10974196 | 3300013100 | Unclassified | 632 |
| 201 | Ga0157371_10000957 | 3300013102 | Bacteria | 32068 |
| 202 | Ga0157371_10005015 | 3300013102 | Bacteria | 11346 |
| 203 | Ga0157371_10143320 | 3300013102 | Bacteria | 1702 |
| 204 | Ga0157371_10622095 | 3300013102 | Bacteria | 804 |
| 205 | Ga0157370_10002299 | 3300013104 | Bacteria | 23148 |
| 206 | Ga0157370_10022195 | 3300013104 | Bacteria | 6317 |
| 207 | Ga0157370_10032663 | 3300013104 | Bacteria | 5081 |
| 208 | Ga0157370_10328080 | 3300013104 | Bacteria | 1411 |
| 209 | Ga0157369_10159116 | 3300013105 | Bacteria | 2385 |
| 210 | Ga0157369_10352439 | 3300013105 | Bacteria | 1529 |
| 211 | Ga0157369_11543071 | 3300013105 | Bacteria | 675 |
| 212 | Ga0157374_11642422 | 3300013296 | Bacteria | 667 |
| 213 | Ga0157378_10802571 | 3300013297 | Bacteria | 967 |
| 214 | Ga0157378_11624136 | 3300013297 | Bacteria | 693 |
| 215 | Ga0163162_10041125 | 3300013306 | Bacteria | 4624 |
| 216 | Ga0163162_10153577 | 3300013306 | Bacteria | 2421 |
| 217 | Ga0163162_10503678 | 3300013306 | Bacteria | 1341 |
| 218 | Ga0163162_10933063 | 3300013306 | Bacteria | 980 |
| 219 | Ga0157372_10014550 | 3300013307 | Bacteria | 8418 |
| 220 | Ga0157372_10020586 | 3300013307 | Bacteria | 7120 |
| 221 | Ga0157372_10088962 | 3300013307 | Bacteria | 3507 |
| 222 | Ga0157372_10586544 | 3300013307 | Bacteria | 1299 |
| 223 | Ga0157372_11420355 | 3300013307 | Bacteria | 800 |
| 224 | Ga0157372_11622289 | 3300013307 | Bacteria | 744 |
| 225 | Ga0157372_11761561 | 3300013307 | Bacteria | 712 |
| 226 | Ga0157375_10101127 | 3300013308 | Bacteria | 2965 |
| 227 | Ga0163163_12465741 | 3300014325 | Unclassified | 578 |
| 228 | Ga0157380_11983174 | 3300014326 | Bacteria | 644 |
| 229 | Ga0157380_12166150 | 3300014326 | Bacteria | 619 |
| 230 | Ga0182008_10297617 | 3300014497 | Bacteria | 843 |
| 231 | Ga0157377_10106473 | 3300014745 | Bacteria | 1679 |
| 232 | Ga0157377_11138737 | 3300014745 | Bacteria | 600 |
| 233 | Ga0157379_10736474 | 3300014968 | Bacteria | 927 |
| 234 | Ga0157376_11430456 | 3300014969 | Bacteria | 723 |
| 235 | Ga0182006_1001057 | 3300015261 | Bacteria | 17773 |
| 236 | Ga0182006_1005498 | 3300015261 | Bacteria | 6029 |
| 237 | Ga0182006_1063654 | 3300015261 | Bacteria | 1385 |
| 238 | Ga0182006_1121984 | 3300015261 | Bacteria | 904 |
| 239 | Ga0182007_10010004 | 3300015262 | Bacteria | 3778 |
| 240 | Ga0163161_10016748 | 3300017792 | Bacteria | 5122 |
| 241 | Ga0163161_11633173 | 3300017792 | Bacteria | 569 |
| 242 | Ga0206356_10385242 | 3300020070 | Bacteria | 1776 |
| 243 | Ga0206356_11168965 | 3300020070 | Bacteria | 673 |
| 244 | Ga0206355_1549020 | 3300020076 | Unclassified | 579 |
| 245 | Ga0206350_10323036 | 3300020080 | Bacteria | 1013 |
| 246 | Ga0206350_10563812 | 3300020080 | Bacteria | 940 |
| 247 | Ga0206354_10413687 | 3300020081 | Bacteria | 3641 |
| 248 | Ga0206354_11642342 | 3300020081 | Bacteria | 3072 |
| 249 | Ga0206353_10122185 | 3300020082 | Bacteria | 1014 |
| 250 | Ga0206353_10127771 | 3300020082 | Bacteria | 5538 |
| 251 | Ga0206353_11390648 | 3300020082 | Bacteria | 1435 |
| 252 | Ga0154015_1474078 | 3300020610 | Bacteria | 730 |
| 253 | Ga0207696_1000237 | 3300025711 | Bacteria | 76707 |
| 254 | Ga0207655_1000178 | 3300025728 | Bacteria | 113749 |
| 255 | Ga0207655_1002439 | 3300025728 | Bacteria | 15111 |
| 256 | Ga0207655_1006667 | 3300025728 | Bacteria | 7609 |
| 257 | Ga0207713_1004567 | 3300025735 | Bacteria | 8959 |
| 258 | Ga0207642_10326856 | 3300025899 | Unclassified | 897 |
| 259 | Ga0207642_10716363 | 3300025899 | Bacteria | 631 |
| 260 | Ga0207688_10034113 | 3300025901 | Bacteria | 2817 |
| 261 | Ga0207688_10256250 | 3300025901 | Bacteria | 1061 |
| 262 | Ga0207647_10657492 | 3300025904 | Bacteria | 574 |
| 263 | Ga0207685_10028322 | 3300025905 | Bacteria | 1972 |
| 264 | Ga0207699_10132800 | 3300025906 | Bacteria | 1626 |
| 265 | Ga0207645_10051414 | 3300025907 | Bacteria | 2633 |
| 266 | Ga0207643_10325438 | 3300025908 | Bacteria | 961 |
| 267 | Ga0207705_10143539 | 3300025909 | Bacteria | 1784 |
| 268 | Ga0207705_10351623 | 3300025909 | Bacteria | 1135 |
| 269 | Ga0207705_10523876 | 3300025909 | Bacteria | 921 |
| 270 | Ga0207705_10555669 | 3300025909 | Bacteria | 892 |
| 271 | Ga0207707_10033821 | 3300025912 | Bacteria | 4474 |
| 272 | Ga0207707_10099760 | 3300025912 | Bacteria | 2538 |
| 273 | Ga0207707_10478197 | 3300025912 | Bacteria | 1064 |
| 274 | Ga0207707_10576191 | 3300025912 | Bacteria | 954 |
| 275 | Ga0207707_11336988 | 3300025912 | Bacteria | 574 |
| 276 | Ga0207695_10125153 | 3300025913 | Bacteria | 2534 |
| 277 | Ga0207695_10312295 | 3300025913 | Bacteria | 1462 |
| 278 | Ga0207660_10015478 | 3300025917 | Bacteria | 5035 |
| 279 | Ga0207660_10246673 | 3300025917 | Bacteria | 1409 |
| 280 | Ga0207660_10267851 | 3300025917 | Bacteria | 1353 |
| 281 | Ga0207660_10896771 | 3300025917 | Bacteria | 724 |
| 282 | Ga0207657_10000054 | 3300025919 | Bacteria | 106767 |
| 283 | Ga0207657_10006406 | 3300025919 | Bacteria | 12215 |
| 284 | Ga0207657_10007679 | 3300025919 | Bacteria | 11024 |
| 285 | Ga0207657_10130964 | 3300025919 | Bacteria | 2055 |
| 286 | Ga0207657_10166159 | 3300025919 | Bacteria | 1790 |
| 287 | Ga0207657_10462043 | 3300025919 | Bacteria | 996 |
| 288 | Ga0207649_10237178 | 3300025920 | Unclassified | 1307 |
| 289 | Ga0207649_10306114 | 3300025920 | Bacteria | 1163 |
| 290 | Ga0207652_10130638 | 3300025921 | Unclassified | 2240 |
| 291 | Ga0207652_10172795 | 3300025921 | Bacteria | 1939 |
| 292 | Ga0207652_10365305 | 3300025921 | Bacteria | 1303 |
| 293 | Ga0207652_10589986 | 3300025921 | Bacteria | 997 |
| 294 | Ga0207652_10602307 | 3300025921 | Bacteria | 985 |
| 295 | Ga0207652_10609556 | 3300025921 | Bacteria | 978 |
| 296 | Ga0207652_11354912 | 3300025921 | Bacteria | 615 |
| 297 | Ga0207646_10006668 | 3300025922 | Bacteria | 11903 |
| 298 | Ga0207646_10045099 | 3300025922 | Bacteria | 3958 |
| 299 | Ga0207694_10713851 | 3300025924 | Bacteria | 846 |
| 300 | Ga0207694_11550883 | 3300025924 | Bacteria | 559 |
| 301 | Ga0207650_11164700 | 3300025925 | Bacteria | 656 |
| 302 | Ga0207650_11187015 | 3300025925 | Bacteria | 650 |
| 303 | Ga0207659_10422882 | 3300025926 | Bacteria | 1118 |
| 304 | Ga0207687_10009952 | 3300025927 | Bacteria | 6224 |
| 305 | Ga0207687_10983432 | 3300025927 | Bacteria | 723 |
| 306 | Ga0207687_11020091 | 3300025927 | Bacteria | 710 |
| 307 | Ga0207700_10299650 | 3300025928 | Bacteria | 1388 |
| 308 | Ga0207700_11024219 | 3300025928 | Bacteria | 739 |
| 309 | Ga0207664_10005768 | 3300025929 | Bacteria | 8470 |
| 310 | Ga0207664_10285088 | 3300025929 | Unclassified | 1450 |
| 311 | Ga0207664_10934943 | 3300025929 | Bacteria | 778 |
| 312 | Ga0207644_11617899 | 3300025931 | Bacteria | 543 |
| 313 | Ga0207690_10195927 | 3300025932 | Unclassified | 1531 |
| 314 | Ga0207706_10001654 | 3300025933 | Bacteria | 22047 |
| 315 | Ga0207706_10073062 | 3300025933 | Bacteria | 3016 |
| 316 | Ga0207706_11261636 | 3300025933 | Bacteria | 612 |
| 317 | Ga0207709_10047161 | 3300025935 | Bacteria | 2618 |
| 318 | Ga0207669_10256942 | 3300025937 | Bacteria | 1304 |
| 319 | Ga0207704_10068645 | 3300025938 | Bacteria | 2236 |
| 320 | Ga0207704_11672388 | 3300025938 | Bacteria | 547 |
| 321 | Ga0207665_10497180 | 3300025939 | Unclassified | 942 |
| 322 | Ga0207691_10151026 | 3300025940 | Bacteria | 2042 |
| 323 | Ga0207691_10771282 | 3300025940 | Unclassified | 809 |
| 324 | Ga0207711_11511811 | 3300025941 | Unclassified | 614 |
| 325 | Ga0207689_10142791 | 3300025942 | Bacteria | 1972 |
| 326 | Ga0207689_10400019 | 3300025942 | Unclassified | 1145 |
| 327 | Ga0207689_10564021 | 3300025942 | Bacteria | 957 |
| 328 | Ga0207661_10034427 | 3300025944 | Bacteria | 3939 |
| 329 | Ga0207661_10182726 | 3300025944 | Bacteria | 1833 |
| 330 | Ga0207661_10331548 | 3300025944 | Bacteria | 1370 |
| 331 | Ga0207661_10807954 | 3300025944 | Bacteria | 863 |
| 332 | Ga0207661_10859782 | 3300025944 | Bacteria | 835 |
| 333 | Ga0207661_11928679 | 3300025944 | Unclassified | 536 |
| 334 | Ga0207679_10068215 | 3300025945 | Bacteria | 2671 |
| 335 | Ga0207679_10174752 | 3300025945 | Bacteria | 1772 |
| 336 | Ga0207667_10177022 | 3300025949 | Bacteria | 2191 |
| 337 | Ga0207667_10196213 | 3300025949 | Bacteria | 2071 |
| 338 | Ga0207667_10592641 | 3300025949 | Bacteria | 1118 |
| 339 | Ga0207667_11973796 | 3300025949 | Bacteria | 544 |
| 340 | Ga0207651_11269751 | 3300025960 | Bacteria | 662 |
| 341 | Ga0207712_10194601 | 3300025961 | Bacteria | 1603 |
| 342 | Ga0207712_11308047 | 3300025961 | Bacteria | 648 |
| 343 | Ga0207668_10011566 | 3300025972 | Bacteria | 5368 |
| 344 | Ga0207668_10172260 | 3300025972 | Bacteria | 1699 |
| 345 | Ga0207640_10093499 | 3300025981 | Bacteria | 2089 |
| 346 | Ga0207640_10922976 | 3300025981 | Unclassified | 764 |
| 347 | Ga0207658_10439556 | 3300025986 | Bacteria | 1153 |
| 348 | Ga0207703_10198494 | 3300026035 | Bacteria | 1781 |
| 349 | Ga0207639_10697919 | 3300026041 | Bacteria | 941 |
| 350 | Ga0207678_10086130 | 3300026067 | Bacteria | 2685 |
| 351 | Ga0207678_10566767 | 3300026067 | Bacteria | 994 |
| 352 | Ga0207708_10027360 | 3300026075 | Bacteria | 4317 |
| 353 | Ga0207708_10090469 | 3300026075 | Bacteria | 2359 |
| 354 | Ga0207702_10463845 | 3300026078 | Bacteria | 1231 |
| 355 | Ga0207702_10907218 | 3300026078 | Bacteria | 873 |
| 356 | Ga0207702_11073427 | 3300026078 | Bacteria | 799 |
| 357 | Ga0207702_11991711 | 3300026078 | Unclassified | 571 |
| 358 | Ga0207641_10220207 | 3300026088 | Bacteria | 1760 |
| 359 | Ga0207641_12536463 | 3300026088 | Bacteria | 511 |
| 360 | Ga0207648_10062399 | 3300026089 | Bacteria | 3249 |
| 361 | Ga0207676_10757013 | 3300026095 | Bacteria | 945 |
| 362 | Ga0207676_12238277 | 3300026095 | Bacteria | 544 |
| 363 | Ga0207674_10003054 | 3300026116 | Bacteria | 20712 |
| 364 | Ga0207674_10091638 | 3300026116 | Bacteria | 3029 |
| 365 | Ga0207674_10092847 | 3300026116 | Bacteria | 3007 |
| 366 | Ga0207674_11257613 | 3300026116 | Unclassified | 710 |
| 367 | Ga0207675_100087900 | 3300026118 | Bacteria | 2919 |
| 368 | Ga0207675_100585770 | 3300026118 | Bacteria | 1117 |
| 369 | Ga0207683_10262765 | 3300026121 | Bacteria | 1576 |
| 370 | Ga0207683_10390286 | 3300026121 | Bacteria | 1280 |
| 371 | Ga0207683_10460081 | 3300026121 | Bacteria | 1173 |
| 372 | Ga0207698_10129089 | 3300026142 | Bacteria | 2156 |
| 373 | Ga0207698_10536824 | 3300026142 | Bacteria | 1144 |
| 374 | Ga0207698_11748024 | 3300026142 | Bacteria | 637 |
| 375 | Ga0209371_1000071 | 3300027312 | Bacteria | 200748 |
| 376 | Ga0209371_1000078 | 3300027312 | Bacteria | 190779 |
| 377 | Ga0209371_1000154 | 3300027312 | Bacteria | 108161 |
| 378 | Ga0209371_1000238 | 3300027312 | Bacteria | 69012 |
| 379 | Ga0209371_1003313 | 3300027312 | Bacteria | 7956 |
| 380 | Ga0209999_1038993 | 3300027543 | Bacteria | 889 |
| 381 | Ga0207428_10128630 | 3300027907 | Bacteria | 1939 |
| 382 | Ga0207428_10181259 | 3300027907 | Unclassified | 1591 |
| 383 | Ga0268266_10026166 | 3300028379 | Bacteria | 4965 |
| 384 | Ga0268266_10365819 | 3300028379 | Unclassified | 1358 |
| 385 | Ga0268265_10859914 | 3300028380 | Bacteria | 888 |
| 386 | Ga0268265_11806639 | 3300028380 | Bacteria | 618 |
| 387 | Ga0268264_11251977 | 3300028381 | Bacteria | 752 |
| 388 | Ga0265334_10038961 | 3300028573 | Bacteria | 1867 |
| 389 | Ga0265338_10008043 | 3300028800 | Bacteria | 12897 |
| 390 | Ga0265324_10051358 | 3300029957 | Bacteria | 1417 |
| 391 | Ga0268256_1000070 | 3300030500 | Bacteria | 189040 |
| 392 | Ga0268256_1000198 | 3300030500 | Bacteria | 68968 |
| 393 | Ga0268256_1000237 | 3300030500 | Bacteria | 57957 |
| 394 | Ga0268256_1000828 | 3300030500 | Bacteria | 22035 |
| 395 | Ga0268256_1003012 | 3300030500 | Bacteria | 7956 |
| 396 | Ga0316179_1100387 | 3300030734 | Bacteria | 715 |
| 397 | Ga0316183_1070363 | 3300030742 | Bacteria | 1302 |
| 398 | Ga0316181_1247714 | 3300030744 | Bacteria | 5166 |
| 399 | Ga0316182_1025437 | 3300030745 | Bacteria | 1682 |
| 400 | Ga0265330_10020394 | 3300031235 | Bacteria | 3029 |
| 401 | Ga0265332_10078495 | 3300031238 | Bacteria | 1402 |
| 402 | Ga0265325_10011190 | 3300031241 | Bacteria | 5164 |
| 403 | Ga0265329_10065986 | 3300031242 | Bacteria | 1145 |
| 404 | Ga0265339_10030156 | 3300031249 | Bacteria | 3073 |
| 405 | Ga0265331_10039309 | 3300031250 | Bacteria | 2308 |
| 406 | Ga0265327_10014468 | 3300031251 | Bacteria | 5158 |
| 407 | Ga0265316_10006730 | 3300031344 | Bacteria | 10953 |
| 408 | Ga0307408_100130576 | 3300031548 | Bacteria | 1959 |
| 409 | Ga0307408_100184910 | 3300031548 | Bacteria | 1674 |
| 410 | Ga0316579_10378930 | 3300031691 | Unclassified | 684 |
| 411 | Ga0265314_10001092 | 3300031711 | Bacteria | 31362 |
| 412 | Ga0265342_10131561 | 3300031712 | Bacteria | 1401 |
| 413 | Ga0316578_10064532 | 3300031728 | Unclassified | 2161 |
| 414 | Ga0307405_10124223 | 3300031731 | Unclassified | 1772 |
| 415 | Ga0307410_10123091 | 3300031852 | Bacteria | 1894 |
| 416 | Ga0307406_10279616 | 3300031901 | Bacteria | 1272 |
| 417 | Ga0307406_11509670 | 3300031901 | Unclassified | 591 |
| 418 | Ga0307407_11089715 | 3300031903 | Bacteria | 620 |
| 419 | Ga0307412_11033320 | 3300031911 | Bacteria | 728 |
| 420 | Ga0307409_100120162 | 3300031995 | Bacteria | 2223 |
| 421 | Ga0307409_100879437 | 3300031995 | Unclassified | 908 |
| 422 | Ga0307416_100033266 | 3300032002 | Bacteria | 3906 |
| 423 | Ga0307416_100152016 | 3300032002 | Bacteria | 2124 |
| 424 | Ga0307414_10419074 | 3300032004 | Bacteria | 1167 |
| 425 | Ga0307411_11076329 | 3300032005 | Bacteria | 723 |
| 426 | Ga0307415_100036289 | 3300032126 | Bacteria | 3228 |
| 427 | Ga0307415_101311422 | 3300032126 | Bacteria | 686 |
| 428 | Ga0316593_10055678 | 3300032168 | Bacteria | 1344 |
| 429 | Ga0373958_0023546 | 3300034819 | Bacteria | 1159 |
| 430 | Ga0373951_0222178 | 3300035091 | Bacteria | 558 |
| 431 | Ga0373939_0241341 | 3300035114 | Bacteria | 700 |
| 432 | Ga0373941_0067871 | 3300035115 | Bacteria | 1177 |
| 433 | Ga0373962_0073388 | 3300035242 | Bacteria | 1027 |
| 434 | Ga0316574_0401048 | 3300035398 | Unclassified | 864 |
| 435 | Ga0373931_0403098 | 3300035691 | Unclassified | 866 |
| 436 | Ga0316582_0082994 | 3300036647 | Bacteria | 2096 |
| 437 | Ga0395899_0616581 | 3300037312 | Bacteria | 689 |
| 438 | Ga0395900_0025546 | 3300037418 | Bacteria | 6046 |
| 439 | Ga0395900_0174066 | 3300037418 | Bacteria | 2190 |
| 440 | Ga0395900_0212298 | 3300037418 | Bacteria | 1954 |
| 441 | Ga0395900_0391386 | 3300037418 | Bacteria | 1356 |
| 442 | Ga0395900_0742795 | 3300037418 | Bacteria | 912 |
| 443 | Ga0395900_0990400 | 3300037418 | Bacteria | 761 |
| 444 | Ga0395898_0007790 | 3300037466 | Bacteria | 11368 |
| 445 | Ga0395898_0181891 | 3300037466 | Bacteria | 2009 |
| 446 | Ga0395898_0467993 | 3300037466 | Bacteria | 1200 |
| 447 | Ga0395898_0471038 | 3300037466 | Bacteria | 1195 |
| 448 | Ga0395898_0795423 | 3300037466 | Bacteria | 886 |
| 449 | Ga0395898_1595481 | 3300037466 | Bacteria | 577 |
| 450 | Ga0395905_0005133 | 3300037471 | Bacteria | 13443 |
| 451 | Ga0395905_1660174 | 3300037471 | Bacteria | 544 |
| 452 | Ga0395905_1901100 | 3300037471 | Bacteria | 501 |
| 453 | Ga0395901_0000858 | 3300038443 | Bacteria | 33469 |
| 454 | Ga0395901_0067100 | 3300038443 | Bacteria | 3736 |
| 455 | Ga0395901_0220757 | 3300038443 | Bacteria | 1981 |
| 456 | Ga0395901_0327517 | 3300038443 | Bacteria | 1584 |
| 457 | Ga0395901_0696226 | 3300038443 | Bacteria | 1014 |
| 458 | Ga0395901_0993850 | 3300038443 | Bacteria | 815 |
| 459 | Ga0395901_1246900 | 3300038443 | Bacteria | 707 |
| 460 | Ga0436365_0516539 | 3300039437 | Bacteria | 716 |
| 461 | Ga0436365_1307869 | 3300039437 | Bacteria | 2039 |
| 462 | Ga0439438_040678 | 3300041405 | Bacteria | 1207 |
| 463 | Ga0439447_013860 | 3300041407 | Bacteria | 2276 |
| 464 | Ga0439466_0000015 | 3300041411 | Bacteria | 114576 |
| 465 | Ga0439466_0125499 | 3300041411 | Bacteria | 791 |
| 466 | Ga0451787_541019 | 3300041441 | Unclassified | 520 |
| 467 | Ga0451793_0693422 | 3300041452 | Bacteria | 3259 |
| 468 | Ga0451797_0246926 | 3300041453 | Bacteria | 821 |
| 469 | Ga0451835_0393426 | 3300041492 | Bacteria | 510 |
| 470 | Ga0451837_1561292 | 3300041494 | Bacteria | 610 |
| 471 | Ga0451847_0004397 | 3300041503 | Bacteria | 601 |
| 472 | Ga0451843_1341141 | 3300041509 | Bacteria | 647 |
| 473 | Ga0451853_1119058 | 3300041512 | Bacteria | 654 |
| 474 | Ga0451853_2077639 | 3300041512 | Unclassified | 733 |
| 475 | Ga0439431_0013547 | 3300041997 | Bacteria | 1883 |
| 476 | Ga0439431_0133921 | 3300041997 | Bacteria | 697 |
| 477 | Ga0439437_000445 | 3300042000 | Bacteria | 4029 |
| 478 | Ga0439443_062992 | 3300042003 | Bacteria | 666 |
| 479 | Ga0439448_0009474 | 3300042005 | Bacteria | 2872 |
| 480 | Ga0439432_003873 | 3300042006 | Bacteria | 5513 |
| 481 | Ga0439432_063541 | 3300042006 | Bacteria | 1134 |
| 482 | Ga0439432_101413 | 3300042006 | Bacteria | 860 |
| 483 | Ga0439452_000050 | 3300042010 | Bacteria | 121019 |
| 484 | Ga0439452_078004 | 3300042010 | Bacteria | 724 |
| 485 | Ga0439455_0132121 | 3300042012 | Bacteria | 704 |
| 486 | Ga0439456_023624 | 3300042013 | Bacteria | 1303 |
| 487 | Ga0439463_001954 | 3300042016 | Bacteria | 5363 |
| 488 | Ga0439463_038918 | 3300042016 | Bacteria | 1207 |
| 489 | Ga0450911_000003 | 3300042115 | Bacteria | 237055 |
| 490 | Ga0450919_018808 | 3300042121 | Bacteria | 780 |
| 491 | Ga0450892_010248 | 3300042130 | Bacteria | 819 |
| 492 | Ga0450902_081209 | 3300042137 | Bacteria | 570 |
| 493 | Ga0450903_042055 | 3300042138 | Bacteria | 675 |
| 494 | Ga0450904_000051 | 3300042139 | Bacteria | 26256 |
| 495 | Ga0450907_000033 | 3300042146 | Bacteria | 63179 |
| 496 | Ga0450907_015075 | 3300042146 | Bacteria | 1289 |
| 497 | Ga0439446_0024710 | 3300042156 | Bacteria | 1715 |
| 498 | Ga0450909_038568 | 3300042185 | Bacteria | 733 |
| 499 | Ga0439434_0011383 | 3300042435 | Unclassified | 2630 |
| 500 | Ga0439459_0006732 | 3300042438 | Bacteria | 1924 |
| 501 | Ga0439464_0001474 | 3300042439 | Bacteria | 5561 |
| 502 | Ga0439464_0067851 | 3300042439 | Bacteria | 1052 |
| 503 | Ga0439464_0074493 | 3300042439 | Bacteria | 1007 |
| 504 | Ga0450916_001523 | 3300042530 | Bacteria | 2326 |
| 505 | Ga0450918_011794 | 3300042531 | Bacteria | 1522 |
| 506 | Ga0450901_020289 | 3300042533 | Bacteria | 711 |
| 507 | Ga0466966_0072294 | 3300044684 | Bacteria | 2160 |
| 508 | Ga0466966_0074790 | 3300044684 | Unclassified | 2117 |
| 509 | Ga0466964_0073005 | 3300044706 | Bacteria | 1455 |
| 510 | Ga0466968_0278051 | 3300044735 | Bacteria | 800 |
| 511 | Ga0466960_0032280 | 3300044901 | Bacteria | 2423 |
| 512 | Ga0466960_0203959 | 3300044901 | Unclassified | 1081 |
| 513 | Ga0466960_0298179 | 3300044901 | Bacteria | 908 |
| 514 | Ga0466958_0647930 | 3300045836 | Bacteria | 688 |
| 515 | Ga0466967_0053959 | 3300045976 | Bacteria | 3535 |
| 516 | Ga0466967_0077380 | 3300045976 | Bacteria | 2995 |
| 517 | Ga0466967_0122312 | 3300045976 | Unclassified | 2407 |
| 518 | Ga0466967_0155186 | 3300045976 | Bacteria | 2143 |
| 519 | Ga0466967_0962013 | 3300045976 | Bacteria | 850 |
| 520 | Ga0495627_016902 | 3300046453 | Bacteria | 2490 |
| 521 | Ga0495592_0290424 | 3300046454 | Bacteria | 1066 |
| 522 | Ga0495590_0376074 | 3300046457 | Bacteria | 542 |
| 523 | Ga0495651_0403042 | 3300046462 | Bacteria | 893 |
| 524 | Ga0495653_0339128 | 3300046463 | Bacteria | 969 |
| 525 | Ga0495650_0003645 | 3300046471 | Bacteria | 11060 |
| 526 | Ga0495605_0000620 | 3300046474 | Bacteria | 27429 |
| 527 | Ga0495605_0188176 | 3300046474 | Bacteria | 905 |
| 528 | Ga0495584_0047606 | 3300046491 | Bacteria | 2162 |
| 529 | Ga0495585_0007122 | 3300046492 | Bacteria | 6871 |
| 530 | Ga0495596_0096247 | 3300046500 | Bacteria | 1149 |
| 531 | Ga0495607_0060488 | 3300046501 | Bacteria | 2155 |
| 532 | Ga0495607_0239497 | 3300046501 | Bacteria | 878 |
| 533 | Ga0495583_0001861 | 3300046506 | Bacteria | 19645 |
| 534 | Ga0495583_0008307 | 3300046506 | Bacteria | 6366 |
| 535 | Ga0495608_0232988 | 3300046511 | Bacteria | 1152 |
| 536 | Ga0495620_0098419 | 3300046515 | Bacteria | 1168 |
| 537 | Ga0495628_0280416 | 3300046516 | Bacteria | 1238 |
| 538 | Ga0495628_0469087 | 3300046516 | Bacteria | 912 |
| 539 | Ga0495632_0004658 | 3300046519 | Bacteria | 9261 |
| 540 | Ga0495632_0175908 | 3300046519 | Bacteria | 982 |
| 541 | Ga0495637_0066311 | 3300046520 | Bacteria | 1467 |
| 542 | Ga0495643_0019080 | 3300046522 | Bacteria | 3970 |
| 543 | Ga0495663_0023711 | 3300046525 | Bacteria | 1779 |
| 544 | Ga0495642_0201191 | 3300046528 | Bacteria | 868 |
| 545 | Ga0495642_0544938 | 3300046528 | Bacteria | 514 |
| 546 | Ga0495598_0003842 | 3300046537 | Bacteria | 3217 |
| 547 | Ga0495598_0321145 | 3300046537 | Bacteria | 590 |
| 548 | Ga0495609_0000023 | 3300046538 | Bacteria | 269702 |
| 549 | Ga0495609_0051735 | 3300046538 | Bacteria | 1828 |
| 550 | Ga0495609_0139924 | 3300046538 | Bacteria | 1033 |
| 551 | Ga0495609_0275962 | 3300046538 | Bacteria | 688 |
| 552 | Ga0495621_0067695 | 3300046539 | Bacteria | 1309 |
| 553 | Ga0495645_0055038 | 3300046543 | Bacteria | 2889 |
| 554 | Ga0495633_0096823 | 3300046558 | Bacteria | 1371 |
| 555 | Ga0495656_0368244 | 3300046615 | Unclassified | 747 |
| 556 | Ga0495656_0498609 | 3300046615 | Bacteria | 645 |
| 557 | Ga0495668_0267016 | 3300046616 | Bacteria | 937 |
| 558 | Ga0495611_0187276 | 3300046648 | Unclassified | 966 |
| 559 | Ga0495625_0393787 | 3300046660 | Bacteria | 867 |
| 560 | Ga0495659_0122975 | 3300046664 | Unclassified | 1023 |
| 561 | Ga0495659_0130291 | 3300046664 | Bacteria | 997 |
| 562 | Ga0495661_0000072 | 3300046665 | Bacteria | 120743 |
| 563 | Ga0495661_0048198 | 3300046665 | Bacteria | 2590 |
| 564 | Ga0495661_0127704 | 3300046665 | Bacteria | 1397 |
| 565 | Ga0495669_0398976 | 3300046684 | Bacteria | 666 |
| 566 | Ga0495624_0146370 | 3300046690 | Bacteria | 1446 |
| 567 | Ga0495670_0111165 | 3300046691 | Bacteria | 1418 |
| 568 | Ga0495671_0252608 | 3300046692 | Bacteria | 851 |
| 569 | Ga0495671_0270452 | 3300046692 | Bacteria | 819 |
| 570 | Ga0495671_0408986 | 3300046692 | Bacteria | 649 |
| 571 | Ga0495589_0093307 | 3300046794 | Bacteria | 1461 |
| 572 | Ga0495589_0253359 | 3300046794 | Bacteria | 822 |
| 573 | Ga0495660_0007318 | 3300046810 | Bacteria | 6486 |
| 574 | Ga0495660_0150832 | 3300046810 | Bacteria | 1148 |
| 575 | Ga0495674_0589997 | 3300047319 | Bacteria | 881 |
| 576 | Ga0495672_0000128 | 3300047320 | Bacteria | 116418 |
| 577 | Ga0495676_0248982 | 3300047321 | Bacteria | 1213 |
| 578 | Ga0495680_0601790 | 3300047322 | Bacteria | 735 |
| 579 | Ga0495683_0040364 | 3300047323 | Bacteria | 2358 |
| 580 | Ga0495677_0390423 | 3300047445 | Bacteria | 550 |
| 581 | Ga0495679_008321 | 3300047446 | Bacteria | 4227 |
| 582 | Ga0495679_047846 | 3300047446 | Bacteria | 1296 |
| 583 | Ga0495685_030227 | 3300047447 | Bacteria | 1863 |
| 584 | Ga0495673_0016101 | 3300047469 | Bacteria | 3832 |
| 585 | Ga0495673_0246572 | 3300047469 | Bacteria | 653 |
| 586 | Ga0495681_0116750 | 3300047470 | Bacteria | 1150 |
| 587 | Ga0495681_0252984 | 3300047470 | Bacteria | 695 |
| 588 | Ga0495684_0251365 | 3300047471 | Bacteria | 1286 |
| 589 | Ga0495615_0081009 | 3300048090 | Bacteria | 890 |
| 590 | Ga0495626_0051652 | 3300048091 | Bacteria | 1896 |
| 591 | Ga0496100_0015942 | 3300048903 | Bacteria | 4401 |
| 592 | Ga0496100_0666725 | 3300048903 | Bacteria | 811 |
| 593 | Ga0496101_0519818 | 3300048904 | Bacteria | 941 |
| 594 | Ga0496102_0026366 | 3300048905 | Bacteria | 5183 |
| 595 | Ga0496102_0057966 | 3300048905 | Bacteria | 3538 |
| 596 | Ga0496102_0361606 | 3300048905 | Bacteria | 1366 |
| 597 | Ga0496102_0447118 | 3300048905 | Bacteria | 1212 |
| 598 | Ga0496102_1640291 | 3300048905 | Archaea | 561 |
| 599 | Ga0496103_0049425 | 3300048906 | Bacteria | 2600 |
| 600 | Ga0496103_0199167 | 3300048906 | Bacteria | 1288 |
| 601 | Ga0496105_0730731 | 3300048908 | Bacteria | 758 |
| 602 | Ga0496107_0231499 | 3300048910 | Bacteria | 1375 |
| 603 | Ga0496107_1295836 | 3300048910 | Bacteria | 521 |
| 604 | Ga0496108_0056899 | 3300048911 | Bacteria | 3286 |
| 605 | Ga0496108_0321424 | 3300048911 | Unclassified | 1349 |
| 606 | Ga0496109_0004156 | 3300048912 | Bacteria | 12085 |
| 607 | Ga0496109_1404587 | 3300048912 | Bacteria | 634 |
| 608 | Ga0496110_0076937 | 3300048913 | Bacteria | 2967 |
| 609 | Ga0496110_0134373 | 3300048913 | Bacteria | 2235 |
| 610 | Ga0496110_1662894 | 3300048913 | Bacteria | 548 |
| 611 | Ga0496110_1754178 | 3300048913 | Bacteria | 531 |
| 612 | Ga0496111_0021446 | 3300048914 | Bacteria | 4511 |
| 613 | Ga0496112_0109287 | 3300048915 | Bacteria | 2735 |
| 614 | Ga0496112_0124794 | 3300048915 | Bacteria | 2545 |
| 615 | Ga0496112_0318901 | 3300048915 | Unclassified | 1498 |
| 616 | Ga0496113_0044155 | 3300048916 | Bacteria | 3301 |
| 617 | Ga0496113_0366941 | 3300048916 | Bacteria | 1155 |
| 618 | Ga0496113_0815486 | 3300048916 | Bacteria | 741 |
| 619 | Ga0496114_0244660 | 3300048917 | Bacteria | 1578 |
| 620 | Ga0496114_1493279 | 3300048917 | Unclassified | 564 |
| 621 | Ga0496115_1274877 | 3300048918 | Unclassified | 549 |
| 622 | Ga0496115_1419957 | 3300048918 | Unclassified | 512 |
| 623 | Ga0496116_0000209 | 3300048919 | Bacteria | 111028 |
| 624 | Ga0496116_0003465 | 3300048919 | Bacteria | 15555 |
| 625 | Ga0496116_0018485 | 3300048919 | Bacteria | 5372 |
| 626 | Ga0496117_0001785 | 3300048920 | Bacteria | 29443 |
| 627 | Ga0496117_0002590 | 3300048920 | Bacteria | 22495 |
| 628 | Ga0496118_0002610 | 3300048921 | Bacteria | 23939 |
| 629 | Ga0496118_0010048 | 3300048921 | Bacteria | 9431 |
| 630 | Ga0496119_0000259 | 3300048922 | Bacteria | 75018 |
| 631 | Ga0496119_0000294 | 3300048922 | Bacteria | 69996 |
| 632 | Ga0496119_0002336 | 3300048922 | Bacteria | 20880 |
| 633 | Ga0496120_0000314 | 3300048923 | Bacteria | 80307 |
| 634 | Ga0496120_0000482 | 3300048923 | Bacteria | 62533 |
| 635 | Ga0496121_0000244 | 3300048924 | Bacteria | 116655 |
| 636 | Ga0496122_0182722 | 3300048925 | Bacteria | 1248 |
| 637 | Ga0496123_0099034 | 3300048926 | Bacteria | 1702 |
| 638 | Ga0496123_0255390 | 3300048926 | Bacteria | 862 |
| 639 | Ga0496124_0000295 | 3300048927 | Bacteria | 92650 |
| 640 | Ga0496124_0011703 | 3300048927 | Bacteria | 8753 |
| 641 | Ga0496124_0013215 | 3300048927 | Bacteria | 8075 |
| 642 | Ga0496125_0001070 | 3300048928 | Bacteria | 42218 |
| 643 | Ga0496126_0026475 | 3300048929 | Bacteria | 5560 |
| 644 | Ga0501031_0033752 | 3300049568 | Bacteria | 3340 |
| 645 | Ga0501031_0040753 | 3300049568 | Bacteria | 3032 |
| 646 | Ga0501032_0066804 | 3300049569 | Bacteria | 2403 |
| 647 | Ga0501033_0152539 | 3300049570 | Unclassified | 1666 |
| 648 | Ga0501034_0339714 | 3300049571 | Bacteria | 1432 |
| 649 | Ga0501036_0026923 | 3300049572 | Bacteria | 4859 |
| 650 | Ga0501036_0033071 | 3300049572 | Bacteria | 4373 |
| 651 | Ga0501037_0045395 | 3300049573 | Bacteria | 3226 |
| 652 | Ga0501037_0110276 | 3300049573 | Bacteria | 1983 |
| 653 | Ga0501038_0059358 | 3300049574 | Bacteria | 3277 |
| 654 | Ga0501039_0049253 | 3300049575 | Bacteria | 3257 |
| 655 | Ga0501039_0311800 | 3300049575 | Bacteria | 1237 |
| 656 | Ga0501040_0029879 | 3300049576 | Bacteria | 3678 |
| 657 | Ga0501040_0179540 | 3300049576 | Bacteria | 1500 |
| 658 | Ga0501041_0118225 | 3300049577 | Bacteria | 1646 |
| 659 | Ga0501041_0294868 | 3300049577 | Bacteria | 1021 |
| 660 | Ga0501042_0010968 | 3300049578 | Bacteria | 6100 |
| 661 | Ga0501042_0063944 | 3300049578 | Bacteria | 2629 |
| 662 | Ga0501043_0164229 | 3300049579 | Unclassified | 1734 |
| 663 | Ga0501046_0109882 | 3300049580 | Bacteria | 2107 |
| 664 | Ga0501048_0006003 | 3300049582 | Bacteria | 9248 |
| 665 | Ga0501048_0199152 | 3300049582 | Bacteria | 1419 |
| 666 | Ga0501068_0223682 | 3300049584 | Bacteria | 1196 |
| 667 | Ga0501071_0004938 | 3300049587 | Bacteria | 8517 |
| 668 | Ga0501071_0063774 | 3300049587 | Bacteria | 2672 |
| 669 | Ga0501072_0001670 | 3300049588 | Bacteria | 16511 |
| 670 | Ga0501072_0007342 | 3300049588 | Bacteria | 8360 |
| 671 | Ga0501073_0100750 | 3300049589 | Bacteria | 2006 |
| 672 | Ga0501074_0023214 | 3300049590 | Bacteria | 4511 |
| 673 | Ga0501074_0234290 | 3300049590 | Bacteria | 1307 |
| 674 | Ga0501075_0135913 | 3300049591 | Bacteria | 1873 |
| 675 | Ga0501075_0151799 | 3300049591 | Bacteria | 1765 |
| 676 | Ga0501076_0045598 | 3300049592 | Bacteria | 3461 |
| 677 | Ga0501076_0195628 | 3300049592 | Bacteria | 1650 |
| 678 | Ga0501077_0320310 | 3300049593 | Bacteria | 988 |
| 679 | Ga0501209_100040 | 3300049656 | Bacteria | 850 |
| 680 | Ga0501217_251894 | 3300049661 | Bacteria | 569 |
| 681 | Ga0501079_0012586 | 3300049741 | Bacteria | 6461 |
| 682 | Ga0501079_0183427 | 3300049741 | Bacteria | 1633 |
| 683 | Ga0501080_0141479 | 3300049742 | Bacteria | 2224 |
| 684 | Ga0501080_0942560 | 3300049742 | Bacteria | 751 |
| 685 | Ga0501081_0027220 | 3300049743 | Bacteria | 3858 |
| 686 | Ga0501081_0034258 | 3300049743 | Bacteria | 3454 |
| 687 | Ga0501083_0198971 | 3300049744 | Bacteria | 1307 |
| 688 | Ga0501035_0104709 | 3300049822 | Bacteria | 2481 |
| 689 | Ga0501045_0005511 | 3300049824 | Bacteria | 8756 |
| 690 | Ga0501045_0073662 | 3300049824 | Bacteria | 2515 |
| 691 | Ga0501212_028918 | 3300049851 | Bacteria | 887 |
| 692 | Ga0501226_000065 | 3300049853 | Bacteria | 34452 |
| 693 | nmdc:mga00v17_211280_c2 | 3300050491 | Bacteria | 750 |
| 694 | nmdc:mga05p37_355444_c1 | 3300050507 | Bacteria | 1724 |
| 695 | nmdc:mga05p37_469091_c1 | 3300050507 | Unclassified | 1453 |
| 696 | nmdc:mga05p37_473816_c1 | 3300050507 | Bacteria | 1444 |
| 697 | nmdc:mga09592_504848_c1 | 3300050508 | Bacteria | 1041 |
| 698 | nmdc:mga0qj67_376832_c1 | 3300050509 | Bacteria | 1146 |
| 699 | nmdc:mga08y16_105171_c1 | 3300050511 | Bacteria | 2939 |
| 700 | nmdc:mga08y16_1899369_c1 | 3300050511 | Bacteria | 546 |
| 701 | nmdc:mga08y16_662711_c1 | 3300050511 | Bacteria | 1047 |
| 702 | nmdc:mga0rr50_83642_c1 | 3300050513 | Bacteria | 2468 |
| 703 | nmdc:mga08x19_141269_c1 | 3300050514 | Bacteria | 1626 |
| 704 | nmdc:mga0sz30_178924_c1 | 3300050516 | Bacteria | 941 |
| 705 | Ga0495601_0740473 | 3300053077 | Bacteria | 626 |
| 706 | Ga0495655_0099948 | 3300053083 | Bacteria | 857 |
| 707 | Ga0495595_0279910 | 3300053084 | Bacteria | 837 |
| 708 | Ga0500642_0092368 | 3300053130 | Bacteria | 1400 |
| 709 | Ga0500577_0203057 | 3300053142 | Bacteria | 855 |
| 710 | Ga0501084_0119462 | 3300054114 | Bacteria | 2215 |
| 711 | Ga0501084_0695319 | 3300054114 | Bacteria | 857 |
| 712 | Ga0501082_0007164 | 3300060353 | Bacteria | 9614 |
| 713 | Ga0501082_0133015 | 3300060353 | Bacteria | 2158 |
| 714 | Ga0501082_0885649 | 3300060353 | Bacteria | 781 |
| 715 | Ga0530510_0067453 | 3300061734 | Bacteria | 2595 |
| 716 | Ga0530510_0491577 | 3300061734 | Bacteria | 930 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005434 | Ga0070709_10062059 | Ga0070709_100620594 | 77 |
| 2 | 3300007076 | Ga0075435_100084508 | Ga0075435_1000845081 | 77 |
| 3 | 3300025906 | Ga0207699_10132800 | Ga0207699_101328002 | 77 |
| 4 | 3300037418 | Ga0395900_0990400 | Ga0395900_0990400_472_708 | 77 |
| 5 | 3300039437 | Ga0436365_0516539 | Ga0436365_0516539_465_701 | 77 |
| 6 | 3300046665 | Ga0495661_0048198 | Ga0495661_0048198_1071_1307 | 77 |
| 7 | 3300048910 | Ga0496107_0231499 | Ga0496107_0231499_179_415 | 77 |
| 8 | 3300048913 | Ga0496110_0134373 | Ga0496110_0134373_1416_1652 | 77 |
| 9 | 3300048916 | Ga0496113_0815486 | Ga0496113_0815486_299_535 | 77 |
| 10 | 3300048918 | Ga0496115_1419957 | Ga0496115_1419957_241_477 | 77 |
| 11 | 3300050513 | nmdc:mga0rr50_83642_c1 | nmdc:mga0rr50_83642_c1_1849_2085 | 77 |
| 12 | 3300050514 | nmdc:mga08x19_141269_c1 | nmdc:mga08x19_141269_c1_843_1079 | 77 |
| 13 | 3300005329 | Ga0070683_100029800 | Ga0070683_1000298006 | 78 |
| 14 | 3300005329 | Ga0070683_100073626 | Ga0070683_1000736263 | 78 |
| 15 | 3300005329 | Ga0070683_100709401 | Ga0070683_1007094012 | 78 |
| 16 | 3300005336 | Ga0070680_100122146 | Ga0070680_1001221462 | 78 |
| 17 | 3300005344 | Ga0070661_100040281 | Ga0070661_1000402815 | 78 |
| 18 | 3300005344 | Ga0070661_100061491 | Ga0070661_1000614913 | 78 |
| 19 | 3300005365 | Ga0070688_100036002 | Ga0070688_1000360022 | 78 |
| 20 | 3300005435 | Ga0070714_100213003 | Ga0070714_1002130033 | 78 |
| 21 | 3300005436 | Ga0070713_101143222 | Ga0070713_1011432222 | 78 |
| 22 | 3300005440 | Ga0070705_101418814 | Ga0070705_1014188142 | 78 |
| 23 | 3300005445 | Ga0070708_100279249 | Ga0070708_1002792492 | 78 |
| 24 | 3300005466 | Ga0070685_10056717 | Ga0070685_100567173 | 78 |
| 25 | 3300005543 | Ga0070672_100296036 | Ga0070672_1002960362 | 78 |
| 26 | 3300005543 | Ga0070672_100378321 | Ga0070672_1003783212 | 78 |
| 27 | 3300005563 | Ga0068855_100558565 | Ga0068855_1005585652 | 78 |
| 28 | 3300005577 | Ga0068857_100169924 | Ga0068857_1001699243 | 78 |
| 29 | 3300005578 | Ga0068854_100306953 | Ga0068854_1003069533 | 78 |
| 30 | 3300005614 | Ga0068856_101538945 | Ga0068856_1015389452 | 78 |
| 31 | 3300005616 | Ga0068852_100753921 | Ga0068852_1007539212 | 78 |
| 32 | 3300005718 | Ga0068866_11407839 | Ga0068866_114078392 | 78 |
| 33 | 3300005719 | Ga0068861_100216065 | Ga0068861_1002160652 | 78 |
| 34 | 3300005834 | Ga0068851_10293926 | Ga0068851_102939262 | 78 |
| 35 | 3300005842 | Ga0068858_100375593 | Ga0068858_1003755932 | 78 |
| 36 | 3300005844 | Ga0068862_100701895 | Ga0068862_1007018952 | 78 |
| 37 | 3300005937 | Ga0081455_10003895 | Ga0081455_1000389512 | 78 |
| 38 | 3300006237 | Ga0097621_100525381 | Ga0097621_1005253812 | 78 |
| 39 | 3300006881 | Ga0068865_100148510 | Ga0068865_1001485103 | 78 |
| 40 | 3300006881 | Ga0068865_100369488 | Ga0068865_1003694882 | 78 |
| 41 | 3300009093 | Ga0105240_10068856 | Ga0105240_100688563 | 78 |
| 42 | 3300009094 | Ga0111539_10040195 | Ga0111539_100401954 | 78 |
| 43 | 3300009177 | Ga0105248_10555845 | Ga0105248_105558452 | 78 |
| 44 | 3300009545 | Ga0105237_10821396 | Ga0105237_108213962 | 78 |
| 45 | 3300010375 | Ga0105239_10752211 | Ga0105239_107522112 | 78 |
| 46 | 3300013104 | Ga0157370_10022195 | Ga0157370_100221954 | 78 |
| 47 | 3300013105 | Ga0157369_10352439 | Ga0157369_103524392 | 78 |
| 48 | 3300013306 | Ga0163162_10153577 | Ga0163162_101535772 | 78 |
| 49 | 3300014969 | Ga0157376_11430456 | Ga0157376_114304562 | 78 |
| 50 | 3300020070 | Ga0206356_10385242 | Ga0206356_103852422 | 78 |
| 51 | 3300020080 | Ga0206350_10323036 | Ga0206350_103230362 | 78 |
| 52 | 3300020080 | Ga0206350_10563812 | Ga0206350_105638122 | 78 |
| 53 | 3300020081 | Ga0206354_10413687 | Ga0206354_104136872 | 78 |
| 54 | 3300020082 | Ga0206353_10127771 | Ga0206353_101277713 | 78 |
| 55 | 3300020610 | Ga0154015_1474078 | Ga0154015_14740781 | 78 |
| 56 | 3300025899 | Ga0207642_10716363 | Ga0207642_107163632 | 78 |
| 57 | 3300025901 | Ga0207688_10034113 | Ga0207688_100341134 | 78 |
| 58 | 3300025901 | Ga0207688_10256250 | Ga0207688_102562502 | 78 |
| 59 | 3300025904 | Ga0207647_10657492 | Ga0207647_106574921 | 78 |
| 60 | 3300025907 | Ga0207645_10051414 | Ga0207645_100514144 | 78 |
| 61 | 3300025908 | Ga0207643_10325438 | Ga0207643_103254382 | 78 |
| 62 | 3300025909 | Ga0207705_10143539 | Ga0207705_101435393 | 78 |
| 63 | 3300025909 | Ga0207705_10351623 | Ga0207705_103516232 | 78 |
| 64 | 3300025912 | Ga0207707_10033821 | Ga0207707_100338216 | 78 |
| 65 | 3300025912 | Ga0207707_10576191 | Ga0207707_105761912 | 78 |
| 66 | 3300025912 | Ga0207707_11336988 | Ga0207707_113369882 | 78 |
| 67 | 3300025913 | Ga0207695_10125153 | Ga0207695_101251532 | 78 |
| 68 | 3300025917 | Ga0207660_10015478 | Ga0207660_100154782 | 78 |
| 69 | 3300025919 | Ga0207657_10000054 | Ga0207657_10000054105 | 78 |
| 70 | 3300025919 | Ga0207657_10007679 | Ga0207657_1000767911 | 78 |
| 71 | 3300025919 | Ga0207657_10166159 | Ga0207657_101661592 | 78 |
| 72 | 3300025920 | Ga0207649_10237178 | Ga0207649_102371783 | 78 |
| 73 | 3300025920 | Ga0207649_10306114 | Ga0207649_103061142 | 78 |
| 74 | 3300025921 | Ga0207652_10172795 | Ga0207652_101727952 | 78 |
| 75 | 3300025921 | Ga0207652_10365305 | Ga0207652_103653052 | 78 |
| 76 | 3300025921 | Ga0207652_10589986 | Ga0207652_105899862 | 78 |
| 77 | 3300025921 | Ga0207652_10602307 | Ga0207652_106023071 | 78 |
| 78 | 3300025922 | Ga0207646_10006668 | Ga0207646_1000666812 | 78 |
| 79 | 3300025924 | Ga0207694_10713851 | Ga0207694_107138512 | 78 |
| 80 | 3300025926 | Ga0207659_10422882 | Ga0207659_104228822 | 78 |
| 81 | 3300025927 | Ga0207687_10009952 | Ga0207687_100099527 | 78 |
| 82 | 3300025927 | Ga0207687_11020091 | Ga0207687_110200912 | 78 |
| 83 | 3300025929 | Ga0207664_10934943 | Ga0207664_109349432 | 78 |
| 84 | 3300025931 | Ga0207644_11617899 | Ga0207644_116178992 | 78 |
| 85 | 3300025933 | Ga0207706_10073062 | Ga0207706_100730623 | 78 |
| 86 | 3300025935 | Ga0207709_10047161 | Ga0207709_100471612 | 78 |
| 87 | 3300025937 | Ga0207669_10256942 | Ga0207669_102569423 | 78 |
| 88 | 3300025938 | Ga0207704_11672388 | Ga0207704_116723882 | 78 |
| 89 | 3300025940 | Ga0207691_10151026 | Ga0207691_101510262 | 78 |
| 90 | 3300025940 | Ga0207691_10771282 | Ga0207691_107712821 | 78 |
| 91 | 3300025941 | Ga0207711_11511811 | Ga0207711_115118111 | 78 |
| 92 | 3300025942 | Ga0207689_10400019 | Ga0207689_104000191 | 78 |
| 93 | 3300025944 | Ga0207661_10034427 | Ga0207661_100344274 | 78 |
| 94 | 3300025944 | Ga0207661_10807954 | Ga0207661_108079541 | 78 |
| 95 | 3300025945 | Ga0207679_10068215 | Ga0207679_100682153 | 78 |
| 96 | 3300025949 | Ga0207667_10177022 | Ga0207667_101770223 | 78 |
| 97 | 3300025960 | Ga0207651_11269751 | Ga0207651_112697512 | 78 |
| 98 | 3300025961 | Ga0207712_10194601 | Ga0207712_101946012 | 78 |
| 99 | 3300025981 | Ga0207640_10093499 | Ga0207640_100934992 | 78 |
| 100 | 3300026041 | Ga0207639_10697919 | Ga0207639_106979192 | 78 |
| 101 | 3300026075 | Ga0207708_10027360 | Ga0207708_100273605 | 78 |
| 102 | 3300026078 | Ga0207702_10907218 | Ga0207702_109072182 | 78 |
| 103 | 3300026088 | Ga0207641_10220207 | Ga0207641_102202072 | 78 |
| 104 | 3300026089 | Ga0207648_10062399 | Ga0207648_100623992 | 78 |
| 105 | 3300026095 | Ga0207676_12238277 | Ga0207676_122382771 | 78 |
| 106 | 3300026116 | Ga0207674_10091638 | Ga0207674_100916385 | 78 |
| 107 | 3300026116 | Ga0207674_10092847 | Ga0207674_100928472 | 78 |
| 108 | 3300026118 | Ga0207675_100087900 | Ga0207675_1000879003 | 78 |
| 109 | 3300026121 | Ga0207683_10262765 | Ga0207683_102627652 | 78 |
| 110 | 3300026121 | Ga0207683_10390286 | Ga0207683_103902862 | 78 |
| 111 | 3300026142 | Ga0207698_10129089 | Ga0207698_101290893 | 78 |
| 112 | 3300026142 | Ga0207698_10536824 | Ga0207698_105368242 | 78 |
| 113 | 3300027543 | Ga0209999_1038993 | Ga0209999_10389932 | 78 |
| 114 | 3300028380 | Ga0268265_10859914 | Ga0268265_108599142 | 78 |
| 115 | 3300028381 | Ga0268264_11251977 | Ga0268264_112519772 | 78 |
| 116 | 3300028573 | Ga0265334_10038961 | Ga0265334_100389612 | 78 |
| 117 | 3300028800 | Ga0265338_10008043 | Ga0265338_1000804310 | 78 |
| 118 | 3300031235 | Ga0265330_10020394 | Ga0265330_100203943 | 78 |
| 119 | 3300031238 | Ga0265332_10078495 | Ga0265332_100784952 | 78 |
| 120 | 3300031241 | Ga0265325_10011190 | Ga0265325_100111905 | 78 |
| 121 | 3300031242 | Ga0265329_10065986 | Ga0265329_100659862 | 78 |
| 122 | 3300031249 | Ga0265339_10030156 | Ga0265339_100301561 | 78 |
| 123 | 3300031250 | Ga0265331_10039309 | Ga0265331_100393094 | 78 |
| 124 | 3300031251 | Ga0265327_10014468 | Ga0265327_100144681 | 78 |
| 125 | 3300031344 | Ga0265316_10006730 | Ga0265316_1000673012 | 78 |
| 126 | 3300031548 | Ga0307408_100130576 | Ga0307408_1001305763 | 78 |
| 127 | 3300031691 | Ga0316579_10378930 | Ga0316579_103789302 | 78 |
| 128 | 3300031711 | Ga0265314_10001092 | Ga0265314_1000109230 | 78 |
| 129 | 3300031712 | Ga0265342_10131561 | Ga0265342_101315612 | 78 |
| 130 | 3300031728 | Ga0316578_10064532 | Ga0316578_100645322 | 78 |
| 131 | 3300031852 | Ga0307410_10123091 | Ga0307410_101230913 | 78 |
| 132 | 3300031901 | Ga0307406_10279616 | Ga0307406_102796162 | 78 |
| 133 | 3300031901 | Ga0307406_11509670 | Ga0307406_115096702 | 78 |
| 134 | 3300031903 | Ga0307407_11089715 | Ga0307407_110897151 | 78 |
| 135 | 3300031995 | Ga0307409_100120162 | Ga0307409_1001201623 | 78 |
| 136 | 3300032002 | Ga0307416_100152016 | Ga0307416_1001520163 | 78 |
| 137 | 3300032004 | Ga0307414_10419074 | Ga0307414_104190742 | 78 |
| 138 | 3300032005 | Ga0307411_11076329 | Ga0307411_110763292 | 78 |
| 139 | 3300032126 | Ga0307415_100036289 | Ga0307415_1000362894 | 78 |
| 140 | 3300032168 | Ga0316593_10055678 | Ga0316593_100556783 | 78 |
| 141 | 3300035114 | Ga0373939_0241341 | Ga0373939_0241341_259_495 | 78 |
| 142 | 3300035115 | Ga0373941_0067871 | Ga0373941_0067871_808_1044 | 78 |
| 143 | 3300035398 | Ga0316574_0401048 | Ga0316574_0401048_524_820 | 78 |
| 144 | 3300036647 | Ga0316582_0082994 | Ga0316582_0082994_211_507 | 78 |
| 145 | 3300037312 | Ga0395899_0616581 | Ga0395899_0616581_140_379 | 78 |
| 146 | 3300037418 | Ga0395900_0025546 | Ga0395900_0025546_5329_5568 | 78 |
| 147 | 3300037418 | Ga0395900_0174066 | Ga0395900_0174066_1910_2149 | 78 |
| 148 | 3300037418 | Ga0395900_0391386 | Ga0395900_0391386_714_950 | 78 |
| 149 | 3300037466 | Ga0395898_0007790 | Ga0395898_0007790_9404_9643 | 78 |
| 150 | 3300037466 | Ga0395898_0471038 | Ga0395898_0471038_771_1007 | 78 |
| 151 | 3300037466 | Ga0395898_1595481 | Ga0395898_1595481_308_547 | 78 |
| 152 | 3300037471 | Ga0395905_0005133 | Ga0395905_0005133_11966_12205 | 78 |
| 153 | 3300037471 | Ga0395905_1901100 | Ga0395905_1901100_195_434 | 78 |
| 154 | 3300038443 | Ga0395901_0000858 | Ga0395901_0000858_20656_20895 | 78 |
| 155 | 3300039437 | Ga0436365_1307869 | Ga0436365_1307869_814_1062 | 78 |
| 156 | 3300041492 | Ga0451835_0393426 | Ga0451835_0393426_10_249 | 78 |
| 157 | 3300041512 | Ga0451853_2077639 | Ga0451853_2077639_395_634 | 78 |
| 158 | 3300041997 | Ga0439431_0133921 | Ga0439431_0133921_85_324 | 78 |
| 159 | 3300042005 | Ga0439448_0009474 | Ga0439448_0009474_692_928 | 78 |
| 160 | 3300042439 | Ga0439464_0067851 | Ga0439464_0067851_176_412 | 78 |
| 161 | 3300044735 | Ga0466968_0278051 | Ga0466968_0278051_529_768 | 78 |
| 162 | 3300044901 | Ga0466960_0203959 | Ga0466960_0203959_65_304 | 78 |
| 163 | 3300045836 | Ga0466958_0647930 | Ga0466958_0647930_80_319 | 78 |
| 164 | 3300045976 | Ga0466967_0122312 | Ga0466967_0122312_1234_1473 | 78 |
| 165 | 3300045976 | Ga0466967_0155186 | Ga0466967_0155186_866_1105 | 78 |
| 166 | 3300045976 | Ga0466967_0962013 | Ga0466967_0962013_507_746 | 78 |
| 167 | 3300046453 | Ga0495627_016902 | Ga0495627_016902_1305_1541 | 78 |
| 168 | 3300046457 | Ga0495590_0376074 | Ga0495590_0376074_183_419 | 78 |
| 169 | 3300046491 | Ga0495584_0047606 | Ga0495584_0047606_441_677 | 78 |
| 170 | 3300046500 | Ga0495596_0096247 | Ga0495596_0096247_128_364 | 78 |
| 171 | 3300046515 | Ga0495620_0098419 | Ga0495620_0098419_568_804 | 78 |
| 172 | 3300046519 | Ga0495632_0175908 | Ga0495632_0175908_92_328 | 78 |
| 173 | 3300046520 | Ga0495637_0066311 | Ga0495637_0066311_490_726 | 78 |
| 174 | 3300046525 | Ga0495663_0023711 | Ga0495663_0023711_307_543 | 78 |
| 175 | 3300046528 | Ga0495642_0201191 | Ga0495642_0201191_64_300 | 78 |
| 176 | 3300046528 | Ga0495642_0544938 | Ga0495642_0544938_24_260 | 78 |
| 177 | 3300046537 | Ga0495598_0003842 | Ga0495598_0003842_1010_1246 | 78 |
| 178 | 3300046538 | Ga0495609_0051735 | Ga0495609_0051735_568_804 | 78 |
| 179 | 3300046539 | Ga0495621_0067695 | Ga0495621_0067695_663_899 | 78 |
| 180 | 3300046558 | Ga0495633_0096823 | Ga0495633_0096823_692_928 | 78 |
| 181 | 3300046615 | Ga0495656_0498609 | Ga0495656_0498609_226_462 | 78 |
| 182 | 3300046616 | Ga0495668_0267016 | Ga0495668_0267016_74_310 | 78 |
| 183 | 3300046648 | Ga0495611_0187276 | Ga0495611_0187276_490_726 | 78 |
| 184 | 3300046660 | Ga0495625_0393787 | Ga0495625_0393787_494_730 | 78 |
| 185 | 3300046664 | Ga0495659_0122975 | Ga0495659_0122975_692_928 | 78 |
| 186 | 3300046665 | Ga0495661_0127704 | Ga0495661_0127704_971_1207 | 78 |
| 187 | 3300046684 | Ga0495669_0398976 | Ga0495669_0398976_290_526 | 78 |
| 188 | 3300046690 | Ga0495624_0146370 | Ga0495624_0146370_429_668 | 78 |
| 189 | 3300046692 | Ga0495671_0270452 | Ga0495671_0270452_113_349 | 78 |
| 190 | 3300046692 | Ga0495671_0408986 | Ga0495671_0408986_120_356 | 78 |
| 191 | 3300046794 | Ga0495589_0093307 | Ga0495589_0093307_247_483 | 78 |
| 192 | 3300046794 | Ga0495589_0253359 | Ga0495589_0253359_128_364 | 78 |
| 193 | 3300046810 | Ga0495660_0150832 | Ga0495660_0150832_380_616 | 78 |
| 194 | 3300047323 | Ga0495683_0040364 | Ga0495683_0040364_537_773 | 78 |
| 195 | 3300047445 | Ga0495677_0390423 | Ga0495677_0390423_300_536 | 78 |
| 196 | 3300047446 | Ga0495679_047846 | Ga0495679_047846_794_1030 | 78 |
| 197 | 3300047447 | Ga0495685_030227 | Ga0495685_030227_210_446 | 78 |
| 198 | 3300047470 | Ga0495681_0116750 | Ga0495681_0116750_604_840 | 78 |
| 199 | 3300048090 | Ga0495615_0081009 | Ga0495615_0081009_273_509 | 78 |
| 200 | 3300048091 | Ga0495626_0051652 | Ga0495626_0051652_100_336 | 78 |
| 201 | 3300048904 | Ga0496101_0519818 | Ga0496101_0519818_187_423 | 78 |
| 202 | 3300048905 | Ga0496102_0026366 | Ga0496102_0026366_231_467 | 78 |
| 203 | 3300048905 | Ga0496102_1640291 | Ga0496102_1640291_181_420 | 78 |
| 204 | 3300048910 | Ga0496107_1295836 | Ga0496107_1295836_87_323 | 78 |
| 205 | 3300048911 | Ga0496108_0056899 | Ga0496108_0056899_182_418 | 78 |
| 206 | 3300048912 | Ga0496109_0004156 | Ga0496109_0004156_1114_1350 | 78 |
| 207 | 3300048913 | Ga0496110_0076937 | Ga0496110_0076937_997_1233 | 78 |
| 208 | 3300048914 | Ga0496111_0021446 | Ga0496111_0021446_1472_1708 | 78 |
| 209 | 3300048916 | Ga0496113_0044155 | Ga0496113_0044155_1714_1950 | 78 |
| 210 | 3300048917 | Ga0496114_0244660 | Ga0496114_0244660_1243_1482 | 78 |
| 211 | 3300049656 | Ga0501209_100040 | Ga0501209_100040_540_776 | 78 |
| 212 | 3300049661 | Ga0501217_251894 | Ga0501217_251894_222_458 | 78 |
| 213 | 3300049851 | Ga0501212_028918 | Ga0501212_028918_159_395 | 78 |
| 214 | 3300050507 | nmdc:mga05p37_469091_c1 | nmdc:mga05p37_469091_c1_351_587 | 78 |
| 215 | 3300050508 | nmdc:mga09592_504848_c1 | nmdc:mga09592_504848_c1_20_256 | 78 |
| 216 | 3300050511 | nmdc:mga08y16_105171_c1 | nmdc:mga08y16_105171_c1_983_1219 | 78 |
| 217 | 3300053083 | Ga0495655_0099948 | Ga0495655_0099948_304_540 | 78 |
| 218 | 3300060353 | Ga0501082_0885649 | Ga0501082_0885649_334_573 | 78 |
| 219 | iso_pu_bacteria | 2599185299 | 2599929561 | 79 |
| 220 | iso_pu_bacteria | 2648501693 | 2650899948 | 79 |
| 221 | iso_pu_bacteria | 2684622997 | 2686356682 | 79 |
| 222 | iso_pu_bacteria | 2808606414 | 2809127796 | 79 |
| 223 | iso_pu_bacteria | 2811994881 | 2812370084 | 79 |
| 224 | iso_pu_bacteria | 2844528606 | 2844532840 | 79 |
| 225 | iso_pu_bacteria | 2847797336 | 2847797498 | 79 |
| 226 | iso_pu_bacteria | 2865014394 | 2865017881 | 79 |
| 227 | iso_pu_bacteria | 2923519811 | 2923524170 | 79 |
| 228 | iso_pu_bacteria | 2939602548 | 2939604983 | 79 |
| 229 | iso_pu_bacteria | 2945951305 | 2945955069 | 79 |
| 230 | iso_pu_bacteria | 2984494565 | 2984498922 | 79 |
| 231 | iso_pu_bacteria | 2990261002 | 2990264820 | 79 |
| 232 | iso_pu_bacteria | 3007315729 | 3007316815 | 79 |
| 233 | 3300032126 | Ga0307415_101311422 | Ga0307415_1013114221 | 80 |
| 234 | 3300038443 | Ga0395901_0220757 | Ga0395901_0220757_1310_1552 | 80 |
| 235 | 3300038443 | Ga0395901_0993850 | Ga0395901_0993850_181_423 | 80 |
| 236 | 3300050507 | nmdc:mga05p37_355444_c1 | nmdc:mga05p37_355444_c1_1197_1439 | 80 |
| 237 | 3300050509 | nmdc:mga0qj67_376832_c1 | nmdc:mga0qj67_376832_c1_144_386 | 80 |
| 238 | 3300026088 | Ga0207641_12536463 | Ga0207641_125364631 | 82 |
| 239 | 3300041512 | Ga0451853_1119058 | Ga0451853_1119058_259_507 | 82 |
| 240 | 3300046474 | Ga0495605_0188176 | Ga0495605_0188176_54_305 | 82 |
| 241 | 3300046537 | Ga0495598_0321145 | Ga0495598_0321145_327_578 | 82 |
| 242 | 3300046538 | Ga0495609_0275962 | Ga0495609_0275962_228_479 | 82 |
| 243 | 3300046615 | Ga0495656_0368244 | Ga0495656_0368244_228_479 | 82 |
| 244 | 3300046664 | Ga0495659_0130291 | Ga0495659_0130291_561_812 | 82 |
| 245 | 3300046691 | Ga0495670_0111165 | Ga0495670_0111165_397_648 | 82 |
| 246 | 3300048903 | Ga0496100_0666725 | Ga0496100_0666725_466_717 | 82 |
| 247 | 3300001977 | JGI24746J21847_1058514 | JGI24746J21847_10585141 | 83 |
| 248 | 3300001989 | JGI24739J22299_10000283 | JGI24739J22299_1000028312 | 83 |
| 249 | 3300001990 | JGI24737J22298_10025257 | JGI24737J22298_100252572 | 83 |
| 250 | 3300003856 | Ga0058692_1002795 | Ga0058692_10027952 | 83 |
| 251 | 3300003856 | Ga0058692_1037455 | Ga0058692_10374552 | 83 |
| 252 | 3300005327 | Ga0070658_10438177 | Ga0070658_104381772 | 83 |
| 253 | 3300005330 | Ga0070690_101437737 | Ga0070690_1014377371 | 83 |
| 254 | 3300005331 | Ga0070670_100394451 | Ga0070670_1003944512 | 83 |
| 255 | 3300005331 | Ga0070670_100406116 | Ga0070670_1004061162 | 83 |
| 256 | 3300005334 | Ga0068869_100272185 | Ga0068869_1002721852 | 83 |
| 257 | 3300005334 | Ga0068869_100333026 | Ga0068869_1003330262 | 83 |
| 258 | 3300005336 | Ga0070680_100130580 | Ga0070680_1001305803 | 83 |
| 259 | 3300005336 | Ga0070680_100393420 | Ga0070680_1003934202 | 83 |
| 260 | 3300005336 | Ga0070680_100492402 | Ga0070680_1004924022 | 83 |
| 261 | 3300005336 | Ga0070680_100847820 | Ga0070680_1008478202 | 83 |
| 262 | 3300005337 | Ga0070682_102005442 | Ga0070682_1020054421 | 83 |
| 263 | 3300005339 | Ga0070660_100006354 | Ga0070660_1000063546 | 83 |
| 264 | 3300005339 | Ga0070660_100428559 | Ga0070660_1004285592 | 83 |
| 265 | 3300005339 | Ga0070660_100755048 | Ga0070660_1007550482 | 83 |
| 266 | 3300005339 | Ga0070660_101265839 | Ga0070660_1012658392 | 83 |
| 267 | 3300005341 | Ga0070691_10063178 | Ga0070691_100631783 | 83 |
| 268 | 3300005344 | Ga0070661_100566336 | Ga0070661_1005663362 | 83 |
| 269 | 3300005347 | Ga0070668_100012549 | Ga0070668_1000125496 | 83 |
| 270 | 3300005354 | Ga0070675_100112421 | Ga0070675_1001124213 | 83 |
| 271 | 3300005354 | Ga0070675_100267290 | Ga0070675_1002672902 | 83 |
| 272 | 3300005355 | Ga0070671_101903262 | Ga0070671_1019032621 | 83 |
| 273 | 3300005356 | Ga0070674_100145246 | Ga0070674_1001452462 | 83 |
| 274 | 3300005364 | Ga0070673_100511073 | Ga0070673_1005110732 | 83 |
| 275 | 3300005366 | Ga0070659_100161739 | Ga0070659_1001617393 | 83 |
| 276 | 3300005366 | Ga0070659_100261155 | Ga0070659_1002611552 | 83 |
| 277 | 3300005367 | Ga0070667_100217408 | Ga0070667_1002174083 | 83 |
| 278 | 3300005435 | Ga0070714_100014073 | Ga0070714_1000140737 | 83 |
| 279 | 3300005435 | Ga0070714_100280213 | Ga0070714_1002802132 | 83 |
| 280 | 3300005438 | Ga0070701_10809212 | Ga0070701_108092122 | 83 |
| 281 | 3300005439 | Ga0070711_101945637 | Ga0070711_1019456371 | 83 |
| 282 | 3300005440 | Ga0070705_100401888 | Ga0070705_1004018882 | 83 |
| 283 | 3300005441 | Ga0070700_100028625 | Ga0070700_1000286252 | 83 |
| 284 | 3300005441 | Ga0070700_100260899 | Ga0070700_1002608991 | 83 |
| 285 | 3300005444 | Ga0070694_100282629 | Ga0070694_1002826292 | 83 |
| 286 | 3300005444 | Ga0070694_100762237 | Ga0070694_1007622372 | 83 |
| 287 | 3300005445 | Ga0070708_100208609 | Ga0070708_1002086092 | 83 |
| 288 | 3300005456 | Ga0070678_100297595 | Ga0070678_1002975952 | 83 |
| 289 | 3300005456 | Ga0070678_100412325 | Ga0070678_1004123252 | 83 |
| 290 | 3300005456 | Ga0070678_100614098 | Ga0070678_1006140982 | 83 |
| 291 | 3300005457 | Ga0070662_100000583 | Ga0070662_10000058313 | 83 |
| 292 | 3300005457 | Ga0070662_100122522 | Ga0070662_1001225222 | 83 |
| 293 | 3300005457 | Ga0070662_100658423 | Ga0070662_1006584232 | 83 |
| 294 | 3300005458 | Ga0070681_10026332 | Ga0070681_100263324 | 83 |
| 295 | 3300005458 | Ga0070681_10063954 | Ga0070681_100639545 | 83 |
| 296 | 3300005458 | Ga0070681_10757258 | Ga0070681_107572582 | 83 |
| 297 | 3300005458 | Ga0070681_11045938 | Ga0070681_110459382 | 83 |
| 298 | 3300005459 | Ga0068867_100100912 | Ga0068867_1001009123 | 83 |
| 299 | 3300005459 | Ga0068867_100135245 | Ga0068867_1001352452 | 83 |
| 300 | 3300005467 | Ga0070706_100422510 | Ga0070706_1004225102 | 83 |
| 301 | 3300005468 | Ga0070707_100034911 | Ga0070707_1000349113 | 83 |
| 302 | 3300005518 | Ga0070699_100014492 | Ga0070699_1000144925 | 83 |
| 303 | 3300005530 | Ga0070679_100235833 | Ga0070679_1002358331 | 83 |
| 304 | 3300005530 | Ga0070679_100397913 | Ga0070679_1003979131 | 83 |
| 305 | 3300005530 | Ga0070679_100637111 | Ga0070679_1006371112 | 83 |
| 306 | 3300005530 | Ga0070679_101996008 | Ga0070679_1019960082 | 83 |
| 307 | 3300005535 | Ga0070684_100061758 | Ga0070684_1000617583 | 83 |
| 308 | 3300005535 | Ga0070684_100553290 | Ga0070684_1005532902 | 83 |
| 309 | 3300005535 | Ga0070684_100969609 | Ga0070684_1009696091 | 83 |
| 310 | 3300005535 | Ga0070684_101120189 | Ga0070684_1011201892 | 83 |
| 311 | 3300005535 | Ga0070684_101765697 | Ga0070684_1017656972 | 83 |
| 312 | 3300005539 | Ga0068853_100511976 | Ga0068853_1005119762 | 83 |
| 313 | 3300005544 | Ga0070686_100153526 | Ga0070686_1001535262 | 83 |
| 314 | 3300005544 | Ga0070686_100185569 | Ga0070686_1001855692 | 83 |
| 315 | 3300005545 | Ga0070695_100205059 | Ga0070695_1002050592 | 83 |
| 316 | 3300005545 | Ga0070695_101324058 | Ga0070695_1013240581 | 83 |
| 317 | 3300005546 | Ga0070696_101053725 | Ga0070696_1010537252 | 83 |
| 318 | 3300005547 | Ga0070693_100045777 | Ga0070693_1000457772 | 83 |
| 319 | 3300005547 | Ga0070693_101599224 | Ga0070693_1015992241 | 83 |
| 320 | 3300005548 | Ga0070665_100025626 | Ga0070665_1000256264 | 83 |
| 321 | 3300005548 | Ga0070665_101949515 | Ga0070665_1019495152 | 83 |
| 322 | 3300005548 | Ga0070665_102409774 | Ga0070665_1024097742 | 83 |
| 323 | 3300005549 | Ga0070704_100241704 | Ga0070704_1002417043 | 83 |
| 324 | 3300005563 | Ga0068855_100053717 | Ga0068855_1000537175 | 83 |
| 325 | 3300005563 | Ga0068855_100053997 | Ga0068855_1000539973 | 83 |
| 326 | 3300005563 | Ga0068855_100360618 | Ga0068855_1003606182 | 83 |
| 327 | 3300005563 | Ga0068855_101753660 | Ga0068855_1017536602 | 83 |
| 328 | 3300005564 | Ga0070664_100063340 | Ga0070664_1000633402 | 83 |
| 329 | 3300005564 | Ga0070664_101714905 | Ga0070664_1017149052 | 83 |
| 330 | 3300005577 | Ga0068857_100000015 | Ga0068857_10000001571 | 83 |
| 331 | 3300005577 | Ga0068857_100000499 | Ga0068857_1000004998 | 83 |
| 332 | 3300005577 | Ga0068857_100178538 | Ga0068857_1001785381 | 83 |
| 333 | 3300005577 | Ga0068857_101795359 | Ga0068857_1017953592 | 83 |
| 334 | 3300005614 | Ga0068856_101420122 | Ga0068856_1014201222 | 83 |
| 335 | 3300005614 | Ga0068856_102246368 | Ga0068856_1022463681 | 83 |
| 336 | 3300005615 | Ga0070702_100670725 | Ga0070702_1006707251 | 83 |
| 337 | 3300005615 | Ga0070702_101265094 | Ga0070702_1012650942 | 83 |
| 338 | 3300005616 | Ga0068852_100067986 | Ga0068852_1000679862 | 83 |
| 339 | 3300005616 | Ga0068852_101342931 | Ga0068852_1013429311 | 83 |
| 340 | 3300005616 | Ga0068852_101373980 | Ga0068852_1013739802 | 83 |
| 341 | 3300005617 | Ga0068859_100216044 | Ga0068859_1002160443 | 83 |
| 342 | 3300005618 | Ga0068864_100535064 | Ga0068864_1005350642 | 83 |
| 343 | 3300005718 | Ga0068866_10192567 | Ga0068866_101925672 | 83 |
| 344 | 3300005719 | Ga0068861_102190785 | Ga0068861_1021907851 | 83 |
| 345 | 3300005834 | Ga0068851_10001471 | Ga0068851_100014718 | 83 |
| 346 | 3300005841 | Ga0068863_100288730 | Ga0068863_1002887302 | 83 |
| 347 | 3300005844 | Ga0068862_102044956 | Ga0068862_1020449562 | 83 |
| 348 | 3300005937 | Ga0081455_10263195 | Ga0081455_102631952 | 83 |
| 349 | 3300005981 | Ga0081538_10326066 | Ga0081538_103260661 | 83 |
| 350 | 3300006051 | Ga0075364_10426563 | Ga0075364_104265632 | 83 |
| 351 | 3300006058 | Ga0075432_10085423 | Ga0075432_100854232 | 83 |
| 352 | 3300006163 | Ga0070715_10008667 | Ga0070715_100086672 | 83 |
| 353 | 3300006186 | Ga0075369_10046641 | Ga0075369_100466412 | 83 |
| 354 | 3300006195 | Ga0075366_10007989 | Ga0075366_100079896 | 83 |
| 355 | 3300006358 | Ga0068871_101556192 | Ga0068871_1015561921 | 83 |
| 356 | 3300006844 | Ga0075428_100159732 | Ga0075428_1001597324 | 83 |
| 357 | 3300006847 | Ga0075431_101064808 | Ga0075431_1010648082 | 83 |
| 358 | 3300006880 | Ga0075429_100310215 | Ga0075429_1003102152 | 83 |
| 359 | 3300006931 | Ga0097620_100216040 | Ga0097620_1002160403 | 83 |
| 360 | 3300006946 | Ga0079104_1000172 | Ga0079104_100017227 | 83 |
| 361 | 3300006946 | Ga0079104_1007460 | Ga0079104_10074603 | 83 |
| 362 | 3300009011 | Ga0105251_10000234 | Ga0105251_1000023425 | 83 |
| 363 | 3300009011 | Ga0105251_10191698 | Ga0105251_101916982 | 83 |
| 364 | 3300009036 | Ga0105244_10002167 | Ga0105244_100021679 | 83 |
| 365 | 3300009036 | Ga0105244_10002274 | Ga0105244_100022744 | 83 |
| 366 | 3300009036 | Ga0105244_10002611 | Ga0105244_100026118 | 83 |
| 367 | 3300009036 | Ga0105244_10010141 | Ga0105244_100101417 | 83 |
| 368 | 3300009036 | Ga0105244_10016612 | Ga0105244_100166124 | 83 |
| 369 | 3300009036 | Ga0105244_10020509 | Ga0105244_100205095 | 83 |
| 370 | 3300009036 | Ga0105244_10048846 | Ga0105244_100488463 | 83 |
| 371 | 3300009036 | Ga0105244_10068461 | Ga0105244_100684612 | 83 |
| 372 | 3300009036 | Ga0105244_10246549 | Ga0105244_102465492 | 83 |
| 373 | 3300009092 | Ga0105250_10000012 | Ga0105250_10000012218 | 83 |
| 374 | 3300009092 | Ga0105250_10001974 | Ga0105250_100019744 | 83 |
| 375 | 3300009092 | Ga0105250_10036270 | Ga0105250_100362702 | 83 |
| 376 | 3300009092 | Ga0105250_10097189 | Ga0105250_100971892 | 83 |
| 377 | 3300009092 | Ga0105250_10113388 | Ga0105250_101133882 | 83 |
| 378 | 3300009093 | Ga0105240_10065139 | Ga0105240_100651392 | 83 |
| 379 | 3300009093 | Ga0105240_10164944 | Ga0105240_101649443 | 83 |
| 380 | 3300009093 | Ga0105240_10563181 | Ga0105240_105631812 | 83 |
| 381 | 3300009094 | Ga0111539_10009131 | Ga0111539_100091317 | 83 |
| 382 | 3300009094 | Ga0111539_10074492 | Ga0111539_100744923 | 83 |
| 383 | 3300009094 | Ga0111539_10683961 | Ga0111539_106839612 | 83 |
| 384 | 3300009098 | Ga0105245_10120739 | Ga0105245_101207392 | 83 |
| 385 | 3300009098 | Ga0105245_10295861 | Ga0105245_102958612 | 83 |
| 386 | 3300009098 | Ga0105245_11292833 | Ga0105245_112928332 | 83 |
| 387 | 3300009098 | Ga0105245_12148494 | Ga0105245_121484942 | 83 |
| 388 | 3300009101 | Ga0105247_10167719 | Ga0105247_101677192 | 83 |
| 389 | 3300009147 | Ga0114129_10095892 | Ga0114129_100958923 | 83 |
| 390 | 3300009147 | Ga0114129_10218064 | Ga0114129_102180644 | 83 |
| 391 | 3300009148 | Ga0105243_10000094 | Ga0105243_1000009424 | 83 |
| 392 | 3300009148 | Ga0105243_10037198 | Ga0105243_100371983 | 83 |
| 393 | 3300009148 | Ga0105243_10163990 | Ga0105243_101639902 | 83 |
| 394 | 3300009148 | Ga0105243_11033305 | Ga0105243_110333052 | 83 |
| 395 | 3300009148 | Ga0105243_11160990 | Ga0105243_111609902 | 83 |
| 396 | 3300009176 | Ga0105242_10168080 | Ga0105242_101680802 | 83 |
| 397 | 3300009545 | Ga0105237_11993251 | Ga0105237_119932511 | 83 |
| 398 | 3300009553 | Ga0105249_10291677 | Ga0105249_102916772 | 83 |
| 399 | 3300009553 | Ga0105249_11035982 | Ga0105249_110359822 | 83 |
| 400 | 3300009553 | Ga0105249_12018115 | Ga0105249_120181152 | 83 |
| 401 | 3300010375 | Ga0105239_10398025 | Ga0105239_103980251 | 83 |
| 402 | 3300010375 | Ga0105239_10683216 | Ga0105239_106832162 | 83 |
| 403 | 3300010375 | Ga0105239_10689438 | Ga0105239_106894382 | 83 |
| 404 | 3300010375 | Ga0105239_11853621 | Ga0105239_118536211 | 83 |
| 405 | 3300011119 | Ga0105246_10480342 | Ga0105246_104803422 | 83 |
| 406 | 3300011119 | Ga0105246_10678812 | Ga0105246_106788122 | 83 |
| 407 | 3300013100 | Ga0157373_10054022 | Ga0157373_100540223 | 83 |
| 408 | 3300013100 | Ga0157373_10055716 | Ga0157373_100557164 | 83 |
| 409 | 3300013100 | Ga0157373_10184517 | Ga0157373_101845171 | 83 |
| 410 | 3300013100 | Ga0157373_10242675 | Ga0157373_102426752 | 83 |
| 411 | 3300013100 | Ga0157373_10974196 | Ga0157373_109741962 | 83 |
| 412 | 3300013102 | Ga0157371_10000957 | Ga0157371_1000095736 | 83 |
| 413 | 3300013102 | Ga0157371_10005015 | Ga0157371_1000501513 | 83 |
| 414 | 3300013102 | Ga0157371_10143320 | Ga0157371_101433202 | 83 |
| 415 | 3300013102 | Ga0157371_10622095 | Ga0157371_106220951 | 83 |
| 416 | 3300013104 | Ga0157370_10002299 | Ga0157370_1000229924 | 83 |
| 417 | 3300013104 | Ga0157370_10032663 | Ga0157370_100326636 | 83 |
| 418 | 3300013104 | Ga0157370_10328080 | Ga0157370_103280802 | 83 |
| 419 | 3300013105 | Ga0157369_10159116 | Ga0157369_101591164 | 83 |
| 420 | 3300013105 | Ga0157369_11543071 | Ga0157369_115430711 | 83 |
| 421 | 3300013296 | Ga0157374_11642422 | Ga0157374_116424221 | 83 |
| 422 | 3300013297 | Ga0157378_10802571 | Ga0157378_108025712 | 83 |
| 423 | 3300013297 | Ga0157378_11624136 | Ga0157378_116241362 | 83 |
| 424 | 3300013306 | Ga0163162_10041125 | Ga0163162_100411254 | 83 |
| 425 | 3300013306 | Ga0163162_10503678 | Ga0163162_105036782 | 83 |
| 426 | 3300013306 | Ga0163162_10933063 | Ga0163162_109330633 | 83 |
| 427 | 3300013307 | Ga0157372_10014550 | Ga0157372_100145506 | 83 |
| 428 | 3300013307 | Ga0157372_10020586 | Ga0157372_100205867 | 83 |
| 429 | 3300013307 | Ga0157372_10088962 | Ga0157372_100889625 | 83 |
| 430 | 3300013307 | Ga0157372_10586544 | Ga0157372_105865442 | 83 |
| 431 | 3300013307 | Ga0157372_11420355 | Ga0157372_114203552 | 83 |
| 432 | 3300013307 | Ga0157372_11622289 | Ga0157372_116222891 | 83 |
| 433 | 3300013307 | Ga0157372_11761561 | Ga0157372_117615611 | 83 |
| 434 | 3300013308 | Ga0157375_10101127 | Ga0157375_101011273 | 83 |
| 435 | 3300014325 | Ga0163163_12465741 | Ga0163163_124657411 | 83 |
| 436 | 3300014326 | Ga0157380_11983174 | Ga0157380_119831742 | 83 |
| 437 | 3300014326 | Ga0157380_12166150 | Ga0157380_121661502 | 83 |
| 438 | 3300014497 | Ga0182008_10297617 | Ga0182008_102976172 | 83 |
| 439 | 3300014745 | Ga0157377_10106473 | Ga0157377_101064731 | 83 |
| 440 | 3300014745 | Ga0157377_11138737 | Ga0157377_111387371 | 83 |
| 441 | 3300014968 | Ga0157379_10736474 | Ga0157379_107364741 | 83 |
| 442 | 3300015261 | Ga0182006_1001057 | Ga0182006_10010576 | 83 |
| 443 | 3300015261 | Ga0182006_1005498 | Ga0182006_10054985 | 83 |
| 444 | 3300015261 | Ga0182006_1063654 | Ga0182006_10636543 | 83 |
| 445 | 3300015261 | Ga0182006_1121984 | Ga0182006_11219842 | 83 |
| 446 | 3300015262 | Ga0182007_10010004 | Ga0182007_100100044 | 83 |
| 447 | 3300017792 | Ga0163161_10016748 | Ga0163161_100167485 | 83 |
| 448 | 3300017792 | Ga0163161_11633173 | Ga0163161_116331731 | 83 |
| 449 | 3300020070 | Ga0206356_11168965 | Ga0206356_111689652 | 83 |
| 450 | 3300020076 | Ga0206355_1549020 | Ga0206355_15490201 | 83 |
| 451 | 3300020081 | Ga0206354_11642342 | Ga0206354_116423422 | 83 |
| 452 | 3300020082 | Ga0206353_10122185 | Ga0206353_101221851 | 83 |
| 453 | 3300020082 | Ga0206353_11390648 | Ga0206353_113906482 | 83 |
| 454 | 3300025711 | Ga0207696_1000237 | Ga0207696_100023731 | 83 |
| 455 | 3300025728 | Ga0207655_1000178 | Ga0207655_100017844 | 83 |
| 456 | 3300025728 | Ga0207655_1002439 | Ga0207655_10024396 | 83 |
| 457 | 3300025728 | Ga0207655_1006667 | Ga0207655_10066676 | 83 |
| 458 | 3300025735 | Ga0207713_1004567 | Ga0207713_10045675 | 83 |
| 459 | 3300025899 | Ga0207642_10326856 | Ga0207642_103268562 | 83 |
| 460 | 3300025905 | Ga0207685_10028322 | Ga0207685_100283223 | 83 |
| 461 | 3300025909 | Ga0207705_10523876 | Ga0207705_105238762 | 83 |
| 462 | 3300025909 | Ga0207705_10555669 | Ga0207705_105556691 | 83 |
| 463 | 3300025912 | Ga0207707_10099760 | Ga0207707_100997601 | 83 |
| 464 | 3300025912 | Ga0207707_10478197 | Ga0207707_104781972 | 83 |
| 465 | 3300025913 | Ga0207695_10312295 | Ga0207695_103122952 | 83 |
| 466 | 3300025917 | Ga0207660_10246673 | Ga0207660_102466732 | 83 |
| 467 | 3300025917 | Ga0207660_10267851 | Ga0207660_102678513 | 83 |
| 468 | 3300025917 | Ga0207660_10896771 | Ga0207660_108967711 | 83 |
| 469 | 3300025919 | Ga0207657_10006406 | Ga0207657_100064063 | 83 |
| 470 | 3300025919 | Ga0207657_10130964 | Ga0207657_101309642 | 83 |
| 471 | 3300025919 | Ga0207657_10462043 | Ga0207657_104620432 | 83 |
| 472 | 3300025921 | Ga0207652_10130638 | Ga0207652_101306385 | 83 |
| 473 | 3300025921 | Ga0207652_10609556 | Ga0207652_106095561 | 83 |
| 474 | 3300025921 | Ga0207652_11354912 | Ga0207652_113549121 | 83 |
| 475 | 3300025922 | Ga0207646_10045099 | Ga0207646_100450993 | 83 |
| 476 | 3300025924 | Ga0207694_11550883 | Ga0207694_115508831 | 83 |
| 477 | 3300025925 | Ga0207650_11164700 | Ga0207650_111647002 | 83 |
| 478 | 3300025925 | Ga0207650_11187015 | Ga0207650_111870152 | 83 |
| 479 | 3300025927 | Ga0207687_10983432 | Ga0207687_109834321 | 83 |
| 480 | 3300025928 | Ga0207700_10299650 | Ga0207700_102996501 | 83 |
| 481 | 3300025928 | Ga0207700_11024219 | Ga0207700_110242192 | 83 |
| 482 | 3300025929 | Ga0207664_10005768 | Ga0207664_100057683 | 83 |
| 483 | 3300025929 | Ga0207664_10285088 | Ga0207664_102850882 | 83 |
| 484 | 3300025932 | Ga0207690_10195927 | Ga0207690_101959273 | 83 |
| 485 | 3300025933 | Ga0207706_10001654 | Ga0207706_1000165412 | 83 |
| 486 | 3300025933 | Ga0207706_11261636 | Ga0207706_112616361 | 83 |
| 487 | 3300025938 | Ga0207704_10068645 | Ga0207704_100686452 | 83 |
| 488 | 3300025939 | Ga0207665_10497180 | Ga0207665_104971801 | 83 |
| 489 | 3300025942 | Ga0207689_10142791 | Ga0207689_101427913 | 83 |
| 490 | 3300025942 | Ga0207689_10564021 | Ga0207689_105640212 | 83 |
| 491 | 3300025944 | Ga0207661_10182726 | Ga0207661_101827262 | 83 |
| 492 | 3300025944 | Ga0207661_10331548 | Ga0207661_103315483 | 83 |
| 493 | 3300025944 | Ga0207661_10859782 | Ga0207661_108597822 | 83 |
| 494 | 3300025944 | Ga0207661_11928679 | Ga0207661_119286791 | 83 |
| 495 | 3300025945 | Ga0207679_10174752 | Ga0207679_101747523 | 83 |
| 496 | 3300025949 | Ga0207667_10196213 | Ga0207667_101962132 | 83 |
| 497 | 3300025949 | Ga0207667_10592641 | Ga0207667_105926412 | 83 |
| 498 | 3300025949 | Ga0207667_11973796 | Ga0207667_119737962 | 83 |
| 499 | 3300025961 | Ga0207712_11308047 | Ga0207712_113080472 | 83 |
| 500 | 3300025972 | Ga0207668_10011566 | Ga0207668_100115665 | 83 |
| 501 | 3300025972 | Ga0207668_10172260 | Ga0207668_101722602 | 83 |
| 502 | 3300025981 | Ga0207640_10922976 | Ga0207640_109229761 | 83 |
| 503 | 3300025986 | Ga0207658_10439556 | Ga0207658_104395562 | 83 |
| 504 | 3300026035 | Ga0207703_10198494 | Ga0207703_101984942 | 83 |
| 505 | 3300026067 | Ga0207678_10086130 | Ga0207678_100861303 | 83 |
| 506 | 3300026067 | Ga0207678_10566767 | Ga0207678_105667672 | 83 |
| 507 | 3300026075 | Ga0207708_10090469 | Ga0207708_100904693 | 83 |
| 508 | 3300026078 | Ga0207702_10463845 | Ga0207702_104638452 | 83 |
| 509 | 3300026078 | Ga0207702_11073427 | Ga0207702_110734272 | 83 |
| 510 | 3300026078 | Ga0207702_11991711 | Ga0207702_119917111 | 83 |
| 511 | 3300026095 | Ga0207676_10757013 | Ga0207676_107570132 | 83 |
| 512 | 3300026116 | Ga0207674_10003054 | Ga0207674_100030545 | 83 |
| 513 | 3300026116 | Ga0207674_11257613 | Ga0207674_112576132 | 83 |
| 514 | 3300026118 | Ga0207675_100585770 | Ga0207675_1005857702 | 83 |
| 515 | 3300026121 | Ga0207683_10460081 | Ga0207683_104600812 | 83 |
| 516 | 3300026142 | Ga0207698_11748024 | Ga0207698_117480242 | 83 |
| 517 | 3300027312 | Ga0209371_1000071 | Ga0209371_1000071141 | 83 |
| 518 | 3300027312 | Ga0209371_1000078 | Ga0209371_100007854 | 83 |
| 519 | 3300027312 | Ga0209371_1000154 | Ga0209371_100015476 | 83 |
| 520 | 3300027312 | Ga0209371_1000238 | Ga0209371_100023844 | 83 |
| 521 | 3300027312 | Ga0209371_1003313 | Ga0209371_10033133 | 83 |
| 522 | 3300027907 | Ga0207428_10128630 | Ga0207428_101286302 | 83 |
| 523 | 3300027907 | Ga0207428_10181259 | Ga0207428_101812592 | 83 |
| 524 | 3300028379 | Ga0268266_10026166 | Ga0268266_100261664 | 83 |
| 525 | 3300028379 | Ga0268266_10365819 | Ga0268266_103658192 | 83 |
| 526 | 3300028380 | Ga0268265_11806639 | Ga0268265_118066391 | 83 |
| 527 | 3300029957 | Ga0265324_10051358 | Ga0265324_100513583 | 83 |
| 528 | 3300030500 | Ga0268256_1000070 | Ga0268256_1000070138 | 83 |
| 529 | 3300030500 | Ga0268256_1000198 | Ga0268256_100019822 | 83 |
| 530 | 3300030500 | Ga0268256_1000237 | Ga0268256_100023730 | 83 |
| 531 | 3300030500 | Ga0268256_1000828 | Ga0268256_10008282 | 83 |
| 532 | 3300030500 | Ga0268256_1003012 | Ga0268256_10030128 | 83 |
| 533 | 3300030734 | Ga0316179_1100387 | Ga0316179_11003871 | 83 |
| 534 | 3300030742 | Ga0316183_1070363 | Ga0316183_10703633 | 83 |
| 535 | 3300030744 | Ga0316181_1247714 | Ga0316181_12477145 | 83 |
| 536 | 3300030745 | Ga0316182_1025437 | Ga0316182_10254372 | 83 |
| 537 | 3300031548 | Ga0307408_100184910 | Ga0307408_1001849102 | 83 |
| 538 | 3300031731 | Ga0307405_10124223 | Ga0307405_101242232 | 83 |
| 539 | 3300031911 | Ga0307412_11033320 | Ga0307412_110333202 | 83 |
| 540 | 3300031995 | Ga0307409_100879437 | Ga0307409_1008794372 | 83 |
| 541 | 3300032002 | Ga0307416_100033266 | Ga0307416_1000332664 | 83 |
| 542 | 3300034819 | Ga0373958_0023546 | Ga0373958_0023546_760_1017 | 83 |
| 543 | 3300035091 | Ga0373951_0222178 | Ga0373951_0222178_93_344 | 83 |
| 544 | 3300035242 | Ga0373962_0073388 | Ga0373962_0073388_29_280 | 83 |
| 545 | 3300035691 | Ga0373931_0403098 | Ga0373931_0403098_543_797 | 83 |
| 546 | 3300037418 | Ga0395900_0212298 | Ga0395900_0212298_862_1122 | 83 |
| 547 | 3300037418 | Ga0395900_0742795 | Ga0395900_0742795_584_838 | 83 |
| 548 | 3300037466 | Ga0395898_0181891 | Ga0395898_0181891_902_1162 | 83 |
| 549 | 3300037466 | Ga0395898_0467993 | Ga0395898_0467993_721_975 | 83 |
| 550 | 3300037466 | Ga0395898_0795423 | Ga0395898_0795423_27_278 | 83 |
| 551 | 3300037471 | Ga0395905_1660174 | Ga0395905_1660174_162_416 | 83 |
| 552 | 3300038443 | Ga0395901_0067100 | Ga0395901_0067100_725_985 | 83 |
| 553 | 3300038443 | Ga0395901_0327517 | Ga0395901_0327517_962_1216 | 83 |
| 554 | 3300038443 | Ga0395901_0696226 | Ga0395901_0696226_153_404 | 83 |
| 555 | 3300038443 | Ga0395901_1246900 | Ga0395901_1246900_394_648 | 83 |
| 556 | 3300041405 | Ga0439438_040678 | Ga0439438_040678_829_1083 | 83 |
| 557 | 3300041407 | Ga0439447_013860 | Ga0439447_013860_1440_1694 | 83 |
| 558 | 3300041411 | Ga0439466_0000015 | Ga0439466_0000015_64360_64614 | 83 |
| 559 | 3300041411 | Ga0439466_0125499 | Ga0439466_0125499_221_475 | 83 |
| 560 | 3300041441 | Ga0451787_541019 | Ga0451787_541019_130_384 | 83 |
| 561 | 3300041452 | Ga0451793_0693422 | Ga0451793_0693422_184_438 | 83 |
| 562 | 3300041453 | Ga0451797_0246926 | Ga0451797_0246926_517_771 | 83 |
| 563 | 3300041494 | Ga0451837_1561292 | Ga0451837_1561292_132_386 | 83 |
| 564 | 3300041503 | Ga0451847_0004397 | Ga0451847_0004397_39_293 | 83 |
| 565 | 3300041509 | Ga0451843_1341141 | Ga0451843_1341141_39_293 | 83 |
| 566 | 3300041997 | Ga0439431_0013547 | Ga0439431_0013547_751_1005 | 83 |
| 567 | 3300042000 | Ga0439437_000445 | Ga0439437_000445_2796_3050 | 83 |
| 568 | 3300042003 | Ga0439443_062992 | Ga0439443_062992_122_376 | 83 |
| 569 | 3300042006 | Ga0439432_003873 | Ga0439432_003873_4899_5153 | 83 |
| 570 | 3300042006 | Ga0439432_063541 | Ga0439432_063541_27_281 | 83 |
| 571 | 3300042006 | Ga0439432_101413 | Ga0439432_101413_302_556 | 83 |
| 572 | 3300042010 | Ga0439452_000050 | Ga0439452_000050_69161_69415 | 83 |
| 573 | 3300042010 | Ga0439452_078004 | Ga0439452_078004_395_649 | 83 |
| 574 | 3300042012 | Ga0439455_0132121 | Ga0439455_0132121_56_310 | 83 |
| 575 | 3300042013 | Ga0439456_023624 | Ga0439456_023624_146_400 | 83 |
| 576 | 3300042016 | Ga0439463_001954 | Ga0439463_001954_3927_4181 | 83 |
| 577 | 3300042016 | Ga0439463_038918 | Ga0439463_038918_182_436 | 83 |
| 578 | 3300042115 | Ga0450911_000003 | Ga0450911_000003_146053_146307 | 83 |
| 579 | 3300042121 | Ga0450919_018808 | Ga0450919_018808_82_336 | 83 |
| 580 | 3300042130 | Ga0450892_010248 | Ga0450892_010248_524_778 | 83 |
| 581 | 3300042137 | Ga0450902_081209 | Ga0450902_081209_233_487 | 83 |
| 582 | 3300042138 | Ga0450903_042055 | Ga0450903_042055_245_499 | 83 |
| 583 | 3300042139 | Ga0450904_000051 | Ga0450904_000051_24904_25158 | 83 |
| 584 | 3300042146 | Ga0450907_000033 | Ga0450907_000033_42560_42814 | 83 |
| 585 | 3300042146 | Ga0450907_015075 | Ga0450907_015075_335_589 | 83 |
| 586 | 3300042156 | Ga0439446_0024710 | Ga0439446_0024710_762_1016 | 83 |
| 587 | 3300042185 | Ga0450909_038568 | Ga0450909_038568_440_694 | 83 |
| 588 | 3300042435 | Ga0439434_0011383 | Ga0439434_0011383_1492_1746 | 83 |
| 589 | 3300042438 | Ga0439459_0006732 | Ga0439459_0006732_971_1225 | 83 |
| 590 | 3300042439 | Ga0439464_0001474 | Ga0439464_0001474_3236_3490 | 83 |
| 591 | 3300042439 | Ga0439464_0074493 | Ga0439464_0074493_530_784 | 83 |
| 592 | 3300042530 | Ga0450916_001523 | Ga0450916_001523_205_459 | 83 |
| 593 | 3300042531 | Ga0450918_011794 | Ga0450918_011794_757_1011 | 83 |
| 594 | 3300042533 | Ga0450901_020289 | Ga0450901_020289_385_639 | 83 |
| 595 | 3300044684 | Ga0466966_0072294 | Ga0466966_0072294_960_1214 | 83 |
| 596 | 3300044684 | Ga0466966_0074790 | Ga0466966_0074790_67_321 | 83 |
| 597 | 3300044706 | Ga0466964_0073005 | Ga0466964_0073005_108_380 | 83 |
| 598 | 3300044901 | Ga0466960_0032280 | Ga0466960_0032280_1914_2168 | 83 |
| 599 | 3300044901 | Ga0466960_0298179 | Ga0466960_0298179_469_726 | 83 |
| 600 | 3300045976 | Ga0466967_0053959 | Ga0466967_0053959_662_916 | 83 |
| 601 | 3300045976 | Ga0466967_0077380 | Ga0466967_0077380_2210_2467 | 83 |
| 602 | 3300046454 | Ga0495592_0290424 | Ga0495592_0290424_346_600 | 83 |
| 603 | 3300046462 | Ga0495651_0403042 | Ga0495651_0403042_95_349 | 83 |
| 604 | 3300046463 | Ga0495653_0339128 | Ga0495653_0339128_376_630 | 83 |
| 605 | 3300046471 | Ga0495650_0003645 | Ga0495650_0003645_820_1074 | 83 |
| 606 | 3300046474 | Ga0495605_0000620 | Ga0495605_0000620_12706_12960 | 83 |
| 607 | 3300046492 | Ga0495585_0007122 | Ga0495585_0007122_3462_3716 | 83 |
| 608 | 3300046501 | Ga0495607_0060488 | Ga0495607_0060488_1464_1718 | 83 |
| 609 | 3300046501 | Ga0495607_0239497 | Ga0495607_0239497_163_417 | 83 |
| 610 | 3300046506 | Ga0495583_0001861 | Ga0495583_0001861_15755_16009 | 83 |
| 611 | 3300046506 | Ga0495583_0008307 | Ga0495583_0008307_1722_1976 | 83 |
| 612 | 3300046511 | Ga0495608_0232988 | Ga0495608_0232988_202_456 | 83 |
| 613 | 3300046516 | Ga0495628_0280416 | Ga0495628_0280416_487_741 | 83 |
| 614 | 3300046516 | Ga0495628_0469087 | Ga0495628_0469087_273_527 | 83 |
| 615 | 3300046519 | Ga0495632_0004658 | Ga0495632_0004658_6915_7169 | 83 |
| 616 | 3300046522 | Ga0495643_0019080 | Ga0495643_0019080_2905_3159 | 83 |
| 617 | 3300046538 | Ga0495609_0000023 | Ga0495609_0000023_191117_191371 | 83 |
| 618 | 3300046538 | Ga0495609_0139924 | Ga0495609_0139924_545_799 | 83 |
| 619 | 3300046543 | Ga0495645_0055038 | Ga0495645_0055038_121_375 | 83 |
| 620 | 3300046665 | Ga0495661_0000072 | Ga0495661_0000072_105777_106031 | 83 |
| 621 | 3300046692 | Ga0495671_0252608 | Ga0495671_0252608_264_518 | 83 |
| 622 | 3300046810 | Ga0495660_0007318 | Ga0495660_0007318_3492_3746 | 83 |
| 623 | 3300047319 | Ga0495674_0589997 | Ga0495674_0589997_132_386 | 83 |
| 624 | 3300047320 | Ga0495672_0000128 | Ga0495672_0000128_49960_50214 | 83 |
| 625 | 3300047321 | Ga0495676_0248982 | Ga0495676_0248982_632_886 | 83 |
| 626 | 3300047322 | Ga0495680_0601790 | Ga0495680_0601790_210_464 | 83 |
| 627 | 3300047446 | Ga0495679_008321 | Ga0495679_008321_235_489 | 83 |
| 628 | 3300047469 | Ga0495673_0016101 | Ga0495673_0016101_2470_2724 | 83 |
| 629 | 3300047469 | Ga0495673_0246572 | Ga0495673_0246572_75_329 | 83 |
| 630 | 3300047470 | Ga0495681_0252984 | Ga0495681_0252984_252_506 | 83 |
| 631 | 3300047471 | Ga0495684_0251365 | Ga0495684_0251365_577_831 | 83 |
| 632 | 3300048903 | Ga0496100_0015942 | Ga0496100_0015942_3888_4142 | 83 |
| 633 | 3300048905 | Ga0496102_0057966 | Ga0496102_0057966_449_703 | 83 |
| 634 | 3300048905 | Ga0496102_0361606 | Ga0496102_0361606_842_1096 | 83 |
| 635 | 3300048905 | Ga0496102_0447118 | Ga0496102_0447118_234_485 | 83 |
| 636 | 3300048906 | Ga0496103_0049425 | Ga0496103_0049425_1675_1926 | 83 |
| 637 | 3300048906 | Ga0496103_0199167 | Ga0496103_0199167_329_583 | 83 |
| 638 | 3300048908 | Ga0496105_0730731 | Ga0496105_0730731_380_634 | 83 |
| 639 | 3300048911 | Ga0496108_0321424 | Ga0496108_0321424_1009_1263 | 83 |
| 640 | 3300048912 | Ga0496109_1404587 | Ga0496109_1404587_99_353 | 83 |
| 641 | 3300048913 | Ga0496110_1662894 | Ga0496110_1662894_89_343 | 83 |
| 642 | 3300048913 | Ga0496110_1754178 | Ga0496110_1754178_45_299 | 83 |
| 643 | 3300048915 | Ga0496112_0109287 | Ga0496112_0109287_444_713 | 83 |
| 644 | 3300048915 | Ga0496112_0124794 | Ga0496112_0124794_1140_1394 | 83 |
| 645 | 3300048915 | Ga0496112_0318901 | Ga0496112_0318901_277_531 | 83 |
| 646 | 3300048916 | Ga0496113_0366941 | Ga0496113_0366941_453_707 | 83 |
| 647 | 3300048917 | Ga0496114_1493279 | Ga0496114_1493279_100_354 | 83 |
| 648 | 3300048918 | Ga0496115_1274877 | Ga0496115_1274877_160_414 | 83 |
| 649 | 3300048919 | Ga0496116_0000209 | Ga0496116_0000209_59178_59432 | 83 |
| 650 | 3300048919 | Ga0496116_0003465 | Ga0496116_0003465_346_600 | 83 |
| 651 | 3300048919 | Ga0496116_0018485 | Ga0496116_0018485_843_1097 | 83 |
| 652 | 3300048920 | Ga0496117_0001785 | Ga0496117_0001785_1396_1650 | 83 |
| 653 | 3300048920 | Ga0496117_0002590 | Ga0496117_0002590_2396_2650 | 83 |
| 654 | 3300048921 | Ga0496118_0002610 | Ga0496118_0002610_17195_17449 | 83 |
| 655 | 3300048921 | Ga0496118_0010048 | Ga0496118_0010048_6058_6312 | 83 |
| 656 | 3300048922 | Ga0496119_0000259 | Ga0496119_0000259_54822_55076 | 83 |
| 657 | 3300048922 | Ga0496119_0000294 | Ga0496119_0000294_19940_20194 | 83 |
| 658 | 3300048922 | Ga0496119_0002336 | Ga0496119_0002336_11221_11475 | 83 |
| 659 | 3300048923 | Ga0496120_0000314 | Ga0496120_0000314_58795_59049 | 83 |
| 660 | 3300048923 | Ga0496120_0000482 | Ga0496120_0000482_54822_55076 | 83 |
| 661 | 3300048924 | Ga0496121_0000244 | Ga0496121_0000244_49960_50214 | 83 |
| 662 | 3300048925 | Ga0496122_0182722 | Ga0496122_0182722_412_666 | 83 |
| 663 | 3300048926 | Ga0496123_0099034 | Ga0496123_0099034_1147_1401 | 83 |
| 664 | 3300048926 | Ga0496123_0255390 | Ga0496123_0255390_61_315 | 83 |
| 665 | 3300048927 | Ga0496124_0000295 | Ga0496124_0000295_49993_50247 | 83 |
| 666 | 3300048927 | Ga0496124_0011703 | Ga0496124_0011703_2837_3091 | 83 |
| 667 | 3300048927 | Ga0496124_0013215 | Ga0496124_0013215_2944_3198 | 83 |
| 668 | 3300048928 | Ga0496125_0001070 | Ga0496125_0001070_3462_3716 | 83 |
| 669 | 3300048929 | Ga0496126_0026475 | Ga0496126_0026475_3935_4189 | 83 |
| 670 | 3300049568 | Ga0501031_0033752 | Ga0501031_0033752_1575_1829 | 83 |
| 671 | 3300049568 | Ga0501031_0040753 | Ga0501031_0040753_1880_2131 | 83 |
| 672 | 3300049569 | Ga0501032_0066804 | Ga0501032_0066804_1154_1408 | 83 |
| 673 | 3300049570 | Ga0501033_0152539 | Ga0501033_0152539_1131_1385 | 83 |
| 674 | 3300049571 | Ga0501034_0339714 | Ga0501034_0339714_570_824 | 83 |
| 675 | 3300049572 | Ga0501036_0026923 | Ga0501036_0026923_2294_2545 | 83 |
| 676 | 3300049572 | Ga0501036_0033071 | Ga0501036_0033071_2713_2967 | 83 |
| 677 | 3300049573 | Ga0501037_0045395 | Ga0501037_0045395_1289_1543 | 83 |
| 678 | 3300049573 | Ga0501037_0110276 | Ga0501037_0110276_1522_1773 | 83 |
| 679 | 3300049574 | Ga0501038_0059358 | Ga0501038_0059358_1152_1406 | 83 |
| 680 | 3300049575 | Ga0501039_0049253 | Ga0501039_0049253_1341_1595 | 83 |
| 681 | 3300049575 | Ga0501039_0311800 | Ga0501039_0311800_395_646 | 83 |
| 682 | 3300049576 | Ga0501040_0029879 | Ga0501040_0029879_863_1117 | 83 |
| 683 | 3300049576 | Ga0501040_0179540 | Ga0501040_0179540_658_909 | 83 |
| 684 | 3300049577 | Ga0501041_0118225 | Ga0501041_0118225_868_1122 | 83 |
| 685 | 3300049577 | Ga0501041_0294868 | Ga0501041_0294868_728_979 | 83 |
| 686 | 3300049578 | Ga0501042_0010968 | Ga0501042_0010968_4192_4446 | 83 |
| 687 | 3300049578 | Ga0501042_0063944 | Ga0501042_0063944_838_1089 | 83 |
| 688 | 3300049579 | Ga0501043_0164229 | Ga0501043_0164229_1428_1682 | 83 |
| 689 | 3300049580 | Ga0501046_0109882 | Ga0501046_0109882_1503_1757 | 83 |
| 690 | 3300049582 | Ga0501048_0006003 | Ga0501048_0006003_7210_7464 | 83 |
| 691 | 3300049582 | Ga0501048_0199152 | Ga0501048_0199152_204_455 | 83 |
| 692 | 3300049584 | Ga0501068_0223682 | Ga0501068_0223682_375_629 | 83 |
| 693 | 3300049587 | Ga0501071_0004938 | Ga0501071_0004938_1202_1456 | 83 |
| 694 | 3300049587 | Ga0501071_0063774 | Ga0501071_0063774_259_510 | 83 |
| 695 | 3300049588 | Ga0501072_0001670 | Ga0501072_0001670_4801_5055 | 83 |
| 696 | 3300049588 | Ga0501072_0007342 | Ga0501072_0007342_1848_2099 | 83 |
| 697 | 3300049589 | Ga0501073_0100750 | Ga0501073_0100750_514_768 | 83 |
| 698 | 3300049590 | Ga0501074_0023214 | Ga0501074_0023214_3247_3501 | 83 |
| 699 | 3300049590 | Ga0501074_0234290 | Ga0501074_0234290_737_988 | 83 |
| 700 | 3300049591 | Ga0501075_0135913 | Ga0501075_0135913_592_843 | 83 |
| 701 | 3300049591 | Ga0501075_0151799 | Ga0501075_0151799_428_682 | 83 |
| 702 | 3300049592 | Ga0501076_0045598 | Ga0501076_0045598_1240_1491 | 83 |
| 703 | 3300049592 | Ga0501076_0195628 | Ga0501076_0195628_1338_1592 | 83 |
| 704 | 3300049593 | Ga0501077_0320310 | Ga0501077_0320310_144_398 | 83 |
| 705 | 3300049741 | Ga0501079_0012586 | Ga0501079_0012586_5782_6036 | 83 |
| 706 | 3300049741 | Ga0501079_0183427 | Ga0501079_0183427_499_750 | 83 |
| 707 | 3300049742 | Ga0501080_0141479 | Ga0501080_0141479_1573_1827 | 83 |
| 708 | 3300049742 | Ga0501080_0942560 | Ga0501080_0942560_445_696 | 83 |
| 709 | 3300049743 | Ga0501081_0027220 | Ga0501081_0027220_1432_1683 | 83 |
| 710 | 3300049743 | Ga0501081_0034258 | Ga0501081_0034258_1167_1421 | 83 |
| 711 | 3300049744 | Ga0501083_0198971 | Ga0501083_0198971_466_717 | 83 |
| 712 | 3300049822 | Ga0501035_0104709 | Ga0501035_0104709_1275_1529 | 83 |
| 713 | 3300049824 | Ga0501045_0005511 | Ga0501045_0005511_7117_7371 | 83 |
| 714 | 3300049824 | Ga0501045_0073662 | Ga0501045_0073662_974_1225 | 83 |
| 715 | 3300049853 | Ga0501226_000065 | Ga0501226_000065_33255_33509 | 83 |
| 716 | 3300050491 | nmdc:mga00v17_211280_c2 | nmdc:mga00v17_211280_c2_174_428 | 83 |
| 717 | 3300050507 | nmdc:mga05p37_473816_c1 | nmdc:mga05p37_473816_c1_198_455 | 83 |
| 718 | 3300050511 | nmdc:mga08y16_1899369_c1 | nmdc:mga08y16_1899369_c1_98_352 | 83 |
| 719 | 3300050511 | nmdc:mga08y16_662711_c1 | nmdc:mga08y16_662711_c1_246_503 | 83 |
| 720 | 3300050516 | nmdc:mga0sz30_178924_c1 | nmdc:mga0sz30_178924_c1_337_591 | 83 |
| 721 | 3300053077 | Ga0495601_0740473 | Ga0495601_0740473_159_413 | 83 |
| 722 | 3300053084 | Ga0495595_0279910 | Ga0495595_0279910_445_699 | 83 |
| 723 | 3300053130 | Ga0500642_0092368 | Ga0500642_0092368_57_317 | 83 |
| 724 | 3300053142 | Ga0500577_0203057 | Ga0500577_0203057_11_265 | 83 |
| 725 | 3300054114 | Ga0501084_0119462 | Ga0501084_0119462_1122_1376 | 83 |
| 726 | 3300054114 | Ga0501084_0695319 | Ga0501084_0695319_509_760 | 83 |
| 727 | 3300060353 | Ga0501082_0007164 | Ga0501082_0007164_7028_7282 | 83 |
| 728 | 3300060353 | Ga0501082_0133015 | Ga0501082_0133015_470_721 | 83 |
| 729 | 3300061734 | Ga0530510_0067453 | Ga0530510_0067453_1503_1757 | 83 |
| 730 | 3300061734 | Ga0530510_0491577 | Ga0530510_0491577_370_621 | 83 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2ht9-assembly1.cif.gz_B | the structure of dimeric human glutaredoxin 2 | 0.943 | 2 | 82 |
| 4tr1-assembly2.cif.gz_B | crystal structure of gsh-bound cgrx2/c15s | 0.9376 | 1 | 81 |
| 2e7p-assembly1.cif.gz_B | crystal structure of the holo form of glutaredoxin c1 from populus tremula x tremuloides | 0.9346 | 4 | 82 |
| 4tr0-assembly2.cif.gz_B | crystal structure of gssg-bound cgrx2 | 0.9344 | 1 | 82 |
| 2fls-assembly1.cif.gz_A | crystal structure of human glutaredoxin 2 complexed with glutathione | 0.9331 | 2 | 82 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O36032_1_101_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9408 | 4 | 81 | 3.40.30.10 |
| af_B6SN61_11_124_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9392 | 4 | 82 | 3.40.30.10 |
| af_Q923X4_47_156_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9337 | 4 | 82 | 3.40.30.10 |
| 4tr0B00 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9329 | 1 | 82 | 3.40.30.10 |
| af_Q9UTI2_1_108_3.40.30.10 | Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin | 0.9273 | 4 | 82 | 3.40.30.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538K841-F1-model_v4 | Glutaredoxin | 0.9961 | 1 | 83 |
GO:0005737
GO:0015038 GO:0034599 |
| AF-A0A7M2YVS6-F1-model_v4 | Glutaredoxin | 0.9788 | 2 | 82 |
GO:0015035
|
| AF-A0A672K3G4-F1-model_v4 | Glutaredoxin-2, mitochondrial | 0.9657 | 4 | 82 |
GO:0005739
GO:0015035 GO:0051537 |
| AF-A0A177B921-F1-model_v4 | Glutaredoxin-2, mitochondrial | 0.9648 | 2 | 82 |
GO:0005739
GO:0015035 GO:0016020 |
| AF-A0A101VDH8-F1-model_v4 | Glutaredoxin domain-containing protein | 0.964 | 1 | 82 |
GO:0005737
GO:0015038 GO:0034599 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar