F477915
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 730 | 414 | 636 | 212 |
Family's Representative Sequence
| Representative Sequence | 3300009551|Ga0105238_10527044|Ga0105238_105270441 |
| Length | 258 |
| Sequence | MALFYDQAQRIYSLTPATGSPDASGFVGAPVNADSADRRHGGRSSTMADILSGIKIPDSKIAREAAELVRQHETEMLYNHSVRVFVFGAMKGNRQNLKFDSELLYVAALFHDLGLVEAYHTDKKRFEVDGADAAREFLRSRGIPAPKADLVWEAIALHTTPGIPQYMRPEIALTNAGVLVDVVGIGYDEYTPEQRDHVIAAFPRGDFKNEMLQLQTCSALKKPQTTFGTVNFDYIQEHDPTFHRPNACTRIRNAPWHT |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 2 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 3 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 4 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 5 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 6 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 7 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 8 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 9 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 10 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 11 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 12 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 13 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 14 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 15 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 16 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 17 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 18 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 19 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 20 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 21 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 22 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 23 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 24 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 25 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 26 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 27 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 28 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 29 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 30 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 31 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 32 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 33 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 34 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 35 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 36 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 37 | 2904699407 | |||
| 38 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 39 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 40 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 41 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 42 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 43 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 44 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 45 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 46 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 47 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 48 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 49 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 50 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 51 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 52 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 53 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 54 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 55 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 56 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 57 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 58 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 59 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 60 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 61 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 62 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 63 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 64 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 65 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 66 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 67 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 68 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 69 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 70 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 71 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 72 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 73 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 74 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 75 | 3300002155 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 | Metagenome | Rhizosphere |
| 76 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 77 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 78 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 79 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 80 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 81 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 82 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 84 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 85 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 86 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 87 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 89 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 90 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 91 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 93 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 94 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 95 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 96 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 97 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 98 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 99 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 100 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 101 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 102 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 103 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 104 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 105 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 106 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 107 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 108 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 109 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 110 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 111 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 112 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 113 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 114 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 115 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 116 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 117 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 118 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 119 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 120 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 121 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 122 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 123 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 124 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 125 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 126 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 127 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 128 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 129 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 130 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 131 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 132 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 133 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 134 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 135 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 136 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 137 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 138 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 139 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 140 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 141 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 142 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 143 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 144 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 145 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 146 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 147 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 148 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 149 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 150 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 151 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 152 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 153 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 155 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 156 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 157 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 158 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 159 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 160 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300006941 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW | Metagenome | Nodule |
| 162 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 163 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 164 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 165 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 166 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 167 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 169 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 170 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 171 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 172 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 173 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 174 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 175 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 176 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 177 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 178 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 179 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 180 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 181 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 182 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 183 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 184 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 185 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 186 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 187 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 188 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 189 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 190 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 191 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 192 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 193 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 194 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 195 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 196 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 197 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 198 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 199 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 200 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 201 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 222 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 223 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 224 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 225 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 226 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 227 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 228 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 229 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 230 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 231 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 232 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 233 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 234 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 235 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 236 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 237 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 238 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 239 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 240 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 241 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 242 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 243 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 244 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 245 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 246 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 247 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 248 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 249 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 250 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 251 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 252 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 253 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 254 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 255 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 256 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 257 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 258 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 259 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 260 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 261 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 262 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 263 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 264 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 265 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 266 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 267 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 268 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 269 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 270 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 271 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 272 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 273 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 274 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 275 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 276 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 277 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 280 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 282 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 283 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 284 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 285 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 286 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 287 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 320 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 322 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 323 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 324 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 325 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 326 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 335 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 336 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 337 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 338 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 339 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 340 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 341 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 342 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 343 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 344 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 345 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 365 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 367 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 368 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 369 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 370 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 371 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 372 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 373 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 377 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 379 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 382 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 383 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 384 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 385 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 386 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 387 | 3300053120 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere | Metagenome | Endosphere |
| 388 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 389 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 390 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 391 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 392 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 393 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 394 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 395 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 396 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 397 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 398 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 399 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 400 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 401 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 402 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 403 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 404 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 405 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 406 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 407 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 408 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 409 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 410 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 411 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 412 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 413 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 414 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.24 |
| Metatranscriptomes | 0 |
| Isolates | 12.76 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 8.77 |
| Nodule | 11.64 |
| Rhizoplane | 7.26 |
| Rhizosphere | 64.11 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.22 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24737J22298_10107068 | 3300001990 | Bacteria | 828 |
| 2 | JGI24750J21931_1004884 | 3300002070 | Bacteria | 1637 |
| 3 | JGI24738J21930_10020092 | 3300002075 | Bacteria | 1389 |
| 4 | JGI24033J26618_1006218 | 3300002155 | Bacteria | 1335 |
| 5 | JGI24742J22300_10015119 | 3300002244 | Bacteria | 1298 |
| 6 | JGI24751J29686_10040913 | 3300002459 | Bacteria | 959 |
| 7 | rootH2_10074383 | 3300003320 | Bacteria | 1822 |
| 8 | rootH2_10130837 | 3300003320 | Bacteria | 1220 |
| 9 | rootL2_10062248 | 3300003322 | Bacteria | 3582 |
| 10 | rootH1_10064064 | 3300003323 | Bacteria | 2186 |
| 11 | JGI25160J50197_1000939 | 3300003354 | Bacteria | 15302 |
| 12 | JGI25160J50197_1007045 | 3300003354 | Bacteria | 4450 |
| 13 | JGI25404J52841_10001673 | 3300003659 | Bacteria | 3987 |
| 14 | JGI25404J52841_10031415 | 3300003659 | Bacteria | 1134 |
| 15 | JGI25404J52841_10032676 | 3300003659 | Bacteria | 1109 |
| 16 | Ga0070683_100116211 | 3300005329 | Bacteria | 2526 |
| 17 | Ga0070690_100043163 | 3300005330 | Bacteria | 2858 |
| 18 | Ga0070670_100208275 | 3300005331 | Bacteria | 1700 |
| 19 | Ga0068869_100244492 | 3300005334 | Bacteria | 1431 |
| 20 | Ga0070666_10400576 | 3300005335 | Bacteria | 987 |
| 21 | Ga0070680_100041868 | 3300005336 | Bacteria | 3714 |
| 22 | Ga0070680_100060330 | 3300005336 | Bacteria | 3104 |
| 23 | Ga0070680_100219358 | 3300005336 | Bacteria | 1605 |
| 24 | Ga0070682_100009270 | 3300005337 | Bacteria | 5569 |
| 25 | Ga0070682_100214163 | 3300005337 | Bacteria | 1367 |
| 26 | Ga0068868_100281102 | 3300005338 | Bacteria | 1409 |
| 27 | Ga0068868_100734712 | 3300005338 | Bacteria | 886 |
| 28 | Ga0070660_100242569 | 3300005339 | Bacteria | 1468 |
| 29 | Ga0070660_100301395 | 3300005339 | Bacteria | 1314 |
| 30 | Ga0070660_100314071 | 3300005339 | Bacteria | 1286 |
| 31 | Ga0070689_100408622 | 3300005340 | Bacteria | 1149 |
| 32 | Ga0070691_10034083 | 3300005341 | Bacteria | 2396 |
| 33 | Ga0070687_100018996 | 3300005343 | Bacteria | 3190 |
| 34 | Ga0070687_100421073 | 3300005343 | Bacteria | 881 |
| 35 | Ga0070661_100165102 | 3300005344 | Bacteria | 1679 |
| 36 | Ga0070661_100166898 | 3300005344 | Bacteria | 1670 |
| 37 | Ga0070661_100604888 | 3300005344 | Bacteria | 887 |
| 38 | Ga0070692_10129604 | 3300005345 | Bacteria | 1416 |
| 39 | Ga0070668_100048385 | 3300005347 | Bacteria | 3269 |
| 40 | Ga0070668_100292214 | 3300005347 | Bacteria | 1364 |
| 41 | Ga0070668_100298501 | 3300005347 | Bacteria | 1350 |
| 42 | Ga0070669_100270337 | 3300005353 | Bacteria | 1359 |
| 43 | Ga0070675_100407150 | 3300005354 | Bacteria | 1214 |
| 44 | Ga0070674_100040883 | 3300005356 | Bacteria | 3138 |
| 45 | Ga0070674_100053157 | 3300005356 | Bacteria | 2795 |
| 46 | Ga0070674_100107375 | 3300005356 | Bacteria | 2044 |
| 47 | Ga0070673_100640014 | 3300005364 | Bacteria | 972 |
| 48 | Ga0070673_100998978 | 3300005364 | Bacteria | 779 |
| 49 | Ga0070659_100112303 | 3300005366 | Bacteria | 2200 |
| 50 | Ga0070667_100100750 | 3300005367 | Bacteria | 2495 |
| 51 | Ga0070709_10143753 | 3300005434 | Bacteria | 1641 |
| 52 | Ga0070714_100537569 | 3300005435 | Bacteria | 1118 |
| 53 | Ga0070713_100219925 | 3300005436 | Bacteria | 1722 |
| 54 | Ga0070713_100330137 | 3300005436 | Bacteria | 1411 |
| 55 | Ga0070701_10069955 | 3300005438 | Bacteria | 1874 |
| 56 | Ga0070711_100331408 | 3300005439 | Bacteria | 1218 |
| 57 | Ga0070700_100434039 | 3300005441 | Bacteria | 995 |
| 58 | Ga0070694_100045595 | 3300005444 | Bacteria | 2939 |
| 59 | Ga0070663_100005431 | 3300005455 | Bacteria | 7568 |
| 60 | Ga0070663_100020805 | 3300005455 | Bacteria | 4349 |
| 61 | Ga0070663_100084590 | 3300005455 | Bacteria | 2339 |
| 62 | Ga0070663_100097128 | 3300005455 | Bacteria | 2193 |
| 63 | Ga0070663_100536002 | 3300005455 | Bacteria | 977 |
| 64 | Ga0070678_100017758 | 3300005456 | Bacteria | 4589 |
| 65 | Ga0070678_100071528 | 3300005456 | Bacteria | 2597 |
| 66 | Ga0070678_100345671 | 3300005456 | Bacteria | 1277 |
| 67 | Ga0070678_100908899 | 3300005456 | Unclassified | 805 |
| 68 | Ga0070662_100095037 | 3300005457 | Bacteria | 2245 |
| 69 | Ga0070681_10017681 | 3300005458 | Bacteria | 7126 |
| 70 | Ga0070681_10069696 | 3300005458 | Bacteria | 3483 |
| 71 | Ga0070681_10282827 | 3300005458 | Bacteria | 1569 |
| 72 | Ga0068867_100030517 | 3300005459 | Bacteria | 3888 |
| 73 | Ga0068867_100826684 | 3300005459 | Bacteria | 828 |
| 74 | Ga0070685_10063225 | 3300005466 | Bacteria | 2173 |
| 75 | Ga0070679_100016988 | 3300005530 | Bacteria | 7035 |
| 76 | Ga0070679_100044869 | 3300005530 | Bacteria | 4404 |
| 77 | Ga0070679_100069731 | 3300005530 | Bacteria | 3507 |
| 78 | Ga0070684_100233687 | 3300005535 | Bacteria | 1679 |
| 79 | Ga0070684_100249910 | 3300005535 | Bacteria | 1621 |
| 80 | Ga0070684_100334780 | 3300005535 | Bacteria | 1391 |
| 81 | Ga0070684_100760460 | 3300005535 | Bacteria | 905 |
| 82 | Ga0070684_100844673 | 3300005535 | Bacteria | 857 |
| 83 | Ga0068853_100018490 | 3300005539 | Bacteria | 5769 |
| 84 | Ga0068853_100464347 | 3300005539 | Bacteria | 1192 |
| 85 | Ga0070672_100186361 | 3300005543 | Bacteria | 1731 |
| 86 | Ga0070686_100526683 | 3300005544 | Bacteria | 921 |
| 87 | Ga0070696_100787895 | 3300005546 | Unclassified | 782 |
| 88 | Ga0070693_100015017 | 3300005547 | Bacteria | 3982 |
| 89 | Ga0070693_100076947 | 3300005547 | Bacteria | 1979 |
| 90 | Ga0070693_100146537 | 3300005547 | Bacteria | 1491 |
| 91 | Ga0070665_100048897 | 3300005548 | Bacteria | 4245 |
| 92 | Ga0070665_100055188 | 3300005548 | Bacteria | 3984 |
| 93 | Ga0070665_100070629 | 3300005548 | Bacteria | 3499 |
| 94 | Ga0070665_100160167 | 3300005548 | Bacteria | 2252 |
| 95 | Ga0070665_100321188 | 3300005548 | Bacteria | 1552 |
| 96 | Ga0070665_100665320 | 3300005548 | Bacteria | 1054 |
| 97 | Ga0070704_100159546 | 3300005549 | Bacteria | 1782 |
| 98 | Ga0068855_100005078 | 3300005563 | Bacteria | 16046 |
| 99 | Ga0068855_100296290 | 3300005563 | Bacteria | 1792 |
| 100 | Ga0068857_100023890 | 3300005577 | Bacteria | 5380 |
| 101 | Ga0068857_100132484 | 3300005577 | Bacteria | 2249 |
| 102 | Ga0068857_100625539 | 3300005577 | Bacteria | 1019 |
| 103 | Ga0068854_100243639 | 3300005578 | Bacteria | 1433 |
| 104 | Ga0068856_100512913 | 3300005614 | Bacteria | 1220 |
| 105 | Ga0068856_100789106 | 3300005614 | Bacteria | 970 |
| 106 | Ga0068856_101322473 | 3300005614 | Bacteria | 736 |
| 107 | Ga0070702_100004976 | 3300005615 | Bacteria | 6136 |
| 108 | Ga0070702_100023926 | 3300005615 | Bacteria | 3252 |
| 109 | Ga0068852_100066913 | 3300005616 | Bacteria | 3140 |
| 110 | Ga0068852_100089288 | 3300005616 | Bacteria | 2754 |
| 111 | Ga0068859_100845111 | 3300005617 | Bacteria | 1002 |
| 112 | Ga0068864_100005000 | 3300005618 | Bacteria | 10864 |
| 113 | Ga0068864_100723550 | 3300005618 | Bacteria | 974 |
| 114 | Ga0068866_10027650 | 3300005718 | Bacteria | 2694 |
| 115 | Ga0068866_10027887 | 3300005718 | Bacteria | 2685 |
| 116 | Ga0068866_10123683 | 3300005718 | Bacteria | 1461 |
| 117 | Ga0068861_100018438 | 3300005719 | Bacteria | 4972 |
| 118 | Ga0068861_100055317 | 3300005719 | Bacteria | 3025 |
| 119 | Ga0068861_100323532 | 3300005719 | Bacteria | 1344 |
| 120 | Ga0068851_10533028 | 3300005834 | Bacteria | 708 |
| 121 | Ga0068870_10006058 | 3300005840 | Bacteria | 5313 |
| 122 | Ga0068863_100476236 | 3300005841 | Bacteria | 1227 |
| 123 | Ga0068863_100843740 | 3300005841 | Bacteria | 915 |
| 124 | Ga0068858_100330261 | 3300005842 | Bacteria | 1458 |
| 125 | Ga0068858_100361851 | 3300005842 | Bacteria | 1390 |
| 126 | Ga0068860_100039612 | 3300005843 | Bacteria | 4507 |
| 127 | Ga0068860_100200490 | 3300005843 | Bacteria | 1933 |
| 128 | Ga0068860_100458229 | 3300005843 | Bacteria | 1268 |
| 129 | Ga0068862_100063580 | 3300005844 | Bacteria | 3175 |
| 130 | Ga0068862_100466603 | 3300005844 | Bacteria | 1193 |
| 131 | Ga0068862_100758361 | 3300005844 | Bacteria | 945 |
| 132 | Ga0081455_10014623 | 3300005937 | Bacteria | 7679 |
| 133 | Ga0081540_1000809 | 3300005983 | Bacteria | 28697 |
| 134 | Ga0081540_1000996 | 3300005983 | Bacteria | 25476 |
| 135 | Ga0081540_1013314 | 3300005983 | Bacteria | 5354 |
| 136 | Ga0081540_1013715 | 3300005983 | Bacteria | 5253 |
| 137 | Ga0081540_1015135 | 3300005983 | Bacteria | 4896 |
| 138 | Ga0081540_1054853 | 3300005983 | Bacteria | 1945 |
| 139 | Ga0070717_10527311 | 3300006028 | Bacteria | 1069 |
| 140 | Ga0075365_10236226 | 3300006038 | Bacteria | 1284 |
| 141 | Ga0075368_10029727 | 3300006042 | Bacteria | 2113 |
| 142 | Ga0075363_100037306 | 3300006048 | Bacteria | 2552 |
| 143 | Ga0075363_100157225 | 3300006048 | Bacteria | 1286 |
| 144 | Ga0075363_100291976 | 3300006048 | Bacteria | 945 |
| 145 | Ga0075364_10143805 | 3300006051 | Bacteria | 1605 |
| 146 | Ga0070716_100039861 | 3300006173 | Bacteria | 2609 |
| 147 | Ga0070716_100095573 | 3300006173 | Bacteria | 1809 |
| 148 | Ga0070712_100029064 | 3300006175 | Bacteria | 3703 |
| 149 | Ga0070712_100137553 | 3300006175 | Bacteria | 1859 |
| 150 | Ga0075367_10053123 | 3300006178 | Bacteria | 2400 |
| 151 | Ga0075367_10211924 | 3300006178 | Bacteria | 1211 |
| 152 | Ga0075369_10174963 | 3300006186 | Bacteria | 987 |
| 153 | Ga0097621_100092686 | 3300006237 | Bacteria | 2531 |
| 154 | Ga0097621_100560237 | 3300006237 | Bacteria | 1041 |
| 155 | Ga0075370_10045857 | 3300006353 | Bacteria | 2473 |
| 156 | Ga0075370_10049859 | 3300006353 | Bacteria | 2374 |
| 157 | Ga0075370_10196213 | 3300006353 | Bacteria | 1190 |
| 158 | Ga0068871_100025883 | 3300006358 | Bacteria | 4571 |
| 159 | Ga0068871_100221731 | 3300006358 | Bacteria | 1638 |
| 160 | Ga0068871_100498804 | 3300006358 | Bacteria | 1097 |
| 161 | Ga0068871_100851972 | 3300006358 | Bacteria | 842 |
| 162 | Ga0075433_11160673 | 3300006852 | Bacteria | 671 |
| 163 | Ga0075434_100034971 | 3300006871 | Bacteria | 4966 |
| 164 | Ga0075434_100726951 | 3300006871 | Bacteria | 1010 |
| 165 | Ga0075434_100862133 | 3300006871 | Bacteria | 921 |
| 166 | Ga0068865_100012377 | 3300006881 | Bacteria | 5368 |
| 167 | Ga0068865_100210503 | 3300006881 | Bacteria | 1515 |
| 168 | Ga0075436_100214521 | 3300006914 | Bacteria | 1365 |
| 169 | Ga0097620_100845062 | 3300006931 | Bacteria | 1002 |
| 170 | Ga0099825_1034652 | 3300006941 | Bacteria | 1862 |
| 171 | Ga0099824_1002487 | 3300006942 | Bacteria | 26950 |
| 172 | Ga0099824_1005150 | 3300006942 | Bacteria | 18530 |
| 173 | Ga0099822_1001480 | 3300006943 | Bacteria | 27484 |
| 174 | Ga0099823_1008083 | 3300006944 | Bacteria | 10710 |
| 175 | Ga0099794_10046610 | 3300007265 | Bacteria | 2077 |
| 176 | Ga0105240_10008605 | 3300009093 | Bacteria | 14585 |
| 177 | Ga0105240_10048479 | 3300009093 | Bacteria | 5368 |
| 178 | Ga0105240_10377799 | 3300009093 | Bacteria | 1601 |
| 179 | Ga0111539_10000616 | 3300009094 | Bacteria | 46125 |
| 180 | Ga0111539_10193578 | 3300009094 | Bacteria | 2372 |
| 181 | Ga0105245_10040936 | 3300009098 | Bacteria | 4129 |
| 182 | Ga0105245_10139293 | 3300009098 | Bacteria | 2283 |
| 183 | Ga0105245_10158379 | 3300009098 | Bacteria | 2147 |
| 184 | Ga0105247_10024077 | 3300009101 | Bacteria | 3666 |
| 185 | Ga0105247_10744171 | 3300009101 | Bacteria | 742 |
| 186 | Ga0105243_10018891 | 3300009148 | Bacteria | 5226 |
| 187 | Ga0105241_10009222 | 3300009174 | Bacteria | 7257 |
| 188 | Ga0105241_10329500 | 3300009174 | Bacteria | 1319 |
| 189 | Ga0105242_10032372 | 3300009176 | Bacteria | 4180 |
| 190 | Ga0105242_10378861 | 3300009176 | Bacteria | 1314 |
| 191 | Ga0105242_10458443 | 3300009176 | Bacteria | 1203 |
| 192 | Ga0105248_10123415 | 3300009177 | Bacteria | 2921 |
| 193 | Ga0105248_10356079 | 3300009177 | Bacteria | 1648 |
| 194 | Ga0105248_10362260 | 3300009177 | Bacteria | 1632 |
| 195 | Ga0105237_10038493 | 3300009545 | Bacteria | 4829 |
| 196 | Ga0105237_10058065 | 3300009545 | Bacteria | 3872 |
| 197 | Ga0105237_10110791 | 3300009545 | Bacteria | 2737 |
| 198 | Ga0105237_10189312 | 3300009545 | Bacteria | 2058 |
| 199 | Ga0105237_10812505 | 3300009545 | Bacteria | 942 |
| 200 | Ga0105238_10063814 | 3300009551 | Bacteria | 3684 |
| 201 | Ga0105238_10075141 | 3300009551 | Bacteria | 3371 |
| 202 | Ga0105238_10213193 | 3300009551 | Bacteria | 1907 |
| 203 | Ga0105238_10460208 | 3300009551 | Bacteria | 1270 |
| 204 | Ga0105238_10495711 | 3300009551 | Bacteria | 1222 |
| 205 | Ga0105238_10527044 | 3300009551 | Bacteria | 1184 |
| 206 | Ga0105249_10079419 | 3300009553 | Bacteria | 3045 |
| 207 | Ga0105249_10704280 | 3300009553 | Bacteria | 1070 |
| 208 | Ga0105239_10037978 | 3300010375 | Bacteria | 5277 |
| 209 | Ga0105239_10081722 | 3300010375 | Bacteria | 3557 |
| 210 | Ga0105239_10103271 | 3300010375 | Bacteria | 3155 |
| 211 | Ga0105239_10580628 | 3300010375 | Bacteria | 1278 |
| 212 | Ga0105239_10765632 | 3300010375 | Bacteria | 1105 |
| 213 | Ga0105246_10020940 | 3300011119 | Bacteria | 4200 |
| 214 | Ga0105246_10043743 | 3300011119 | Bacteria | 3040 |
| 215 | Ga0105246_10351677 | 3300011119 | Bacteria | 1208 |
| 216 | Ga0105246_10607995 | 3300011119 | Bacteria | 946 |
| 217 | Ga0157370_10018913 | 3300013104 | Bacteria | 6927 |
| 218 | Ga0157370_10113527 | 3300013104 | Bacteria | 2532 |
| 219 | Ga0157369_10002208 | 3300013105 | Bacteria | 23445 |
| 220 | Ga0157369_10005932 | 3300013105 | Bacteria | 14188 |
| 221 | Ga0157369_10129466 | 3300013105 | Bacteria | 2675 |
| 222 | Ga0157369_10890353 | 3300013105 | Bacteria | 913 |
| 223 | Ga0157374_10017728 | 3300013296 | Bacteria | 6275 |
| 224 | Ga0157374_10075411 | 3300013296 | Bacteria | 3187 |
| 225 | Ga0157374_10286184 | 3300013296 | Bacteria | 1628 |
| 226 | Ga0157374_10657183 | 3300013296 | Bacteria | 1060 |
| 227 | Ga0157378_10034557 | 3300013297 | Bacteria | 4470 |
| 228 | Ga0157378_10088682 | 3300013297 | Bacteria | 2807 |
| 229 | Ga0157378_10202460 | 3300013297 | Bacteria | 1878 |
| 230 | Ga0157378_10255666 | 3300013297 | Bacteria | 1679 |
| 231 | Ga0157378_10476591 | 3300013297 | Bacteria | 1243 |
| 232 | Ga0163162_10189605 | 3300013306 | Bacteria | 2183 |
| 233 | Ga0163162_10194870 | 3300013306 | Bacteria | 2154 |
| 234 | Ga0163162_10238263 | 3300013306 | Bacteria | 1950 |
| 235 | Ga0163162_10279544 | 3300013306 | Bacteria | 1801 |
| 236 | Ga0163162_11405756 | 3300013306 | Bacteria | 794 |
| 237 | Ga0157372_10025495 | 3300013307 | Bacteria | 6430 |
| 238 | Ga0157372_10141634 | 3300013307 | Bacteria | 2771 |
| 239 | Ga0157375_10024985 | 3300013308 | Bacteria | 5541 |
| 240 | Ga0157375_10364530 | 3300013308 | Bacteria | 1611 |
| 241 | Ga0157375_10577411 | 3300013308 | Bacteria | 1285 |
| 242 | Ga0157375_10688017 | 3300013308 | Bacteria | 1177 |
| 243 | Ga0157375_11130558 | 3300013308 | Bacteria | 917 |
| 244 | Ga0163163_10020992 | 3300014325 | Bacteria | 6159 |
| 245 | Ga0163163_10065770 | 3300014325 | Bacteria | 3600 |
| 246 | Ga0157380_10067985 | 3300014326 | Bacteria | 2870 |
| 247 | Ga0157380_10229846 | 3300014326 | Bacteria | 1665 |
| 248 | Ga0157380_10635009 | 3300014326 | Bacteria | 1062 |
| 249 | Ga0157380_10724726 | 3300014326 | Bacteria | 1002 |
| 250 | Ga0157377_10188014 | 3300014745 | Bacteria | 1303 |
| 251 | Ga0157379_10049822 | 3300014968 | Bacteria | 3739 |
| 252 | Ga0157379_10116176 | 3300014968 | Bacteria | 2406 |
| 253 | Ga0157376_10184631 | 3300014969 | Bacteria | 1908 |
| 254 | Ga0157376_10454401 | 3300014969 | Bacteria | 1250 |
| 255 | Ga0163161_10019274 | 3300017792 | Bacteria | 4784 |
| 256 | Ga0163161_10201308 | 3300017792 | Bacteria | 1535 |
| 257 | Ga0214542_1000002 | 3300021321 | Bacteria | 720798 |
| 258 | Ga0214545_1000002 | 3300021324 | Bacteria | 727485 |
| 259 | Ga0214543_1000013 | 3300021327 | Bacteria | 329117 |
| 260 | Ga0209677_103741 | 3300025253 | Bacteria | 4753 |
| 261 | Ga0209673_1040492 | 3300025273 | Bacteria | 1332 |
| 262 | Ga0209130_1000672 | 3300025284 | Bacteria | 31000 |
| 263 | Ga0209564_1002754 | 3300025295 | Bacteria | 13209 |
| 264 | Ga0209758_1001375 | 3300025297 | Bacteria | 29007 |
| 265 | Ga0207426_1000331 | 3300025302 | Bacteria | 89838 |
| 266 | Ga0207426_1000577 | 3300025302 | Bacteria | 49128 |
| 267 | Ga0207697_10026545 | 3300025315 | Bacteria | 2368 |
| 268 | Ga0207697_10091416 | 3300025315 | Bacteria | 1290 |
| 269 | Ga0207642_10329531 | 3300025899 | Bacteria | 894 |
| 270 | Ga0207710_10069744 | 3300025900 | Bacteria | 1610 |
| 271 | Ga0207710_10287364 | 3300025900 | Bacteria | 829 |
| 272 | Ga0207688_10006895 | 3300025901 | Bacteria | 6182 |
| 273 | Ga0207688_10118914 | 3300025901 | Bacteria | 1540 |
| 274 | Ga0207688_10185248 | 3300025901 | Bacteria | 1243 |
| 275 | Ga0207680_10165370 | 3300025903 | Bacteria | 1486 |
| 276 | Ga0207647_10015001 | 3300025904 | Bacteria | 5326 |
| 277 | Ga0207647_10016497 | 3300025904 | Bacteria | 5040 |
| 278 | Ga0207647_10080046 | 3300025904 | Bacteria | 1960 |
| 279 | Ga0207699_10090954 | 3300025906 | Bacteria | 1915 |
| 280 | Ga0207645_10069204 | 3300025907 | Bacteria | 2258 |
| 281 | Ga0207645_10124253 | 3300025907 | Bacteria | 1677 |
| 282 | Ga0207643_10003065 | 3300025908 | Bacteria | 8982 |
| 283 | Ga0207705_10168133 | 3300025909 | Bacteria | 1650 |
| 284 | Ga0207705_10176843 | 3300025909 | Bacteria | 1609 |
| 285 | Ga0207654_10070847 | 3300025911 | Bacteria | 2071 |
| 286 | Ga0207654_10153821 | 3300025911 | Bacteria | 1479 |
| 287 | Ga0207707_10008176 | 3300025912 | Bacteria | 9077 |
| 288 | Ga0207707_10056244 | 3300025912 | Plasmid | 3423 |
| 289 | Ga0207707_10060266 | 3300025912 | Bacteria | 3302 |
| 290 | Ga0207695_10052552 | 3300025913 | Bacteria | 4267 |
| 291 | Ga0207695_10104080 | 3300025913 | Bacteria | 2829 |
| 292 | Ga0207695_10686852 | 3300025913 | Bacteria | 904 |
| 293 | Ga0207671_10155741 | 3300025914 | Bacteria | 1767 |
| 294 | Ga0207671_10328540 | 3300025914 | Bacteria | 1211 |
| 295 | Ga0207671_10460978 | 3300025914 | Bacteria | 1013 |
| 296 | Ga0207693_10008904 | 3300025915 | Bacteria | 8199 |
| 297 | Ga0207663_10035518 | 3300025916 | Bacteria | 2991 |
| 298 | Ga0207660_10012093 | 3300025917 | Bacteria | 5642 |
| 299 | Ga0207660_10082578 | 3300025917 | Bacteria | 2364 |
| 300 | Ga0207660_10149059 | 3300025917 | Bacteria | 1796 |
| 301 | Ga0207660_10177074 | 3300025917 | Bacteria | 1654 |
| 302 | Ga0207662_10008159 | 3300025918 | Bacteria | 5725 |
| 303 | Ga0207662_10470559 | 3300025918 | Bacteria | 862 |
| 304 | Ga0207657_10123999 | 3300025919 | Bacteria | 2123 |
| 305 | Ga0207657_10191822 | 3300025919 | Bacteria | 1648 |
| 306 | Ga0207649_10114862 | 3300025920 | Bacteria | 1805 |
| 307 | Ga0207649_10209964 | 3300025920 | Bacteria | 1380 |
| 308 | Ga0207652_10039347 | 3300025921 | Bacteria | 4013 |
| 309 | Ga0207652_10094643 | 3300025921 | Bacteria | 2631 |
| 310 | Ga0207652_10139022 | 3300025921 | Bacteria | 2171 |
| 311 | Ga0207652_10212196 | 3300025921 | Bacteria | 1743 |
| 312 | Ga0207681_10542577 | 3300025923 | Bacteria | 956 |
| 313 | Ga0207681_10620381 | 3300025923 | Bacteria | 895 |
| 314 | Ga0207650_10084230 | 3300025925 | Bacteria | 2416 |
| 315 | Ga0207659_10170430 | 3300025926 | Bacteria | 1717 |
| 316 | Ga0207659_10297442 | 3300025926 | Bacteria | 1324 |
| 317 | Ga0207687_10054726 | 3300025927 | Bacteria | 2793 |
| 318 | Ga0207687_10284004 | 3300025927 | Bacteria | 1328 |
| 319 | Ga0207700_10105873 | 3300025928 | Bacteria | 2253 |
| 320 | Ga0207700_10428107 | 3300025928 | Bacteria | 1163 |
| 321 | Ga0207644_10425646 | 3300025931 | Bacteria | 1088 |
| 322 | Ga0207690_10157301 | 3300025932 | Bacteria | 1690 |
| 323 | Ga0207706_10055804 | 3300025933 | Bacteria | 3483 |
| 324 | Ga0207706_10699721 | 3300025933 | Bacteria | 866 |
| 325 | Ga0207686_10075143 | 3300025934 | Bacteria | 2186 |
| 326 | Ga0207709_10042810 | 3300025935 | Bacteria | 2726 |
| 327 | Ga0207709_10285314 | 3300025935 | Bacteria | 1221 |
| 328 | Ga0207709_10352669 | 3300025935 | Bacteria | 1111 |
| 329 | Ga0207709_10402308 | 3300025935 | Bacteria | 1047 |
| 330 | Ga0207669_10007578 | 3300025937 | Bacteria | 5033 |
| 331 | Ga0207669_10646277 | 3300025937 | Bacteria | 864 |
| 332 | Ga0207704_10175145 | 3300025938 | Bacteria | 1544 |
| 333 | Ga0207704_10480685 | 3300025938 | Bacteria | 997 |
| 334 | Ga0207665_10082174 | 3300025939 | Bacteria | 2219 |
| 335 | Ga0207665_10277525 | 3300025939 | Bacteria | 1246 |
| 336 | Ga0207711_10053201 | 3300025941 | Bacteria | 3472 |
| 337 | Ga0207711_10630343 | 3300025941 | Bacteria | 1000 |
| 338 | Ga0207689_10022669 | 3300025942 | Bacteria | 5276 |
| 339 | Ga0207689_10234012 | 3300025942 | Bacteria | 1518 |
| 340 | Ga0207667_10131378 | 3300025949 | Bacteria | 2579 |
| 341 | Ga0207651_10759464 | 3300025960 | Bacteria | 857 |
| 342 | Ga0207668_10164783 | 3300025972 | Bacteria | 1731 |
| 343 | Ga0207668_10941376 | 3300025972 | Bacteria | 770 |
| 344 | Ga0207640_10394061 | 3300025981 | Bacteria | 1126 |
| 345 | Ga0207658_10268560 | 3300025986 | Bacteria | 1457 |
| 346 | Ga0207658_10512593 | 3300025986 | Bacteria | 1070 |
| 347 | Ga0207703_10235556 | 3300026035 | Bacteria | 1643 |
| 348 | Ga0207703_10282485 | 3300026035 | Bacteria | 1508 |
| 349 | Ga0207639_10027145 | 3300026041 | Plasmid | 4167 |
| 350 | Ga0207639_10093251 | 3300026041 | Bacteria | 2414 |
| 351 | Ga0207639_10626122 | 3300026041 | Bacteria | 994 |
| 352 | Ga0207678_10002892 | 3300026067 | Bacteria | 15594 |
| 353 | Ga0207678_10029216 | 3300026067 | Bacteria | 4811 |
| 354 | Ga0207678_10030754 | 3300026067 | Bacteria | 4687 |
| 355 | Ga0207678_10037726 | 3300026067 | Bacteria | 4202 |
| 356 | Ga0207678_10057840 | 3300026067 | Bacteria | 3336 |
| 357 | Ga0207678_10067852 | 3300026067 | Bacteria | 3060 |
| 358 | Ga0207678_10074338 | 3300026067 | Bacteria | 2912 |
| 359 | Ga0207708_10066753 | 3300026075 | Bacteria | 2750 |
| 360 | Ga0207708_10204076 | 3300026075 | Bacteria | 1578 |
| 361 | Ga0207702_10271226 | 3300026078 | Bacteria | 1600 |
| 362 | Ga0207641_10374025 | 3300026088 | Bacteria | 1363 |
| 363 | Ga0207648_10014945 | 3300026089 | Bacteria | 7153 |
| 364 | Ga0207648_10030692 | 3300026089 | Bacteria | 4757 |
| 365 | Ga0207648_10057117 | 3300026089 | Bacteria | 3405 |
| 366 | Ga0207676_10030936 | 3300026095 | Bacteria | 4022 |
| 367 | Ga0207676_10048747 | 3300026095 | Bacteria | 3290 |
| 368 | Ga0207674_10026473 | 3300026116 | Bacteria | 6157 |
| 369 | Ga0207674_10154323 | 3300026116 | Bacteria | 2251 |
| 370 | Ga0207675_100034100 | 3300026118 | Bacteria | 4744 |
| 371 | Ga0207675_100069433 | 3300026118 | Bacteria | 3293 |
| 372 | Ga0207675_100392341 | 3300026118 | Bacteria | 1367 |
| 373 | Ga0207675_100709962 | 3300026118 | Bacteria | 1015 |
| 374 | Ga0207675_100730175 | 3300026118 | Bacteria | 1001 |
| 375 | Ga0207683_10021227 | 3300026121 | Bacteria | 5557 |
| 376 | Ga0207683_10085803 | 3300026121 | Bacteria | 2799 |
| 377 | Ga0207683_10201945 | 3300026121 | Bacteria | 1807 |
| 378 | Ga0207683_10539874 | 3300026121 | Bacteria | 1078 |
| 379 | Ga0207683_10929522 | 3300026121 | Unclassified | 808 |
| 380 | Ga0207698_10045641 | 3300026142 | Plasmid | 3303 |
| 381 | Ga0207698_10638719 | 3300026142 | Bacteria | 1053 |
| 382 | Ga0207698_10831687 | 3300026142 | Bacteria | 927 |
| 383 | Ga0209389_1000026 | 3300027296 | Bacteria | 147580 |
| 384 | Ga0209389_1000117 | 3300027296 | Bacteria | 71506 |
| 385 | Ga0209589_1000001 | 3300027357 | Bacteria | 794224 |
| 386 | Ga0209589_1000022 | 3300027357 | Bacteria | 180757 |
| 387 | Ga0209489_100001 | 3300027361 | Bacteria | 794224 |
| 388 | Ga0209489_100058 | 3300027361 | Bacteria | 147117 |
| 389 | Ga0209489_102405 | 3300027361 | Bacteria | 38216 |
| 390 | Ga0209700_100001 | 3300027363 | Bacteria | 794224 |
| 391 | Ga0209700_100021 | 3300027363 | Bacteria | 230859 |
| 392 | Ga0209588_1015760 | 3300027671 | Bacteria | 2326 |
| 393 | Ga0209813_10015975 | 3300027866 | Bacteria | 2041 |
| 394 | Ga0207428_10000129 | 3300027907 | Bacteria | 104467 |
| 395 | Ga0268266_10008307 | 3300028379 | Bacteria | 9243 |
| 396 | Ga0268266_10083006 | 3300028379 | Bacteria | 2796 |
| 397 | Ga0268266_10311719 | 3300028379 | Bacteria | 1470 |
| 398 | Ga0268266_10476649 | 3300028379 | Bacteria | 1189 |
| 399 | Ga0268265_10200184 | 3300028380 | Bacteria | 1732 |
| 400 | Ga0268265_10204654 | 3300028380 | Bacteria | 1715 |
| 401 | Ga0307517_10062698 | 3300028786 | Bacteria | 3491 |
| 402 | Ga0307515_10111249 | 3300028794 | Bacteria | 3198 |
| 403 | Ga0307513_10276049 | 3300031456 | Bacteria | 1461 |
| 404 | Ga0307509_10032602 | 3300031507 | Bacteria | 5740 |
| 405 | Ga0307412_10152103 | 3300031911 | Bacteria | 1709 |
| 406 | Ga0307415_100092914 | 3300032126 | Bacteria | 2189 |
| 407 | Ga0307510_10065385 | 3300033180 | Bacteria | 3684 |
| 408 | Ga0315911_1000010 | 3300033442 | Bacteria | 322197 |
| 409 | Ga0373961_0216258 | 3300035241 | Bacteria | 682 |
| 410 | Ga0373927_0010000 | 3300035695 | Bacteria | 6357 |
| 411 | Ga0373937_1059467 | 3300036401 | Bacteria | 760 |
| 412 | Ga0373925_0032546 | 3300037068 | Bacteria | 3839 |
| 413 | Ga0395900_0045800 | 3300037418 | Bacteria | 4505 |
| 414 | Ga0395900_0053188 | 3300037418 | Bacteria | 4168 |
| 415 | Ga0395900_0303707 | 3300037418 | Bacteria | 1581 |
| 416 | Ga0395898_0040300 | 3300037466 | Bacteria | 4619 |
| 417 | Ga0395898_0073130 | 3300037466 | Bacteria | 3311 |
| 418 | Ga0395898_0190561 | 3300037466 | Bacteria | 1959 |
| 419 | Ga0395898_0254629 | 3300037466 | Bacteria | 1674 |
| 420 | Ga0395898_0256396 | 3300037466 | Bacteria | 1668 |
| 421 | Ga0395898_0260944 | 3300037466 | Bacteria | 1653 |
| 422 | Ga0395905_0071674 | 3300037471 | Bacteria | 3248 |
| 423 | Ga0395905_0129014 | 3300037471 | Bacteria | 2378 |
| 424 | Ga0395905_0163751 | 3300037471 | Bacteria | 2090 |
| 425 | Ga0395905_0216782 | 3300037471 | Bacteria | 1792 |
| 426 | Ga0395901_0032406 | 3300038443 | Bacteria | 5392 |
| 427 | Ga0395901_0060239 | 3300038443 | Bacteria | 3950 |
| 428 | Ga0395901_0258230 | 3300038443 | Bacteria | 1814 |
| 429 | Ga0242420_037387 | 3300038996 | Bacteria | 919 |
| 430 | Ga0451807_0261817 | 3300041486 | Bacteria | 962 |
| 431 | Ga0451845_0753450 | 3300041501 | Bacteria | 1114 |
| 432 | Ga0466972_0000113 | 3300044658 | Bacteria | 69042 |
| 433 | Ga0466965_0168816 | 3300044683 | Bacteria | 1150 |
| 434 | Ga0466970_0058228 | 3300044765 | Bacteria | 2068 |
| 435 | Ga0466959_0100592 | 3300045049 | Bacteria | 2069 |
| 436 | Ga0466967_0761927 | 3300045976 | Bacteria | 960 |
| 437 | Ga0495603_0031711 | 3300046455 | Bacteria | 3182 |
| 438 | Ga0495603_0046262 | 3300046455 | Bacteria | 2593 |
| 439 | Ga0495638_0000617 | 3300046460 | Bacteria | 39602 |
| 440 | Ga0495638_0085637 | 3300046460 | Bacteria | 1905 |
| 441 | Ga0495651_0317068 | 3300046462 | Bacteria | 1040 |
| 442 | Ga0495584_0145729 | 3300046491 | Bacteria | 1203 |
| 443 | Ga0495585_0136118 | 3300046492 | Bacteria | 1290 |
| 444 | Ga0495631_0077468 | 3300046518 | Bacteria | 1435 |
| 445 | Ga0495631_0170281 | 3300046518 | Bacteria | 934 |
| 446 | Ga0495632_0096355 | 3300046519 | Bacteria | 1397 |
| 447 | Ga0495644_0051561 | 3300046523 | Bacteria | 1545 |
| 448 | Ga0495644_0113701 | 3300046523 | Bacteria | 1028 |
| 449 | Ga0495648_0056053 | 3300046524 | Bacteria | 2373 |
| 450 | Ga0495587_0027109 | 3300046536 | Bacteria | 3489 |
| 451 | Ga0495645_0419453 | 3300046543 | Bacteria | 850 |
| 452 | Ga0495667_0270071 | 3300046559 | Bacteria | 1081 |
| 453 | Ga0495656_0043353 | 3300046615 | Bacteria | 1889 |
| 454 | Ga0495656_0079764 | 3300046615 | Bacteria | 1474 |
| 455 | Ga0495656_0118887 | 3300046615 | Bacteria | 1245 |
| 456 | Ga0495668_0236478 | 3300046616 | Bacteria | 1000 |
| 457 | Ga0495611_0138988 | 3300046648 | Bacteria | 1134 |
| 458 | Ga0495625_0043325 | 3300046660 | Bacteria | 3264 |
| 459 | Ga0495625_0131372 | 3300046660 | Bacteria | 1696 |
| 460 | Ga0495588_0134144 | 3300046674 | Bacteria | 1307 |
| 461 | Ga0495599_0001619 | 3300046678 | Bacteria | 12981 |
| 462 | Ga0495623_0089669 | 3300046679 | Bacteria | 1890 |
| 463 | Ga0495669_0053160 | 3300046684 | Bacteria | 1821 |
| 464 | Ga0495669_0240521 | 3300046684 | Bacteria | 869 |
| 465 | Ga0495670_0137122 | 3300046691 | Bacteria | 1278 |
| 466 | Ga0495671_0096101 | 3300046692 | Bacteria | 1450 |
| 467 | Ga0495671_0186238 | 3300046692 | Bacteria | 1008 |
| 468 | Ga0495649_0158568 | 3300046694 | Bacteria | 1187 |
| 469 | Ga0495600_0184531 | 3300046809 | Bacteria | 1344 |
| 470 | Ga0495604_0228605 | 3300047317 | Bacteria | 1277 |
| 471 | Ga0495672_0002625 | 3300047320 | Bacteria | 16239 |
| 472 | Ga0495672_0052638 | 3300047320 | Bacteria | 2390 |
| 473 | Ga0495672_0229890 | 3300047320 | Bacteria | 911 |
| 474 | Ga0495680_0164016 | 3300047322 | Bacteria | 1612 |
| 475 | Ga0495675_0105846 | 3300047444 | Bacteria | 1758 |
| 476 | Ga0495679_067547 | 3300047446 | Bacteria | 1036 |
| 477 | Ga0495686_0032571 | 3300047472 | Bacteria | 3373 |
| 478 | Ga0495686_0122640 | 3300047472 | Bacteria | 1547 |
| 479 | Ga0495602_0160909 | 3300048088 | Bacteria | 1753 |
| 480 | Ga0495602_0395781 | 3300048088 | Bacteria | 986 |
| 481 | Ga0495626_0238257 | 3300048091 | Bacteria | 733 |
| 482 | Ga0496100_0009755 | 3300048903 | Bacteria | 5405 |
| 483 | Ga0496100_0090263 | 3300048903 | Bacteria | 2089 |
| 484 | Ga0496100_0124975 | 3300048903 | Bacteria | 1804 |
| 485 | Ga0496101_0014497 | 3300048904 | Bacteria | 5298 |
| 486 | Ga0496101_0055564 | 3300048904 | Bacteria | 2860 |
| 487 | Ga0496101_0149686 | 3300048904 | Bacteria | 1784 |
| 488 | Ga0496102_0004216 | 3300048905 | Bacteria | 12155 |
| 489 | Ga0496102_0047752 | 3300048905 | Bacteria | 3891 |
| 490 | Ga0496102_0215349 | 3300048905 | Bacteria | 1810 |
| 491 | Ga0496102_0265592 | 3300048905 | Bacteria | 1618 |
| 492 | Ga0496102_0319796 | 3300048905 | Bacteria | 1462 |
| 493 | Ga0496103_0006073 | 3300048906 | Bacteria | 7217 |
| 494 | Ga0496103_0011676 | 3300048906 | Bacteria | 5210 |
| 495 | Ga0496103_0297598 | 3300048906 | Bacteria | 1038 |
| 496 | Ga0496104_0035437 | 3300048907 | Bacteria | 4659 |
| 497 | Ga0496104_0072721 | 3300048907 | Bacteria | 3270 |
| 498 | Ga0496104_0173037 | 3300048907 | Bacteria | 2070 |
| 499 | Ga0496104_0988298 | 3300048907 | Bacteria | 746 |
| 500 | Ga0496105_0011994 | 3300048908 | Bacteria | 6862 |
| 501 | Ga0496105_0035363 | 3300048908 | Bacteria | 4111 |
| 502 | Ga0496105_0192611 | 3300048908 | Bacteria | 1666 |
| 503 | Ga0496105_0256925 | 3300048908 | Bacteria | 1414 |
| 504 | Ga0496106_0009589 | 3300048909 | Bacteria | 7148 |
| 505 | Ga0496106_0018599 | 3300048909 | Bacteria | 5142 |
| 506 | Ga0496106_0138882 | 3300048909 | Bacteria | 1910 |
| 507 | Ga0496107_0001367 | 3300048910 | Bacteria | 15005 |
| 508 | Ga0496107_0029040 | 3300048910 | Bacteria | 3932 |
| 509 | Ga0496107_0030734 | 3300048910 | Bacteria | 3829 |
| 510 | Ga0496107_0326294 | 3300048910 | Bacteria | 1142 |
| 511 | Ga0496107_0350657 | 3300048910 | Bacteria | 1098 |
| 512 | Ga0496108_0338038 | 3300048911 | Bacteria | 1313 |
| 513 | Ga0496109_0082403 | 3300048912 | Bacteria | 2964 |
| 514 | Ga0496109_0104894 | 3300048912 | Bacteria | 2625 |
| 515 | Ga0496109_0300180 | 3300048912 | Bacteria | 1514 |
| 516 | Ga0496109_0333485 | 3300048912 | Bacteria | 1432 |
| 517 | Ga0496110_0008299 | 3300048913 | Bacteria | 8351 |
| 518 | Ga0496110_0030489 | 3300048913 | Bacteria | 4649 |
| 519 | Ga0496111_0081741 | 3300048914 | Bacteria | 2358 |
| 520 | Ga0496111_0375909 | 3300048914 | Bacteria | 1051 |
| 521 | Ga0496112_0022256 | 3300048915 | Bacteria | 6038 |
| 522 | Ga0496112_0048853 | 3300048915 | Bacteria | 4145 |
| 523 | Ga0496112_0193766 | 3300048915 | Bacteria | 1993 |
| 524 | Ga0496113_0020710 | 3300048916 | Bacteria | 4629 |
| 525 | Ga0496113_0117289 | 3300048916 | Bacteria | 2078 |
| 526 | Ga0496113_0448397 | 3300048916 | Bacteria | 1037 |
| 527 | Ga0496114_0030373 | 3300048917 | Plasmid | 4446 |
| 528 | Ga0496114_0061607 | 3300048917 | Bacteria | 3138 |
| 529 | Ga0496114_0245516 | 3300048917 | Bacteria | 1575 |
| 530 | Ga0496115_0013542 | 3300048918 | Bacteria | 6170 |
| 531 | Ga0496115_0258584 | 3300048918 | Bacteria | 1432 |
| 532 | Ga0496115_0318028 | 3300048918 | Bacteria | 1273 |
| 533 | Ga0496115_0321129 | 3300048918 | Bacteria | 1266 |
| 534 | Ga0496116_0085847 | 3300048919 | Bacteria | 1933 |
| 535 | Ga0496117_0039671 | 3300048920 | Bacteria | 3472 |
| 536 | Ga0496118_0018719 | 3300048921 | Bacteria | 6224 |
| 537 | Ga0496118_0103004 | 3300048921 | Bacteria | 1922 |
| 538 | Ga0496119_0129755 | 3300048922 | Bacteria | 1375 |
| 539 | Ga0496121_0001059 | 3300048924 | Bacteria | 48728 |
| 540 | Ga0496121_0029157 | 3300048924 | Bacteria | 5114 |
| 541 | Ga0496121_0053408 | 3300048924 | Bacteria | 3385 |
| 542 | Ga0496121_0105889 | 3300048924 | Bacteria | 2157 |
| 543 | Ga0496121_0116614 | 3300048924 | Bacteria | 2025 |
| 544 | Ga0496121_0136549 | 3300048924 | Bacteria | 1826 |
| 545 | Ga0496121_0175055 | 3300048924 | Bacteria | 1554 |
| 546 | Ga0496121_0296777 | 3300048924 | Bacteria | 1098 |
| 547 | Ga0496121_0323802 | 3300048924 | Bacteria | 1037 |
| 548 | Ga0496123_0241306 | 3300048926 | Bacteria | 897 |
| 549 | Ga0496125_0006575 | 3300048928 | Bacteria | 12525 |
| 550 | Ga0496125_0171819 | 3300048928 | Bacteria | 1456 |
| 551 | Ga0496126_0001940 | 3300048929 | Bacteria | 29487 |
| 552 | Ga0496126_0003509 | 3300048929 | Bacteria | 19758 |
| 553 | Ga0496126_0020176 | 3300048929 | Bacteria | 6540 |
| 554 | Ga0496126_0043026 | 3300048929 | Bacteria | 4169 |
| 555 | Ga0496126_0300323 | 3300048929 | Bacteria | 1325 |
| 556 | Ga0496126_0487507 | 3300048929 | Bacteria | 987 |
| 557 | Ga0501032_0027862 | 3300049569 | Bacteria | 3882 |
| 558 | Ga0501033_0002631 | 3300049570 | Bacteria | 15105 |
| 559 | Ga0501034_0015233 | 3300049571 | Bacteria | 7902 |
| 560 | Ga0501036_0001868 | 3300049572 | Bacteria | 16328 |
| 561 | Ga0501037_0005101 | 3300049573 | Bacteria | 9553 |
| 562 | Ga0501038_0000276 | 3300049574 | Bacteria | 43448 |
| 563 | Ga0501039_0009202 | 3300049575 | Bacteria | 7527 |
| 564 | Ga0501043_0003013 | 3300049579 | Bacteria | 14020 |
| 565 | Ga0501046_0011595 | 3300049580 | Bacteria | 7534 |
| 566 | Ga0501047_0014333 | 3300049581 | Bacteria | 7539 |
| 567 | Ga0501047_0111567 | 3300049581 | Bacteria | 2617 |
| 568 | Ga0501048_0038426 | 3300049582 | Bacteria | 3434 |
| 569 | Ga0501067_0002106 | 3300049583 | Bacteria | 10960 |
| 570 | Ga0501068_0024578 | 3300049584 | Bacteria | 3539 |
| 571 | Ga0501069_0000483 | 3300049585 | Bacteria | 18234 |
| 572 | Ga0501070_0003133 | 3300049586 | Bacteria | 14401 |
| 573 | Ga0501070_0056921 | 3300049586 | Bacteria | 3241 |
| 574 | Ga0501071_0188296 | 3300049587 | Bacteria | 1547 |
| 575 | Ga0501072_0242658 | 3300049588 | Bacteria | 1435 |
| 576 | Ga0501073_0000456 | 3300049589 | Bacteria | 28306 |
| 577 | Ga0501073_0198737 | 3300049589 | Bacteria | 1387 |
| 578 | Ga0501074_0023481 | 3300049590 | Bacteria | 4482 |
| 579 | Ga0501080_0001321 | 3300049742 | Bacteria | 20652 |
| 580 | Ga0501080_0144322 | 3300049742 | Bacteria | 2200 |
| 581 | Ga0501083_0351282 | 3300049744 | Bacteria | 958 |
| 582 | Ga0501035_0015892 | 3300049822 | Bacteria | 6945 |
| 583 | Ga0501035_0494539 | 3300049822 | Bacteria | 1007 |
| 584 | Ga0501044_0018935 | 3300049823 | Bacteria | 7371 |
| 585 | Ga0501044_0021138 | 3300049823 | Bacteria | 6948 |
| 586 | nmdc:mga03n38_177140_c1 | 3300050490 | Bacteria | 1090 |
| 587 | nmdc:mga03n38_314650_c1 | 3300050490 | Bacteria | 844 |
| 588 | nmdc:mga00v17_143315_c1 | 3300050491 | Bacteria | 1533 |
| 589 | nmdc:mga0yw44_37622_c1 | 3300050492 | Bacteria | 2858 |
| 590 | nmdc:mga0yw44_3788_c1 | 3300050492 | Bacteria | 6785 |
| 591 | nmdc:mga0k408_221551_c1 | 3300050493 | Bacteria | 1129 |
| 592 | nmdc:mga0k408_33235_c1 | 3300050493 | Bacteria | 2949 |
| 593 | nmdc:mga06z11_112356_c1 | 3300050494 | Bacteria | 1510 |
| 594 | nmdc:mga06z11_15070_c1 | 3300050494 | Bacteria | 3441 |
| 595 | nmdc:mga06z11_494833_c1 | 3300050494 | Bacteria | 740 |
| 596 | nmdc:mga04h51_17050_c1 | 3300050495 | Bacteria | 2117 |
| 597 | nmdc:mga04h51_18778_c1 | 3300050495 | Bacteria | 2041 |
| 598 | nmdc:mga04h51_82215_c1 | 3300050495 | Bacteria | 1145 |
| 599 | nmdc:mga07m45_175208_c1 | 3300050496 | Bacteria | 1247 |
| 600 | nmdc:mga07m45_33640_c1 | 3300050496 | Bacteria | 2374 |
| 601 | nmdc:mga07m45_69583_c1 | 3300050496 | Bacteria | 2001 |
| 602 | nmdc:mga07m45_76928_c1 | 3300050496 | Bacteria | 1903 |
| 603 | nmdc:mga07m45_87906_c1 | 3300050496 | Bacteria | 1778 |
| 604 | nmdc:mga08y16_41292_c1 | 3300050511 | Bacteria | 4833 |
| 605 | nmdc:mga08y16_51_c1 | 3300050511 | Bacteria | 105348 |
| 606 | nmdc:mga0n895_142219_c1 | 3300050512 | Bacteria | 2428 |
| 607 | nmdc:mga0n895_608606_c1 | 3300050512 | Bacteria | 1094 |
| 608 | nmdc:mga08x19_199733_c1 | 3300050514 | Bacteria | 1370 |
| 609 | nmdc:mga0sz30_91851_c1 | 3300050516 | Bacteria | 1321 |
| 610 | Ga0495601_0472849 | 3300053077 | Bacteria | 810 |
| 611 | Ga0500635_0089368 | 3300053080 | Bacteria | 1118 |
| 612 | Ga0495655_0006222 | 3300053083 | Bacteria | 2157 |
| 613 | Ga0495619_0306840 | 3300053085 | Bacteria | 1099 |
| 614 | Ga0500578_0181510 | 3300053086 | Bacteria | 1297 |
| 615 | Ga0500647_0065765 | 3300053091 | Bacteria | 1744 |
| 616 | Ga0500566_0001043 | 3300053094 | Bacteria | 16047 |
| 617 | Ga0500557_000050 | 3300053105 | Bacteria | 54589 |
| 618 | Ga0500562_026887 | 3300053108 | Bacteria | 1509 |
| 619 | Ga0500595_000280 | 3300053119 | Bacteria | 33866 |
| 620 | Ga0500595_004922 | 3300053119 | Bacteria | 5905 |
| 621 | Ga0500597_062295 | 3300053120 | Bacteria | 1604 |
| 622 | Ga0500642_0071449 | 3300053130 | Bacteria | 1580 |
| 623 | Ga0500655_045193 | 3300053133 | Bacteria | 870 |
| 624 | Ga0500658_0078078 | 3300053134 | Bacteria | 1411 |
| 625 | Ga0500568_0060320 | 3300053139 | Bacteria | 1469 |
| 626 | Ga0500603_000163 | 3300053150 | Bacteria | 16654 |
| 627 | Ga0500603_021371 | 3300053150 | Bacteria | 1591 |
| 628 | Ga0500627_0132339 | 3300053158 | Bacteria | 1126 |
| 629 | Ga0500627_0199104 | 3300053158 | Bacteria | 898 |
| 630 | Ga0500636_0042997 | 3300053177 | Bacteria | 2669 |
| 631 | Ga0500636_0168477 | 3300053177 | Bacteria | 1187 |
| 632 | Ga0500637_0000178 | 3300053178 | Bacteria | 23661 |
| 633 | Ga0500625_003403 | 3300053729 | Bacteria | 6276 |
| 634 | Ga0500645_015755 | 3300053730 | Bacteria | 2390 |
| 635 | Ga0500601_007923 | 3300053737 | Bacteria | 1179 |
| 636 | Ga0501082_0075174 | 3300060353 | Bacteria | 2910 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300013306 | Ga0163162_10279544 | Ga0163162_102795443 | 203 |
| 2 | 3300025926 | Ga0207659_10297442 | Ga0207659_102974422 | 203 |
| 3 | 3300048907 | Ga0496104_0173037 | Ga0496104_0173037_1405_2040 | 203 |
| 4 | 3300048908 | Ga0496105_0256925 | Ga0496105_0256925_300_935 | 203 |
| 5 | 3300048912 | Ga0496109_0104894 | Ga0496109_0104894_639_1274 | 203 |
| 6 | iso_pu_bacteria | 2919073203 | 2919074831 | 207 |
| 7 | 3300028794 | Ga0307515_10111249 | Ga0307515_101112492 | 208 |
| 8 | iso_pu_bacteria | 2507262055 | 2507509298 | 208 |
| 9 | iso_pu_bacteria | 2508501042 | 2508698872 | 208 |
| 10 | iso_pu_bacteria | 2513237096 | 2513654897 | 208 |
| 11 | iso_pu_bacteria | 2513237098 | 2513671997 | 208 |
| 12 | iso_pu_bacteria | 2513237098 | 2513675737 | 208 |
| 13 | iso_pu_bacteria | 2513237102 | 2513700625 | 208 |
| 14 | iso_pu_bacteria | 2513237137 | 2513861306 | 208 |
| 15 | iso_pu_bacteria | 2513237141 | 2513890010 | 208 |
| 16 | iso_pu_bacteria | 2513237145 | 2513916080 | 208 |
| 17 | iso_pu_bacteria | 2515154112 | 2515628897 | 208 |
| 18 | iso_pu_bacteria | 2524023210 | 2524466096 | 208 |
| 19 | iso_pu_bacteria | 2617270741 | 2617376427 | 208 |
| 20 | iso_pu_bacteria | 2824600985 | 2824606418 | 208 |
| 21 | iso_pu_bacteria | 2824609381 | 2824616339 | 208 |
| 22 | iso_pu_bacteria | 2824617872 | 2824619878 | 208 |
| 23 | iso_pu_bacteria | 2824626560 | 2824629486 | 208 |
| 24 | iso_pu_bacteria | 2824635225 | 2824637127 | 208 |
| 25 | iso_pu_bacteria | 2824644064 | 2824650450 | 208 |
| 26 | iso_pu_bacteria | 2824704595 | 2824710693 | 208 |
| 27 | iso_pu_bacteria | 2824714736 | 2824720978 | 208 |
| 28 | iso_pu_bacteria | 2824723954 | 2824730350 | 208 |
| 29 | iso_pu_bacteria | 2824753945 | 2824758541 | 208 |
| 30 | iso_pu_bacteria | 2824763712 | 2824768280 | 208 |
| 31 | iso_pu_bacteria | 2841966195 | 2841966910 | 208 |
| 32 | iso_pu_bacteria | 2847930680 | 2847935311 | 208 |
| 33 | iso_pu_bacteria | 2849076700 | 2849078007 | 208 |
| 34 | iso_pu_bacteria | 2857509624 | 2857510676 | 208 |
| 35 | iso_pu_bacteria | 2874645413 | 2874648491 | 208 |
| 36 | iso_pu_bacteria | 2874645413 | 2874649537 | 208 |
| 37 | iso_pu_bacteria | 2879083081 | 2879088945 | 208 |
| 38 | iso_pu_bacteria | 2879099564 | 2879100367 | 208 |
| 39 | iso_pu_bacteria | 2879127579 | 2879133390 | 208 |
| 40 | iso_pu_bacteria | 2879142872 | 2879146272 | 208 |
| 41 | iso_pu_bacteria | 2881364244 | 2881366741 | 208 |
| 42 | iso_pu_bacteria | 2881665667 | 2881670867 | 208 |
| 43 | iso_pu_bacteria | 2885383462 | 2885391542 | 208 |
| 44 | iso_pu_bacteria | 2885383462 | 2885392113 | 208 |
| 45 | iso_pu_bacteria | 2888419890 | 2888422108 | 208 |
| 46 | iso_pu_bacteria | 2888419890 | 2888425147 | 208 |
| 47 | iso_pu_bacteria | 2903768456 | 2903772972 | 208 |
| 48 | iso_pu_bacteria | 2903768456 | 2903776335 | 208 |
| 49 | iso_pu_bacteria | 2904699407 | 2904705641 | 208 |
| 50 | iso_pu_bacteria | 2904711408 | 2904717213 | 208 |
| 51 | iso_pu_bacteria | 2906660503 | 2906661319 | 208 |
| 52 | iso_pu_bacteria | 2929615660 | 2929617289 | 208 |
| 53 | iso_pu_bacteria | 2929624759 | 2929626993 | 208 |
| 54 | iso_pu_bacteria | 2932784394 | 2932793520 | 208 |
| 55 | iso_pu_bacteria | 2932828146 | 2932836687 | 208 |
| 56 | iso_pu_bacteria | 2932828146 | 2932837187 | 208 |
| 57 | iso_pu_bacteria | 2933577622 | 2933579246 | 208 |
| 58 | iso_pu_bacteria | 2935608549 | 2935611806 | 208 |
| 59 | iso_pu_bacteria | 2935638405 | 2935647235 | 208 |
| 60 | iso_pu_bacteria | 2935648319 | 2935651878 | 208 |
| 61 | iso_pu_bacteria | 2935656913 | 2935660688 | 208 |
| 62 | iso_pu_bacteria | 2935665750 | 2935674459 | 208 |
| 63 | iso_pu_bacteria | 2935810662 | 2935818892 | 208 |
| 64 | iso_pu_bacteria | 2935819856 | 2935821284 | 208 |
| 65 | iso_pu_bacteria | 2935827899 | 2935836734 | 208 |
| 66 | iso_pu_bacteria | 2935837841 | 2935846698 | 208 |
| 67 | iso_pu_bacteria | 2935847175 | 2935850455 | 208 |
| 68 | iso_pu_bacteria | 2935908558 | 2935914058 | 208 |
| 69 | iso_pu_bacteria | 2935916978 | 2935921227 | 208 |
| 70 | iso_pu_bacteria | 2935926038 | 2935931753 | 208 |
| 71 | iso_pu_bacteria | 2935934488 | 2935940312 | 208 |
| 72 | iso_pu_bacteria | 2935942939 | 2935947863 | 208 |
| 73 | iso_pu_bacteria | 2935951376 | 2935956596 | 208 |
| 74 | iso_pu_bacteria | 2935967501 | 2935973389 | 208 |
| 75 | iso_pu_bacteria | 2935975950 | 2935980995 | 208 |
| 76 | iso_pu_bacteria | 2935984226 | 2935989553 | 208 |
| 77 | iso_pu_bacteria | 2936011229 | 2936014744 | 208 |
| 78 | iso_pu_bacteria | 2936019824 | 2936023459 | 208 |
| 79 | iso_pu_bacteria | 2936028420 | 2936032487 | 208 |
| 80 | iso_pu_bacteria | 2936037263 | 2936045606 | 208 |
| 81 | iso_pu_bacteria | 2936046547 | 2936050485 | 208 |
| 82 | iso_pu_bacteria | 2936055302 | 2936059023 | 208 |
| 83 | iso_pu_bacteria | 2941538514 | 2941547181 | 208 |
| 84 | iso_pu_bacteria | 8006933436 | 8006933489 | 208 |
| 85 | iso_pu_bacteria | 8006973647 | 8006983161 | 208 |
| 86 | iso_pu_bacteria | 8016511872 | 8016512737 | 208 |
| 87 | iso_pu_bacteria | 8016511872 | 8016512847 | 208 |
| 88 | iso_pu_bacteria | 8016622563 | 8016627525 | 208 |
| 89 | iso_pu_bacteria | 8016630954 | 8016631750 | 208 |
| 90 | iso_pu_bacteria | 8017057580 | 8017067254 | 208 |
| 91 | iso_pu_bacteria | 8017057580 | 8017067354 | 208 |
| 92 | iso_pu_bacteria | 8019547302 | 8019554629 | 208 |
| 93 | iso_pu_bacteria | 8019619141 | 8019627389 | 208 |
| 94 | iso_pu_bacteria | 8019629233 | 8019635186 | 208 |
| 95 | iso_pu_bacteria | 8019659431 | 8019663028 | 208 |
| 96 | iso_pu_bacteria | 8019668869 | 8019672626 | 208 |
| 97 | iso_pu_bacteria | 8019678201 | 8019683534 | 208 |
| 98 | iso_pu_bacteria | 8019687851 | 8019689279 | 208 |
| 99 | iso_pu_bacteria | 8055742211 | 8055747096 | 208 |
| 100 | iso_pu_bacteria | 8056681323 | 8056688187 | 208 |
| 101 | 3300003322 | rootL2_10062248 | rootL2_100622486 | 209 |
| 102 | 3300003659 | JGI25404J52841_10001673 | JGI25404J52841_100016731 | 209 |
| 103 | 3300005336 | Ga0070680_100060330 | Ga0070680_1000603304 | 209 |
| 104 | 3300005339 | Ga0070660_100242569 | Ga0070660_1002425692 | 209 |
| 105 | 3300005356 | Ga0070674_100107375 | Ga0070674_1001073753 | 209 |
| 106 | 3300005436 | Ga0070713_100330137 | Ga0070713_1003301371 | 209 |
| 107 | 3300005455 | Ga0070663_100084590 | Ga0070663_1000845901 | 209 |
| 108 | 3300005456 | Ga0070678_100345671 | Ga0070678_1003456712 | 209 |
| 109 | 3300005458 | Ga0070681_10069696 | Ga0070681_100696962 | 209 |
| 110 | 3300005530 | Ga0070679_100069731 | Ga0070679_1000697314 | 209 |
| 111 | 3300005535 | Ga0070684_100844673 | Ga0070684_1008446732 | 209 |
| 112 | 3300005548 | Ga0070665_100048897 | Ga0070665_1000488974 | 209 |
| 113 | 3300005548 | Ga0070665_100070629 | Ga0070665_1000706292 | 209 |
| 114 | 3300005548 | Ga0070665_100160167 | Ga0070665_1001601672 | 209 |
| 115 | 3300005563 | Ga0068855_100005078 | Ga0068855_1000050784 | 209 |
| 116 | 3300005577 | Ga0068857_100625539 | Ga0068857_1006255392 | 209 |
| 117 | 3300005614 | Ga0068856_100512913 | Ga0068856_1005129131 | 209 |
| 118 | 3300005617 | Ga0068859_100845111 | Ga0068859_1008451112 | 209 |
| 119 | 3300005718 | Ga0068866_10123683 | Ga0068866_101236832 | 209 |
| 120 | 3300005844 | Ga0068862_100466603 | Ga0068862_1004666032 | 209 |
| 121 | 3300005937 | Ga0081455_10014623 | Ga0081455_100146236 | 209 |
| 122 | 3300005983 | Ga0081540_1054853 | Ga0081540_10548532 | 209 |
| 123 | 3300006178 | Ga0075367_10211924 | Ga0075367_102119242 | 209 |
| 124 | 3300006237 | Ga0097621_100560237 | Ga0097621_1005602372 | 209 |
| 125 | 3300006931 | Ga0097620_100845062 | Ga0097620_1008450621 | 209 |
| 126 | 3300006944 | Ga0099823_1008083 | Ga0099823_10080834 | 209 |
| 127 | 3300007265 | Ga0099794_10046610 | Ga0099794_100466101 | 209 |
| 128 | 3300009093 | Ga0105240_10377799 | Ga0105240_103777992 | 209 |
| 129 | 3300009101 | Ga0105247_10744171 | Ga0105247_107441712 | 209 |
| 130 | 3300009545 | Ga0105237_10189312 | Ga0105237_101893122 | 209 |
| 131 | 3300013104 | Ga0157370_10113527 | Ga0157370_101135273 | 209 |
| 132 | 3300013306 | Ga0163162_10194870 | Ga0163162_101948703 | 209 |
| 133 | 3300013306 | Ga0163162_10238263 | Ga0163162_102382633 | 209 |
| 134 | 3300013308 | Ga0157375_10688017 | Ga0157375_106880172 | 209 |
| 135 | 3300013308 | Ga0157375_11130558 | Ga0157375_111305581 | 209 |
| 136 | 3300014326 | Ga0157380_10724726 | Ga0157380_107247261 | 209 |
| 137 | 3300014969 | Ga0157376_10454401 | Ga0157376_104544012 | 209 |
| 138 | 3300017792 | Ga0163161_10201308 | Ga0163161_102013082 | 209 |
| 139 | 3300025909 | Ga0207705_10168133 | Ga0207705_101681332 | 209 |
| 140 | 3300025917 | Ga0207660_10149059 | Ga0207660_101490591 | 209 |
| 141 | 3300025921 | Ga0207652_10139022 | Ga0207652_101390224 | 209 |
| 142 | 3300025928 | Ga0207700_10428107 | Ga0207700_104281071 | 209 |
| 143 | 3300025933 | Ga0207706_10699721 | Ga0207706_106997211 | 209 |
| 144 | 3300026067 | Ga0207678_10074338 | Ga0207678_100743384 | 209 |
| 145 | 3300026118 | Ga0207675_100730175 | Ga0207675_1007301752 | 209 |
| 146 | 3300026121 | Ga0207683_10201945 | Ga0207683_102019452 | 209 |
| 147 | 3300026142 | Ga0207698_10831687 | Ga0207698_108316872 | 209 |
| 148 | 3300028379 | Ga0268266_10476649 | Ga0268266_104766492 | 209 |
| 149 | 3300028786 | Ga0307517_10062698 | Ga0307517_100626984 | 209 |
| 150 | 3300031456 | Ga0307513_10276049 | Ga0307513_102760491 | 209 |
| 151 | 3300031507 | Ga0307509_10032602 | Ga0307509_100326024 | 209 |
| 152 | 3300032126 | Ga0307415_100092914 | Ga0307415_1000929142 | 209 |
| 153 | 3300037418 | Ga0395900_0303707 | Ga0395900_0303707_406_1035 | 209 |
| 154 | 3300037466 | Ga0395898_0256396 | Ga0395898_0256396_969_1598 | 209 |
| 155 | 3300037471 | Ga0395905_0071674 | Ga0395905_0071674_2227_2856 | 209 |
| 156 | 3300038443 | Ga0395901_0258230 | Ga0395901_0258230_402_1031 | 209 |
| 157 | 3300046455 | Ga0495603_0046262 | Ga0495603_0046262_1853_2482 | 209 |
| 158 | 3300046460 | Ga0495638_0085637 | Ga0495638_0085637_1146_1775 | 209 |
| 159 | 3300046518 | Ga0495631_0077468 | Ga0495631_0077468_451_1080 | 209 |
| 160 | 3300046519 | Ga0495632_0096355 | Ga0495632_0096355_200_829 | 209 |
| 161 | 3300046524 | Ga0495648_0056053 | Ga0495648_0056053_1065_1694 | 209 |
| 162 | 3300046559 | Ga0495667_0270071 | Ga0495667_0270071_425_1057 | 209 |
| 163 | 3300046615 | Ga0495656_0118887 | Ga0495656_0118887_461_1090 | 209 |
| 164 | 3300046616 | Ga0495668_0236478 | Ga0495668_0236478_291_920 | 209 |
| 165 | 3300046648 | Ga0495611_0138988 | Ga0495611_0138988_60_689 | 209 |
| 166 | 3300046660 | Ga0495625_0043325 | Ga0495625_0043325_1878_2507 | 209 |
| 167 | 3300046660 | Ga0495625_0131372 | Ga0495625_0131372_217_846 | 209 |
| 168 | 3300046684 | Ga0495669_0053160 | Ga0495669_0053160_400_1029 | 209 |
| 169 | 3300046684 | Ga0495669_0240521 | Ga0495669_0240521_15_644 | 209 |
| 170 | 3300046694 | Ga0495649_0158568 | Ga0495649_0158568_340_969 | 209 |
| 171 | 3300047320 | Ga0495672_0002625 | Ga0495672_0002625_2910_3539 | 209 |
| 172 | 3300047446 | Ga0495679_067547 | Ga0495679_067547_56_685 | 209 |
| 173 | 3300048091 | Ga0495626_0238257 | Ga0495626_0238257_49_678 | 209 |
| 174 | 3300048924 | Ga0496121_0029157 | Ga0496121_0029157_1125_1754 | 209 |
| 175 | 3300048928 | Ga0496125_0171819 | Ga0496125_0171819_808_1437 | 209 |
| 176 | 3300048929 | Ga0496126_0020176 | Ga0496126_0020176_4324_4953 | 209 |
| 177 | 3300050492 | nmdc:mga0yw44_37622_c1 | nmdc:mga0yw44_37622_c1_1747_2376 | 209 |
| 178 | 3300050495 | nmdc:mga04h51_17050_c1 | nmdc:mga04h51_17050_c1_126_755 | 209 |
| 179 | 3300053091 | Ga0500647_0065765 | Ga0500647_0065765_38_667 | 209 |
| 180 | 3300053105 | Ga0500557_000050 | Ga0500557_000050_37201_37830 | 209 |
| 181 | 3300053120 | Ga0500597_062295 | Ga0500597_062295_195_824 | 209 |
| 182 | 3300053130 | Ga0500642_0071449 | Ga0500642_0071449_892_1521 | 209 |
| 183 | 3300053133 | Ga0500655_045193 | Ga0500655_045193_229_858 | 209 |
| 184 | 3300053134 | Ga0500658_0078078 | Ga0500658_0078078_273_902 | 209 |
| 185 | 3300053158 | Ga0500627_0199104 | Ga0500627_0199104_137_766 | 209 |
| 186 | 3300053177 | Ga0500636_0168477 | Ga0500636_0168477_444_1073 | 209 |
| 187 | 3300053729 | Ga0500625_003403 | Ga0500625_003403_3209_3838 | 209 |
| 188 | 3300053730 | Ga0500645_015755 | Ga0500645_015755_970_1599 | 209 |
| 189 | 3300053737 | Ga0500601_007923 | Ga0500601_007923_149_778 | 209 |
| 190 | 3300005336 | Ga0070680_100219358 | Ga0070680_1002193581 | 211 |
| 191 | 3300005458 | Ga0070681_10017681 | Ga0070681_100176815 | 211 |
| 192 | 3300005530 | Ga0070679_100044869 | Ga0070679_1000448694 | 211 |
| 193 | 3300005535 | Ga0070684_100249910 | Ga0070684_1002499102 | 211 |
| 194 | 3300005983 | Ga0081540_1000809 | Ga0081540_100080921 | 211 |
| 195 | 3300006042 | Ga0075368_10029727 | Ga0075368_100297273 | 211 |
| 196 | 3300006353 | Ga0075370_10045857 | Ga0075370_100458572 | 211 |
| 197 | 3300006353 | Ga0075370_10049859 | Ga0075370_100498593 | 211 |
| 198 | 3300009174 | Ga0105241_10329500 | Ga0105241_103295002 | 211 |
| 199 | 3300009551 | Ga0105238_10527044 | Ga0105238_105270441 | 211 |
| 200 | 3300011119 | Ga0105246_10607995 | Ga0105246_106079951 | 211 |
| 201 | 3300013105 | Ga0157369_10129466 | Ga0157369_101294662 | 211 |
| 202 | 3300013307 | Ga0157372_10141634 | Ga0157372_101416343 | 211 |
| 203 | 3300025912 | Ga0207707_10008176 | Ga0207707_100081764 | 211 |
| 204 | 3300025917 | Ga0207660_10177074 | Ga0207660_101770742 | 211 |
| 205 | 3300025921 | Ga0207652_10094643 | Ga0207652_100946433 | 211 |
| 206 | 3300027866 | Ga0209813_10015975 | Ga0209813_100159751 | 211 |
| 207 | 3300031911 | Ga0307412_10152103 | Ga0307412_101521031 | 211 |
| 208 | 3300046460 | Ga0495638_0000617 | Ga0495638_0000617_12277_12921 | 211 |
| 209 | 3300048924 | Ga0496121_0105889 | Ga0496121_0105889_493_1131 | 211 |
| 210 | 3300048929 | Ga0496126_0043026 | Ga0496126_0043026_2111_2755 | 211 |
| 211 | 3300050493 | nmdc:mga0k408_221551_c1 | nmdc:mga0k408_221551_c1_418_1056 | 211 |
| 212 | 3300050494 | nmdc:mga06z11_112356_c1 | nmdc:mga06z11_112356_c1_802_1440 | 211 |
| 213 | 3300050495 | nmdc:mga04h51_18778_c1 | nmdc:mga04h51_18778_c1_646_1284 | 211 |
| 214 | 3300050496 | nmdc:mga07m45_175208_c1 | nmdc:mga07m45_175208_c1_158_796 | 211 |
| 215 | 3300050496 | nmdc:mga07m45_33640_c1 | nmdc:mga07m45_33640_c1_143_781 | 211 |
| 216 | 3300053108 | Ga0500562_026887 | Ga0500562_026887_501_1145 | 211 |
| 217 | 3300053158 | Ga0500627_0132339 | Ga0500627_0132339_364_1008 | 211 |
| 218 | 3300001990 | JGI24737J22298_10107068 | JGI24737J22298_101070681 | 212 |
| 219 | 3300002070 | JGI24750J21931_1004884 | JGI24750J21931_10048842 | 212 |
| 220 | 3300002075 | JGI24738J21930_10020092 | JGI24738J21930_100200922 | 212 |
| 221 | 3300002155 | JGI24033J26618_1006218 | JGI24033J26618_10062182 | 212 |
| 222 | 3300002244 | JGI24742J22300_10015119 | JGI24742J22300_100151192 | 212 |
| 223 | 3300002459 | JGI24751J29686_10040913 | JGI24751J29686_100409131 | 212 |
| 224 | 3300003320 | rootH2_10074383 | rootH2_100743832 | 212 |
| 225 | 3300003320 | rootH2_10130837 | rootH2_101308371 | 212 |
| 226 | 3300003323 | rootH1_10064064 | rootH1_100640642 | 212 |
| 227 | 3300003354 | JGI25160J50197_1000939 | JGI25160J50197_10009392 | 212 |
| 228 | 3300003354 | JGI25160J50197_1007045 | JGI25160J50197_10070452 | 212 |
| 229 | 3300003659 | JGI25404J52841_10031415 | JGI25404J52841_100314152 | 212 |
| 230 | 3300003659 | JGI25404J52841_10032676 | JGI25404J52841_100326762 | 212 |
| 231 | 3300005329 | Ga0070683_100116211 | Ga0070683_1001162113 | 212 |
| 232 | 3300005330 | Ga0070690_100043163 | Ga0070690_1000431633 | 212 |
| 233 | 3300005331 | Ga0070670_100208275 | Ga0070670_1002082751 | 212 |
| 234 | 3300005334 | Ga0068869_100244492 | Ga0068869_1002444921 | 212 |
| 235 | 3300005335 | Ga0070666_10400576 | Ga0070666_104005761 | 212 |
| 236 | 3300005336 | Ga0070680_100041868 | Ga0070680_1000418681 | 212 |
| 237 | 3300005337 | Ga0070682_100009270 | Ga0070682_1000092707 | 212 |
| 238 | 3300005337 | Ga0070682_100214163 | Ga0070682_1002141632 | 212 |
| 239 | 3300005338 | Ga0068868_100281102 | Ga0068868_1002811022 | 212 |
| 240 | 3300005338 | Ga0068868_100734712 | Ga0068868_1007347122 | 212 |
| 241 | 3300005339 | Ga0070660_100301395 | Ga0070660_1003013952 | 212 |
| 242 | 3300005339 | Ga0070660_100314071 | Ga0070660_1003140712 | 212 |
| 243 | 3300005340 | Ga0070689_100408622 | Ga0070689_1004086221 | 212 |
| 244 | 3300005341 | Ga0070691_10034083 | Ga0070691_100340833 | 212 |
| 245 | 3300005343 | Ga0070687_100018996 | Ga0070687_1000189962 | 212 |
| 246 | 3300005343 | Ga0070687_100421073 | Ga0070687_1004210731 | 212 |
| 247 | 3300005344 | Ga0070661_100165102 | Ga0070661_1001651022 | 212 |
| 248 | 3300005344 | Ga0070661_100166898 | Ga0070661_1001668983 | 212 |
| 249 | 3300005344 | Ga0070661_100604888 | Ga0070661_1006048881 | 212 |
| 250 | 3300005345 | Ga0070692_10129604 | Ga0070692_101296042 | 212 |
| 251 | 3300005347 | Ga0070668_100048385 | Ga0070668_1000483852 | 212 |
| 252 | 3300005347 | Ga0070668_100292214 | Ga0070668_1002922142 | 212 |
| 253 | 3300005347 | Ga0070668_100298501 | Ga0070668_1002985012 | 212 |
| 254 | 3300005353 | Ga0070669_100270337 | Ga0070669_1002703372 | 212 |
| 255 | 3300005354 | Ga0070675_100407150 | Ga0070675_1004071502 | 212 |
| 256 | 3300005356 | Ga0070674_100040883 | Ga0070674_1000408832 | 212 |
| 257 | 3300005356 | Ga0070674_100053157 | Ga0070674_1000531572 | 212 |
| 258 | 3300005364 | Ga0070673_100640014 | Ga0070673_1006400142 | 212 |
| 259 | 3300005364 | Ga0070673_100998978 | Ga0070673_1009989781 | 212 |
| 260 | 3300005366 | Ga0070659_100112303 | Ga0070659_1001123032 | 212 |
| 261 | 3300005367 | Ga0070667_100100750 | Ga0070667_1001007501 | 212 |
| 262 | 3300005434 | Ga0070709_10143753 | Ga0070709_101437532 | 212 |
| 263 | 3300005435 | Ga0070714_100537569 | Ga0070714_1005375692 | 212 |
| 264 | 3300005436 | Ga0070713_100219925 | Ga0070713_1002199252 | 212 |
| 265 | 3300005438 | Ga0070701_10069955 | Ga0070701_100699552 | 212 |
| 266 | 3300005439 | Ga0070711_100331408 | Ga0070711_1003314082 | 212 |
| 267 | 3300005441 | Ga0070700_100434039 | Ga0070700_1004340392 | 212 |
| 268 | 3300005444 | Ga0070694_100045595 | Ga0070694_1000455952 | 212 |
| 269 | 3300005455 | Ga0070663_100005431 | Ga0070663_1000054317 | 212 |
| 270 | 3300005455 | Ga0070663_100020805 | Ga0070663_1000208053 | 212 |
| 271 | 3300005455 | Ga0070663_100097128 | Ga0070663_1000971282 | 212 |
| 272 | 3300005455 | Ga0070663_100536002 | Ga0070663_1005360021 | 212 |
| 273 | 3300005456 | Ga0070678_100017758 | Ga0070678_1000177585 | 212 |
| 274 | 3300005456 | Ga0070678_100071528 | Ga0070678_1000715282 | 212 |
| 275 | 3300005456 | Ga0070678_100908899 | Ga0070678_1009088991 | 212 |
| 276 | 3300005457 | Ga0070662_100095037 | Ga0070662_1000950371 | 212 |
| 277 | 3300005458 | Ga0070681_10282827 | Ga0070681_102828272 | 212 |
| 278 | 3300005459 | Ga0068867_100030517 | Ga0068867_1000305173 | 212 |
| 279 | 3300005459 | Ga0068867_100826684 | Ga0068867_1008266841 | 212 |
| 280 | 3300005466 | Ga0070685_10063225 | Ga0070685_100632253 | 212 |
| 281 | 3300005530 | Ga0070679_100016988 | Ga0070679_1000169888 | 212 |
| 282 | 3300005535 | Ga0070684_100233687 | Ga0070684_1002336872 | 212 |
| 283 | 3300005535 | Ga0070684_100334780 | Ga0070684_1003347802 | 212 |
| 284 | 3300005535 | Ga0070684_100760460 | Ga0070684_1007604601 | 212 |
| 285 | 3300005539 | Ga0068853_100018490 | Ga0068853_1000184905 | 212 |
| 286 | 3300005539 | Ga0068853_100464347 | Ga0068853_1004643472 | 212 |
| 287 | 3300005543 | Ga0070672_100186361 | Ga0070672_1001863612 | 212 |
| 288 | 3300005544 | Ga0070686_100526683 | Ga0070686_1005266831 | 212 |
| 289 | 3300005546 | Ga0070696_100787895 | Ga0070696_1007878951 | 212 |
| 290 | 3300005547 | Ga0070693_100015017 | Ga0070693_1000150176 | 212 |
| 291 | 3300005547 | Ga0070693_100076947 | Ga0070693_1000769472 | 212 |
| 292 | 3300005547 | Ga0070693_100146537 | Ga0070693_1001465372 | 212 |
| 293 | 3300005548 | Ga0070665_100055188 | Ga0070665_1000551883 | 212 |
| 294 | 3300005548 | Ga0070665_100321188 | Ga0070665_1003211882 | 212 |
| 295 | 3300005548 | Ga0070665_100665320 | Ga0070665_1006653202 | 212 |
| 296 | 3300005549 | Ga0070704_100159546 | Ga0070704_1001595463 | 212 |
| 297 | 3300005563 | Ga0068855_100296290 | Ga0068855_1002962902 | 212 |
| 298 | 3300005577 | Ga0068857_100023890 | Ga0068857_1000238907 | 212 |
| 299 | 3300005577 | Ga0068857_100132484 | Ga0068857_1001324843 | 212 |
| 300 | 3300005578 | Ga0068854_100243639 | Ga0068854_1002436392 | 212 |
| 301 | 3300005614 | Ga0068856_100789106 | Ga0068856_1007891061 | 212 |
| 302 | 3300005614 | Ga0068856_101322473 | Ga0068856_1013224731 | 212 |
| 303 | 3300005615 | Ga0070702_100004976 | Ga0070702_1000049766 | 212 |
| 304 | 3300005615 | Ga0070702_100023926 | Ga0070702_1000239263 | 212 |
| 305 | 3300005616 | Ga0068852_100066913 | Ga0068852_1000669133 | 212 |
| 306 | 3300005616 | Ga0068852_100089288 | Ga0068852_1000892882 | 212 |
| 307 | 3300005618 | Ga0068864_100005000 | Ga0068864_1000050005 | 212 |
| 308 | 3300005618 | Ga0068864_100723550 | Ga0068864_1007235502 | 212 |
| 309 | 3300005718 | Ga0068866_10027650 | Ga0068866_100276503 | 212 |
| 310 | 3300005718 | Ga0068866_10027887 | Ga0068866_100278873 | 212 |
| 311 | 3300005719 | Ga0068861_100018438 | Ga0068861_1000184387 | 212 |
| 312 | 3300005719 | Ga0068861_100055317 | Ga0068861_1000553172 | 212 |
| 313 | 3300005719 | Ga0068861_100323532 | Ga0068861_1003235321 | 212 |
| 314 | 3300005834 | Ga0068851_10533028 | Ga0068851_105330281 | 212 |
| 315 | 3300005840 | Ga0068870_10006058 | Ga0068870_100060589 | 212 |
| 316 | 3300005841 | Ga0068863_100476236 | Ga0068863_1004762361 | 212 |
| 317 | 3300005841 | Ga0068863_100843740 | Ga0068863_1008437401 | 212 |
| 318 | 3300005842 | Ga0068858_100330261 | Ga0068858_1003302612 | 212 |
| 319 | 3300005842 | Ga0068858_100361851 | Ga0068858_1003618512 | 212 |
| 320 | 3300005843 | Ga0068860_100039612 | Ga0068860_1000396123 | 212 |
| 321 | 3300005843 | Ga0068860_100200490 | Ga0068860_1002004904 | 212 |
| 322 | 3300005843 | Ga0068860_100458229 | Ga0068860_1004582292 | 212 |
| 323 | 3300005844 | Ga0068862_100063580 | Ga0068862_1000635802 | 212 |
| 324 | 3300005844 | Ga0068862_100758361 | Ga0068862_1007583611 | 212 |
| 325 | 3300005983 | Ga0081540_1000996 | Ga0081540_10009967 | 212 |
| 326 | 3300005983 | Ga0081540_1013314 | Ga0081540_10133142 | 212 |
| 327 | 3300005983 | Ga0081540_1013715 | Ga0081540_10137156 | 212 |
| 328 | 3300005983 | Ga0081540_1015135 | Ga0081540_10151354 | 212 |
| 329 | 3300006028 | Ga0070717_10527311 | Ga0070717_105273112 | 212 |
| 330 | 3300006038 | Ga0075365_10236226 | Ga0075365_102362262 | 212 |
| 331 | 3300006048 | Ga0075363_100037306 | Ga0075363_1000373063 | 212 |
| 332 | 3300006048 | Ga0075363_100157225 | Ga0075363_1001572252 | 212 |
| 333 | 3300006048 | Ga0075363_100291976 | Ga0075363_1002919761 | 212 |
| 334 | 3300006051 | Ga0075364_10143805 | Ga0075364_101438052 | 212 |
| 335 | 3300006173 | Ga0070716_100039861 | Ga0070716_1000398614 | 212 |
| 336 | 3300006173 | Ga0070716_100095573 | Ga0070716_1000955732 | 212 |
| 337 | 3300006175 | Ga0070712_100029064 | Ga0070712_1000290642 | 212 |
| 338 | 3300006175 | Ga0070712_100137553 | Ga0070712_1001375531 | 212 |
| 339 | 3300006178 | Ga0075367_10053123 | Ga0075367_100531233 | 212 |
| 340 | 3300006186 | Ga0075369_10174963 | Ga0075369_101749632 | 212 |
| 341 | 3300006237 | Ga0097621_100092686 | Ga0097621_1000926864 | 212 |
| 342 | 3300006353 | Ga0075370_10196213 | Ga0075370_101962131 | 212 |
| 343 | 3300006358 | Ga0068871_100025883 | Ga0068871_1000258836 | 212 |
| 344 | 3300006358 | Ga0068871_100221731 | Ga0068871_1002217312 | 212 |
| 345 | 3300006358 | Ga0068871_100498804 | Ga0068871_1004988042 | 212 |
| 346 | 3300006358 | Ga0068871_100851972 | Ga0068871_1008519722 | 212 |
| 347 | 3300006852 | Ga0075433_11160673 | Ga0075433_111606731 | 212 |
| 348 | 3300006871 | Ga0075434_100034971 | Ga0075434_1000349717 | 212 |
| 349 | 3300006871 | Ga0075434_100726951 | Ga0075434_1007269512 | 212 |
| 350 | 3300006871 | Ga0075434_100862133 | Ga0075434_1008621332 | 212 |
| 351 | 3300006881 | Ga0068865_100012377 | Ga0068865_1000123774 | 212 |
| 352 | 3300006881 | Ga0068865_100210503 | Ga0068865_1002105032 | 212 |
| 353 | 3300006914 | Ga0075436_100214521 | Ga0075436_1002145211 | 212 |
| 354 | 3300006941 | Ga0099825_1034652 | Ga0099825_10346523 | 212 |
| 355 | 3300006942 | Ga0099824_1002487 | Ga0099824_10024879 | 212 |
| 356 | 3300006942 | Ga0099824_1005150 | Ga0099824_100515012 | 212 |
| 357 | 3300006943 | Ga0099822_1001480 | Ga0099822_10014809 | 212 |
| 358 | 3300009093 | Ga0105240_10008605 | Ga0105240_1000860514 | 212 |
| 359 | 3300009093 | Ga0105240_10048479 | Ga0105240_100484794 | 212 |
| 360 | 3300009094 | Ga0111539_10000616 | Ga0111539_1000061639 | 212 |
| 361 | 3300009094 | Ga0111539_10193578 | Ga0111539_101935782 | 212 |
| 362 | 3300009098 | Ga0105245_10040936 | Ga0105245_100409362 | 212 |
| 363 | 3300009098 | Ga0105245_10139293 | Ga0105245_101392932 | 212 |
| 364 | 3300009098 | Ga0105245_10158379 | Ga0105245_101583791 | 212 |
| 365 | 3300009101 | Ga0105247_10024077 | Ga0105247_100240773 | 212 |
| 366 | 3300009148 | Ga0105243_10018891 | Ga0105243_100188913 | 212 |
| 367 | 3300009174 | Ga0105241_10009222 | Ga0105241_100092225 | 212 |
| 368 | 3300009176 | Ga0105242_10032372 | Ga0105242_100323723 | 212 |
| 369 | 3300009176 | Ga0105242_10378861 | Ga0105242_103788612 | 212 |
| 370 | 3300009176 | Ga0105242_10458443 | Ga0105242_104584431 | 212 |
| 371 | 3300009177 | Ga0105248_10123415 | Ga0105248_101234152 | 212 |
| 372 | 3300009177 | Ga0105248_10356079 | Ga0105248_103560792 | 212 |
| 373 | 3300009177 | Ga0105248_10362260 | Ga0105248_103622602 | 212 |
| 374 | 3300009545 | Ga0105237_10038493 | Ga0105237_100384937 | 212 |
| 375 | 3300009545 | Ga0105237_10058065 | Ga0105237_100580652 | 212 |
| 376 | 3300009545 | Ga0105237_10110791 | Ga0105237_101107913 | 212 |
| 377 | 3300009545 | Ga0105237_10812505 | Ga0105237_108125051 | 212 |
| 378 | 3300009551 | Ga0105238_10063814 | Ga0105238_100638142 | 212 |
| 379 | 3300009551 | Ga0105238_10075141 | Ga0105238_100751412 | 212 |
| 380 | 3300009551 | Ga0105238_10213193 | Ga0105238_102131932 | 212 |
| 381 | 3300009551 | Ga0105238_10460208 | Ga0105238_104602081 | 212 |
| 382 | 3300009551 | Ga0105238_10495711 | Ga0105238_104957112 | 212 |
| 383 | 3300009553 | Ga0105249_10079419 | Ga0105249_100794192 | 212 |
| 384 | 3300009553 | Ga0105249_10704280 | Ga0105249_107042802 | 212 |
| 385 | 3300010375 | Ga0105239_10037978 | Ga0105239_100379782 | 212 |
| 386 | 3300010375 | Ga0105239_10081722 | Ga0105239_100817224 | 212 |
| 387 | 3300010375 | Ga0105239_10103271 | Ga0105239_101032712 | 212 |
| 388 | 3300010375 | Ga0105239_10580628 | Ga0105239_105806281 | 212 |
| 389 | 3300010375 | Ga0105239_10765632 | Ga0105239_107656322 | 212 |
| 390 | 3300011119 | Ga0105246_10020940 | Ga0105246_100209404 | 212 |
| 391 | 3300011119 | Ga0105246_10043743 | Ga0105246_100437433 | 212 |
| 392 | 3300011119 | Ga0105246_10351677 | Ga0105246_103516771 | 212 |
| 393 | 3300013104 | Ga0157370_10018913 | Ga0157370_100189133 | 212 |
| 394 | 3300013105 | Ga0157369_10002208 | Ga0157369_100022083 | 212 |
| 395 | 3300013105 | Ga0157369_10005932 | Ga0157369_100059325 | 212 |
| 396 | 3300013105 | Ga0157369_10890353 | Ga0157369_108903531 | 212 |
| 397 | 3300013296 | Ga0157374_10017728 | Ga0157374_100177282 | 212 |
| 398 | 3300013296 | Ga0157374_10075411 | Ga0157374_100754111 | 212 |
| 399 | 3300013296 | Ga0157374_10286184 | Ga0157374_102861841 | 212 |
| 400 | 3300013296 | Ga0157374_10657183 | Ga0157374_106571832 | 212 |
| 401 | 3300013297 | Ga0157378_10034557 | Ga0157378_100345576 | 212 |
| 402 | 3300013297 | Ga0157378_10088682 | Ga0157378_100886825 | 212 |
| 403 | 3300013297 | Ga0157378_10202460 | Ga0157378_102024602 | 212 |
| 404 | 3300013297 | Ga0157378_10255666 | Ga0157378_102556663 | 212 |
| 405 | 3300013297 | Ga0157378_10476591 | Ga0157378_104765912 | 212 |
| 406 | 3300013306 | Ga0163162_10189605 | Ga0163162_101896053 | 212 |
| 407 | 3300013306 | Ga0163162_11405756 | Ga0163162_114057561 | 212 |
| 408 | 3300013307 | Ga0157372_10025495 | Ga0157372_100254956 | 212 |
| 409 | 3300013308 | Ga0157375_10024985 | Ga0157375_100249851 | 212 |
| 410 | 3300013308 | Ga0157375_10364530 | Ga0157375_103645302 | 212 |
| 411 | 3300013308 | Ga0157375_10577411 | Ga0157375_105774112 | 212 |
| 412 | 3300014325 | Ga0163163_10020992 | Ga0163163_100209929 | 212 |
| 413 | 3300014325 | Ga0163163_10065770 | Ga0163163_100657701 | 212 |
| 414 | 3300014326 | Ga0157380_10067985 | Ga0157380_100679854 | 212 |
| 415 | 3300014326 | Ga0157380_10229846 | Ga0157380_102298462 | 212 |
| 416 | 3300014326 | Ga0157380_10635009 | Ga0157380_106350092 | 212 |
| 417 | 3300014745 | Ga0157377_10188014 | Ga0157377_101880142 | 212 |
| 418 | 3300014968 | Ga0157379_10049822 | Ga0157379_100498222 | 212 |
| 419 | 3300014968 | Ga0157379_10116176 | Ga0157379_101161761 | 212 |
| 420 | 3300014969 | Ga0157376_10184631 | Ga0157376_101846312 | 212 |
| 421 | 3300017792 | Ga0163161_10019274 | Ga0163161_100192742 | 212 |
| 422 | 3300021321 | Ga0214542_1000002 | Ga0214542_1000002692 | 212 |
| 423 | 3300021324 | Ga0214545_1000002 | Ga0214545_100000228 | 212 |
| 424 | 3300021327 | Ga0214543_1000013 | Ga0214543_1000013294 | 212 |
| 425 | 3300025253 | Ga0209677_103741 | Ga0209677_1037413 | 212 |
| 426 | 3300025273 | Ga0209673_1040492 | Ga0209673_10404922 | 212 |
| 427 | 3300025284 | Ga0209130_1000672 | Ga0209130_10006724 | 212 |
| 428 | 3300025295 | Ga0209564_1002754 | Ga0209564_10027548 | 212 |
| 429 | 3300025297 | Ga0209758_1001375 | Ga0209758_100137516 | 212 |
| 430 | 3300025302 | Ga0207426_1000331 | Ga0207426_100033151 | 212 |
| 431 | 3300025302 | Ga0207426_1000577 | Ga0207426_100057746 | 212 |
| 432 | 3300025315 | Ga0207697_10026545 | Ga0207697_100265452 | 212 |
| 433 | 3300025315 | Ga0207697_10091416 | Ga0207697_100914162 | 212 |
| 434 | 3300025899 | Ga0207642_10329531 | Ga0207642_103295311 | 212 |
| 435 | 3300025900 | Ga0207710_10069744 | Ga0207710_100697442 | 212 |
| 436 | 3300025900 | Ga0207710_10287364 | Ga0207710_102873641 | 212 |
| 437 | 3300025901 | Ga0207688_10006895 | Ga0207688_100068952 | 212 |
| 438 | 3300025901 | Ga0207688_10118914 | Ga0207688_101189142 | 212 |
| 439 | 3300025901 | Ga0207688_10185248 | Ga0207688_101852482 | 212 |
| 440 | 3300025903 | Ga0207680_10165370 | Ga0207680_101653701 | 212 |
| 441 | 3300025904 | Ga0207647_10015001 | Ga0207647_100150014 | 212 |
| 442 | 3300025904 | Ga0207647_10016497 | Ga0207647_100164972 | 212 |
| 443 | 3300025904 | Ga0207647_10080046 | Ga0207647_100800463 | 212 |
| 444 | 3300025906 | Ga0207699_10090954 | Ga0207699_100909541 | 212 |
| 445 | 3300025907 | Ga0207645_10069204 | Ga0207645_100692042 | 212 |
| 446 | 3300025907 | Ga0207645_10124253 | Ga0207645_101242532 | 212 |
| 447 | 3300025908 | Ga0207643_10003065 | Ga0207643_1000306510 | 212 |
| 448 | 3300025909 | Ga0207705_10176843 | Ga0207705_101768432 | 212 |
| 449 | 3300025911 | Ga0207654_10070847 | Ga0207654_100708472 | 212 |
| 450 | 3300025911 | Ga0207654_10153821 | Ga0207654_101538212 | 212 |
| 451 | 3300025912 | Ga0207707_10056244 | Ga0207707_100562443 | 212 |
| 452 | 3300025912 | Ga0207707_10060266 | Ga0207707_100602663 | 212 |
| 453 | 3300025913 | Ga0207695_10052552 | Ga0207695_100525524 | 212 |
| 454 | 3300025913 | Ga0207695_10104080 | Ga0207695_101040802 | 212 |
| 455 | 3300025913 | Ga0207695_10686852 | Ga0207695_106868521 | 212 |
| 456 | 3300025914 | Ga0207671_10155741 | Ga0207671_101557413 | 212 |
| 457 | 3300025914 | Ga0207671_10328540 | Ga0207671_103285401 | 212 |
| 458 | 3300025914 | Ga0207671_10460978 | Ga0207671_104609781 | 212 |
| 459 | 3300025915 | Ga0207693_10008904 | Ga0207693_100089043 | 212 |
| 460 | 3300025916 | Ga0207663_10035518 | Ga0207663_100355183 | 212 |
| 461 | 3300025917 | Ga0207660_10012093 | Ga0207660_100120935 | 212 |
| 462 | 3300025917 | Ga0207660_10082578 | Ga0207660_100825782 | 212 |
| 463 | 3300025918 | Ga0207662_10008159 | Ga0207662_100081595 | 212 |
| 464 | 3300025918 | Ga0207662_10470559 | Ga0207662_104705591 | 212 |
| 465 | 3300025919 | Ga0207657_10123999 | Ga0207657_101239992 | 212 |
| 466 | 3300025919 | Ga0207657_10191822 | Ga0207657_101918221 | 212 |
| 467 | 3300025920 | Ga0207649_10114862 | Ga0207649_101148622 | 212 |
| 468 | 3300025920 | Ga0207649_10209964 | Ga0207649_102099642 | 212 |
| 469 | 3300025921 | Ga0207652_10039347 | Ga0207652_100393474 | 212 |
| 470 | 3300025921 | Ga0207652_10212196 | Ga0207652_102121963 | 212 |
| 471 | 3300025923 | Ga0207681_10542577 | Ga0207681_105425771 | 212 |
| 472 | 3300025923 | Ga0207681_10620381 | Ga0207681_106203811 | 212 |
| 473 | 3300025925 | Ga0207650_10084230 | Ga0207650_100842303 | 212 |
| 474 | 3300025926 | Ga0207659_10170430 | Ga0207659_101704301 | 212 |
| 475 | 3300025927 | Ga0207687_10054726 | Ga0207687_100547262 | 212 |
| 476 | 3300025927 | Ga0207687_10284004 | Ga0207687_102840043 | 212 |
| 477 | 3300025928 | Ga0207700_10105873 | Ga0207700_101058732 | 212 |
| 478 | 3300025931 | Ga0207644_10425646 | Ga0207644_104256462 | 212 |
| 479 | 3300025932 | Ga0207690_10157301 | Ga0207690_101573013 | 212 |
| 480 | 3300025933 | Ga0207706_10055804 | Ga0207706_100558042 | 212 |
| 481 | 3300025934 | Ga0207686_10075143 | Ga0207686_100751432 | 212 |
| 482 | 3300025935 | Ga0207709_10042810 | Ga0207709_100428102 | 212 |
| 483 | 3300025935 | Ga0207709_10285314 | Ga0207709_102853142 | 212 |
| 484 | 3300025935 | Ga0207709_10352669 | Ga0207709_103526692 | 212 |
| 485 | 3300025935 | Ga0207709_10402308 | Ga0207709_104023083 | 212 |
| 486 | 3300025937 | Ga0207669_10007578 | Ga0207669_100075785 | 212 |
| 487 | 3300025937 | Ga0207669_10646277 | Ga0207669_106462771 | 212 |
| 488 | 3300025938 | Ga0207704_10175145 | Ga0207704_101751452 | 212 |
| 489 | 3300025938 | Ga0207704_10480685 | Ga0207704_104806851 | 212 |
| 490 | 3300025939 | Ga0207665_10082174 | Ga0207665_100821742 | 212 |
| 491 | 3300025939 | Ga0207665_10277525 | Ga0207665_102775252 | 212 |
| 492 | 3300025941 | Ga0207711_10053201 | Ga0207711_100532012 | 212 |
| 493 | 3300025941 | Ga0207711_10630343 | Ga0207711_106303431 | 212 |
| 494 | 3300025942 | Ga0207689_10022669 | Ga0207689_100226694 | 212 |
| 495 | 3300025942 | Ga0207689_10234012 | Ga0207689_102340122 | 212 |
| 496 | 3300025949 | Ga0207667_10131378 | Ga0207667_101313782 | 212 |
| 497 | 3300025960 | Ga0207651_10759464 | Ga0207651_107594641 | 212 |
| 498 | 3300025972 | Ga0207668_10164783 | Ga0207668_101647832 | 212 |
| 499 | 3300025972 | Ga0207668_10941376 | Ga0207668_109413761 | 212 |
| 500 | 3300025981 | Ga0207640_10394061 | Ga0207640_103940611 | 212 |
| 501 | 3300025986 | Ga0207658_10268560 | Ga0207658_102685602 | 212 |
| 502 | 3300025986 | Ga0207658_10512593 | Ga0207658_105125931 | 212 |
| 503 | 3300026035 | Ga0207703_10235556 | Ga0207703_102355562 | 212 |
| 504 | 3300026035 | Ga0207703_10282485 | Ga0207703_102824853 | 212 |
| 505 | 3300026041 | Ga0207639_10027145 | Ga0207639_100271454 | 212 |
| 506 | 3300026041 | Ga0207639_10093251 | Ga0207639_100932512 | 212 |
| 507 | 3300026041 | Ga0207639_10626122 | Ga0207639_106261221 | 212 |
| 508 | 3300026067 | Ga0207678_10002892 | Ga0207678_100028928 | 212 |
| 509 | 3300026067 | Ga0207678_10029216 | Ga0207678_100292163 | 212 |
| 510 | 3300026067 | Ga0207678_10030754 | Ga0207678_100307543 | 212 |
| 511 | 3300026067 | Ga0207678_10037726 | Ga0207678_100377264 | 212 |
| 512 | 3300026067 | Ga0207678_10057840 | Ga0207678_100578403 | 212 |
| 513 | 3300026067 | Ga0207678_10067852 | Ga0207678_100678523 | 212 |
| 514 | 3300026075 | Ga0207708_10066753 | Ga0207708_100667532 | 212 |
| 515 | 3300026075 | Ga0207708_10204076 | Ga0207708_102040761 | 212 |
| 516 | 3300026078 | Ga0207702_10271226 | Ga0207702_102712261 | 212 |
| 517 | 3300026088 | Ga0207641_10374025 | Ga0207641_103740252 | 212 |
| 518 | 3300026089 | Ga0207648_10014945 | Ga0207648_1001494510 | 212 |
| 519 | 3300026089 | Ga0207648_10030692 | Ga0207648_100306922 | 212 |
| 520 | 3300026089 | Ga0207648_10057117 | Ga0207648_100571174 | 212 |
| 521 | 3300026095 | Ga0207676_10030936 | Ga0207676_100309365 | 212 |
| 522 | 3300026095 | Ga0207676_10048747 | Ga0207676_100487473 | 212 |
| 523 | 3300026116 | Ga0207674_10026473 | Ga0207674_100264737 | 212 |
| 524 | 3300026116 | Ga0207674_10154323 | Ga0207674_101543233 | 212 |
| 525 | 3300026118 | Ga0207675_100034100 | Ga0207675_1000341004 | 212 |
| 526 | 3300026118 | Ga0207675_100069433 | Ga0207675_1000694332 | 212 |
| 527 | 3300026118 | Ga0207675_100392341 | Ga0207675_1003923412 | 212 |
| 528 | 3300026118 | Ga0207675_100709962 | Ga0207675_1007099622 | 212 |
| 529 | 3300026121 | Ga0207683_10021227 | Ga0207683_100212272 | 212 |
| 530 | 3300026121 | Ga0207683_10085803 | Ga0207683_100858034 | 212 |
| 531 | 3300026121 | Ga0207683_10539874 | Ga0207683_105398741 | 212 |
| 532 | 3300026121 | Ga0207683_10929522 | Ga0207683_109295221 | 212 |
| 533 | 3300026142 | Ga0207698_10045641 | Ga0207698_100456414 | 212 |
| 534 | 3300026142 | Ga0207698_10638719 | Ga0207698_106387192 | 212 |
| 535 | 3300027296 | Ga0209389_1000026 | Ga0209389_100002699 | 212 |
| 536 | 3300027296 | Ga0209389_1000117 | Ga0209389_100011730 | 212 |
| 537 | 3300027357 | Ga0209589_1000001 | Ga0209589_1000001185 | 212 |
| 538 | 3300027357 | Ga0209589_1000022 | Ga0209589_100002299 | 212 |
| 539 | 3300027361 | Ga0209489_100001 | Ga0209489_100001185 | 212 |
| 540 | 3300027361 | Ga0209489_100058 | Ga0209489_100058100 | 212 |
| 541 | 3300027361 | Ga0209489_102405 | Ga0209489_1024059 | 212 |
| 542 | 3300027363 | Ga0209700_100001 | Ga0209700_100001185 | 212 |
| 543 | 3300027363 | Ga0209700_100021 | Ga0209700_10002130 | 212 |
| 544 | 3300027671 | Ga0209588_1015760 | Ga0209588_10157602 | 212 |
| 545 | 3300027907 | Ga0207428_10000129 | Ga0207428_1000012963 | 212 |
| 546 | 3300028379 | Ga0268266_10008307 | Ga0268266_1000830710 | 212 |
| 547 | 3300028379 | Ga0268266_10083006 | Ga0268266_100830061 | 212 |
| 548 | 3300028379 | Ga0268266_10311719 | Ga0268266_103117191 | 212 |
| 549 | 3300028380 | Ga0268265_10200184 | Ga0268265_102001842 | 212 |
| 550 | 3300028380 | Ga0268265_10204654 | Ga0268265_102046541 | 212 |
| 551 | 3300033180 | Ga0307510_10065385 | Ga0307510_100653851 | 212 |
| 552 | 3300033442 | Ga0315911_1000010 | Ga0315911_1000010287 | 212 |
| 553 | 3300035241 | Ga0373961_0216258 | Ga0373961_0216258_21_659 | 212 |
| 554 | 3300035695 | Ga0373927_0010000 | Ga0373927_0010000_1905_2543 | 212 |
| 555 | 3300036401 | Ga0373937_1059467 | Ga0373937_1059467_109_747 | 212 |
| 556 | 3300037068 | Ga0373925_0032546 | Ga0373925_0032546_2778_3416 | 212 |
| 557 | 3300037418 | Ga0395900_0045800 | Ga0395900_0045800_277_987 | 212 |
| 558 | 3300037418 | Ga0395900_0053188 | Ga0395900_0053188_1872_2510 | 212 |
| 559 | 3300037466 | Ga0395898_0040300 | Ga0395898_0040300_1980_2690 | 212 |
| 560 | 3300037466 | Ga0395898_0073130 | Ga0395898_0073130_1631_2269 | 212 |
| 561 | 3300037466 | Ga0395898_0190561 | Ga0395898_0190561_429_1067 | 212 |
| 562 | 3300037466 | Ga0395898_0254629 | Ga0395898_0254629_151_966 | 212 |
| 563 | 3300037466 | Ga0395898_0260944 | Ga0395898_0260944_741_1379 | 212 |
| 564 | 3300037471 | Ga0395905_0129014 | Ga0395905_0129014_807_1445 | 212 |
| 565 | 3300037471 | Ga0395905_0163751 | Ga0395905_0163751_665_1303 | 212 |
| 566 | 3300037471 | Ga0395905_0216782 | Ga0395905_0216782_790_1428 | 212 |
| 567 | 3300038443 | Ga0395901_0032406 | Ga0395901_0032406_2602_3240 | 212 |
| 568 | 3300038443 | Ga0395901_0060239 | Ga0395901_0060239_2224_2862 | 212 |
| 569 | 3300038996 | Ga0242420_037387 | Ga0242420_037387_168_809 | 212 |
| 570 | 3300041486 | Ga0451807_0261817 | Ga0451807_0261817_171_809 | 212 |
| 571 | 3300041501 | Ga0451845_0753450 | Ga0451845_0753450_441_1079 | 212 |
| 572 | 3300044658 | Ga0466972_0000113 | Ga0466972_0000113_25241_25879 | 212 |
| 573 | 3300044683 | Ga0466965_0168816 | Ga0466965_0168816_97_735 | 212 |
| 574 | 3300044765 | Ga0466970_0058228 | Ga0466970_0058228_1191_1829 | 212 |
| 575 | 3300045049 | Ga0466959_0100592 | Ga0466959_0100592_1410_2048 | 212 |
| 576 | 3300045976 | Ga0466967_0761927 | Ga0466967_0761927_11_649 | 212 |
| 577 | 3300046455 | Ga0495603_0031711 | Ga0495603_0031711_1172_1813 | 212 |
| 578 | 3300046462 | Ga0495651_0317068 | Ga0495651_0317068_290_928 | 212 |
| 579 | 3300046491 | Ga0495584_0145729 | Ga0495584_0145729_428_1066 | 212 |
| 580 | 3300046492 | Ga0495585_0136118 | Ga0495585_0136118_239_877 | 212 |
| 581 | 3300046518 | Ga0495631_0170281 | Ga0495631_0170281_161_853 | 212 |
| 582 | 3300046523 | Ga0495644_0051561 | Ga0495644_0051561_430_1071 | 212 |
| 583 | 3300046523 | Ga0495644_0113701 | Ga0495644_0113701_173_874 | 212 |
| 584 | 3300046536 | Ga0495587_0027109 | Ga0495587_0027109_757_1395 | 212 |
| 585 | 3300046543 | Ga0495645_0419453 | Ga0495645_0419453_123_761 | 212 |
| 586 | 3300046615 | Ga0495656_0043353 | Ga0495656_0043353_998_1699 | 212 |
| 587 | 3300046615 | Ga0495656_0079764 | Ga0495656_0079764_113_754 | 212 |
| 588 | 3300046674 | Ga0495588_0134144 | Ga0495588_0134144_353_991 | 212 |
| 589 | 3300046678 | Ga0495599_0001619 | Ga0495599_0001619_8735_9373 | 212 |
| 590 | 3300046679 | Ga0495623_0089669 | Ga0495623_0089669_489_1127 | 212 |
| 591 | 3300046691 | Ga0495670_0137122 | Ga0495670_0137122_254_892 | 212 |
| 592 | 3300046692 | Ga0495671_0096101 | Ga0495671_0096101_421_1122 | 212 |
| 593 | 3300046692 | Ga0495671_0186238 | Ga0495671_0186238_76_714 | 212 |
| 594 | 3300046809 | Ga0495600_0184531 | Ga0495600_0184531_183_821 | 212 |
| 595 | 3300047317 | Ga0495604_0228605 | Ga0495604_0228605_277_915 | 212 |
| 596 | 3300047320 | Ga0495672_0052638 | Ga0495672_0052638_840_1481 | 212 |
| 597 | 3300047320 | Ga0495672_0229890 | Ga0495672_0229890_67_705 | 212 |
| 598 | 3300047322 | Ga0495680_0164016 | Ga0495680_0164016_455_1093 | 212 |
| 599 | 3300047444 | Ga0495675_0105846 | Ga0495675_0105846_715_1353 | 212 |
| 600 | 3300047472 | Ga0495686_0032571 | Ga0495686_0032571_1074_1712 | 212 |
| 601 | 3300047472 | Ga0495686_0122640 | Ga0495686_0122640_70_771 | 212 |
| 602 | 3300048088 | Ga0495602_0160909 | Ga0495602_0160909_162_800 | 212 |
| 603 | 3300048088 | Ga0495602_0395781 | Ga0495602_0395781_32_715 | 212 |
| 604 | 3300048903 | Ga0496100_0009755 | Ga0496100_0009755_1938_2579 | 212 |
| 605 | 3300048903 | Ga0496100_0090263 | Ga0496100_0090263_1154_1810 | 212 |
| 606 | 3300048903 | Ga0496100_0124975 | Ga0496100_0124975_95_733 | 212 |
| 607 | 3300048904 | Ga0496101_0014497 | Ga0496101_0014497_1176_1814 | 212 |
| 608 | 3300048904 | Ga0496101_0055564 | Ga0496101_0055564_1053_1691 | 212 |
| 609 | 3300048904 | Ga0496101_0149686 | Ga0496101_0149686_475_1116 | 212 |
| 610 | 3300048905 | Ga0496102_0004216 | Ga0496102_0004216_198_839 | 212 |
| 611 | 3300048905 | Ga0496102_0047752 | Ga0496102_0047752_2181_2819 | 212 |
| 612 | 3300048905 | Ga0496102_0215349 | Ga0496102_0215349_879_1517 | 212 |
| 613 | 3300048905 | Ga0496102_0265592 | Ga0496102_0265592_573_1211 | 212 |
| 614 | 3300048905 | Ga0496102_0319796 | Ga0496102_0319796_285_923 | 212 |
| 615 | 3300048906 | Ga0496103_0006073 | Ga0496103_0006073_5094_5732 | 212 |
| 616 | 3300048906 | Ga0496103_0011676 | Ga0496103_0011676_1572_2210 | 212 |
| 617 | 3300048906 | Ga0496103_0297598 | Ga0496103_0297598_36_677 | 212 |
| 618 | 3300048907 | Ga0496104_0035437 | Ga0496104_0035437_3373_4014 | 212 |
| 619 | 3300048907 | Ga0496104_0072721 | Ga0496104_0072721_1286_1963 | 212 |
| 620 | 3300048907 | Ga0496104_0988298 | Ga0496104_0988298_41_682 | 212 |
| 621 | 3300048908 | Ga0496105_0011994 | Ga0496105_0011994_540_1217 | 212 |
| 622 | 3300048908 | Ga0496105_0035363 | Ga0496105_0035363_2032_2670 | 212 |
| 623 | 3300048908 | Ga0496105_0192611 | Ga0496105_0192611_449_1090 | 212 |
| 624 | 3300048909 | Ga0496106_0009589 | Ga0496106_0009589_2693_3334 | 212 |
| 625 | 3300048909 | Ga0496106_0018599 | Ga0496106_0018599_4400_5038 | 212 |
| 626 | 3300048909 | Ga0496106_0138882 | Ga0496106_0138882_1020_1658 | 212 |
| 627 | 3300048910 | Ga0496107_0001367 | Ga0496107_0001367_9115_9756 | 212 |
| 628 | 3300048910 | Ga0496107_0029040 | Ga0496107_0029040_1869_2507 | 212 |
| 629 | 3300048910 | Ga0496107_0030734 | Ga0496107_0030734_308_946 | 212 |
| 630 | 3300048910 | Ga0496107_0326294 | Ga0496107_0326294_166_807 | 212 |
| 631 | 3300048910 | Ga0496107_0350657 | Ga0496107_0350657_87_725 | 212 |
| 632 | 3300048911 | Ga0496108_0338038 | Ga0496108_0338038_351_989 | 212 |
| 633 | 3300048912 | Ga0496109_0082403 | Ga0496109_0082403_2169_2807 | 212 |
| 634 | 3300048912 | Ga0496109_0300180 | Ga0496109_0300180_405_1046 | 212 |
| 635 | 3300048912 | Ga0496109_0333485 | Ga0496109_0333485_565_1242 | 212 |
| 636 | 3300048913 | Ga0496110_0008299 | Ga0496110_0008299_542_1183 | 212 |
| 637 | 3300048913 | Ga0496110_0030489 | Ga0496110_0030489_2194_2832 | 212 |
| 638 | 3300048914 | Ga0496111_0081741 | Ga0496111_0081741_185_823 | 212 |
| 639 | 3300048914 | Ga0496111_0375909 | Ga0496111_0375909_309_950 | 212 |
| 640 | 3300048915 | Ga0496112_0022256 | Ga0496112_0022256_1634_2311 | 212 |
| 641 | 3300048915 | Ga0496112_0048853 | Ga0496112_0048853_2315_2956 | 212 |
| 642 | 3300048915 | Ga0496112_0193766 | Ga0496112_0193766_181_819 | 212 |
| 643 | 3300048916 | Ga0496113_0020710 | Ga0496113_0020710_1524_2162 | 212 |
| 644 | 3300048916 | Ga0496113_0117289 | Ga0496113_0117289_93_797 | 212 |
| 645 | 3300048916 | Ga0496113_0448397 | Ga0496113_0448397_43_684 | 212 |
| 646 | 3300048917 | Ga0496114_0030373 | Ga0496114_0030373_431_1069 | 212 |
| 647 | 3300048917 | Ga0496114_0061607 | Ga0496114_0061607_1880_2518 | 212 |
| 648 | 3300048917 | Ga0496114_0245516 | Ga0496114_0245516_695_1336 | 212 |
| 649 | 3300048918 | Ga0496115_0013542 | Ga0496115_0013542_2112_2753 | 212 |
| 650 | 3300048918 | Ga0496115_0258584 | Ga0496115_0258584_143_781 | 212 |
| 651 | 3300048918 | Ga0496115_0318028 | Ga0496115_0318028_620_1258 | 212 |
| 652 | 3300048918 | Ga0496115_0321129 | Ga0496115_0321129_527_1165 | 212 |
| 653 | 3300048919 | Ga0496116_0085847 | Ga0496116_0085847_808_1446 | 212 |
| 654 | 3300048920 | Ga0496117_0039671 | Ga0496117_0039671_976_1614 | 212 |
| 655 | 3300048921 | Ga0496118_0018719 | Ga0496118_0018719_5283_5921 | 212 |
| 656 | 3300048921 | Ga0496118_0103004 | Ga0496118_0103004_931_1572 | 212 |
| 657 | 3300048922 | Ga0496119_0129755 | Ga0496119_0129755_43_681 | 212 |
| 658 | 3300048924 | Ga0496121_0001059 | Ga0496121_0001059_15773_16414 | 212 |
| 659 | 3300048924 | Ga0496121_0053408 | Ga0496121_0053408_150_788 | 212 |
| 660 | 3300048924 | Ga0496121_0116614 | Ga0496121_0116614_1367_2005 | 212 |
| 661 | 3300048924 | Ga0496121_0136549 | Ga0496121_0136549_241_882 | 212 |
| 662 | 3300048924 | Ga0496121_0175055 | Ga0496121_0175055_377_1015 | 212 |
| 663 | 3300048924 | Ga0496121_0296777 | Ga0496121_0296777_311_949 | 212 |
| 664 | 3300048924 | Ga0496121_0323802 | Ga0496121_0323802_385_1026 | 212 |
| 665 | 3300048926 | Ga0496123_0241306 | Ga0496123_0241306_228_866 | 212 |
| 666 | 3300048928 | Ga0496125_0006575 | Ga0496125_0006575_554_1192 | 212 |
| 667 | 3300048929 | Ga0496126_0001940 | Ga0496126_0001940_12768_13409 | 212 |
| 668 | 3300048929 | Ga0496126_0003509 | Ga0496126_0003509_2513_3244 | 212 |
| 669 | 3300048929 | Ga0496126_0300323 | Ga0496126_0300323_217_858 | 212 |
| 670 | 3300048929 | Ga0496126_0487507 | Ga0496126_0487507_14_652 | 212 |
| 671 | 3300049569 | Ga0501032_0027862 | Ga0501032_0027862_3025_3663 | 212 |
| 672 | 3300049570 | Ga0501033_0002631 | Ga0501033_0002631_2920_3558 | 212 |
| 673 | 3300049571 | Ga0501034_0015233 | Ga0501034_0015233_3095_3733 | 212 |
| 674 | 3300049572 | Ga0501036_0001868 | Ga0501036_0001868_4809_5447 | 212 |
| 675 | 3300049573 | Ga0501037_0005101 | Ga0501037_0005101_2265_2903 | 212 |
| 676 | 3300049574 | Ga0501038_0000276 | Ga0501038_0000276_10554_11192 | 212 |
| 677 | 3300049575 | Ga0501039_0009202 | Ga0501039_0009202_2300_2938 | 212 |
| 678 | 3300049579 | Ga0501043_0003013 | Ga0501043_0003013_9213_9851 | 212 |
| 679 | 3300049580 | Ga0501046_0011595 | Ga0501046_0011595_3930_4568 | 212 |
| 680 | 3300049581 | Ga0501047_0014333 | Ga0501047_0014333_4061_4699 | 212 |
| 681 | 3300049581 | Ga0501047_0111567 | Ga0501047_0111567_728_1366 | 212 |
| 682 | 3300049582 | Ga0501048_0038426 | Ga0501048_0038426_1137_1775 | 212 |
| 683 | 3300049583 | Ga0501067_0002106 | Ga0501067_0002106_8265_8903 | 212 |
| 684 | 3300049584 | Ga0501068_0024578 | Ga0501068_0024578_96_734 | 212 |
| 685 | 3300049585 | Ga0501069_0000483 | Ga0501069_0000483_2855_3493 | 212 |
| 686 | 3300049586 | Ga0501070_0003133 | Ga0501070_0003133_2216_2854 | 212 |
| 687 | 3300049586 | Ga0501070_0056921 | Ga0501070_0056921_180_818 | 212 |
| 688 | 3300049587 | Ga0501071_0188296 | Ga0501071_0188296_848_1486 | 212 |
| 689 | 3300049588 | Ga0501072_0242658 | Ga0501072_0242658_617_1255 | 212 |
| 690 | 3300049589 | Ga0501073_0000456 | Ga0501073_0000456_2614_3252 | 212 |
| 691 | 3300049589 | Ga0501073_0198737 | Ga0501073_0198737_53_691 | 212 |
| 692 | 3300049590 | Ga0501074_0023481 | Ga0501074_0023481_1231_1869 | 212 |
| 693 | 3300049742 | Ga0501080_0001321 | Ga0501080_0001321_13401_14039 | 212 |
| 694 | 3300049742 | Ga0501080_0144322 | Ga0501080_0144322_869_1507 | 212 |
| 695 | 3300049744 | Ga0501083_0351282 | Ga0501083_0351282_101_739 | 212 |
| 696 | 3300049822 | Ga0501035_0015892 | Ga0501035_0015892_2666_3304 | 212 |
| 697 | 3300049822 | Ga0501035_0494539 | Ga0501035_0494539_110_748 | 212 |
| 698 | 3300049823 | Ga0501044_0018935 | Ga0501044_0018935_4560_5198 | 212 |
| 699 | 3300049823 | Ga0501044_0021138 | Ga0501044_0021138_4554_5192 | 212 |
| 700 | 3300050490 | nmdc:mga03n38_177140_c1 | nmdc:mga03n38_177140_c1_422_1063 | 212 |
| 701 | 3300050490 | nmdc:mga03n38_314650_c1 | nmdc:mga03n38_314650_c1_166_807 | 212 |
| 702 | 3300050491 | nmdc:mga00v17_143315_c1 | nmdc:mga00v17_143315_c1_605_1246 | 212 |
| 703 | 3300050492 | nmdc:mga0yw44_3788_c1 | nmdc:mga0yw44_3788_c1_4987_5643 | 212 |
| 704 | 3300050493 | nmdc:mga0k408_33235_c1 | nmdc:mga0k408_33235_c1_1735_2373 | 212 |
| 705 | 3300050494 | nmdc:mga06z11_15070_c1 | nmdc:mga06z11_15070_c1_1579_2235 | 212 |
| 706 | 3300050494 | nmdc:mga06z11_494833_c1 | nmdc:mga06z11_494833_c1_35_700 | 212 |
| 707 | 3300050495 | nmdc:mga04h51_82215_c1 | nmdc:mga04h51_82215_c1_132_773 | 212 |
| 708 | 3300050496 | nmdc:mga07m45_69583_c1 | nmdc:mga07m45_69583_c1_482_1123 | 212 |
| 709 | 3300050496 | nmdc:mga07m45_76928_c1 | nmdc:mga07m45_76928_c1_924_1565 | 212 |
| 710 | 3300050496 | nmdc:mga07m45_87906_c1 | nmdc:mga07m45_87906_c1_354_995 | 212 |
| 711 | 3300050511 | nmdc:mga08y16_41292_c1 | nmdc:mga08y16_41292_c1_1302_1943 | 212 |
| 712 | 3300050511 | nmdc:mga08y16_51_c1 | nmdc:mga08y16_51_c1_32950_33591 | 212 |
| 713 | 3300050512 | nmdc:mga0n895_142219_c1 | nmdc:mga0n895_142219_c1_1693_2334 | 212 |
| 714 | 3300050512 | nmdc:mga0n895_608606_c1 | nmdc:mga0n895_608606_c1_219_857 | 212 |
| 715 | 3300050514 | nmdc:mga08x19_199733_c1 | nmdc:mga08x19_199733_c1_633_1274 | 212 |
| 716 | 3300050516 | nmdc:mga0sz30_91851_c1 | nmdc:mga0sz30_91851_c1_630_1271 | 212 |
| 717 | 3300053077 | Ga0495601_0472849 | Ga0495601_0472849_56_694 | 212 |
| 718 | 3300053080 | Ga0500635_0089368 | Ga0500635_0089368_76_717 | 212 |
| 719 | 3300053083 | Ga0495655_0006222 | Ga0495655_0006222_182_820 | 212 |
| 720 | 3300053085 | Ga0495619_0306840 | Ga0495619_0306840_441_1079 | 212 |
| 721 | 3300053086 | Ga0500578_0181510 | Ga0500578_0181510_62_703 | 212 |
| 722 | 3300053094 | Ga0500566_0001043 | Ga0500566_0001043_7323_7961 | 212 |
| 723 | 3300053119 | Ga0500595_000280 | Ga0500595_000280_982_1620 | 212 |
| 724 | 3300053119 | Ga0500595_004922 | Ga0500595_004922_2497_3135 | 212 |
| 725 | 3300053139 | Ga0500568_0060320 | Ga0500568_0060320_305_946 | 212 |
| 726 | 3300053150 | Ga0500603_000163 | Ga0500603_000163_5332_5973 | 212 |
| 727 | 3300053150 | Ga0500603_021371 | Ga0500603_021371_767_1408 | 212 |
| 728 | 3300053177 | Ga0500636_0042997 | Ga0500636_0042997_1098_1739 | 212 |
| 729 | 3300053178 | Ga0500637_0000178 | Ga0500637_0000178_5292_5933 | 212 |
| 730 | 3300060353 | Ga0501082_0075174 | Ga0501082_0075174_101_739 | 212 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6dk9-assembly4.cif.gz_F | yeast ddi2 cyanamide hydratase | 0.8218 | 8 | 197 |
| 6dkd-assembly2.cif.gz_C | yeast ddi2 cyanamide hydratase | 0.8155 | 8 | 197 |
| 6dka-assembly4.cif.gz_F | yeast ddi2 cyanamide hydratase | 0.7934 | 1 | 199 |
| 6dka-assembly4.cif.gz_F | yeast ddi2 cyanamide hydratase | 0.7454 | 1 | 199 |
| 6dk9-assembly4.cif.gz_F | yeast ddi2 cyanamide hydratase | 0.7383 | 8 | 197 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0CH63_33_194_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.9116 | 12 | 168 | 1.10.3210.10 |
| af_P0CH63_33_194_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.8798 | 12 | 168 | 1.10.3210.10 |
| af_P9WN29_336_562_1.10.3090.10 | Mainly Alpha;Orthogonal Bundle;cca-adding enzyme, domain 2;cca-adding enzyme, domain 2 | 0.5803 | 18 | 151 | 1.10.3090.10 |
| af_Q58188_1_153_1.10.3210.10 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 | 0.5691 | 17 | 163 | 1.10.3210.10 |
| af_Q86JB3_16_237_1.10.3210.50 | Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432; | 0.5686 | 13 | 180 | 1.10.3210.50 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V8JKF7-F1-model_v4 | HD domain-containing protein | 0.9893 | 1 | 104 |
|
| AF-A0A512JR07-F1-model_v4 | HD domain-containing protein | 0.9887 | 1 | 106 |
|
| AF-A0A0H3KS96-F1-model_v4 | Metal-dependent phosphohydrolase | 0.9881 | 1 | 187 |
|
| AF-A0A8B4XTV5-F1-model_v4 | deleted | 0.987 | 1 | 153 |
|
| AF-A0A6P3C0E7-F1-model_v4 | deleted | 0.9864 | 1 | 110 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar