F477915

General Info

Members Datasets Scaffolds Average Seq Length
730 414 636 212

Family's Representative Sequence

Representative Sequence 3300009551|Ga0105238_10527044|Ga0105238_105270441
Length 258
Sequence MALFYDQAQRIYSLTPATGSPDASGFVGAPVNADSADRRHGGRSSTMADILSGIKIPDSKIAREAAELVRQHETEMLYNHSVRVFVFGAMKGNRQNLKFDSELLYVAALFHDLGLVEAYHTDKKRFEVDGADAAREFLRSRGIPAPKADLVWEAIALHTTPGIPQYMRPEIALTNAGVLVDVVGIGYDEYTPEQRDHVIAAFPRGDFKNEMLQLQTCSALKKPQTTFGTVNFDYIQEHDPTFHRPNACTRIRNAPWHT

Samples

Sample ID Description Type Environment
1 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
2 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
3 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
4 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
5 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
6 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
7 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
8 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
9 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
10 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
11 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
12 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
13 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
14 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
15 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
16 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
17 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
18 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
19 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
20 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
21 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
22 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
23 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
24 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
25 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
26 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
27 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
28 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
29 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
30 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
31 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
32 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
33 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
34 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
35 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
36 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
37 2904699407
38 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
39 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
40 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
41 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
42 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
43 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
44 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
45 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
46 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
47 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
48 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
49 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
50 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
51 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
52 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
53 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
54 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
55 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
56 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
57 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
58 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
59 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
60 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
61 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
62 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
63 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
64 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
65 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
66 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
67 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
68 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
69 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
70 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
71 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
72 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
73 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
74 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
75 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
76 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
77 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
78 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
79 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
80 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
81 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
82 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
83 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
84 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
85 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
86 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
87 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
88 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
89 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
90 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
91 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
92 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
93 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
94 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
95 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
96 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
97 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
98 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
99 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
100 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
101 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
102 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
103 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
104 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
105 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
106 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
107 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
108 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
109 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
110 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
111 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
112 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
113 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
114 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
115 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
116 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
117 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
118 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
119 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
120 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
121 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
122 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
123 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
124 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
125 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
126 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
127 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
128 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
129 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
130 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
131 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
132 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
133 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
134 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
135 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
136 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
137 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
138 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
139 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
140 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
141 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
142 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
143 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
144 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
145 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
146 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
147 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
148 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
149 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
150 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
151 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
152 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
153 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
154 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
155 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
156 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
157 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
158 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
159 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
160 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
161 3300006941 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW Metagenome Nodule
162 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
163 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
164 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
165 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
166 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
167 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
168 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
169 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
170 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
171 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
172 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
173 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
174 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
175 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
176 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
177 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
178 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
179 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
180 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
181 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
182 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
183 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
184 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
185 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
186 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
187 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
188 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
189 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
190 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
191 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
192 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
193 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
194 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
195 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
196 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
197 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
198 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
199 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
200 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
201 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
216 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
217 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
221 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
223 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
225 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
226 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
228 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
229 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
230 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
231 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
232 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
233 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
234 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
236 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
238 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
239 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
240 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
241 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
242 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
243 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
244 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
245 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
246 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
247 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
248 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
249 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
250 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
251 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
252 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
253 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
254 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
255 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
256 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
257 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
258 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
259 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
260 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
261 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
262 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
263 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
264 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
265 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
266 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
267 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
268 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
269 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
270 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
271 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
272 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
273 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
277 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
280 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
281 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
282 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
283 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
284 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
285 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
286 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
287 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
288 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
289 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
290 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
291 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
292 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
293 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
294 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
295 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
296 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
297 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
298 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
299 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
300 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
301 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
302 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
303 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
304 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
305 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
306 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
307 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
308 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
309 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
312 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
313 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
314 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
315 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
316 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
317 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
318 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
319 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
336 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
337 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
338 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
341 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
342 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
343 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
344 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
345 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
355 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
356 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
357 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
358 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
359 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
360 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
361 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
362 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
363 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
364 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
365 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
366 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
367 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
368 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
369 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
370 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
371 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
372 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
376 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
379 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
380 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
381 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
382 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
383 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
384 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
385 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
388 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
389 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
390 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
391 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
392 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
393 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
394 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
395 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
396 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
397 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
398 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
399 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
400 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
401 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
402 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
403 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
404 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
405 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
406 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
407 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
408 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
409 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
410 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
411 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
412 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
413 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
414 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.24
Metatranscriptomes 0
Isolates 12.76

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.77
Nodule 11.64
Rhizoplane 7.26
Rhizosphere 64.11
Stem 0
Stem Tuber 0
Unclassified 8.22

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24737J22298_10107068 3300001990 Bacteria 828
2 JGI24750J21931_1004884 3300002070 Bacteria 1637
3 JGI24738J21930_10020092 3300002075 Bacteria 1389
4 JGI24033J26618_1006218 3300002155 Bacteria 1335
5 JGI24742J22300_10015119 3300002244 Bacteria 1298
6 JGI24751J29686_10040913 3300002459 Bacteria 959
7 rootH2_10074383 3300003320 Bacteria 1822
8 rootH2_10130837 3300003320 Bacteria 1220
9 rootL2_10062248 3300003322 Bacteria 3582
10 rootH1_10064064 3300003323 Bacteria 2186
11 JGI25160J50197_1000939 3300003354 Bacteria 15302
12 JGI25160J50197_1007045 3300003354 Bacteria 4450
13 JGI25404J52841_10001673 3300003659 Bacteria 3987
14 JGI25404J52841_10031415 3300003659 Bacteria 1134
15 JGI25404J52841_10032676 3300003659 Bacteria 1109
16 Ga0070683_100116211 3300005329 Bacteria 2526
17 Ga0070690_100043163 3300005330 Bacteria 2858
18 Ga0070670_100208275 3300005331 Bacteria 1700
19 Ga0068869_100244492 3300005334 Bacteria 1431
20 Ga0070666_10400576 3300005335 Bacteria 987
21 Ga0070680_100041868 3300005336 Bacteria 3714
22 Ga0070680_100060330 3300005336 Bacteria 3104
23 Ga0070680_100219358 3300005336 Bacteria 1605
24 Ga0070682_100009270 3300005337 Bacteria 5569
25 Ga0070682_100214163 3300005337 Bacteria 1367
26 Ga0068868_100281102 3300005338 Bacteria 1409
27 Ga0068868_100734712 3300005338 Bacteria 886
28 Ga0070660_100242569 3300005339 Bacteria 1468
29 Ga0070660_100301395 3300005339 Bacteria 1314
30 Ga0070660_100314071 3300005339 Bacteria 1286
31 Ga0070689_100408622 3300005340 Bacteria 1149
32 Ga0070691_10034083 3300005341 Bacteria 2396
33 Ga0070687_100018996 3300005343 Bacteria 3190
34 Ga0070687_100421073 3300005343 Bacteria 881
35 Ga0070661_100165102 3300005344 Bacteria 1679
36 Ga0070661_100166898 3300005344 Bacteria 1670
37 Ga0070661_100604888 3300005344 Bacteria 887
38 Ga0070692_10129604 3300005345 Bacteria 1416
39 Ga0070668_100048385 3300005347 Bacteria 3269
40 Ga0070668_100292214 3300005347 Bacteria 1364
41 Ga0070668_100298501 3300005347 Bacteria 1350
42 Ga0070669_100270337 3300005353 Bacteria 1359
43 Ga0070675_100407150 3300005354 Bacteria 1214
44 Ga0070674_100040883 3300005356 Bacteria 3138
45 Ga0070674_100053157 3300005356 Bacteria 2795
46 Ga0070674_100107375 3300005356 Bacteria 2044
47 Ga0070673_100640014 3300005364 Bacteria 972
48 Ga0070673_100998978 3300005364 Bacteria 779
49 Ga0070659_100112303 3300005366 Bacteria 2200
50 Ga0070667_100100750 3300005367 Bacteria 2495
51 Ga0070709_10143753 3300005434 Bacteria 1641
52 Ga0070714_100537569 3300005435 Bacteria 1118
53 Ga0070713_100219925 3300005436 Bacteria 1722
54 Ga0070713_100330137 3300005436 Bacteria 1411
55 Ga0070701_10069955 3300005438 Bacteria 1874
56 Ga0070711_100331408 3300005439 Bacteria 1218
57 Ga0070700_100434039 3300005441 Bacteria 995
58 Ga0070694_100045595 3300005444 Bacteria 2939
59 Ga0070663_100005431 3300005455 Bacteria 7568
60 Ga0070663_100020805 3300005455 Bacteria 4349
61 Ga0070663_100084590 3300005455 Bacteria 2339
62 Ga0070663_100097128 3300005455 Bacteria 2193
63 Ga0070663_100536002 3300005455 Bacteria 977
64 Ga0070678_100017758 3300005456 Bacteria 4589
65 Ga0070678_100071528 3300005456 Bacteria 2597
66 Ga0070678_100345671 3300005456 Bacteria 1277
67 Ga0070678_100908899 3300005456 Unclassified 805
68 Ga0070662_100095037 3300005457 Bacteria 2245
69 Ga0070681_10017681 3300005458 Bacteria 7126
70 Ga0070681_10069696 3300005458 Bacteria 3483
71 Ga0070681_10282827 3300005458 Bacteria 1569
72 Ga0068867_100030517 3300005459 Bacteria 3888
73 Ga0068867_100826684 3300005459 Bacteria 828
74 Ga0070685_10063225 3300005466 Bacteria 2173
75 Ga0070679_100016988 3300005530 Bacteria 7035
76 Ga0070679_100044869 3300005530 Bacteria 4404
77 Ga0070679_100069731 3300005530 Bacteria 3507
78 Ga0070684_100233687 3300005535 Bacteria 1679
79 Ga0070684_100249910 3300005535 Bacteria 1621
80 Ga0070684_100334780 3300005535 Bacteria 1391
81 Ga0070684_100760460 3300005535 Bacteria 905
82 Ga0070684_100844673 3300005535 Bacteria 857
83 Ga0068853_100018490 3300005539 Bacteria 5769
84 Ga0068853_100464347 3300005539 Bacteria 1192
85 Ga0070672_100186361 3300005543 Bacteria 1731
86 Ga0070686_100526683 3300005544 Bacteria 921
87 Ga0070696_100787895 3300005546 Unclassified 782
88 Ga0070693_100015017 3300005547 Bacteria 3982
89 Ga0070693_100076947 3300005547 Bacteria 1979
90 Ga0070693_100146537 3300005547 Bacteria 1491
91 Ga0070665_100048897 3300005548 Bacteria 4245
92 Ga0070665_100055188 3300005548 Bacteria 3984
93 Ga0070665_100070629 3300005548 Bacteria 3499
94 Ga0070665_100160167 3300005548 Bacteria 2252
95 Ga0070665_100321188 3300005548 Bacteria 1552
96 Ga0070665_100665320 3300005548 Bacteria 1054
97 Ga0070704_100159546 3300005549 Bacteria 1782
98 Ga0068855_100005078 3300005563 Bacteria 16046
99 Ga0068855_100296290 3300005563 Bacteria 1792
100 Ga0068857_100023890 3300005577 Bacteria 5380
101 Ga0068857_100132484 3300005577 Bacteria 2249
102 Ga0068857_100625539 3300005577 Bacteria 1019
103 Ga0068854_100243639 3300005578 Bacteria 1433
104 Ga0068856_100512913 3300005614 Bacteria 1220
105 Ga0068856_100789106 3300005614 Bacteria 970
106 Ga0068856_101322473 3300005614 Bacteria 736
107 Ga0070702_100004976 3300005615 Bacteria 6136
108 Ga0070702_100023926 3300005615 Bacteria 3252
109 Ga0068852_100066913 3300005616 Bacteria 3140
110 Ga0068852_100089288 3300005616 Bacteria 2754
111 Ga0068859_100845111 3300005617 Bacteria 1002
112 Ga0068864_100005000 3300005618 Bacteria 10864
113 Ga0068864_100723550 3300005618 Bacteria 974
114 Ga0068866_10027650 3300005718 Bacteria 2694
115 Ga0068866_10027887 3300005718 Bacteria 2685
116 Ga0068866_10123683 3300005718 Bacteria 1461
117 Ga0068861_100018438 3300005719 Bacteria 4972
118 Ga0068861_100055317 3300005719 Bacteria 3025
119 Ga0068861_100323532 3300005719 Bacteria 1344
120 Ga0068851_10533028 3300005834 Bacteria 708
121 Ga0068870_10006058 3300005840 Bacteria 5313
122 Ga0068863_100476236 3300005841 Bacteria 1227
123 Ga0068863_100843740 3300005841 Bacteria 915
124 Ga0068858_100330261 3300005842 Bacteria 1458
125 Ga0068858_100361851 3300005842 Bacteria 1390
126 Ga0068860_100039612 3300005843 Bacteria 4507
127 Ga0068860_100200490 3300005843 Bacteria 1933
128 Ga0068860_100458229 3300005843 Bacteria 1268
129 Ga0068862_100063580 3300005844 Bacteria 3175
130 Ga0068862_100466603 3300005844 Bacteria 1193
131 Ga0068862_100758361 3300005844 Bacteria 945
132 Ga0081455_10014623 3300005937 Bacteria 7679
133 Ga0081540_1000809 3300005983 Bacteria 28697
134 Ga0081540_1000996 3300005983 Bacteria 25476
135 Ga0081540_1013314 3300005983 Bacteria 5354
136 Ga0081540_1013715 3300005983 Bacteria 5253
137 Ga0081540_1015135 3300005983 Bacteria 4896
138 Ga0081540_1054853 3300005983 Bacteria 1945
139 Ga0070717_10527311 3300006028 Bacteria 1069
140 Ga0075365_10236226 3300006038 Bacteria 1284
141 Ga0075368_10029727 3300006042 Bacteria 2113
142 Ga0075363_100037306 3300006048 Bacteria 2552
143 Ga0075363_100157225 3300006048 Bacteria 1286
144 Ga0075363_100291976 3300006048 Bacteria 945
145 Ga0075364_10143805 3300006051 Bacteria 1605
146 Ga0070716_100039861 3300006173 Bacteria 2609
147 Ga0070716_100095573 3300006173 Bacteria 1809
148 Ga0070712_100029064 3300006175 Bacteria 3703
149 Ga0070712_100137553 3300006175 Bacteria 1859
150 Ga0075367_10053123 3300006178 Bacteria 2400
151 Ga0075367_10211924 3300006178 Bacteria 1211
152 Ga0075369_10174963 3300006186 Bacteria 987
153 Ga0097621_100092686 3300006237 Bacteria 2531
154 Ga0097621_100560237 3300006237 Bacteria 1041
155 Ga0075370_10045857 3300006353 Bacteria 2473
156 Ga0075370_10049859 3300006353 Bacteria 2374
157 Ga0075370_10196213 3300006353 Bacteria 1190
158 Ga0068871_100025883 3300006358 Bacteria 4571
159 Ga0068871_100221731 3300006358 Bacteria 1638
160 Ga0068871_100498804 3300006358 Bacteria 1097
161 Ga0068871_100851972 3300006358 Bacteria 842
162 Ga0075433_11160673 3300006852 Bacteria 671
163 Ga0075434_100034971 3300006871 Bacteria 4966
164 Ga0075434_100726951 3300006871 Bacteria 1010
165 Ga0075434_100862133 3300006871 Bacteria 921
166 Ga0068865_100012377 3300006881 Bacteria 5368
167 Ga0068865_100210503 3300006881 Bacteria 1515
168 Ga0075436_100214521 3300006914 Bacteria 1365
169 Ga0097620_100845062 3300006931 Bacteria 1002
170 Ga0099825_1034652 3300006941 Bacteria 1862
171 Ga0099824_1002487 3300006942 Bacteria 26950
172 Ga0099824_1005150 3300006942 Bacteria 18530
173 Ga0099822_1001480 3300006943 Bacteria 27484
174 Ga0099823_1008083 3300006944 Bacteria 10710
175 Ga0099794_10046610 3300007265 Bacteria 2077
176 Ga0105240_10008605 3300009093 Bacteria 14585
177 Ga0105240_10048479 3300009093 Bacteria 5368
178 Ga0105240_10377799 3300009093 Bacteria 1601
179 Ga0111539_10000616 3300009094 Bacteria 46125
180 Ga0111539_10193578 3300009094 Bacteria 2372
181 Ga0105245_10040936 3300009098 Bacteria 4129
182 Ga0105245_10139293 3300009098 Bacteria 2283
183 Ga0105245_10158379 3300009098 Bacteria 2147
184 Ga0105247_10024077 3300009101 Bacteria 3666
185 Ga0105247_10744171 3300009101 Bacteria 742
186 Ga0105243_10018891 3300009148 Bacteria 5226
187 Ga0105241_10009222 3300009174 Bacteria 7257
188 Ga0105241_10329500 3300009174 Bacteria 1319
189 Ga0105242_10032372 3300009176 Bacteria 4180
190 Ga0105242_10378861 3300009176 Bacteria 1314
191 Ga0105242_10458443 3300009176 Bacteria 1203
192 Ga0105248_10123415 3300009177 Bacteria 2921
193 Ga0105248_10356079 3300009177 Bacteria 1648
194 Ga0105248_10362260 3300009177 Bacteria 1632
195 Ga0105237_10038493 3300009545 Bacteria 4829
196 Ga0105237_10058065 3300009545 Bacteria 3872
197 Ga0105237_10110791 3300009545 Bacteria 2737
198 Ga0105237_10189312 3300009545 Bacteria 2058
199 Ga0105237_10812505 3300009545 Bacteria 942
200 Ga0105238_10063814 3300009551 Bacteria 3684
201 Ga0105238_10075141 3300009551 Bacteria 3371
202 Ga0105238_10213193 3300009551 Bacteria 1907
203 Ga0105238_10460208 3300009551 Bacteria 1270
204 Ga0105238_10495711 3300009551 Bacteria 1222
205 Ga0105238_10527044 3300009551 Bacteria 1184
206 Ga0105249_10079419 3300009553 Bacteria 3045
207 Ga0105249_10704280 3300009553 Bacteria 1070
208 Ga0105239_10037978 3300010375 Bacteria 5277
209 Ga0105239_10081722 3300010375 Bacteria 3557
210 Ga0105239_10103271 3300010375 Bacteria 3155
211 Ga0105239_10580628 3300010375 Bacteria 1278
212 Ga0105239_10765632 3300010375 Bacteria 1105
213 Ga0105246_10020940 3300011119 Bacteria 4200
214 Ga0105246_10043743 3300011119 Bacteria 3040
215 Ga0105246_10351677 3300011119 Bacteria 1208
216 Ga0105246_10607995 3300011119 Bacteria 946
217 Ga0157370_10018913 3300013104 Bacteria 6927
218 Ga0157370_10113527 3300013104 Bacteria 2532
219 Ga0157369_10002208 3300013105 Bacteria 23445
220 Ga0157369_10005932 3300013105 Bacteria 14188
221 Ga0157369_10129466 3300013105 Bacteria 2675
222 Ga0157369_10890353 3300013105 Bacteria 913
223 Ga0157374_10017728 3300013296 Bacteria 6275
224 Ga0157374_10075411 3300013296 Bacteria 3187
225 Ga0157374_10286184 3300013296 Bacteria 1628
226 Ga0157374_10657183 3300013296 Bacteria 1060
227 Ga0157378_10034557 3300013297 Bacteria 4470
228 Ga0157378_10088682 3300013297 Bacteria 2807
229 Ga0157378_10202460 3300013297 Bacteria 1878
230 Ga0157378_10255666 3300013297 Bacteria 1679
231 Ga0157378_10476591 3300013297 Bacteria 1243
232 Ga0163162_10189605 3300013306 Bacteria 2183
233 Ga0163162_10194870 3300013306 Bacteria 2154
234 Ga0163162_10238263 3300013306 Bacteria 1950
235 Ga0163162_10279544 3300013306 Bacteria 1801
236 Ga0163162_11405756 3300013306 Bacteria 794
237 Ga0157372_10025495 3300013307 Bacteria 6430
238 Ga0157372_10141634 3300013307 Bacteria 2771
239 Ga0157375_10024985 3300013308 Bacteria 5541
240 Ga0157375_10364530 3300013308 Bacteria 1611
241 Ga0157375_10577411 3300013308 Bacteria 1285
242 Ga0157375_10688017 3300013308 Bacteria 1177
243 Ga0157375_11130558 3300013308 Bacteria 917
244 Ga0163163_10020992 3300014325 Bacteria 6159
245 Ga0163163_10065770 3300014325 Bacteria 3600
246 Ga0157380_10067985 3300014326 Bacteria 2870
247 Ga0157380_10229846 3300014326 Bacteria 1665
248 Ga0157380_10635009 3300014326 Bacteria 1062
249 Ga0157380_10724726 3300014326 Bacteria 1002
250 Ga0157377_10188014 3300014745 Bacteria 1303
251 Ga0157379_10049822 3300014968 Bacteria 3739
252 Ga0157379_10116176 3300014968 Bacteria 2406
253 Ga0157376_10184631 3300014969 Bacteria 1908
254 Ga0157376_10454401 3300014969 Bacteria 1250
255 Ga0163161_10019274 3300017792 Bacteria 4784
256 Ga0163161_10201308 3300017792 Bacteria 1535
257 Ga0214542_1000002 3300021321 Bacteria 720798
258 Ga0214545_1000002 3300021324 Bacteria 727485
259 Ga0214543_1000013 3300021327 Bacteria 329117
260 Ga0209677_103741 3300025253 Bacteria 4753
261 Ga0209673_1040492 3300025273 Bacteria 1332
262 Ga0209130_1000672 3300025284 Bacteria 31000
263 Ga0209564_1002754 3300025295 Bacteria 13209
264 Ga0209758_1001375 3300025297 Bacteria 29007
265 Ga0207426_1000331 3300025302 Bacteria 89838
266 Ga0207426_1000577 3300025302 Bacteria 49128
267 Ga0207697_10026545 3300025315 Bacteria 2368
268 Ga0207697_10091416 3300025315 Bacteria 1290
269 Ga0207642_10329531 3300025899 Bacteria 894
270 Ga0207710_10069744 3300025900 Bacteria 1610
271 Ga0207710_10287364 3300025900 Bacteria 829
272 Ga0207688_10006895 3300025901 Bacteria 6182
273 Ga0207688_10118914 3300025901 Bacteria 1540
274 Ga0207688_10185248 3300025901 Bacteria 1243
275 Ga0207680_10165370 3300025903 Bacteria 1486
276 Ga0207647_10015001 3300025904 Bacteria 5326
277 Ga0207647_10016497 3300025904 Bacteria 5040
278 Ga0207647_10080046 3300025904 Bacteria 1960
279 Ga0207699_10090954 3300025906 Bacteria 1915
280 Ga0207645_10069204 3300025907 Bacteria 2258
281 Ga0207645_10124253 3300025907 Bacteria 1677
282 Ga0207643_10003065 3300025908 Bacteria 8982
283 Ga0207705_10168133 3300025909 Bacteria 1650
284 Ga0207705_10176843 3300025909 Bacteria 1609
285 Ga0207654_10070847 3300025911 Bacteria 2071
286 Ga0207654_10153821 3300025911 Bacteria 1479
287 Ga0207707_10008176 3300025912 Bacteria 9077
288 Ga0207707_10056244 3300025912 Plasmid 3423
289 Ga0207707_10060266 3300025912 Bacteria 3302
290 Ga0207695_10052552 3300025913 Bacteria 4267
291 Ga0207695_10104080 3300025913 Bacteria 2829
292 Ga0207695_10686852 3300025913 Bacteria 904
293 Ga0207671_10155741 3300025914 Bacteria 1767
294 Ga0207671_10328540 3300025914 Bacteria 1211
295 Ga0207671_10460978 3300025914 Bacteria 1013
296 Ga0207693_10008904 3300025915 Bacteria 8199
297 Ga0207663_10035518 3300025916 Bacteria 2991
298 Ga0207660_10012093 3300025917 Bacteria 5642
299 Ga0207660_10082578 3300025917 Bacteria 2364
300 Ga0207660_10149059 3300025917 Bacteria 1796
301 Ga0207660_10177074 3300025917 Bacteria 1654
302 Ga0207662_10008159 3300025918 Bacteria 5725
303 Ga0207662_10470559 3300025918 Bacteria 862
304 Ga0207657_10123999 3300025919 Bacteria 2123
305 Ga0207657_10191822 3300025919 Bacteria 1648
306 Ga0207649_10114862 3300025920 Bacteria 1805
307 Ga0207649_10209964 3300025920 Bacteria 1380
308 Ga0207652_10039347 3300025921 Bacteria 4013
309 Ga0207652_10094643 3300025921 Bacteria 2631
310 Ga0207652_10139022 3300025921 Bacteria 2171
311 Ga0207652_10212196 3300025921 Bacteria 1743
312 Ga0207681_10542577 3300025923 Bacteria 956
313 Ga0207681_10620381 3300025923 Bacteria 895
314 Ga0207650_10084230 3300025925 Bacteria 2416
315 Ga0207659_10170430 3300025926 Bacteria 1717
316 Ga0207659_10297442 3300025926 Bacteria 1324
317 Ga0207687_10054726 3300025927 Bacteria 2793
318 Ga0207687_10284004 3300025927 Bacteria 1328
319 Ga0207700_10105873 3300025928 Bacteria 2253
320 Ga0207700_10428107 3300025928 Bacteria 1163
321 Ga0207644_10425646 3300025931 Bacteria 1088
322 Ga0207690_10157301 3300025932 Bacteria 1690
323 Ga0207706_10055804 3300025933 Bacteria 3483
324 Ga0207706_10699721 3300025933 Bacteria 866
325 Ga0207686_10075143 3300025934 Bacteria 2186
326 Ga0207709_10042810 3300025935 Bacteria 2726
327 Ga0207709_10285314 3300025935 Bacteria 1221
328 Ga0207709_10352669 3300025935 Bacteria 1111
329 Ga0207709_10402308 3300025935 Bacteria 1047
330 Ga0207669_10007578 3300025937 Bacteria 5033
331 Ga0207669_10646277 3300025937 Bacteria 864
332 Ga0207704_10175145 3300025938 Bacteria 1544
333 Ga0207704_10480685 3300025938 Bacteria 997
334 Ga0207665_10082174 3300025939 Bacteria 2219
335 Ga0207665_10277525 3300025939 Bacteria 1246
336 Ga0207711_10053201 3300025941 Bacteria 3472
337 Ga0207711_10630343 3300025941 Bacteria 1000
338 Ga0207689_10022669 3300025942 Bacteria 5276
339 Ga0207689_10234012 3300025942 Bacteria 1518
340 Ga0207667_10131378 3300025949 Bacteria 2579
341 Ga0207651_10759464 3300025960 Bacteria 857
342 Ga0207668_10164783 3300025972 Bacteria 1731
343 Ga0207668_10941376 3300025972 Bacteria 770
344 Ga0207640_10394061 3300025981 Bacteria 1126
345 Ga0207658_10268560 3300025986 Bacteria 1457
346 Ga0207658_10512593 3300025986 Bacteria 1070
347 Ga0207703_10235556 3300026035 Bacteria 1643
348 Ga0207703_10282485 3300026035 Bacteria 1508
349 Ga0207639_10027145 3300026041 Plasmid 4167
350 Ga0207639_10093251 3300026041 Bacteria 2414
351 Ga0207639_10626122 3300026041 Bacteria 994
352 Ga0207678_10002892 3300026067 Bacteria 15594
353 Ga0207678_10029216 3300026067 Bacteria 4811
354 Ga0207678_10030754 3300026067 Bacteria 4687
355 Ga0207678_10037726 3300026067 Bacteria 4202
356 Ga0207678_10057840 3300026067 Bacteria 3336
357 Ga0207678_10067852 3300026067 Bacteria 3060
358 Ga0207678_10074338 3300026067 Bacteria 2912
359 Ga0207708_10066753 3300026075 Bacteria 2750
360 Ga0207708_10204076 3300026075 Bacteria 1578
361 Ga0207702_10271226 3300026078 Bacteria 1600
362 Ga0207641_10374025 3300026088 Bacteria 1363
363 Ga0207648_10014945 3300026089 Bacteria 7153
364 Ga0207648_10030692 3300026089 Bacteria 4757
365 Ga0207648_10057117 3300026089 Bacteria 3405
366 Ga0207676_10030936 3300026095 Bacteria 4022
367 Ga0207676_10048747 3300026095 Bacteria 3290
368 Ga0207674_10026473 3300026116 Bacteria 6157
369 Ga0207674_10154323 3300026116 Bacteria 2251
370 Ga0207675_100034100 3300026118 Bacteria 4744
371 Ga0207675_100069433 3300026118 Bacteria 3293
372 Ga0207675_100392341 3300026118 Bacteria 1367
373 Ga0207675_100709962 3300026118 Bacteria 1015
374 Ga0207675_100730175 3300026118 Bacteria 1001
375 Ga0207683_10021227 3300026121 Bacteria 5557
376 Ga0207683_10085803 3300026121 Bacteria 2799
377 Ga0207683_10201945 3300026121 Bacteria 1807
378 Ga0207683_10539874 3300026121 Bacteria 1078
379 Ga0207683_10929522 3300026121 Unclassified 808
380 Ga0207698_10045641 3300026142 Plasmid 3303
381 Ga0207698_10638719 3300026142 Bacteria 1053
382 Ga0207698_10831687 3300026142 Bacteria 927
383 Ga0209389_1000026 3300027296 Bacteria 147580
384 Ga0209389_1000117 3300027296 Bacteria 71506
385 Ga0209589_1000001 3300027357 Bacteria 794224
386 Ga0209589_1000022 3300027357 Bacteria 180757
387 Ga0209489_100001 3300027361 Bacteria 794224
388 Ga0209489_100058 3300027361 Bacteria 147117
389 Ga0209489_102405 3300027361 Bacteria 38216
390 Ga0209700_100001 3300027363 Bacteria 794224
391 Ga0209700_100021 3300027363 Bacteria 230859
392 Ga0209588_1015760 3300027671 Bacteria 2326
393 Ga0209813_10015975 3300027866 Bacteria 2041
394 Ga0207428_10000129 3300027907 Bacteria 104467
395 Ga0268266_10008307 3300028379 Bacteria 9243
396 Ga0268266_10083006 3300028379 Bacteria 2796
397 Ga0268266_10311719 3300028379 Bacteria 1470
398 Ga0268266_10476649 3300028379 Bacteria 1189
399 Ga0268265_10200184 3300028380 Bacteria 1732
400 Ga0268265_10204654 3300028380 Bacteria 1715
401 Ga0307517_10062698 3300028786 Bacteria 3491
402 Ga0307515_10111249 3300028794 Bacteria 3198
403 Ga0307513_10276049 3300031456 Bacteria 1461
404 Ga0307509_10032602 3300031507 Bacteria 5740
405 Ga0307412_10152103 3300031911 Bacteria 1709
406 Ga0307415_100092914 3300032126 Bacteria 2189
407 Ga0307510_10065385 3300033180 Bacteria 3684
408 Ga0315911_1000010 3300033442 Bacteria 322197
409 Ga0373961_0216258 3300035241 Bacteria 682
410 Ga0373927_0010000 3300035695 Bacteria 6357
411 Ga0373937_1059467 3300036401 Bacteria 760
412 Ga0373925_0032546 3300037068 Bacteria 3839
413 Ga0395900_0045800 3300037418 Bacteria 4505
414 Ga0395900_0053188 3300037418 Bacteria 4168
415 Ga0395900_0303707 3300037418 Bacteria 1581
416 Ga0395898_0040300 3300037466 Bacteria 4619
417 Ga0395898_0073130 3300037466 Bacteria 3311
418 Ga0395898_0190561 3300037466 Bacteria 1959
419 Ga0395898_0254629 3300037466 Bacteria 1674
420 Ga0395898_0256396 3300037466 Bacteria 1668
421 Ga0395898_0260944 3300037466 Bacteria 1653
422 Ga0395905_0071674 3300037471 Bacteria 3248
423 Ga0395905_0129014 3300037471 Bacteria 2378
424 Ga0395905_0163751 3300037471 Bacteria 2090
425 Ga0395905_0216782 3300037471 Bacteria 1792
426 Ga0395901_0032406 3300038443 Bacteria 5392
427 Ga0395901_0060239 3300038443 Bacteria 3950
428 Ga0395901_0258230 3300038443 Bacteria 1814
429 Ga0242420_037387 3300038996 Bacteria 919
430 Ga0451807_0261817 3300041486 Bacteria 962
431 Ga0451845_0753450 3300041501 Bacteria 1114
432 Ga0466972_0000113 3300044658 Bacteria 69042
433 Ga0466965_0168816 3300044683 Bacteria 1150
434 Ga0466970_0058228 3300044765 Bacteria 2068
435 Ga0466959_0100592 3300045049 Bacteria 2069
436 Ga0466967_0761927 3300045976 Bacteria 960
437 Ga0495603_0031711 3300046455 Bacteria 3182
438 Ga0495603_0046262 3300046455 Bacteria 2593
439 Ga0495638_0000617 3300046460 Bacteria 39602
440 Ga0495638_0085637 3300046460 Bacteria 1905
441 Ga0495651_0317068 3300046462 Bacteria 1040
442 Ga0495584_0145729 3300046491 Bacteria 1203
443 Ga0495585_0136118 3300046492 Bacteria 1290
444 Ga0495631_0077468 3300046518 Bacteria 1435
445 Ga0495631_0170281 3300046518 Bacteria 934
446 Ga0495632_0096355 3300046519 Bacteria 1397
447 Ga0495644_0051561 3300046523 Bacteria 1545
448 Ga0495644_0113701 3300046523 Bacteria 1028
449 Ga0495648_0056053 3300046524 Bacteria 2373
450 Ga0495587_0027109 3300046536 Bacteria 3489
451 Ga0495645_0419453 3300046543 Bacteria 850
452 Ga0495667_0270071 3300046559 Bacteria 1081
453 Ga0495656_0043353 3300046615 Bacteria 1889
454 Ga0495656_0079764 3300046615 Bacteria 1474
455 Ga0495656_0118887 3300046615 Bacteria 1245
456 Ga0495668_0236478 3300046616 Bacteria 1000
457 Ga0495611_0138988 3300046648 Bacteria 1134
458 Ga0495625_0043325 3300046660 Bacteria 3264
459 Ga0495625_0131372 3300046660 Bacteria 1696
460 Ga0495588_0134144 3300046674 Bacteria 1307
461 Ga0495599_0001619 3300046678 Bacteria 12981
462 Ga0495623_0089669 3300046679 Bacteria 1890
463 Ga0495669_0053160 3300046684 Bacteria 1821
464 Ga0495669_0240521 3300046684 Bacteria 869
465 Ga0495670_0137122 3300046691 Bacteria 1278
466 Ga0495671_0096101 3300046692 Bacteria 1450
467 Ga0495671_0186238 3300046692 Bacteria 1008
468 Ga0495649_0158568 3300046694 Bacteria 1187
469 Ga0495600_0184531 3300046809 Bacteria 1344
470 Ga0495604_0228605 3300047317 Bacteria 1277
471 Ga0495672_0002625 3300047320 Bacteria 16239
472 Ga0495672_0052638 3300047320 Bacteria 2390
473 Ga0495672_0229890 3300047320 Bacteria 911
474 Ga0495680_0164016 3300047322 Bacteria 1612
475 Ga0495675_0105846 3300047444 Bacteria 1758
476 Ga0495679_067547 3300047446 Bacteria 1036
477 Ga0495686_0032571 3300047472 Bacteria 3373
478 Ga0495686_0122640 3300047472 Bacteria 1547
479 Ga0495602_0160909 3300048088 Bacteria 1753
480 Ga0495602_0395781 3300048088 Bacteria 986
481 Ga0495626_0238257 3300048091 Bacteria 733
482 Ga0496100_0009755 3300048903 Bacteria 5405
483 Ga0496100_0090263 3300048903 Bacteria 2089
484 Ga0496100_0124975 3300048903 Bacteria 1804
485 Ga0496101_0014497 3300048904 Bacteria 5298
486 Ga0496101_0055564 3300048904 Bacteria 2860
487 Ga0496101_0149686 3300048904 Bacteria 1784
488 Ga0496102_0004216 3300048905 Bacteria 12155
489 Ga0496102_0047752 3300048905 Bacteria 3891
490 Ga0496102_0215349 3300048905 Bacteria 1810
491 Ga0496102_0265592 3300048905 Bacteria 1618
492 Ga0496102_0319796 3300048905 Bacteria 1462
493 Ga0496103_0006073 3300048906 Bacteria 7217
494 Ga0496103_0011676 3300048906 Bacteria 5210
495 Ga0496103_0297598 3300048906 Bacteria 1038
496 Ga0496104_0035437 3300048907 Bacteria 4659
497 Ga0496104_0072721 3300048907 Bacteria 3270
498 Ga0496104_0173037 3300048907 Bacteria 2070
499 Ga0496104_0988298 3300048907 Bacteria 746
500 Ga0496105_0011994 3300048908 Bacteria 6862
501 Ga0496105_0035363 3300048908 Bacteria 4111
502 Ga0496105_0192611 3300048908 Bacteria 1666
503 Ga0496105_0256925 3300048908 Bacteria 1414
504 Ga0496106_0009589 3300048909 Bacteria 7148
505 Ga0496106_0018599 3300048909 Bacteria 5142
506 Ga0496106_0138882 3300048909 Bacteria 1910
507 Ga0496107_0001367 3300048910 Bacteria 15005
508 Ga0496107_0029040 3300048910 Bacteria 3932
509 Ga0496107_0030734 3300048910 Bacteria 3829
510 Ga0496107_0326294 3300048910 Bacteria 1142
511 Ga0496107_0350657 3300048910 Bacteria 1098
512 Ga0496108_0338038 3300048911 Bacteria 1313
513 Ga0496109_0082403 3300048912 Bacteria 2964
514 Ga0496109_0104894 3300048912 Bacteria 2625
515 Ga0496109_0300180 3300048912 Bacteria 1514
516 Ga0496109_0333485 3300048912 Bacteria 1432
517 Ga0496110_0008299 3300048913 Bacteria 8351
518 Ga0496110_0030489 3300048913 Bacteria 4649
519 Ga0496111_0081741 3300048914 Bacteria 2358
520 Ga0496111_0375909 3300048914 Bacteria 1051
521 Ga0496112_0022256 3300048915 Bacteria 6038
522 Ga0496112_0048853 3300048915 Bacteria 4145
523 Ga0496112_0193766 3300048915 Bacteria 1993
524 Ga0496113_0020710 3300048916 Bacteria 4629
525 Ga0496113_0117289 3300048916 Bacteria 2078
526 Ga0496113_0448397 3300048916 Bacteria 1037
527 Ga0496114_0030373 3300048917 Plasmid 4446
528 Ga0496114_0061607 3300048917 Bacteria 3138
529 Ga0496114_0245516 3300048917 Bacteria 1575
530 Ga0496115_0013542 3300048918 Bacteria 6170
531 Ga0496115_0258584 3300048918 Bacteria 1432
532 Ga0496115_0318028 3300048918 Bacteria 1273
533 Ga0496115_0321129 3300048918 Bacteria 1266
534 Ga0496116_0085847 3300048919 Bacteria 1933
535 Ga0496117_0039671 3300048920 Bacteria 3472
536 Ga0496118_0018719 3300048921 Bacteria 6224
537 Ga0496118_0103004 3300048921 Bacteria 1922
538 Ga0496119_0129755 3300048922 Bacteria 1375
539 Ga0496121_0001059 3300048924 Bacteria 48728
540 Ga0496121_0029157 3300048924 Bacteria 5114
541 Ga0496121_0053408 3300048924 Bacteria 3385
542 Ga0496121_0105889 3300048924 Bacteria 2157
543 Ga0496121_0116614 3300048924 Bacteria 2025
544 Ga0496121_0136549 3300048924 Bacteria 1826
545 Ga0496121_0175055 3300048924 Bacteria 1554
546 Ga0496121_0296777 3300048924 Bacteria 1098
547 Ga0496121_0323802 3300048924 Bacteria 1037
548 Ga0496123_0241306 3300048926 Bacteria 897
549 Ga0496125_0006575 3300048928 Bacteria 12525
550 Ga0496125_0171819 3300048928 Bacteria 1456
551 Ga0496126_0001940 3300048929 Bacteria 29487
552 Ga0496126_0003509 3300048929 Bacteria 19758
553 Ga0496126_0020176 3300048929 Bacteria 6540
554 Ga0496126_0043026 3300048929 Bacteria 4169
555 Ga0496126_0300323 3300048929 Bacteria 1325
556 Ga0496126_0487507 3300048929 Bacteria 987
557 Ga0501032_0027862 3300049569 Bacteria 3882
558 Ga0501033_0002631 3300049570 Bacteria 15105
559 Ga0501034_0015233 3300049571 Bacteria 7902
560 Ga0501036_0001868 3300049572 Bacteria 16328
561 Ga0501037_0005101 3300049573 Bacteria 9553
562 Ga0501038_0000276 3300049574 Bacteria 43448
563 Ga0501039_0009202 3300049575 Bacteria 7527
564 Ga0501043_0003013 3300049579 Bacteria 14020
565 Ga0501046_0011595 3300049580 Bacteria 7534
566 Ga0501047_0014333 3300049581 Bacteria 7539
567 Ga0501047_0111567 3300049581 Bacteria 2617
568 Ga0501048_0038426 3300049582 Bacteria 3434
569 Ga0501067_0002106 3300049583 Bacteria 10960
570 Ga0501068_0024578 3300049584 Bacteria 3539
571 Ga0501069_0000483 3300049585 Bacteria 18234
572 Ga0501070_0003133 3300049586 Bacteria 14401
573 Ga0501070_0056921 3300049586 Bacteria 3241
574 Ga0501071_0188296 3300049587 Bacteria 1547
575 Ga0501072_0242658 3300049588 Bacteria 1435
576 Ga0501073_0000456 3300049589 Bacteria 28306
577 Ga0501073_0198737 3300049589 Bacteria 1387
578 Ga0501074_0023481 3300049590 Bacteria 4482
579 Ga0501080_0001321 3300049742 Bacteria 20652
580 Ga0501080_0144322 3300049742 Bacteria 2200
581 Ga0501083_0351282 3300049744 Bacteria 958
582 Ga0501035_0015892 3300049822 Bacteria 6945
583 Ga0501035_0494539 3300049822 Bacteria 1007
584 Ga0501044_0018935 3300049823 Bacteria 7371
585 Ga0501044_0021138 3300049823 Bacteria 6948
586 nmdc:mga03n38_177140_c1 3300050490 Bacteria 1090
587 nmdc:mga03n38_314650_c1 3300050490 Bacteria 844
588 nmdc:mga00v17_143315_c1 3300050491 Bacteria 1533
589 nmdc:mga0yw44_37622_c1 3300050492 Bacteria 2858
590 nmdc:mga0yw44_3788_c1 3300050492 Bacteria 6785
591 nmdc:mga0k408_221551_c1 3300050493 Bacteria 1129
592 nmdc:mga0k408_33235_c1 3300050493 Bacteria 2949
593 nmdc:mga06z11_112356_c1 3300050494 Bacteria 1510
594 nmdc:mga06z11_15070_c1 3300050494 Bacteria 3441
595 nmdc:mga06z11_494833_c1 3300050494 Bacteria 740
596 nmdc:mga04h51_17050_c1 3300050495 Bacteria 2117
597 nmdc:mga04h51_18778_c1 3300050495 Bacteria 2041
598 nmdc:mga04h51_82215_c1 3300050495 Bacteria 1145
599 nmdc:mga07m45_175208_c1 3300050496 Bacteria 1247
600 nmdc:mga07m45_33640_c1 3300050496 Bacteria 2374
601 nmdc:mga07m45_69583_c1 3300050496 Bacteria 2001
602 nmdc:mga07m45_76928_c1 3300050496 Bacteria 1903
603 nmdc:mga07m45_87906_c1 3300050496 Bacteria 1778
604 nmdc:mga08y16_41292_c1 3300050511 Bacteria 4833
605 nmdc:mga08y16_51_c1 3300050511 Bacteria 105348
606 nmdc:mga0n895_142219_c1 3300050512 Bacteria 2428
607 nmdc:mga0n895_608606_c1 3300050512 Bacteria 1094
608 nmdc:mga08x19_199733_c1 3300050514 Bacteria 1370
609 nmdc:mga0sz30_91851_c1 3300050516 Bacteria 1321
610 Ga0495601_0472849 3300053077 Bacteria 810
611 Ga0500635_0089368 3300053080 Bacteria 1118
612 Ga0495655_0006222 3300053083 Bacteria 2157
613 Ga0495619_0306840 3300053085 Bacteria 1099
614 Ga0500578_0181510 3300053086 Bacteria 1297
615 Ga0500647_0065765 3300053091 Bacteria 1744
616 Ga0500566_0001043 3300053094 Bacteria 16047
617 Ga0500557_000050 3300053105 Bacteria 54589
618 Ga0500562_026887 3300053108 Bacteria 1509
619 Ga0500595_000280 3300053119 Bacteria 33866
620 Ga0500595_004922 3300053119 Bacteria 5905
621 Ga0500597_062295 3300053120 Bacteria 1604
622 Ga0500642_0071449 3300053130 Bacteria 1580
623 Ga0500655_045193 3300053133 Bacteria 870
624 Ga0500658_0078078 3300053134 Bacteria 1411
625 Ga0500568_0060320 3300053139 Bacteria 1469
626 Ga0500603_000163 3300053150 Bacteria 16654
627 Ga0500603_021371 3300053150 Bacteria 1591
628 Ga0500627_0132339 3300053158 Bacteria 1126
629 Ga0500627_0199104 3300053158 Bacteria 898
630 Ga0500636_0042997 3300053177 Bacteria 2669
631 Ga0500636_0168477 3300053177 Bacteria 1187
632 Ga0500637_0000178 3300053178 Bacteria 23661
633 Ga0500625_003403 3300053729 Bacteria 6276
634 Ga0500645_015755 3300053730 Bacteria 2390
635 Ga0500601_007923 3300053737 Bacteria 1179
636 Ga0501082_0075174 3300060353 Bacteria 2910

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300013306 Ga0163162_10279544 Ga0163162_102795443 203
2 3300025926 Ga0207659_10297442 Ga0207659_102974422 203
3 3300048907 Ga0496104_0173037 Ga0496104_0173037_1405_2040 203
4 3300048908 Ga0496105_0256925 Ga0496105_0256925_300_935 203
5 3300048912 Ga0496109_0104894 Ga0496109_0104894_639_1274 203
6 iso_pu_bacteria 2919073203 2919074831 207
7 3300028794 Ga0307515_10111249 Ga0307515_101112492 208
8 iso_pu_bacteria 2507262055 2507509298 208
9 iso_pu_bacteria 2508501042 2508698872 208
10 iso_pu_bacteria 2513237096 2513654897 208
11 iso_pu_bacteria 2513237098 2513671997 208
12 iso_pu_bacteria 2513237098 2513675737 208
13 iso_pu_bacteria 2513237102 2513700625 208
14 iso_pu_bacteria 2513237137 2513861306 208
15 iso_pu_bacteria 2513237141 2513890010 208
16 iso_pu_bacteria 2513237145 2513916080 208
17 iso_pu_bacteria 2515154112 2515628897 208
18 iso_pu_bacteria 2524023210 2524466096 208
19 iso_pu_bacteria 2617270741 2617376427 208
20 iso_pu_bacteria 2824600985 2824606418 208
21 iso_pu_bacteria 2824609381 2824616339 208
22 iso_pu_bacteria 2824617872 2824619878 208
23 iso_pu_bacteria 2824626560 2824629486 208
24 iso_pu_bacteria 2824635225 2824637127 208
25 iso_pu_bacteria 2824644064 2824650450 208
26 iso_pu_bacteria 2824704595 2824710693 208
27 iso_pu_bacteria 2824714736 2824720978 208
28 iso_pu_bacteria 2824723954 2824730350 208
29 iso_pu_bacteria 2824753945 2824758541 208
30 iso_pu_bacteria 2824763712 2824768280 208
31 iso_pu_bacteria 2841966195 2841966910 208
32 iso_pu_bacteria 2847930680 2847935311 208
33 iso_pu_bacteria 2849076700 2849078007 208
34 iso_pu_bacteria 2857509624 2857510676 208
35 iso_pu_bacteria 2874645413 2874648491 208
36 iso_pu_bacteria 2874645413 2874649537 208
37 iso_pu_bacteria 2879083081 2879088945 208
38 iso_pu_bacteria 2879099564 2879100367 208
39 iso_pu_bacteria 2879127579 2879133390 208
40 iso_pu_bacteria 2879142872 2879146272 208
41 iso_pu_bacteria 2881364244 2881366741 208
42 iso_pu_bacteria 2881665667 2881670867 208
43 iso_pu_bacteria 2885383462 2885391542 208
44 iso_pu_bacteria 2885383462 2885392113 208
45 iso_pu_bacteria 2888419890 2888422108 208
46 iso_pu_bacteria 2888419890 2888425147 208
47 iso_pu_bacteria 2903768456 2903772972 208
48 iso_pu_bacteria 2903768456 2903776335 208
49 iso_pu_bacteria 2904699407 2904705641 208
50 iso_pu_bacteria 2904711408 2904717213 208
51 iso_pu_bacteria 2906660503 2906661319 208
52 iso_pu_bacteria 2929615660 2929617289 208
53 iso_pu_bacteria 2929624759 2929626993 208
54 iso_pu_bacteria 2932784394 2932793520 208
55 iso_pu_bacteria 2932828146 2932836687 208
56 iso_pu_bacteria 2932828146 2932837187 208
57 iso_pu_bacteria 2933577622 2933579246 208
58 iso_pu_bacteria 2935608549 2935611806 208
59 iso_pu_bacteria 2935638405 2935647235 208
60 iso_pu_bacteria 2935648319 2935651878 208
61 iso_pu_bacteria 2935656913 2935660688 208
62 iso_pu_bacteria 2935665750 2935674459 208
63 iso_pu_bacteria 2935810662 2935818892 208
64 iso_pu_bacteria 2935819856 2935821284 208
65 iso_pu_bacteria 2935827899 2935836734 208
66 iso_pu_bacteria 2935837841 2935846698 208
67 iso_pu_bacteria 2935847175 2935850455 208
68 iso_pu_bacteria 2935908558 2935914058 208
69 iso_pu_bacteria 2935916978 2935921227 208
70 iso_pu_bacteria 2935926038 2935931753 208
71 iso_pu_bacteria 2935934488 2935940312 208
72 iso_pu_bacteria 2935942939 2935947863 208
73 iso_pu_bacteria 2935951376 2935956596 208
74 iso_pu_bacteria 2935967501 2935973389 208
75 iso_pu_bacteria 2935975950 2935980995 208
76 iso_pu_bacteria 2935984226 2935989553 208
77 iso_pu_bacteria 2936011229 2936014744 208
78 iso_pu_bacteria 2936019824 2936023459 208
79 iso_pu_bacteria 2936028420 2936032487 208
80 iso_pu_bacteria 2936037263 2936045606 208
81 iso_pu_bacteria 2936046547 2936050485 208
82 iso_pu_bacteria 2936055302 2936059023 208
83 iso_pu_bacteria 2941538514 2941547181 208
84 iso_pu_bacteria 8006933436 8006933489 208
85 iso_pu_bacteria 8006973647 8006983161 208
86 iso_pu_bacteria 8016511872 8016512737 208
87 iso_pu_bacteria 8016511872 8016512847 208
88 iso_pu_bacteria 8016622563 8016627525 208
89 iso_pu_bacteria 8016630954 8016631750 208
90 iso_pu_bacteria 8017057580 8017067254 208
91 iso_pu_bacteria 8017057580 8017067354 208
92 iso_pu_bacteria 8019547302 8019554629 208
93 iso_pu_bacteria 8019619141 8019627389 208
94 iso_pu_bacteria 8019629233 8019635186 208
95 iso_pu_bacteria 8019659431 8019663028 208
96 iso_pu_bacteria 8019668869 8019672626 208
97 iso_pu_bacteria 8019678201 8019683534 208
98 iso_pu_bacteria 8019687851 8019689279 208
99 iso_pu_bacteria 8055742211 8055747096 208
100 iso_pu_bacteria 8056681323 8056688187 208
101 3300003322 rootL2_10062248 rootL2_100622486 209
102 3300003659 JGI25404J52841_10001673 JGI25404J52841_100016731 209
103 3300005336 Ga0070680_100060330 Ga0070680_1000603304 209
104 3300005339 Ga0070660_100242569 Ga0070660_1002425692 209
105 3300005356 Ga0070674_100107375 Ga0070674_1001073753 209
106 3300005436 Ga0070713_100330137 Ga0070713_1003301371 209
107 3300005455 Ga0070663_100084590 Ga0070663_1000845901 209
108 3300005456 Ga0070678_100345671 Ga0070678_1003456712 209
109 3300005458 Ga0070681_10069696 Ga0070681_100696962 209
110 3300005530 Ga0070679_100069731 Ga0070679_1000697314 209
111 3300005535 Ga0070684_100844673 Ga0070684_1008446732 209
112 3300005548 Ga0070665_100048897 Ga0070665_1000488974 209
113 3300005548 Ga0070665_100070629 Ga0070665_1000706292 209
114 3300005548 Ga0070665_100160167 Ga0070665_1001601672 209
115 3300005563 Ga0068855_100005078 Ga0068855_1000050784 209
116 3300005577 Ga0068857_100625539 Ga0068857_1006255392 209
117 3300005614 Ga0068856_100512913 Ga0068856_1005129131 209
118 3300005617 Ga0068859_100845111 Ga0068859_1008451112 209
119 3300005718 Ga0068866_10123683 Ga0068866_101236832 209
120 3300005844 Ga0068862_100466603 Ga0068862_1004666032 209
121 3300005937 Ga0081455_10014623 Ga0081455_100146236 209
122 3300005983 Ga0081540_1054853 Ga0081540_10548532 209
123 3300006178 Ga0075367_10211924 Ga0075367_102119242 209
124 3300006237 Ga0097621_100560237 Ga0097621_1005602372 209
125 3300006931 Ga0097620_100845062 Ga0097620_1008450621 209
126 3300006944 Ga0099823_1008083 Ga0099823_10080834 209
127 3300007265 Ga0099794_10046610 Ga0099794_100466101 209
128 3300009093 Ga0105240_10377799 Ga0105240_103777992 209
129 3300009101 Ga0105247_10744171 Ga0105247_107441712 209
130 3300009545 Ga0105237_10189312 Ga0105237_101893122 209
131 3300013104 Ga0157370_10113527 Ga0157370_101135273 209
132 3300013306 Ga0163162_10194870 Ga0163162_101948703 209
133 3300013306 Ga0163162_10238263 Ga0163162_102382633 209
134 3300013308 Ga0157375_10688017 Ga0157375_106880172 209
135 3300013308 Ga0157375_11130558 Ga0157375_111305581 209
136 3300014326 Ga0157380_10724726 Ga0157380_107247261 209
137 3300014969 Ga0157376_10454401 Ga0157376_104544012 209
138 3300017792 Ga0163161_10201308 Ga0163161_102013082 209
139 3300025909 Ga0207705_10168133 Ga0207705_101681332 209
140 3300025917 Ga0207660_10149059 Ga0207660_101490591 209
141 3300025921 Ga0207652_10139022 Ga0207652_101390224 209
142 3300025928 Ga0207700_10428107 Ga0207700_104281071 209
143 3300025933 Ga0207706_10699721 Ga0207706_106997211 209
144 3300026067 Ga0207678_10074338 Ga0207678_100743384 209
145 3300026118 Ga0207675_100730175 Ga0207675_1007301752 209
146 3300026121 Ga0207683_10201945 Ga0207683_102019452 209
147 3300026142 Ga0207698_10831687 Ga0207698_108316872 209
148 3300028379 Ga0268266_10476649 Ga0268266_104766492 209
149 3300028786 Ga0307517_10062698 Ga0307517_100626984 209
150 3300031456 Ga0307513_10276049 Ga0307513_102760491 209
151 3300031507 Ga0307509_10032602 Ga0307509_100326024 209
152 3300032126 Ga0307415_100092914 Ga0307415_1000929142 209
153 3300037418 Ga0395900_0303707 Ga0395900_0303707_406_1035 209
154 3300037466 Ga0395898_0256396 Ga0395898_0256396_969_1598 209
155 3300037471 Ga0395905_0071674 Ga0395905_0071674_2227_2856 209
156 3300038443 Ga0395901_0258230 Ga0395901_0258230_402_1031 209
157 3300046455 Ga0495603_0046262 Ga0495603_0046262_1853_2482 209
158 3300046460 Ga0495638_0085637 Ga0495638_0085637_1146_1775 209
159 3300046518 Ga0495631_0077468 Ga0495631_0077468_451_1080 209
160 3300046519 Ga0495632_0096355 Ga0495632_0096355_200_829 209
161 3300046524 Ga0495648_0056053 Ga0495648_0056053_1065_1694 209
162 3300046559 Ga0495667_0270071 Ga0495667_0270071_425_1057 209
163 3300046615 Ga0495656_0118887 Ga0495656_0118887_461_1090 209
164 3300046616 Ga0495668_0236478 Ga0495668_0236478_291_920 209
165 3300046648 Ga0495611_0138988 Ga0495611_0138988_60_689 209
166 3300046660 Ga0495625_0043325 Ga0495625_0043325_1878_2507 209
167 3300046660 Ga0495625_0131372 Ga0495625_0131372_217_846 209
168 3300046684 Ga0495669_0053160 Ga0495669_0053160_400_1029 209
169 3300046684 Ga0495669_0240521 Ga0495669_0240521_15_644 209
170 3300046694 Ga0495649_0158568 Ga0495649_0158568_340_969 209
171 3300047320 Ga0495672_0002625 Ga0495672_0002625_2910_3539 209
172 3300047446 Ga0495679_067547 Ga0495679_067547_56_685 209
173 3300048091 Ga0495626_0238257 Ga0495626_0238257_49_678 209
174 3300048924 Ga0496121_0029157 Ga0496121_0029157_1125_1754 209
175 3300048928 Ga0496125_0171819 Ga0496125_0171819_808_1437 209
176 3300048929 Ga0496126_0020176 Ga0496126_0020176_4324_4953 209
177 3300050492 nmdc:mga0yw44_37622_c1 nmdc:mga0yw44_37622_c1_1747_2376 209
178 3300050495 nmdc:mga04h51_17050_c1 nmdc:mga04h51_17050_c1_126_755 209
179 3300053091 Ga0500647_0065765 Ga0500647_0065765_38_667 209
180 3300053105 Ga0500557_000050 Ga0500557_000050_37201_37830 209
181 3300053120 Ga0500597_062295 Ga0500597_062295_195_824 209
182 3300053130 Ga0500642_0071449 Ga0500642_0071449_892_1521 209
183 3300053133 Ga0500655_045193 Ga0500655_045193_229_858 209
184 3300053134 Ga0500658_0078078 Ga0500658_0078078_273_902 209
185 3300053158 Ga0500627_0199104 Ga0500627_0199104_137_766 209
186 3300053177 Ga0500636_0168477 Ga0500636_0168477_444_1073 209
187 3300053729 Ga0500625_003403 Ga0500625_003403_3209_3838 209
188 3300053730 Ga0500645_015755 Ga0500645_015755_970_1599 209
189 3300053737 Ga0500601_007923 Ga0500601_007923_149_778 209
190 3300005336 Ga0070680_100219358 Ga0070680_1002193581 211
191 3300005458 Ga0070681_10017681 Ga0070681_100176815 211
192 3300005530 Ga0070679_100044869 Ga0070679_1000448694 211
193 3300005535 Ga0070684_100249910 Ga0070684_1002499102 211
194 3300005983 Ga0081540_1000809 Ga0081540_100080921 211
195 3300006042 Ga0075368_10029727 Ga0075368_100297273 211
196 3300006353 Ga0075370_10045857 Ga0075370_100458572 211
197 3300006353 Ga0075370_10049859 Ga0075370_100498593 211
198 3300009174 Ga0105241_10329500 Ga0105241_103295002 211
199 3300009551 Ga0105238_10527044 Ga0105238_105270441 211
200 3300011119 Ga0105246_10607995 Ga0105246_106079951 211
201 3300013105 Ga0157369_10129466 Ga0157369_101294662 211
202 3300013307 Ga0157372_10141634 Ga0157372_101416343 211
203 3300025912 Ga0207707_10008176 Ga0207707_100081764 211
204 3300025917 Ga0207660_10177074 Ga0207660_101770742 211
205 3300025921 Ga0207652_10094643 Ga0207652_100946433 211
206 3300027866 Ga0209813_10015975 Ga0209813_100159751 211
207 3300031911 Ga0307412_10152103 Ga0307412_101521031 211
208 3300046460 Ga0495638_0000617 Ga0495638_0000617_12277_12921 211
209 3300048924 Ga0496121_0105889 Ga0496121_0105889_493_1131 211
210 3300048929 Ga0496126_0043026 Ga0496126_0043026_2111_2755 211
211 3300050493 nmdc:mga0k408_221551_c1 nmdc:mga0k408_221551_c1_418_1056 211
212 3300050494 nmdc:mga06z11_112356_c1 nmdc:mga06z11_112356_c1_802_1440 211
213 3300050495 nmdc:mga04h51_18778_c1 nmdc:mga04h51_18778_c1_646_1284 211
214 3300050496 nmdc:mga07m45_175208_c1 nmdc:mga07m45_175208_c1_158_796 211
215 3300050496 nmdc:mga07m45_33640_c1 nmdc:mga07m45_33640_c1_143_781 211
216 3300053108 Ga0500562_026887 Ga0500562_026887_501_1145 211
217 3300053158 Ga0500627_0132339 Ga0500627_0132339_364_1008 211
218 3300001990 JGI24737J22298_10107068 JGI24737J22298_101070681 212
219 3300002070 JGI24750J21931_1004884 JGI24750J21931_10048842 212
220 3300002075 JGI24738J21930_10020092 JGI24738J21930_100200922 212
221 3300002155 JGI24033J26618_1006218 JGI24033J26618_10062182 212
222 3300002244 JGI24742J22300_10015119 JGI24742J22300_100151192 212
223 3300002459 JGI24751J29686_10040913 JGI24751J29686_100409131 212
224 3300003320 rootH2_10074383 rootH2_100743832 212
225 3300003320 rootH2_10130837 rootH2_101308371 212
226 3300003323 rootH1_10064064 rootH1_100640642 212
227 3300003354 JGI25160J50197_1000939 JGI25160J50197_10009392 212
228 3300003354 JGI25160J50197_1007045 JGI25160J50197_10070452 212
229 3300003659 JGI25404J52841_10031415 JGI25404J52841_100314152 212
230 3300003659 JGI25404J52841_10032676 JGI25404J52841_100326762 212
231 3300005329 Ga0070683_100116211 Ga0070683_1001162113 212
232 3300005330 Ga0070690_100043163 Ga0070690_1000431633 212
233 3300005331 Ga0070670_100208275 Ga0070670_1002082751 212
234 3300005334 Ga0068869_100244492 Ga0068869_1002444921 212
235 3300005335 Ga0070666_10400576 Ga0070666_104005761 212
236 3300005336 Ga0070680_100041868 Ga0070680_1000418681 212
237 3300005337 Ga0070682_100009270 Ga0070682_1000092707 212
238 3300005337 Ga0070682_100214163 Ga0070682_1002141632 212
239 3300005338 Ga0068868_100281102 Ga0068868_1002811022 212
240 3300005338 Ga0068868_100734712 Ga0068868_1007347122 212
241 3300005339 Ga0070660_100301395 Ga0070660_1003013952 212
242 3300005339 Ga0070660_100314071 Ga0070660_1003140712 212
243 3300005340 Ga0070689_100408622 Ga0070689_1004086221 212
244 3300005341 Ga0070691_10034083 Ga0070691_100340833 212
245 3300005343 Ga0070687_100018996 Ga0070687_1000189962 212
246 3300005343 Ga0070687_100421073 Ga0070687_1004210731 212
247 3300005344 Ga0070661_100165102 Ga0070661_1001651022 212
248 3300005344 Ga0070661_100166898 Ga0070661_1001668983 212
249 3300005344 Ga0070661_100604888 Ga0070661_1006048881 212
250 3300005345 Ga0070692_10129604 Ga0070692_101296042 212
251 3300005347 Ga0070668_100048385 Ga0070668_1000483852 212
252 3300005347 Ga0070668_100292214 Ga0070668_1002922142 212
253 3300005347 Ga0070668_100298501 Ga0070668_1002985012 212
254 3300005353 Ga0070669_100270337 Ga0070669_1002703372 212
255 3300005354 Ga0070675_100407150 Ga0070675_1004071502 212
256 3300005356 Ga0070674_100040883 Ga0070674_1000408832 212
257 3300005356 Ga0070674_100053157 Ga0070674_1000531572 212
258 3300005364 Ga0070673_100640014 Ga0070673_1006400142 212
259 3300005364 Ga0070673_100998978 Ga0070673_1009989781 212
260 3300005366 Ga0070659_100112303 Ga0070659_1001123032 212
261 3300005367 Ga0070667_100100750 Ga0070667_1001007501 212
262 3300005434 Ga0070709_10143753 Ga0070709_101437532 212
263 3300005435 Ga0070714_100537569 Ga0070714_1005375692 212
264 3300005436 Ga0070713_100219925 Ga0070713_1002199252 212
265 3300005438 Ga0070701_10069955 Ga0070701_100699552 212
266 3300005439 Ga0070711_100331408 Ga0070711_1003314082 212
267 3300005441 Ga0070700_100434039 Ga0070700_1004340392 212
268 3300005444 Ga0070694_100045595 Ga0070694_1000455952 212
269 3300005455 Ga0070663_100005431 Ga0070663_1000054317 212
270 3300005455 Ga0070663_100020805 Ga0070663_1000208053 212
271 3300005455 Ga0070663_100097128 Ga0070663_1000971282 212
272 3300005455 Ga0070663_100536002 Ga0070663_1005360021 212
273 3300005456 Ga0070678_100017758 Ga0070678_1000177585 212
274 3300005456 Ga0070678_100071528 Ga0070678_1000715282 212
275 3300005456 Ga0070678_100908899 Ga0070678_1009088991 212
276 3300005457 Ga0070662_100095037 Ga0070662_1000950371 212
277 3300005458 Ga0070681_10282827 Ga0070681_102828272 212
278 3300005459 Ga0068867_100030517 Ga0068867_1000305173 212
279 3300005459 Ga0068867_100826684 Ga0068867_1008266841 212
280 3300005466 Ga0070685_10063225 Ga0070685_100632253 212
281 3300005530 Ga0070679_100016988 Ga0070679_1000169888 212
282 3300005535 Ga0070684_100233687 Ga0070684_1002336872 212
283 3300005535 Ga0070684_100334780 Ga0070684_1003347802 212
284 3300005535 Ga0070684_100760460 Ga0070684_1007604601 212
285 3300005539 Ga0068853_100018490 Ga0068853_1000184905 212
286 3300005539 Ga0068853_100464347 Ga0068853_1004643472 212
287 3300005543 Ga0070672_100186361 Ga0070672_1001863612 212
288 3300005544 Ga0070686_100526683 Ga0070686_1005266831 212
289 3300005546 Ga0070696_100787895 Ga0070696_1007878951 212
290 3300005547 Ga0070693_100015017 Ga0070693_1000150176 212
291 3300005547 Ga0070693_100076947 Ga0070693_1000769472 212
292 3300005547 Ga0070693_100146537 Ga0070693_1001465372 212
293 3300005548 Ga0070665_100055188 Ga0070665_1000551883 212
294 3300005548 Ga0070665_100321188 Ga0070665_1003211882 212
295 3300005548 Ga0070665_100665320 Ga0070665_1006653202 212
296 3300005549 Ga0070704_100159546 Ga0070704_1001595463 212
297 3300005563 Ga0068855_100296290 Ga0068855_1002962902 212
298 3300005577 Ga0068857_100023890 Ga0068857_1000238907 212
299 3300005577 Ga0068857_100132484 Ga0068857_1001324843 212
300 3300005578 Ga0068854_100243639 Ga0068854_1002436392 212
301 3300005614 Ga0068856_100789106 Ga0068856_1007891061 212
302 3300005614 Ga0068856_101322473 Ga0068856_1013224731 212
303 3300005615 Ga0070702_100004976 Ga0070702_1000049766 212
304 3300005615 Ga0070702_100023926 Ga0070702_1000239263 212
305 3300005616 Ga0068852_100066913 Ga0068852_1000669133 212
306 3300005616 Ga0068852_100089288 Ga0068852_1000892882 212
307 3300005618 Ga0068864_100005000 Ga0068864_1000050005 212
308 3300005618 Ga0068864_100723550 Ga0068864_1007235502 212
309 3300005718 Ga0068866_10027650 Ga0068866_100276503 212
310 3300005718 Ga0068866_10027887 Ga0068866_100278873 212
311 3300005719 Ga0068861_100018438 Ga0068861_1000184387 212
312 3300005719 Ga0068861_100055317 Ga0068861_1000553172 212
313 3300005719 Ga0068861_100323532 Ga0068861_1003235321 212
314 3300005834 Ga0068851_10533028 Ga0068851_105330281 212
315 3300005840 Ga0068870_10006058 Ga0068870_100060589 212
316 3300005841 Ga0068863_100476236 Ga0068863_1004762361 212
317 3300005841 Ga0068863_100843740 Ga0068863_1008437401 212
318 3300005842 Ga0068858_100330261 Ga0068858_1003302612 212
319 3300005842 Ga0068858_100361851 Ga0068858_1003618512 212
320 3300005843 Ga0068860_100039612 Ga0068860_1000396123 212
321 3300005843 Ga0068860_100200490 Ga0068860_1002004904 212
322 3300005843 Ga0068860_100458229 Ga0068860_1004582292 212
323 3300005844 Ga0068862_100063580 Ga0068862_1000635802 212
324 3300005844 Ga0068862_100758361 Ga0068862_1007583611 212
325 3300005983 Ga0081540_1000996 Ga0081540_10009967 212
326 3300005983 Ga0081540_1013314 Ga0081540_10133142 212
327 3300005983 Ga0081540_1013715 Ga0081540_10137156 212
328 3300005983 Ga0081540_1015135 Ga0081540_10151354 212
329 3300006028 Ga0070717_10527311 Ga0070717_105273112 212
330 3300006038 Ga0075365_10236226 Ga0075365_102362262 212
331 3300006048 Ga0075363_100037306 Ga0075363_1000373063 212
332 3300006048 Ga0075363_100157225 Ga0075363_1001572252 212
333 3300006048 Ga0075363_100291976 Ga0075363_1002919761 212
334 3300006051 Ga0075364_10143805 Ga0075364_101438052 212
335 3300006173 Ga0070716_100039861 Ga0070716_1000398614 212
336 3300006173 Ga0070716_100095573 Ga0070716_1000955732 212
337 3300006175 Ga0070712_100029064 Ga0070712_1000290642 212
338 3300006175 Ga0070712_100137553 Ga0070712_1001375531 212
339 3300006178 Ga0075367_10053123 Ga0075367_100531233 212
340 3300006186 Ga0075369_10174963 Ga0075369_101749632 212
341 3300006237 Ga0097621_100092686 Ga0097621_1000926864 212
342 3300006353 Ga0075370_10196213 Ga0075370_101962131 212
343 3300006358 Ga0068871_100025883 Ga0068871_1000258836 212
344 3300006358 Ga0068871_100221731 Ga0068871_1002217312 212
345 3300006358 Ga0068871_100498804 Ga0068871_1004988042 212
346 3300006358 Ga0068871_100851972 Ga0068871_1008519722 212
347 3300006852 Ga0075433_11160673 Ga0075433_111606731 212
348 3300006871 Ga0075434_100034971 Ga0075434_1000349717 212
349 3300006871 Ga0075434_100726951 Ga0075434_1007269512 212
350 3300006871 Ga0075434_100862133 Ga0075434_1008621332 212
351 3300006881 Ga0068865_100012377 Ga0068865_1000123774 212
352 3300006881 Ga0068865_100210503 Ga0068865_1002105032 212
353 3300006914 Ga0075436_100214521 Ga0075436_1002145211 212
354 3300006941 Ga0099825_1034652 Ga0099825_10346523 212
355 3300006942 Ga0099824_1002487 Ga0099824_10024879 212
356 3300006942 Ga0099824_1005150 Ga0099824_100515012 212
357 3300006943 Ga0099822_1001480 Ga0099822_10014809 212
358 3300009093 Ga0105240_10008605 Ga0105240_1000860514 212
359 3300009093 Ga0105240_10048479 Ga0105240_100484794 212
360 3300009094 Ga0111539_10000616 Ga0111539_1000061639 212
361 3300009094 Ga0111539_10193578 Ga0111539_101935782 212
362 3300009098 Ga0105245_10040936 Ga0105245_100409362 212
363 3300009098 Ga0105245_10139293 Ga0105245_101392932 212
364 3300009098 Ga0105245_10158379 Ga0105245_101583791 212
365 3300009101 Ga0105247_10024077 Ga0105247_100240773 212
366 3300009148 Ga0105243_10018891 Ga0105243_100188913 212
367 3300009174 Ga0105241_10009222 Ga0105241_100092225 212
368 3300009176 Ga0105242_10032372 Ga0105242_100323723 212
369 3300009176 Ga0105242_10378861 Ga0105242_103788612 212
370 3300009176 Ga0105242_10458443 Ga0105242_104584431 212
371 3300009177 Ga0105248_10123415 Ga0105248_101234152 212
372 3300009177 Ga0105248_10356079 Ga0105248_103560792 212
373 3300009177 Ga0105248_10362260 Ga0105248_103622602 212
374 3300009545 Ga0105237_10038493 Ga0105237_100384937 212
375 3300009545 Ga0105237_10058065 Ga0105237_100580652 212
376 3300009545 Ga0105237_10110791 Ga0105237_101107913 212
377 3300009545 Ga0105237_10812505 Ga0105237_108125051 212
378 3300009551 Ga0105238_10063814 Ga0105238_100638142 212
379 3300009551 Ga0105238_10075141 Ga0105238_100751412 212
380 3300009551 Ga0105238_10213193 Ga0105238_102131932 212
381 3300009551 Ga0105238_10460208 Ga0105238_104602081 212
382 3300009551 Ga0105238_10495711 Ga0105238_104957112 212
383 3300009553 Ga0105249_10079419 Ga0105249_100794192 212
384 3300009553 Ga0105249_10704280 Ga0105249_107042802 212
385 3300010375 Ga0105239_10037978 Ga0105239_100379782 212
386 3300010375 Ga0105239_10081722 Ga0105239_100817224 212
387 3300010375 Ga0105239_10103271 Ga0105239_101032712 212
388 3300010375 Ga0105239_10580628 Ga0105239_105806281 212
389 3300010375 Ga0105239_10765632 Ga0105239_107656322 212
390 3300011119 Ga0105246_10020940 Ga0105246_100209404 212
391 3300011119 Ga0105246_10043743 Ga0105246_100437433 212
392 3300011119 Ga0105246_10351677 Ga0105246_103516771 212
393 3300013104 Ga0157370_10018913 Ga0157370_100189133 212
394 3300013105 Ga0157369_10002208 Ga0157369_100022083 212
395 3300013105 Ga0157369_10005932 Ga0157369_100059325 212
396 3300013105 Ga0157369_10890353 Ga0157369_108903531 212
397 3300013296 Ga0157374_10017728 Ga0157374_100177282 212
398 3300013296 Ga0157374_10075411 Ga0157374_100754111 212
399 3300013296 Ga0157374_10286184 Ga0157374_102861841 212
400 3300013296 Ga0157374_10657183 Ga0157374_106571832 212
401 3300013297 Ga0157378_10034557 Ga0157378_100345576 212
402 3300013297 Ga0157378_10088682 Ga0157378_100886825 212
403 3300013297 Ga0157378_10202460 Ga0157378_102024602 212
404 3300013297 Ga0157378_10255666 Ga0157378_102556663 212
405 3300013297 Ga0157378_10476591 Ga0157378_104765912 212
406 3300013306 Ga0163162_10189605 Ga0163162_101896053 212
407 3300013306 Ga0163162_11405756 Ga0163162_114057561 212
408 3300013307 Ga0157372_10025495 Ga0157372_100254956 212
409 3300013308 Ga0157375_10024985 Ga0157375_100249851 212
410 3300013308 Ga0157375_10364530 Ga0157375_103645302 212
411 3300013308 Ga0157375_10577411 Ga0157375_105774112 212
412 3300014325 Ga0163163_10020992 Ga0163163_100209929 212
413 3300014325 Ga0163163_10065770 Ga0163163_100657701 212
414 3300014326 Ga0157380_10067985 Ga0157380_100679854 212
415 3300014326 Ga0157380_10229846 Ga0157380_102298462 212
416 3300014326 Ga0157380_10635009 Ga0157380_106350092 212
417 3300014745 Ga0157377_10188014 Ga0157377_101880142 212
418 3300014968 Ga0157379_10049822 Ga0157379_100498222 212
419 3300014968 Ga0157379_10116176 Ga0157379_101161761 212
420 3300014969 Ga0157376_10184631 Ga0157376_101846312 212
421 3300017792 Ga0163161_10019274 Ga0163161_100192742 212
422 3300021321 Ga0214542_1000002 Ga0214542_1000002692 212
423 3300021324 Ga0214545_1000002 Ga0214545_100000228 212
424 3300021327 Ga0214543_1000013 Ga0214543_1000013294 212
425 3300025253 Ga0209677_103741 Ga0209677_1037413 212
426 3300025273 Ga0209673_1040492 Ga0209673_10404922 212
427 3300025284 Ga0209130_1000672 Ga0209130_10006724 212
428 3300025295 Ga0209564_1002754 Ga0209564_10027548 212
429 3300025297 Ga0209758_1001375 Ga0209758_100137516 212
430 3300025302 Ga0207426_1000331 Ga0207426_100033151 212
431 3300025302 Ga0207426_1000577 Ga0207426_100057746 212
432 3300025315 Ga0207697_10026545 Ga0207697_100265452 212
433 3300025315 Ga0207697_10091416 Ga0207697_100914162 212
434 3300025899 Ga0207642_10329531 Ga0207642_103295311 212
435 3300025900 Ga0207710_10069744 Ga0207710_100697442 212
436 3300025900 Ga0207710_10287364 Ga0207710_102873641 212
437 3300025901 Ga0207688_10006895 Ga0207688_100068952 212
438 3300025901 Ga0207688_10118914 Ga0207688_101189142 212
439 3300025901 Ga0207688_10185248 Ga0207688_101852482 212
440 3300025903 Ga0207680_10165370 Ga0207680_101653701 212
441 3300025904 Ga0207647_10015001 Ga0207647_100150014 212
442 3300025904 Ga0207647_10016497 Ga0207647_100164972 212
443 3300025904 Ga0207647_10080046 Ga0207647_100800463 212
444 3300025906 Ga0207699_10090954 Ga0207699_100909541 212
445 3300025907 Ga0207645_10069204 Ga0207645_100692042 212
446 3300025907 Ga0207645_10124253 Ga0207645_101242532 212
447 3300025908 Ga0207643_10003065 Ga0207643_1000306510 212
448 3300025909 Ga0207705_10176843 Ga0207705_101768432 212
449 3300025911 Ga0207654_10070847 Ga0207654_100708472 212
450 3300025911 Ga0207654_10153821 Ga0207654_101538212 212
451 3300025912 Ga0207707_10056244 Ga0207707_100562443 212
452 3300025912 Ga0207707_10060266 Ga0207707_100602663 212
453 3300025913 Ga0207695_10052552 Ga0207695_100525524 212
454 3300025913 Ga0207695_10104080 Ga0207695_101040802 212
455 3300025913 Ga0207695_10686852 Ga0207695_106868521 212
456 3300025914 Ga0207671_10155741 Ga0207671_101557413 212
457 3300025914 Ga0207671_10328540 Ga0207671_103285401 212
458 3300025914 Ga0207671_10460978 Ga0207671_104609781 212
459 3300025915 Ga0207693_10008904 Ga0207693_100089043 212
460 3300025916 Ga0207663_10035518 Ga0207663_100355183 212
461 3300025917 Ga0207660_10012093 Ga0207660_100120935 212
462 3300025917 Ga0207660_10082578 Ga0207660_100825782 212
463 3300025918 Ga0207662_10008159 Ga0207662_100081595 212
464 3300025918 Ga0207662_10470559 Ga0207662_104705591 212
465 3300025919 Ga0207657_10123999 Ga0207657_101239992 212
466 3300025919 Ga0207657_10191822 Ga0207657_101918221 212
467 3300025920 Ga0207649_10114862 Ga0207649_101148622 212
468 3300025920 Ga0207649_10209964 Ga0207649_102099642 212
469 3300025921 Ga0207652_10039347 Ga0207652_100393474 212
470 3300025921 Ga0207652_10212196 Ga0207652_102121963 212
471 3300025923 Ga0207681_10542577 Ga0207681_105425771 212
472 3300025923 Ga0207681_10620381 Ga0207681_106203811 212
473 3300025925 Ga0207650_10084230 Ga0207650_100842303 212
474 3300025926 Ga0207659_10170430 Ga0207659_101704301 212
475 3300025927 Ga0207687_10054726 Ga0207687_100547262 212
476 3300025927 Ga0207687_10284004 Ga0207687_102840043 212
477 3300025928 Ga0207700_10105873 Ga0207700_101058732 212
478 3300025931 Ga0207644_10425646 Ga0207644_104256462 212
479 3300025932 Ga0207690_10157301 Ga0207690_101573013 212
480 3300025933 Ga0207706_10055804 Ga0207706_100558042 212
481 3300025934 Ga0207686_10075143 Ga0207686_100751432 212
482 3300025935 Ga0207709_10042810 Ga0207709_100428102 212
483 3300025935 Ga0207709_10285314 Ga0207709_102853142 212
484 3300025935 Ga0207709_10352669 Ga0207709_103526692 212
485 3300025935 Ga0207709_10402308 Ga0207709_104023083 212
486 3300025937 Ga0207669_10007578 Ga0207669_100075785 212
487 3300025937 Ga0207669_10646277 Ga0207669_106462771 212
488 3300025938 Ga0207704_10175145 Ga0207704_101751452 212
489 3300025938 Ga0207704_10480685 Ga0207704_104806851 212
490 3300025939 Ga0207665_10082174 Ga0207665_100821742 212
491 3300025939 Ga0207665_10277525 Ga0207665_102775252 212
492 3300025941 Ga0207711_10053201 Ga0207711_100532012 212
493 3300025941 Ga0207711_10630343 Ga0207711_106303431 212
494 3300025942 Ga0207689_10022669 Ga0207689_100226694 212
495 3300025942 Ga0207689_10234012 Ga0207689_102340122 212
496 3300025949 Ga0207667_10131378 Ga0207667_101313782 212
497 3300025960 Ga0207651_10759464 Ga0207651_107594641 212
498 3300025972 Ga0207668_10164783 Ga0207668_101647832 212
499 3300025972 Ga0207668_10941376 Ga0207668_109413761 212
500 3300025981 Ga0207640_10394061 Ga0207640_103940611 212
501 3300025986 Ga0207658_10268560 Ga0207658_102685602 212
502 3300025986 Ga0207658_10512593 Ga0207658_105125931 212
503 3300026035 Ga0207703_10235556 Ga0207703_102355562 212
504 3300026035 Ga0207703_10282485 Ga0207703_102824853 212
505 3300026041 Ga0207639_10027145 Ga0207639_100271454 212
506 3300026041 Ga0207639_10093251 Ga0207639_100932512 212
507 3300026041 Ga0207639_10626122 Ga0207639_106261221 212
508 3300026067 Ga0207678_10002892 Ga0207678_100028928 212
509 3300026067 Ga0207678_10029216 Ga0207678_100292163 212
510 3300026067 Ga0207678_10030754 Ga0207678_100307543 212
511 3300026067 Ga0207678_10037726 Ga0207678_100377264 212
512 3300026067 Ga0207678_10057840 Ga0207678_100578403 212
513 3300026067 Ga0207678_10067852 Ga0207678_100678523 212
514 3300026075 Ga0207708_10066753 Ga0207708_100667532 212
515 3300026075 Ga0207708_10204076 Ga0207708_102040761 212
516 3300026078 Ga0207702_10271226 Ga0207702_102712261 212
517 3300026088 Ga0207641_10374025 Ga0207641_103740252 212
518 3300026089 Ga0207648_10014945 Ga0207648_1001494510 212
519 3300026089 Ga0207648_10030692 Ga0207648_100306922 212
520 3300026089 Ga0207648_10057117 Ga0207648_100571174 212
521 3300026095 Ga0207676_10030936 Ga0207676_100309365 212
522 3300026095 Ga0207676_10048747 Ga0207676_100487473 212
523 3300026116 Ga0207674_10026473 Ga0207674_100264737 212
524 3300026116 Ga0207674_10154323 Ga0207674_101543233 212
525 3300026118 Ga0207675_100034100 Ga0207675_1000341004 212
526 3300026118 Ga0207675_100069433 Ga0207675_1000694332 212
527 3300026118 Ga0207675_100392341 Ga0207675_1003923412 212
528 3300026118 Ga0207675_100709962 Ga0207675_1007099622 212
529 3300026121 Ga0207683_10021227 Ga0207683_100212272 212
530 3300026121 Ga0207683_10085803 Ga0207683_100858034 212
531 3300026121 Ga0207683_10539874 Ga0207683_105398741 212
532 3300026121 Ga0207683_10929522 Ga0207683_109295221 212
533 3300026142 Ga0207698_10045641 Ga0207698_100456414 212
534 3300026142 Ga0207698_10638719 Ga0207698_106387192 212
535 3300027296 Ga0209389_1000026 Ga0209389_100002699 212
536 3300027296 Ga0209389_1000117 Ga0209389_100011730 212
537 3300027357 Ga0209589_1000001 Ga0209589_1000001185 212
538 3300027357 Ga0209589_1000022 Ga0209589_100002299 212
539 3300027361 Ga0209489_100001 Ga0209489_100001185 212
540 3300027361 Ga0209489_100058 Ga0209489_100058100 212
541 3300027361 Ga0209489_102405 Ga0209489_1024059 212
542 3300027363 Ga0209700_100001 Ga0209700_100001185 212
543 3300027363 Ga0209700_100021 Ga0209700_10002130 212
544 3300027671 Ga0209588_1015760 Ga0209588_10157602 212
545 3300027907 Ga0207428_10000129 Ga0207428_1000012963 212
546 3300028379 Ga0268266_10008307 Ga0268266_1000830710 212
547 3300028379 Ga0268266_10083006 Ga0268266_100830061 212
548 3300028379 Ga0268266_10311719 Ga0268266_103117191 212
549 3300028380 Ga0268265_10200184 Ga0268265_102001842 212
550 3300028380 Ga0268265_10204654 Ga0268265_102046541 212
551 3300033180 Ga0307510_10065385 Ga0307510_100653851 212
552 3300033442 Ga0315911_1000010 Ga0315911_1000010287 212
553 3300035241 Ga0373961_0216258 Ga0373961_0216258_21_659 212
554 3300035695 Ga0373927_0010000 Ga0373927_0010000_1905_2543 212
555 3300036401 Ga0373937_1059467 Ga0373937_1059467_109_747 212
556 3300037068 Ga0373925_0032546 Ga0373925_0032546_2778_3416 212
557 3300037418 Ga0395900_0045800 Ga0395900_0045800_277_987 212
558 3300037418 Ga0395900_0053188 Ga0395900_0053188_1872_2510 212
559 3300037466 Ga0395898_0040300 Ga0395898_0040300_1980_2690 212
560 3300037466 Ga0395898_0073130 Ga0395898_0073130_1631_2269 212
561 3300037466 Ga0395898_0190561 Ga0395898_0190561_429_1067 212
562 3300037466 Ga0395898_0254629 Ga0395898_0254629_151_966 212
563 3300037466 Ga0395898_0260944 Ga0395898_0260944_741_1379 212
564 3300037471 Ga0395905_0129014 Ga0395905_0129014_807_1445 212
565 3300037471 Ga0395905_0163751 Ga0395905_0163751_665_1303 212
566 3300037471 Ga0395905_0216782 Ga0395905_0216782_790_1428 212
567 3300038443 Ga0395901_0032406 Ga0395901_0032406_2602_3240 212
568 3300038443 Ga0395901_0060239 Ga0395901_0060239_2224_2862 212
569 3300038996 Ga0242420_037387 Ga0242420_037387_168_809 212
570 3300041486 Ga0451807_0261817 Ga0451807_0261817_171_809 212
571 3300041501 Ga0451845_0753450 Ga0451845_0753450_441_1079 212
572 3300044658 Ga0466972_0000113 Ga0466972_0000113_25241_25879 212
573 3300044683 Ga0466965_0168816 Ga0466965_0168816_97_735 212
574 3300044765 Ga0466970_0058228 Ga0466970_0058228_1191_1829 212
575 3300045049 Ga0466959_0100592 Ga0466959_0100592_1410_2048 212
576 3300045976 Ga0466967_0761927 Ga0466967_0761927_11_649 212
577 3300046455 Ga0495603_0031711 Ga0495603_0031711_1172_1813 212
578 3300046462 Ga0495651_0317068 Ga0495651_0317068_290_928 212
579 3300046491 Ga0495584_0145729 Ga0495584_0145729_428_1066 212
580 3300046492 Ga0495585_0136118 Ga0495585_0136118_239_877 212
581 3300046518 Ga0495631_0170281 Ga0495631_0170281_161_853 212
582 3300046523 Ga0495644_0051561 Ga0495644_0051561_430_1071 212
583 3300046523 Ga0495644_0113701 Ga0495644_0113701_173_874 212
584 3300046536 Ga0495587_0027109 Ga0495587_0027109_757_1395 212
585 3300046543 Ga0495645_0419453 Ga0495645_0419453_123_761 212
586 3300046615 Ga0495656_0043353 Ga0495656_0043353_998_1699 212
587 3300046615 Ga0495656_0079764 Ga0495656_0079764_113_754 212
588 3300046674 Ga0495588_0134144 Ga0495588_0134144_353_991 212
589 3300046678 Ga0495599_0001619 Ga0495599_0001619_8735_9373 212
590 3300046679 Ga0495623_0089669 Ga0495623_0089669_489_1127 212
591 3300046691 Ga0495670_0137122 Ga0495670_0137122_254_892 212
592 3300046692 Ga0495671_0096101 Ga0495671_0096101_421_1122 212
593 3300046692 Ga0495671_0186238 Ga0495671_0186238_76_714 212
594 3300046809 Ga0495600_0184531 Ga0495600_0184531_183_821 212
595 3300047317 Ga0495604_0228605 Ga0495604_0228605_277_915 212
596 3300047320 Ga0495672_0052638 Ga0495672_0052638_840_1481 212
597 3300047320 Ga0495672_0229890 Ga0495672_0229890_67_705 212
598 3300047322 Ga0495680_0164016 Ga0495680_0164016_455_1093 212
599 3300047444 Ga0495675_0105846 Ga0495675_0105846_715_1353 212
600 3300047472 Ga0495686_0032571 Ga0495686_0032571_1074_1712 212
601 3300047472 Ga0495686_0122640 Ga0495686_0122640_70_771 212
602 3300048088 Ga0495602_0160909 Ga0495602_0160909_162_800 212
603 3300048088 Ga0495602_0395781 Ga0495602_0395781_32_715 212
604 3300048903 Ga0496100_0009755 Ga0496100_0009755_1938_2579 212
605 3300048903 Ga0496100_0090263 Ga0496100_0090263_1154_1810 212
606 3300048903 Ga0496100_0124975 Ga0496100_0124975_95_733 212
607 3300048904 Ga0496101_0014497 Ga0496101_0014497_1176_1814 212
608 3300048904 Ga0496101_0055564 Ga0496101_0055564_1053_1691 212
609 3300048904 Ga0496101_0149686 Ga0496101_0149686_475_1116 212
610 3300048905 Ga0496102_0004216 Ga0496102_0004216_198_839 212
611 3300048905 Ga0496102_0047752 Ga0496102_0047752_2181_2819 212
612 3300048905 Ga0496102_0215349 Ga0496102_0215349_879_1517 212
613 3300048905 Ga0496102_0265592 Ga0496102_0265592_573_1211 212
614 3300048905 Ga0496102_0319796 Ga0496102_0319796_285_923 212
615 3300048906 Ga0496103_0006073 Ga0496103_0006073_5094_5732 212
616 3300048906 Ga0496103_0011676 Ga0496103_0011676_1572_2210 212
617 3300048906 Ga0496103_0297598 Ga0496103_0297598_36_677 212
618 3300048907 Ga0496104_0035437 Ga0496104_0035437_3373_4014 212
619 3300048907 Ga0496104_0072721 Ga0496104_0072721_1286_1963 212
620 3300048907 Ga0496104_0988298 Ga0496104_0988298_41_682 212
621 3300048908 Ga0496105_0011994 Ga0496105_0011994_540_1217 212
622 3300048908 Ga0496105_0035363 Ga0496105_0035363_2032_2670 212
623 3300048908 Ga0496105_0192611 Ga0496105_0192611_449_1090 212
624 3300048909 Ga0496106_0009589 Ga0496106_0009589_2693_3334 212
625 3300048909 Ga0496106_0018599 Ga0496106_0018599_4400_5038 212
626 3300048909 Ga0496106_0138882 Ga0496106_0138882_1020_1658 212
627 3300048910 Ga0496107_0001367 Ga0496107_0001367_9115_9756 212
628 3300048910 Ga0496107_0029040 Ga0496107_0029040_1869_2507 212
629 3300048910 Ga0496107_0030734 Ga0496107_0030734_308_946 212
630 3300048910 Ga0496107_0326294 Ga0496107_0326294_166_807 212
631 3300048910 Ga0496107_0350657 Ga0496107_0350657_87_725 212
632 3300048911 Ga0496108_0338038 Ga0496108_0338038_351_989 212
633 3300048912 Ga0496109_0082403 Ga0496109_0082403_2169_2807 212
634 3300048912 Ga0496109_0300180 Ga0496109_0300180_405_1046 212
635 3300048912 Ga0496109_0333485 Ga0496109_0333485_565_1242 212
636 3300048913 Ga0496110_0008299 Ga0496110_0008299_542_1183 212
637 3300048913 Ga0496110_0030489 Ga0496110_0030489_2194_2832 212
638 3300048914 Ga0496111_0081741 Ga0496111_0081741_185_823 212
639 3300048914 Ga0496111_0375909 Ga0496111_0375909_309_950 212
640 3300048915 Ga0496112_0022256 Ga0496112_0022256_1634_2311 212
641 3300048915 Ga0496112_0048853 Ga0496112_0048853_2315_2956 212
642 3300048915 Ga0496112_0193766 Ga0496112_0193766_181_819 212
643 3300048916 Ga0496113_0020710 Ga0496113_0020710_1524_2162 212
644 3300048916 Ga0496113_0117289 Ga0496113_0117289_93_797 212
645 3300048916 Ga0496113_0448397 Ga0496113_0448397_43_684 212
646 3300048917 Ga0496114_0030373 Ga0496114_0030373_431_1069 212
647 3300048917 Ga0496114_0061607 Ga0496114_0061607_1880_2518 212
648 3300048917 Ga0496114_0245516 Ga0496114_0245516_695_1336 212
649 3300048918 Ga0496115_0013542 Ga0496115_0013542_2112_2753 212
650 3300048918 Ga0496115_0258584 Ga0496115_0258584_143_781 212
651 3300048918 Ga0496115_0318028 Ga0496115_0318028_620_1258 212
652 3300048918 Ga0496115_0321129 Ga0496115_0321129_527_1165 212
653 3300048919 Ga0496116_0085847 Ga0496116_0085847_808_1446 212
654 3300048920 Ga0496117_0039671 Ga0496117_0039671_976_1614 212
655 3300048921 Ga0496118_0018719 Ga0496118_0018719_5283_5921 212
656 3300048921 Ga0496118_0103004 Ga0496118_0103004_931_1572 212
657 3300048922 Ga0496119_0129755 Ga0496119_0129755_43_681 212
658 3300048924 Ga0496121_0001059 Ga0496121_0001059_15773_16414 212
659 3300048924 Ga0496121_0053408 Ga0496121_0053408_150_788 212
660 3300048924 Ga0496121_0116614 Ga0496121_0116614_1367_2005 212
661 3300048924 Ga0496121_0136549 Ga0496121_0136549_241_882 212
662 3300048924 Ga0496121_0175055 Ga0496121_0175055_377_1015 212
663 3300048924 Ga0496121_0296777 Ga0496121_0296777_311_949 212
664 3300048924 Ga0496121_0323802 Ga0496121_0323802_385_1026 212
665 3300048926 Ga0496123_0241306 Ga0496123_0241306_228_866 212
666 3300048928 Ga0496125_0006575 Ga0496125_0006575_554_1192 212
667 3300048929 Ga0496126_0001940 Ga0496126_0001940_12768_13409 212
668 3300048929 Ga0496126_0003509 Ga0496126_0003509_2513_3244 212
669 3300048929 Ga0496126_0300323 Ga0496126_0300323_217_858 212
670 3300048929 Ga0496126_0487507 Ga0496126_0487507_14_652 212
671 3300049569 Ga0501032_0027862 Ga0501032_0027862_3025_3663 212
672 3300049570 Ga0501033_0002631 Ga0501033_0002631_2920_3558 212
673 3300049571 Ga0501034_0015233 Ga0501034_0015233_3095_3733 212
674 3300049572 Ga0501036_0001868 Ga0501036_0001868_4809_5447 212
675 3300049573 Ga0501037_0005101 Ga0501037_0005101_2265_2903 212
676 3300049574 Ga0501038_0000276 Ga0501038_0000276_10554_11192 212
677 3300049575 Ga0501039_0009202 Ga0501039_0009202_2300_2938 212
678 3300049579 Ga0501043_0003013 Ga0501043_0003013_9213_9851 212
679 3300049580 Ga0501046_0011595 Ga0501046_0011595_3930_4568 212
680 3300049581 Ga0501047_0014333 Ga0501047_0014333_4061_4699 212
681 3300049581 Ga0501047_0111567 Ga0501047_0111567_728_1366 212
682 3300049582 Ga0501048_0038426 Ga0501048_0038426_1137_1775 212
683 3300049583 Ga0501067_0002106 Ga0501067_0002106_8265_8903 212
684 3300049584 Ga0501068_0024578 Ga0501068_0024578_96_734 212
685 3300049585 Ga0501069_0000483 Ga0501069_0000483_2855_3493 212
686 3300049586 Ga0501070_0003133 Ga0501070_0003133_2216_2854 212
687 3300049586 Ga0501070_0056921 Ga0501070_0056921_180_818 212
688 3300049587 Ga0501071_0188296 Ga0501071_0188296_848_1486 212
689 3300049588 Ga0501072_0242658 Ga0501072_0242658_617_1255 212
690 3300049589 Ga0501073_0000456 Ga0501073_0000456_2614_3252 212
691 3300049589 Ga0501073_0198737 Ga0501073_0198737_53_691 212
692 3300049590 Ga0501074_0023481 Ga0501074_0023481_1231_1869 212
693 3300049742 Ga0501080_0001321 Ga0501080_0001321_13401_14039 212
694 3300049742 Ga0501080_0144322 Ga0501080_0144322_869_1507 212
695 3300049744 Ga0501083_0351282 Ga0501083_0351282_101_739 212
696 3300049822 Ga0501035_0015892 Ga0501035_0015892_2666_3304 212
697 3300049822 Ga0501035_0494539 Ga0501035_0494539_110_748 212
698 3300049823 Ga0501044_0018935 Ga0501044_0018935_4560_5198 212
699 3300049823 Ga0501044_0021138 Ga0501044_0021138_4554_5192 212
700 3300050490 nmdc:mga03n38_177140_c1 nmdc:mga03n38_177140_c1_422_1063 212
701 3300050490 nmdc:mga03n38_314650_c1 nmdc:mga03n38_314650_c1_166_807 212
702 3300050491 nmdc:mga00v17_143315_c1 nmdc:mga00v17_143315_c1_605_1246 212
703 3300050492 nmdc:mga0yw44_3788_c1 nmdc:mga0yw44_3788_c1_4987_5643 212
704 3300050493 nmdc:mga0k408_33235_c1 nmdc:mga0k408_33235_c1_1735_2373 212
705 3300050494 nmdc:mga06z11_15070_c1 nmdc:mga06z11_15070_c1_1579_2235 212
706 3300050494 nmdc:mga06z11_494833_c1 nmdc:mga06z11_494833_c1_35_700 212
707 3300050495 nmdc:mga04h51_82215_c1 nmdc:mga04h51_82215_c1_132_773 212
708 3300050496 nmdc:mga07m45_69583_c1 nmdc:mga07m45_69583_c1_482_1123 212
709 3300050496 nmdc:mga07m45_76928_c1 nmdc:mga07m45_76928_c1_924_1565 212
710 3300050496 nmdc:mga07m45_87906_c1 nmdc:mga07m45_87906_c1_354_995 212
711 3300050511 nmdc:mga08y16_41292_c1 nmdc:mga08y16_41292_c1_1302_1943 212
712 3300050511 nmdc:mga08y16_51_c1 nmdc:mga08y16_51_c1_32950_33591 212
713 3300050512 nmdc:mga0n895_142219_c1 nmdc:mga0n895_142219_c1_1693_2334 212
714 3300050512 nmdc:mga0n895_608606_c1 nmdc:mga0n895_608606_c1_219_857 212
715 3300050514 nmdc:mga08x19_199733_c1 nmdc:mga08x19_199733_c1_633_1274 212
716 3300050516 nmdc:mga0sz30_91851_c1 nmdc:mga0sz30_91851_c1_630_1271 212
717 3300053077 Ga0495601_0472849 Ga0495601_0472849_56_694 212
718 3300053080 Ga0500635_0089368 Ga0500635_0089368_76_717 212
719 3300053083 Ga0495655_0006222 Ga0495655_0006222_182_820 212
720 3300053085 Ga0495619_0306840 Ga0495619_0306840_441_1079 212
721 3300053086 Ga0500578_0181510 Ga0500578_0181510_62_703 212
722 3300053094 Ga0500566_0001043 Ga0500566_0001043_7323_7961 212
723 3300053119 Ga0500595_000280 Ga0500595_000280_982_1620 212
724 3300053119 Ga0500595_004922 Ga0500595_004922_2497_3135 212
725 3300053139 Ga0500568_0060320 Ga0500568_0060320_305_946 212
726 3300053150 Ga0500603_000163 Ga0500603_000163_5332_5973 212
727 3300053150 Ga0500603_021371 Ga0500603_021371_767_1408 212
728 3300053177 Ga0500636_0042997 Ga0500636_0042997_1098_1739 212
729 3300053178 Ga0500637_0000178 Ga0500637_0000178_5292_5933 212
730 3300060353 Ga0501082_0075174 Ga0501082_0075174_101_739 212

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01966

HD

HD domain

77

196

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
6dk9-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.8218 8 197
6dkd-assembly2.cif.gz_C yeast ddi2 cyanamide hydratase 0.8155 8 197
6dka-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.7934 1 199
6dka-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.7454 1 199
6dk9-assembly4.cif.gz_F yeast ddi2 cyanamide hydratase 0.7383 8 197
ID Description Score Start End Superfamily
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.9116 12 168 1.10.3210.10
af_P0CH63_33_194_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.8798 12 168 1.10.3210.10
af_P9WN29_336_562_1.10.3090.10 Mainly Alpha;Orthogonal Bundle;cca-adding enzyme, domain 2;cca-adding enzyme, domain 2 0.5803 18 151 1.10.3090.10
af_Q58188_1_153_1.10.3210.10 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432;Hypothetical protein af1432 0.5691 17 163 1.10.3210.10
af_Q86JB3_16_237_1.10.3210.50 Mainly Alpha;Orthogonal Bundle;Hypothetical protein af1432; 0.5686 13 180 1.10.3210.50
ID Description Score Start End GO Terms
AF-A0A7V8JKF7-F1-model_v4 HD domain-containing protein 0.9893 1 104
AF-A0A512JR07-F1-model_v4 HD domain-containing protein 0.9887 1 106
AF-A0A0H3KS96-F1-model_v4 Metal-dependent phosphohydrolase 0.9881 1 187
AF-A0A8B4XTV5-F1-model_v4 deleted 0.987 1 153
AF-A0A6P3C0E7-F1-model_v4 deleted 0.9864 1 110

Feature Viewer

pLDDT pTM Quality
93.69 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map