F477829

General Info

Members Datasets Scaffolds Average Seq Length
728 311 1456 145

Family's Representative Sequence

Representative Sequence 3300049743|Ga0501081_0502625|Ga0501081_0502625_19_543
Length 174
Sequence MTGTEDRHRAAGEAGEQPATARRLKPMKLTLAFAMAMVGVCLAGTAVRVAAHHAFAAEFDANKPVEFTGTVTRMEWVNPHVWIHLDVKKPDGKIEAWAFEAGTPNVLFRRGFTKASLMPGTQVKVDGYQAKDGTRRANGRDLTFADGKKLFLGSSGTGAPYELARPGVDTVKPK

Samples

Sample ID Description Type Environment
1 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
4 3300003577 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_32 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
5 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
8 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004801 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-3 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
13 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
14 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
37 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
38 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
39 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
60 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
61 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
62 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
63 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
64 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
71 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
72 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
73 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
79 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
80 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
81 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
82 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
83 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
84 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
85 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
89 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
90 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
91 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
92 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
93 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
94 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
95 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
96 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
97 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
98 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
99 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
100 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
101 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
102 3300012481 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.1.yng.040610 Metagenome Rhizosphere
103 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
112 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
113 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
114 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
115 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
116 3300019166 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
117 3300019181 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
118 3300019182 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
119 3300019183 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA1 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
120 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
121 3300019190 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
122 3300019192 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA3 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
123 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
124 3300023536 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
125 3300023539 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
126 3300023547 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300023552 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300023660 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300023672 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
130 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
186 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300030762 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300030863 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300030877 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300030880 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300030882 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300030942 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300031043 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
202 3300031591 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
203 3300031592 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRA4 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
204 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
205 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
206 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
207 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
208 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
211 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
212 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
213 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
214 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
215 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
216 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
217 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
218 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
219 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
220 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
221 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
222 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
223 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
224 3300036242 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRI5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
225 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
226 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
228 3300036534 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRU5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
229 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
230 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
231 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
232 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
233 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
234 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
235 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
236 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
237 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
238 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
239 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
240 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
241 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
242 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
243 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
244 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
245 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
246 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
247 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
248 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
249 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
250 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
251 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
254 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
255 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
256 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
257 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
258 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
259 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
260 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
261 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
262 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
263 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
264 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
265 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
266 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
267 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
268 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
269 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
270 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
271 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
272 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
273 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
274 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
275 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
276 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
277 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
278 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
279 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
280 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
281 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
282 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
283 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
284 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
285 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
286 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
287 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
288 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
289 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
290 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
291 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
292 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
293 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
294 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
295 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
296 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
297 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
298 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
299 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
300 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
301 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
302 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
303 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
304 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
305 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
306 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
307 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
308 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
309 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
310 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
311 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 90.93
Metatranscriptomes 9.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.14
Nodule 0
Rhizoplane 4.81
Rhizosphere 93.27
Stem 0
Stem Tuber 0
Unclassified 32.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501081_0502625 3300049743 Unclassified 903
2 MBSR1b_contig_9788204 2162886012 Bacteria 917
3 Ga0007417J51691_1010683 3300003544 Unclassified 538
4 Ga0007416J51690_1010618 3300003577 Unclassified 532
5 Ga0007429J51699_1021454 3300003579 Unclassified 523
6 Ga0032354_1011261 3300003693 Unclassified 532
7 Ga0058859_10072345 3300004798 Bacteria 1066
8 Ga0058859_11186929 3300004798 Unclassified 517
9 Ga0058859_11638730 3300004798 Unclassified 944
10 Ga0058859_11818803 3300004798 Bacteria 571
11 Ga0058861_10023400 3300004800 Bacteria 707
12 Ga0058861_10048849 3300004800 Bacteria 1215
13 Ga0058860_10201134 3300004801 Bacteria 739
14 Ga0058860_11904063 3300004801 Unclassified 809
15 Ga0058862_10075301 3300004803 Bacteria 726
16 Ga0065714_10253403 3300005288 Unclassified 770
17 Ga0065704_10109465 3300005289 Bacteria 2002
18 Ga0065704_10409004 3300005289 Bacteria 743
19 Ga0065704_10547703 3300005289 Unclassified 637
20 Ga0065715_10001092 3300005293 Bacteria 13908
21 Ga0065715_10247462 3300005293 Bacteria 1178
22 Ga0065707_10022615 3300005295 Bacteria 2599
23 Ga0065707_10086330 3300005295 Bacteria 5518
24 Ga0065707_10194827 3300005295 Bacteria 1341
25 Ga0065707_10206502 3300005295 Unclassified 1286
26 Ga0065707_10323440 3300005295 Bacteria 962
27 Ga0065707_10413985 3300005295 Bacteria 785
28 Ga0065707_10684438 3300005295 Unclassified 647
29 Ga0070676_10602851 3300005328 Unclassified 792
30 Ga0070683_100349204 3300005329 Bacteria 1409
31 Ga0070690_100529067 3300005330 Bacteria 886
32 Ga0070670_100033200 3300005331 Bacteria 4446
33 Ga0070670_100919199 3300005331 Bacteria 794
34 Ga0070677_10290701 3300005333 Unclassified 827
35 Ga0070677_10374411 3300005333 Unclassified 744
36 Ga0070666_10148813 3300005335 Bacteria 1633
37 Ga0070680_100042783 3300005336 Bacteria 3677
38 Ga0070680_100172200 3300005336 Bacteria 1822
39 Ga0070680_100436596 3300005336 Bacteria 1118
40 Ga0070682_100280247 3300005337 Bacteria 1215
41 Ga0070682_101447962 3300005337 Unclassified 589
42 Ga0068868_100062622 3300005338 Bacteria 2949
43 Ga0068868_101338418 3300005338 Unclassified 666
44 Ga0070660_100003979 3300005339 Bacteria 10209
45 Ga0070660_100047214 3300005339 Bacteria 3303
46 Ga0070689_100136244 3300005340 Bacteria 1972
47 Ga0070689_100143951 3300005340 Bacteria 1919
48 Ga0070689_100145929 3300005340 Bacteria 1906
49 Ga0070689_101695813 3300005340 Bacteria 575
50 Ga0070691_10297354 3300005341 Unclassified 881
51 Ga0070691_11077953 3300005341 Bacteria 505
52 Ga0070661_100122593 3300005344 Bacteria 1948
53 Ga0070661_100246223 3300005344 Bacteria 1378
54 Ga0070669_100687534 3300005353 Bacteria 863
55 Ga0070669_100796583 3300005353 Viruses 803
56 Ga0070669_101643444 3300005353 Bacteria 560
57 Ga0070675_100119451 3300005354 Unclassified 2239
58 Ga0070675_100333163 3300005354 Unclassified 1343
59 Ga0070675_100926968 3300005354 Unclassified 799
60 Ga0070675_101717037 3300005354 Unclassified 579
61 Ga0070671_100017195 3300005355 Bacteria 5854
62 Ga0070671_100032305 3300005355 Bacteria 4328
63 Ga0070671_100468479 3300005355 Bacteria 1082
64 Ga0070674_100076726 3300005356 Bacteria 2377
65 Ga0070674_100432313 3300005356 Bacteria 1083
66 Ga0070674_100565255 3300005356 Unclassified 956
67 Ga0070674_101030270 3300005356 Bacteria 724
68 Ga0070674_101747642 3300005356 Bacteria 563
69 Ga0070673_100528608 3300005364 Unclassified 1070
70 Ga0070673_101420803 3300005364 Unclassified 653
71 Ga0070659_100176669 3300005366 Bacteria 1751
72 Ga0070659_100360526 3300005366 Bacteria 1221
73 Ga0070713_100453459 3300005436 Unclassified 1205
74 Ga0070710_10478074 3300005437 Unclassified 849
75 Ga0070710_10887745 3300005437 Unclassified 643
76 Ga0070711_100164558 3300005439 Bacteria 1685
77 Ga0070705_100000232 3300005440 Bacteria 33169
78 Ga0070705_100528945 3300005440 Unclassified 900
79 Ga0070705_101113241 3300005440 Unclassified 647
80 Ga0070700_100523189 3300005441 Unclassified 916
81 Ga0070700_100991746 3300005441 Unclassified 690
82 Ga0070694_100004381 3300005444 Bacteria 8496
83 Ga0070694_100005469 3300005444 Bacteria 7692
84 Ga0070694_100105045 3300005444 Bacteria 2004
85 Ga0070694_100546533 3300005444 Bacteria 927
86 Ga0070694_100768087 3300005444 Bacteria 788
87 Ga0070694_101539946 3300005444 Unclassified 563
88 Ga0070708_100497461 3300005445 Unclassified 1150
89 Ga0070708_100729465 3300005445 Bacteria 932
90 Ga0070708_100793447 3300005445 Bacteria 890
91 Ga0070708_100888626 3300005445 Bacteria 837
92 Ga0070708_100926403 3300005445 Unclassified 818
93 Ga0070663_100549838 3300005455 Bacteria 965
94 Ga0070663_100660729 3300005455 Bacteria 885
95 Ga0070678_100191289 3300005456 Bacteria 1683
96 Ga0070662_101234249 3300005457 Unclassified 643
97 Ga0070681_10086182 3300005458 Bacteria 3094
98 Ga0070681_10493676 3300005458 Bacteria 1137
99 Ga0070685_10301797 3300005466 Unclassified 1079
100 Ga0070706_100059472 3300005467 Bacteria 3527
101 Ga0070706_101248504 3300005467 Unclassified 682
102 Ga0070707_100115761 3300005468 Bacteria 2602
103 Ga0070707_100442238 3300005468 Bacteria 1261
104 Ga0070707_100580562 3300005468 Unclassified 1083
105 Ga0070698_100147906 3300005471 Bacteria 2298
106 Ga0070698_100176146 3300005471 Bacteria 2078
107 Ga0070698_100265364 3300005471 Bacteria 1649
108 Ga0070698_100293122 3300005471 Bacteria 1558
109 Ga0070698_100413878 3300005471 Unclassified 1282
110 Ga0070698_100436111 3300005471 Bacteria 1245
111 Ga0070698_100460188 3300005471 Bacteria 1208
112 Ga0070698_100727429 3300005471 Bacteria 935
113 Ga0070698_101541784 3300005471 Bacteria 616
114 Ga0070699_100013808 3300005518 Bacteria 6948
115 Ga0070699_100405465 3300005518 Unclassified 1233
116 Ga0070699_100702222 3300005518 Bacteria 924
117 Ga0070699_100901620 3300005518 Unclassified 810
118 Ga0070679_100250167 3300005530 Bacteria 1729
119 Ga0070679_100369068 3300005530 Bacteria 1382
120 Ga0070684_101822605 3300005535 Bacteria 574
121 Ga0070697_100028041 3300005536 Bacteria 4508
122 Ga0070697_100254200 3300005536 Bacteria 1503
123 Ga0070697_100338892 3300005536 Unclassified 1297
124 Ga0070697_101827031 3300005536 Unclassified 544
125 Ga0070697_101973147 3300005536 Unclassified 522
126 Ga0068853_101725249 3300005539 Bacteria 607
127 Ga0070672_100297359 3300005543 Unclassified 1368
128 Ga0070672_100954671 3300005543 Bacteria 759
129 Ga0070686_100274879 3300005544 Unclassified 1240
130 Ga0070686_100557679 3300005544 Bacteria 897
131 Ga0070695_100001588 3300005545 Bacteria 12702
132 Ga0070695_100022124 3300005545 Bacteria 3897
133 Ga0070695_100177742 3300005545 Bacteria 1506
134 Ga0070695_100355221 3300005545 Bacteria 1099
135 Ga0070695_100566121 3300005545 Bacteria 888
136 Ga0070695_100632025 3300005545 Unclassified 844
137 Ga0070696_100000411 3300005546 Bacteria 26681
138 Ga0070696_100186800 3300005546 Unclassified 1540
139 Ga0070696_100256152 3300005546 Bacteria 1325
140 Ga0070696_100348547 3300005546 Unclassified 1146
141 Ga0070696_101151088 3300005546 Unclassified 654
142 Ga0070665_100008061 3300005548 Bacteria 10664
143 Ga0070665_102115938 3300005548 Unclassified 567
144 Ga0070704_100030551 3300005549 Bacteria 3611
145 Ga0070704_100050782 3300005549 Unclassified 2917
146 Ga0070704_100062970 3300005549 Bacteria 2661
147 Ga0070704_100342372 3300005549 Bacteria 1259
148 Ga0068855_100120246 3300005563 Bacteria 3006
149 Ga0068855_100139219 3300005563 Unclassified 2768
150 Ga0070664_100122008 3300005564 Bacteria 2283
151 Ga0070664_100417775 3300005564 Bacteria 1228
152 Ga0070664_100824690 3300005564 Unclassified 868
153 Ga0070664_101108056 3300005564 Bacteria 746
154 Ga0068857_100234999 3300005577 Bacteria 1677
155 Ga0068857_101035527 3300005577 Unclassified 791
156 Ga0068854_100156301 3300005578 Bacteria 1762
157 Ga0068854_101232842 3300005578 Bacteria 671
158 Ga0068854_101475482 3300005578 Bacteria 617
159 Ga0070702_100347464 3300005615 Unclassified 1043
160 Ga0068852_100002606 3300005616 Bacteria 12458
161 Ga0068859_100028296 3300005617 Bacteria 5618
162 Ga0068859_100164723 3300005617 Bacteria 2297
163 Ga0068859_100776823 3300005617 Unclassified 1046
164 Ga0068859_100800577 3300005617 Bacteria 1030
165 Ga0068861_100185259 3300005719 Bacteria 1736
166 Ga0068861_100799908 3300005719 Bacteria 885
167 Ga0068851_10226663 3300005834 Bacteria 1052
168 Ga0068863_100036196 3300005841 Unclassified 4702
169 Ga0068863_100376561 3300005841 Bacteria 1386
170 Ga0068858_100260294 3300005842 Unclassified 1649
171 Ga0068858_100324162 3300005842 Bacteria 1473
172 Ga0068860_101138172 3300005843 Bacteria 800
173 Ga0068860_101491355 3300005843 Unclassified 698
174 Ga0068862_100041044 3300005844 Bacteria 3936
175 Ga0068862_100062270 3300005844 Unclassified 3208
176 Ga0068862_100211234 3300005844 Bacteria 1754
177 Ga0068862_100764274 3300005844 Viruses 941
178 Ga0068862_100794106 3300005844 Bacteria 924
179 Ga0081455_10076217 3300005937 Unclassified 2763
180 Ga0075432_10275847 3300006058 Bacteria 690
181 Ga0075427_10011414 3300006194 Bacteria 1339
182 Ga0097621_100022525 3300006237 Bacteria 4891
183 Ga0097621_100214148 3300006237 Bacteria 1677
184 Ga0097621_101226914 3300006237 Unclassified 707
185 Ga0097621_101316266 3300006237 Bacteria 683
186 Ga0097621_101334619 3300006237 Unclassified 678
187 Ga0068871_100013231 3300006358 Bacteria 6119
188 Ga0068871_100016898 3300006358 Bacteria 5508
189 Ga0068871_101459849 3300006358 Bacteria 646
190 Ga0075428_100274049 3300006844 Bacteria 1815
191 Ga0075428_100284100 3300006844 Unclassified 1780
192 Ga0075428_100682649 3300006844 Bacteria 1094
193 Ga0075428_100715222 3300006844 Unclassified 1067
194 Ga0075430_100045905 3300006846 Bacteria 3690
195 Ga0075430_100121606 3300006846 Unclassified 2176
196 Ga0075430_100132031 3300006846 Bacteria 2081
197 Ga0075430_100176975 3300006846 Unclassified 1775
198 Ga0075430_100306757 3300006846 Bacteria 1313
199 Ga0075430_100436957 3300006846 Bacteria 1080
200 Ga0075431_100029028 3300006847 Bacteria 5690
201 Ga0075431_100967474 3300006847 Bacteria 819
202 Ga0075431_100998855 3300006847 Bacteria 804
203 Ga0075431_101128958 3300006847 Unclassified 748
204 Ga0075431_101440366 3300006847 Unclassified 648
205 Ga0075433_10038967 3300006852 Bacteria 4107
206 Ga0075433_10087269 3300006852 Unclassified 2755
207 Ga0075433_10103135 3300006852 Bacteria 2526
208 Ga0075433_10696253 3300006852 Bacteria 890
209 Ga0075433_11654195 3300006852 Unclassified 552
210 Ga0075434_100008102 3300006871 Bacteria 9747
211 Ga0075434_100008471 3300006871 Bacteria 9565
212 Ga0075434_100022183 3300006871 Bacteria 6184
213 Ga0075434_100115659 3300006871 Bacteria 2695
214 Ga0075434_100296563 3300006871 Bacteria 1637
215 Ga0075434_100406577 3300006871 Unclassified 1382
216 Ga0075434_100582709 3300006871 Unclassified 1138
217 Ga0075434_101084233 3300006871 Bacteria 814
218 Ga0075429_100082944 3300006880 Bacteria 2795
219 Ga0075429_100301250 3300006880 Bacteria 1403
220 Ga0075429_100597800 3300006880 Bacteria 967
221 Ga0075429_100744344 3300006880 Unclassified 859
222 Ga0068865_100511232 3300006881 Bacteria 1003
223 Ga0068865_102067162 3300006881 Bacteria 518
224 Ga0075436_100158395 3300006914 Unclassified 1595
225 Ga0075436_100188123 3300006914 Bacteria 1460
226 Ga0097620_100028296 3300006931 Bacteria 5618
227 Ga0097620_100164716 3300006931 Bacteria 2297
228 Ga0097620_100776708 3300006931 Unclassified 1046
229 Ga0097620_100800387 3300006931 Bacteria 1030
230 Ga0075435_100013021 3300007076 Bacteria 6175
231 Ga0075435_100013547 3300007076 Bacteria 6070
232 Ga0075435_100014122 3300007076 Bacteria 5959
233 Ga0075435_100186562 3300007076 Bacteria 1754
234 Ga0075435_100196693 3300007076 Unclassified 1707
235 Ga0075435_100197827 3300007076 Bacteria 1702
236 Ga0075435_100230807 3300007076 Bacteria 1572
237 Ga0075435_100623317 3300007076 Bacteria 936
238 Ga0075435_101309768 3300007076 Unclassified 634
239 Ga0099794_10427052 3300007265 Unclassified 694
240 Ga0099794_10748895 3300007265 Bacteria 522
241 Ga0111539_10005857 3300009094 Bacteria 15882
242 Ga0111539_10007902 3300009094 Bacteria 13575
243 Ga0111539_10026839 3300009094 Bacteria 7036
244 Ga0111539_10068618 3300009094 Bacteria 4186
245 Ga0111539_10086047 3300009094 Bacteria 3694
246 Ga0111539_10629223 3300009094 Unclassified 1250
247 Ga0105245_10030994 3300009098 Bacteria 4730
248 Ga0105245_11862405 3300009098 Unclassified 655
249 Ga0105247_10283615 3300009101 Unclassified 1143
250 Ga0105247_11077657 3300009101 Unclassified 632
251 Ga0114129_10004689 3300009147 Bacteria 19309
252 Ga0114129_10016710 3300009147 Bacteria 10451
253 Ga0114129_10022112 3300009147 Bacteria 9025
254 Ga0114129_10022514 3300009147 Bacteria 8941
255 Ga0114129_10026052 3300009147 Bacteria 8281
256 Ga0114129_10043505 3300009147 Bacteria 6318
257 Ga0114129_10073273 3300009147 Bacteria 4771
258 Ga0114129_10139813 3300009147 Bacteria 3320
259 Ga0114129_10172932 3300009147 Unclassified 2943
260 Ga0114129_10230246 3300009147 Bacteria 2496
261 Ga0114129_10385371 3300009147 Bacteria 1850
262 Ga0114129_10394371 3300009147 Bacteria 1825
263 Ga0114129_10397821 3300009147 Bacteria 1816
264 Ga0114129_10490094 3300009147 Bacteria 1607
265 Ga0114129_10826849 3300009147 Unclassified 1179
266 Ga0114129_11016356 3300009147 Bacteria 1043
267 Ga0114129_11306984 3300009147 Bacteria 899
268 Ga0114129_11703402 3300009147 Bacteria 769
269 Ga0114129_12288817 3300009147 Bacteria 649
270 Ga0105243_10197418 3300009148 Unclassified 1762
271 Ga0105243_10902189 3300009148 Unclassified 879
272 Ga0105243_10977212 3300009148 Bacteria 848
273 Ga0105243_11683883 3300009148 Bacteria 663
274 Ga0105241_10408916 3300009174 Unclassified 1192
275 Ga0105241_11513930 3300009174 Unclassified 646
276 Ga0105242_10003868 3300009176 Bacteria 11645
277 Ga0105242_10126639 3300009176 Unclassified 2199
278 Ga0105242_10190550 3300009176 Unclassified 1815
279 Ga0105242_10261267 3300009176 Bacteria 1564
280 Ga0105248_10014933 3300009177 Bacteria 8550
281 Ga0105248_10108988 3300009177 Bacteria 3122
282 Ga0105248_10520042 3300009177 Bacteria 1342
283 Ga0105248_11345451 3300009177 Bacteria 808
284 Ga0105238_10011270 3300009551 Bacteria 8998
285 Ga0105238_10170006 3300009551 Unclassified 2156
286 Ga0105238_10809741 3300009551 Unclassified 952
287 Ga0105238_11462849 3300009551 Bacteria 711
288 Ga0105249_10029389 3300009553 Bacteria 4963
289 Ga0105249_10288439 3300009553 Bacteria 1642
290 Ga0099796_10016922 3300010159 Bacteria 2162
291 Ga0105239_10042669 3300010375 Bacteria 4970
292 Ga0105239_13087922 3300010375 Unclassified 542
293 Ga0105246_10047489 3300011119 Bacteria 2932
294 Ga0105246_10609626 3300011119 Unclassified 944
295 Ga0157320_1031879 3300012481 Unclassified 535
296 Ga0157371_11137339 3300013102 Unclassified 600
297 Ga0157374_10029941 3300013296 Bacteria 4938
298 Ga0157374_10398714 3300013296 Bacteria 1372
299 Ga0157374_10551557 3300013296 Bacteria 1160
300 Ga0157378_10303308 3300013297 Bacteria 1546
301 Ga0157378_10575913 3300013297 Bacteria 1134
302 Ga0157378_10951275 3300013297 Unclassified 892
303 Ga0157378_11073801 3300013297 Bacteria 841
304 Ga0157378_12206366 3300013297 Bacteria 602
305 Ga0163162_10028638 3300013306 Bacteria 5513
306 Ga0163162_10033094 3300013306 Bacteria 5135
307 Ga0163162_10570737 3300013306 Bacteria 1259
308 Ga0157372_10537862 3300013307 Bacteria 1362
309 Ga0157375_10448790 3300013308 Unclassified 1455
310 Ga0163163_10016188 3300014325 Bacteria 6923
311 Ga0157380_10032202 3300014326 Unclassified 4031
312 Ga0157380_10135639 3300014326 Bacteria 2106
313 Ga0157380_10570134 3300014326 Bacteria 1114
314 Ga0157380_10754057 3300014326 Bacteria 985
315 Ga0157380_12585105 3300014326 Unclassified 574
316 Ga0182008_10693451 3300014497 Bacteria 581
317 Ga0157377_10556432 3300014745 Bacteria 811
318 Ga0157379_10056291 3300014968 Bacteria 3514
319 Ga0157379_12426644 3300014968 Unclassified 523
320 Ga0157376_10187168 3300014969 Bacteria 1896
321 Ga0157376_10314177 3300014969 Bacteria 1487
322 Ga0157376_10860404 3300014969 Bacteria 922
323 Ga0157376_11413627 3300014969 Unclassified 727
324 Ga0163161_10242627 3300017792 Bacteria 1402
325 Ga0163161_10691052 3300017792 Bacteria 849
326 Ga0184595_112250 3300019166 Unclassified 604
327 Ga0184594_107199 3300019181 Bacteria 536
328 Ga0184598_107632 3300019182 Unclassified 811
329 Ga0184598_132634 3300019182 Bacteria 1291
330 Ga0184601_130196 3300019183 Unclassified 737
331 Ga0184601_132320 3300019183 Bacteria 521
332 Ga0184599_123219 3300019188 Unclassified 567
333 Ga0184600_108622 3300019190 Unclassified 836
334 Ga0184600_138350 3300019190 Bacteria 893
335 Ga0184600_148188 3300019190 Unclassified 561
336 Ga0184603_116527 3300019192 Unclassified 689
337 Ga0184603_120065 3300019192 Bacteria 1107
338 Ga0184603_135405 3300019192 Bacteria 1017
339 Ga0213875_10115506 3300021388 Bacteria 1254
340 Ga0247552_100601 3300023536 Bacteria 920
341 Ga0247555_100187 3300023539 Bacteria 1448
342 Ga0247555_100771 3300023539 Unclassified 892
343 Ga0247554_100978 3300023547 Unclassified 929
344 Ga0247551_102899 3300023552 Unclassified 644
345 Ga0247550_101646 3300023660 Bacteria 722
346 Ga0247553_100295 3300023672 Bacteria 1718
347 Ga0247553_101951 3300023672 Unclassified 922
348 Ga0247553_109403 3300023672 Unclassified 554
349 Ga0207697_10031113 3300025315 Bacteria 2183
350 Ga0207656_10628137 3300025321 Bacteria 549
351 Ga0207682_10012968 3300025893 Bacteria 3250
352 Ga0207682_10611429 3300025893 Unclassified 513
353 Ga0207680_10791828 3300025903 Unclassified 680
354 Ga0207699_10842330 3300025906 Unclassified 675
355 Ga0207645_10531481 3300025907 Unclassified 797
356 Ga0207705_10010062 3300025909 Bacteria 6883
357 Ga0207684_10103785 3300025910 Bacteria 2431
358 Ga0207684_10913061 3300025910 Unclassified 738
359 Ga0207654_10033685 3300025911 Bacteria 2842
360 Ga0207654_10319151 3300025911 Unclassified 1061
361 Ga0207707_10078538 3300025912 Bacteria 2882
362 Ga0207707_10411601 3300025912 Bacteria 1160
363 Ga0207695_10004930 3300025913 Bacteria 17986
364 Ga0207671_10512189 3300025914 Unclassified 957
365 Ga0207663_10439212 3300025916 Bacteria 1005
366 Ga0207660_10097651 3300025917 Bacteria 2189
367 Ga0207660_10204570 3300025917 Bacteria 1543
368 Ga0207657_10009853 3300025919 Bacteria 9568
369 Ga0207657_10032222 3300025919 Bacteria 4738
370 Ga0207649_10094350 3300025920 Bacteria 1966
371 Ga0207652_10283055 3300025921 Bacteria 1496
372 Ga0207646_10085149 3300025922 Bacteria 2828
373 Ga0207646_10141967 3300025922 Bacteria 2163
374 Ga0207646_10413636 3300025922 Bacteria 1218
375 Ga0207646_10504998 3300025922 Unclassified 1089
376 Ga0207646_10513978 3300025922 Bacteria 1078
377 Ga0207681_10213413 3300025923 Unclassified 1489
378 Ga0207681_10723226 3300025923 Bacteria 829
379 Ga0207694_10014997 3300025924 Bacteria 5844
380 Ga0207694_10237608 3300025924 Unclassified 1489
381 Ga0207694_10246003 3300025924 Bacteria 1462
382 Ga0207650_10116726 3300025925 Bacteria 2073
383 Ga0207650_10831328 3300025925 Bacteria 783
384 Ga0207659_10098946 3300025926 Bacteria 2195
385 Ga0207659_10137841 3300025926 Unclassified 1891
386 Ga0207659_10460176 3300025926 Bacteria 1072
387 Ga0207659_11229936 3300025926 Unclassified 644
388 Ga0207687_10229087 3300025927 Unclassified 1467
389 Ga0207700_10334508 3300025928 Unclassified 1315
390 Ga0207644_10166695 3300025931 Bacteria 1717
391 Ga0207644_10257409 3300025931 Bacteria 1394
392 Ga0207644_10586941 3300025931 Bacteria 924
393 Ga0207706_10053218 3300025933 Bacteria 3573
394 Ga0207686_10026763 3300025934 Bacteria 3369
395 Ga0207709_10014511 3300025935 Bacteria 4352
396 Ga0207670_10104663 3300025936 Bacteria 2027
397 Ga0207670_10110754 3300025936 Bacteria 1978
398 Ga0207670_10232159 3300025936 Bacteria 1417
399 Ga0207670_10846348 3300025936 Bacteria 764
400 Ga0207669_10191634 3300025937 Bacteria 1475
401 Ga0207669_10328195 3300025937 Bacteria 1174
402 Ga0207704_10455603 3300025938 Bacteria 1022
403 Ga0207704_10464280 3300025938 Bacteria 1013
404 Ga0207665_10201907 3300025939 Unclassified 1449
405 Ga0207691_10367728 3300025940 Unclassified 1229
406 Ga0207691_10445501 3300025940 Bacteria 1102
407 Ga0207691_10545683 3300025940 Bacteria 983
408 Ga0207711_10036120 3300025941 Bacteria 4192
409 Ga0207711_10064889 3300025941 Bacteria 3155
410 Ga0207711_10118915 3300025941 Unclassified 2357
411 Ga0207711_10274728 3300025941 Unclassified 1551
412 Ga0207711_10449749 3300025941 Bacteria 1199
413 Ga0207711_11511971 3300025941 Bacteria 614
414 Ga0207689_10113735 3300025942 Bacteria 2224
415 Ga0207689_10544458 3300025942 Unclassified 975
416 Ga0207679_10400332 3300025945 Bacteria 1207
417 Ga0207679_10501797 3300025945 Bacteria 1083
418 Ga0207679_11632045 3300025945 Unclassified 591
419 Ga0207667_10002175 3300025949 Bacteria 24580
420 Ga0207667_10119591 3300025949 Unclassified 2715
421 Ga0207651_10013919 3300025960 Bacteria 4626
422 Ga0207651_10115547 3300025960 Bacteria 2024
423 Ga0207651_10121173 3300025960 Bacteria 1984
424 Ga0207651_10789743 3300025960 Unclassified 841
425 Ga0207712_10080540 3300025961 Unclassified 2369
426 Ga0207712_10915002 3300025961 Bacteria 776
427 Ga0207668_10909009 3300025972 Bacteria 784
428 Ga0207640_11071864 3300025981 Bacteria 712
429 Ga0207658_10499799 3300025986 Bacteria 1083
430 Ga0207703_10174779 3300026035 Bacteria 1892
431 Ga0207703_10181482 3300026035 Bacteria 1858
432 Ga0207703_10715430 3300026035 Unclassified 953
433 Ga0207678_10728428 3300026067 Bacteria 874
434 Ga0207678_10928271 3300026067 Bacteria 770
435 Ga0207708_10372967 3300026075 Bacteria 1175
436 Ga0207708_10426875 3300026075 Bacteria 1100
437 Ga0207708_10714464 3300026075 Bacteria 857
438 Ga0207641_10025938 3300026088 Unclassified 4836
439 Ga0207641_10295961 3300026088 Bacteria 1527
440 Ga0207641_11059529 3300026088 Unclassified 809
441 Ga0207648_10856467 3300026089 Bacteria 848
442 Ga0207676_10035182 3300026095 Bacteria 3799
443 Ga0207676_10071567 3300026095 Unclassified 2785
444 Ga0207674_10938990 3300026116 Unclassified 833
445 Ga0207675_100129929 3300026118 Bacteria 2388
446 Ga0207675_100300710 3300026118 Bacteria 1563
447 Ga0207675_100364736 3300026118 Bacteria 1418
448 Ga0207675_100904106 3300026118 Bacteria 899
449 Ga0207683_10052578 3300026121 Bacteria 3569
450 Ga0207683_10094083 3300026121 Bacteria 2671
451 Ga0207683_10493224 3300026121 Unclassified 1131
452 Ga0207683_10704753 3300026121 Bacteria 936
453 Ga0207698_10011155 3300026142 Bacteria 5813
454 Ga0209981_1076324 3300027378 Bacteria 520
455 Ga0209179_1065973 3300027512 Bacteria 789
456 Ga0209588_1195391 3300027671 Bacteria 631
457 Ga0207428_10008384 3300027907 Bacteria 9335
458 Ga0207428_10049823 3300027907 Unclassified 3354
459 Ga0207428_10064040 3300027907 Bacteria 2903
460 Ga0207428_10357147 3300027907 Bacteria 1074
461 Ga0207428_10371157 3300027907 Unclassified 1051
462 Ga0207428_11026552 3300027907 Unclassified 579
463 Ga0268266_10040434 3300028379 Bacteria 3974
464 Ga0268266_10066674 3300028379 Bacteria 3114
465 Ga0268266_10321823 3300028379 Bacteria 1448
466 Ga0268265_10136854 3300028380 Bacteria 2045
467 Ga0268265_10393376 3300028380 Bacteria 1279
468 Ga0268265_10791883 3300028380 Bacteria 923
469 Ga0268265_10902150 3300028380 Unclassified 868
470 Ga0268265_11282323 3300028380 Bacteria 732
471 Ga0268265_11373262 3300028380 Viruses 708
472 Ga0268264_10138975 3300028381 Unclassified 2164
473 Ga0268264_10426773 3300028381 Unclassified 1280
474 Ga0268264_11425281 3300028381 Unclassified 703
475 Ga0265775_106454 3300030762 Unclassified 690
476 Ga0265763_1049028 3300030763 Unclassified 528
477 Ga0265767_113947 3300030836 Bacteria 568
478 Ga0265766_1002073 3300030863 Bacteria 1080
479 Ga0265766_1006154 3300030863 Bacteria 779
480 Ga0265766_1013719 3300030863 Unclassified 611
481 Ga0265777_119631 3300030877 Unclassified 552
482 Ga0265777_123331 3300030877 Bacteria 521
483 Ga0265776_105535 3300030880 Bacteria 666
484 Ga0265764_104876 3300030882 Unclassified 739
485 Ga0265769_102478 3300030888 Unclassified 971
486 Ga0265769_102982 3300030888 Bacteria 918
487 Ga0247549_100112 3300030942 Bacteria 1944
488 Ga0247549_105024 3300030942 Bacteria 522
489 Ga0265768_103308 3300030963 Unclassified 862
490 Ga0265768_109198 3300030963 Bacteria 622
491 Ga0265779_103728 3300031043 Bacteria 787
492 Ga0265779_104602 3300031043 Unclassified 738
493 Ga0265779_105332 3300031043 Unclassified 703
494 Ga0265779_106571 3300031043 Bacteria 655
495 Ga0265760_10059748 3300031090 Bacteria 1157
496 Ga0265760_10063407 3300031090 Bacteria 1126
497 Ga0307408_100069574 3300031548 Bacteria 2596
498 Ga0310116_117713 3300031591 Unclassified 605
499 Ga0310117_119121 3300031592 Bacteria 690
500 Ga0307405_10015882 3300031731 Bacteria 4091
501 Ga0307405_10215506 3300031731 Bacteria 1405
502 Ga0307407_11164326 3300031903 Unclassified 601
503 Ga0307412_10100000 3300031911 Bacteria 2049
504 Ga0307409_100112170 3300031995 Bacteria 2289
505 Ga0307409_100170094 3300031995 Bacteria 1917
506 Ga0307416_100129773 3300032002 Bacteria 2266
507 Ga0307416_100321619 3300032002 Bacteria 1549
508 Ga0307416_100692375 3300032002 Bacteria 1108
509 Ga0307416_102434030 3300032002 Unclassified 623
510 Ga0307411_12062408 3300032005 Unclassified 533
511 Ga0316053_100759 3300032120 Bacteria 1561
512 Ga0307415_100084836 3300032126 Bacteria 2274
513 Ga0307415_101174591 3300032126 Unclassified 722
514 Ga0307415_101412329 3300032126 Unclassified 663
515 Ga0373928_0228002 3300035084 Unclassified 547
516 Ga0373934_0168045 3300035086 Bacteria 900
517 Ga0373951_0015341 3300035091 Unclassified 1725
518 Ga0373945_0183782 3300035116 Bacteria 862
519 Ga0373960_0132419 3300035121 Bacteria 837
520 Ga0373943_0123123 3300035170 Bacteria 1380
521 Ga0373946_0162384 3300035171 Bacteria 1050
522 Ga0373955_0073647 3300035172 Bacteria 1915
523 Ga0373955_0244947 3300035172 Bacteria 1074
524 Ga0373942_0039485 3300035207 Unclassified 1284
525 Ga0373942_0340802 3300035207 Bacteria 528
526 Ga0373935_0882798 3300035692 Unclassified 662
527 Ga0373933_0222351 3300035724 Unclassified 1212
528 Ga0373947_0166200 3300035725 Unclassified 1429
529 Ga0373947_0180322 3300035725 Bacteria 1375
530 Ga0310104_18783 3300036242 Bacteria 526
531 Ga0373937_0033021 3300036401 Bacteria 4697
532 Ga0373937_0124517 3300036401 Bacteria 2404
533 Ga0373937_0314271 3300036401 Unclassified 1482
534 Ga0373937_1267584 3300036401 Unclassified 685
535 Ga0265778_010184 3300036457 Bacteria 1068
536 Ga0265778_027875 3300036457 Bacteria 721
537 Ga0372808_066545 3300036459 Bacteria 520
538 Ga0310109_053158 3300036534 Bacteria 520
539 Ga0310109_055582 3300036534 Unclassified 507
540 Ga0373925_0135852 3300037068 Bacteria 1922
541 Ga0373925_0155400 3300037068 Bacteria 1799
542 Ga0373925_0545658 3300037068 Unclassified 953
543 Ga0373925_0871551 3300037068 Bacteria 742
544 Ga0436360_0025296 3300039438 Unclassified 1123
545 Ga0439439_0172699 3300041406 Bacteria 620
546 Ga0439453_0013711 3300041408 Bacteria 1381
547 Ga0439431_0078572 3300041997 Unclassified 887
548 Ga0439433_0055396 3300041999 Bacteria 939
549 Ga0439433_0145944 3300041999 Unclassified 607
550 Ga0439450_159757 3300042008 Bacteria 593
551 Ga0439446_0208232 3300042156 Unclassified 662
552 Ga0439434_0021034 3300042435 Bacteria 1960
553 Ga0453683_0622410 3300044673 Bacteria 705
554 Ga0453683_0643986 3300044673 Unclassified 693
555 Ga0453684_1843416 3300044712 Bacteria 614
556 Ga0451576_0607933 3300045051 Unclassified 1149
557 Ga0451576_0639388 3300045051 Unclassified 1118
558 Ga0451576_1535988 3300045051 Unclassified 691
559 Ga0495592_0812871 3300046454 Unclassified 555
560 Ga0495603_0089832 3300046455 Bacteria 1797
561 Ga0495603_0301166 3300046455 Bacteria 921
562 Ga0495603_0429874 3300046455 Unclassified 756
563 Ga0495590_0176043 3300046457 Unclassified 781
564 Ga0495629_0830132 3300046459 Bacteria 609
565 Ga0495582_0438002 3300046473 Bacteria 754
566 Ga0495639_0380625 3300046475 Bacteria 711
567 Ga0495594_0006349 3300046499 Bacteria 6079
568 Ga0495628_0266329 3300046516 Bacteria 1276
569 Ga0495586_0269810 3300046535 Unclassified 973
570 Ga0495586_0330952 3300046535 Bacteria 874
571 Ga0495598_0029991 3300046537 Archaea 1520
572 Ga0495621_0011706 3300046539 Bacteria 2722
573 Ga0495621_0041558 3300046539 Archaea 1615
574 Ga0495621_0058587 3300046539 Unclassified 1393
575 Ga0495633_0030114 3300046558 Bacteria 2638
576 Ga0495634_0264774 3300046642 Bacteria 1048
577 Ga0495634_0325178 3300046642 Unclassified 925
578 Ga0495659_0076570 3300046664 Unclassified 1262
579 Ga0495659_0099361 3300046664 Bacteria 1125
580 Ga0495659_0271282 3300046664 Unclassified 711
581 Ga0495658_0161725 3300046683 Bacteria 1381
582 Ga0495658_0370172 3300046683 Unclassified 912
583 Ga0495669_0010464 3300046684 Bacteria 3921
584 Ga0495613_0454192 3300046689 Bacteria 868
585 Ga0495670_0033036 3300046691 Bacteria 2574
586 Ga0495670_0208131 3300046691 Unclassified 1037
587 Ga0495604_0917378 3300047317 Bacteria 546
588 Ga0495674_0463658 3300047319 Bacteria 1017
589 Ga0495680_0154216 3300047322 Bacteria 1672
590 Ga0495680_0482588 3300047322 Bacteria 844
591 Ga0495684_0464386 3300047471 Unclassified 877
592 Ga0496100_0005498 3300048903 Bacteria 6832
593 Ga0496100_0516292 3300048903 Unclassified 922
594 Ga0496101_0008662 3300048904 Bacteria 6651
595 Ga0496101_0027005 3300048904 Bacteria 3994
596 Ga0496102_0229555 3300048905 Bacteria 1750
597 Ga0496102_0287660 3300048905 Bacteria 1549
598 Ga0496104_0010259 3300048907 Bacteria 8367
599 Ga0496104_0016643 3300048907 Bacteria 6683
600 Ga0496104_0104141 3300048907 Unclassified 2719
601 Ga0496105_0087909 3300048908 Unclassified 2567
602 Ga0496105_0120558 3300048908 Bacteria 2163
603 Ga0496105_0624728 3300048908 Unclassified 834
604 Ga0496106_0067224 3300048909 Bacteria 2732
605 Ga0496106_0206449 3300048909 Bacteria 1564
606 Ga0496106_0405750 3300048909 Bacteria 1095
607 Ga0496106_0407984 3300048909 Unclassified 1092
608 Ga0496107_0193032 3300048910 Bacteria 1513
609 Ga0496107_0259849 3300048910 Unclassified 1292
610 Ga0496108_0294163 3300048911 Unclassified 1414
611 Ga0496108_0479289 3300048911 Bacteria 1087
612 Ga0496109_0178490 3300048912 Unclassified 1994
613 Ga0496109_0312398 3300048912 Unclassified 1483
614 Ga0496109_0599018 3300048912 Unclassified 1038
615 Ga0496109_2000175 3300048912 Unclassified 511
616 Ga0496110_0128183 3300048913 Bacteria 2290
617 Ga0496110_0258916 3300048913 Bacteria 1584
618 Ga0496110_0809927 3300048913 Bacteria 841
619 Ga0496111_0104638 3300048914 Bacteria 2082
620 Ga0496112_0181630 3300048915 Bacteria 2068
621 Ga0496114_0004904 3300048917 Bacteria 10423
622 Ga0496114_0094550 3300048917 Bacteria 2542
623 Ga0496114_0687783 3300048917 Bacteria 898
624 Ga0496115_0078321 3300048918 Bacteria 2689
625 Ga0496115_0080044 3300048918 Unclassified 2660
626 Ga0496115_0198357 3300048918 Unclassified 1658
627 Ga0501031_0514476 3300049568 Unclassified 772
628 Ga0501031_0957352 3300049568 Unclassified 547
629 Ga0501036_0731340 3300049572 Bacteria 817
630 Ga0501037_0321447 3300049573 Bacteria 1071
631 Ga0501039_0035645 3300049575 Bacteria 3840
632 Ga0501040_0033237 3300049576 Bacteria 3493
633 Ga0501041_0017130 3300049577 Bacteria 4311
634 Ga0501042_0011416 3300049578 Bacteria 5994
635 Ga0501042_0443035 3300049578 Unclassified 942
636 Ga0501042_0667096 3300049578 Bacteria 756
637 Ga0501043_0491405 3300049579 Bacteria 918
638 Ga0501071_0235496 3300049587 Unclassified 1380
639 Ga0501071_0402852 3300049587 Bacteria 1045
640 Ga0501072_0035297 3300049588 Unclassified 3919
641 Ga0501072_0277117 3300049588 Bacteria 1334
642 Ga0501072_1422346 3300049588 Unclassified 536
643 Ga0501073_0740765 3300049589 Unclassified 678
644 Ga0501074_0730890 3300049590 Unclassified 698
645 Ga0501074_1171426 3300049590 Unclassified 539
646 Ga0501075_0251217 3300049591 Unclassified 1348
647 Ga0501075_1267201 3300049591 Unclassified 559
648 Ga0501076_0169070 3300049592 Unclassified 1782
649 Ga0501076_0638541 3300049592 Unclassified 878
650 Ga0501076_0895285 3300049592 Archaea 732
651 Ga0501223_096475 3300049663 Bacteria 605
652 Ga0501079_0064092 3300049741 Bacteria 2835
653 Ga0501081_0022795 3300049743 Bacteria 4191
654 Ga0501081_0604839 3300049743 Bacteria 821
655 Ga0501035_0052013 3300049822 Bacteria 3666
656 Ga0501044_0012159 3300049823 Bacteria 9320
657 Ga0501045_0323642 3300049824 Bacteria 1147
658 Ga0501045_0433102 3300049824 Bacteria 978
659 nmdc:mga06z11_70305_c1 3300050494 Bacteria 1850
660 nmdc:mga05p37_104305_c1 3300050507 Bacteria 3488
661 nmdc:mga05p37_16049_c1 3300050507 Bacteria 9013
662 nmdc:mga05p37_164064_c1 3300050507 Bacteria 2712
663 nmdc:mga05p37_165121_c1 3300050507 Unclassified 2703
664 nmdc:mga05p37_1682771_c1 3300050507 Bacteria 620
665 nmdc:mga05p37_202512_c1 3300050507 Bacteria 2403
666 nmdc:mga05p37_203243_c1 3300050507 Bacteria 2398
667 nmdc:mga05p37_21453_c1 3300050507 Bacteria 7823
668 nmdc:mga05p37_251876_c1 3300050507 Unclassified 2118
669 nmdc:mga05p37_38392_c1 3300050507 Bacteria 5873
670 nmdc:mga05p37_421901_c1 3300050507 Unclassified 1552
671 nmdc:mga05p37_679600_c1 3300050507 Bacteria 1148
672 nmdc:mga05p37_77318_c2 3300050507 Bacteria 3786
673 nmdc:mga05p37_826202_c1 3300050507 Unclassified 1010
674 nmdc:mga05p37_9751_c1 3300050507 Bacteria 11390
675 nmdc:mga09592_1379951_c1 3300050508 Unclassified 577
676 nmdc:mga09592_348428_c1 3300050508 Bacteria 1282
677 nmdc:mga09592_49904_c1 3300050508 Bacteria 3529
678 nmdc:mga09592_82523_c1 3300050508 Bacteria 2739
679 nmdc:mga0qj67_1048677_c1 3300050509 Unclassified 638
680 nmdc:mga0qj67_281623_c1 3300050509 Bacteria 1347
681 nmdc:mga0qj67_456712_c1 3300050509 Bacteria 1029
682 nmdc:mga0qj67_52997_c1 3300050509 Bacteria 3211
683 nmdc:mga0qj67_587285_c1 3300050509 Unclassified 892
684 nmdc:mga0qj67_898246_c1 3300050509 Unclassified 698
685 nmdc:mga06r32_178929_c1 3300050510 Unclassified 2106
686 nmdc:mga06r32_283153_c1 3300050510 Unclassified 1645
687 nmdc:mga06r32_286057_c1 3300050510 Unclassified 1635
688 nmdc:mga06r32_462937_c1 3300050510 Bacteria 1247
689 nmdc:mga06r32_612759_c1 3300050510 Bacteria 1059
690 nmdc:mga08y16_100527_c1 3300050511 Bacteria 3011
691 nmdc:mga08y16_11311_c1 3300050511 Bacteria 9375
692 nmdc:mga08y16_305880_c1 3300050511 Unclassified 1638
693 nmdc:mga08y16_36274_c1 3300050511 Bacteria 5177
694 nmdc:mga08y16_4787_c1 3300050511 Bacteria 14121
695 nmdc:mga08y16_9627_c1 3300050511 Bacteria 10145
696 nmdc:mga0n895_126200_c1 3300050512 Bacteria 2583
697 nmdc:mga0n895_1458923_c1 3300050512 Unclassified 651
698 nmdc:mga0n895_172670_c1 3300050512 Bacteria 2193
699 nmdc:mga0n895_30816_c1 3300050512 Bacteria 5130
700 nmdc:mga0n895_5069_c1 3300050512 Bacteria 10940
701 nmdc:mga0n895_555621_c1 3300050512 Bacteria 1153
702 nmdc:mga0n895_622549_c1 3300050512 Bacteria 1080
703 nmdc:mga0n895_652747_c1 3300050512 Unclassified 1051
704 nmdc:mga0n895_66030_c1 3300050512 Bacteria 3582
705 nmdc:mga0rr50_1144678_c1 3300050513 Bacteria 661
706 nmdc:mga0rr50_26762_c1 3300050513 Bacteria 4030
707 nmdc:mga0rr50_36464_c1 3300050513 Bacteria 3541
708 nmdc:mga0rr50_457100_c1 3300050513 Bacteria 1083
709 nmdc:mga0rr50_6413_c1 3300050513 Bacteria 7156
710 nmdc:mga08x19_107256_c1 3300050514 Bacteria 1859
711 nmdc:mga08x19_142807_c1 3300050514 Bacteria 1618
712 nmdc:mga08x19_247_c1 3300050514 Bacteria 41045
713 nmdc:mga08x19_281480_c1 3300050514 Bacteria 1152
714 nmdc:mga08x19_371815_c1 3300050514 Bacteria 1000
715 nmdc:mga08x19_84750_c1 3300050514 Bacteria 2085
716 nmdc:mga0a205_1261970_c1 3300050515 Viruses 587
717 nmdc:mga0a205_1272311_c1 3300050515 Unclassified 583
718 nmdc:mga0a205_263027_c1 3300050515 Bacteria 1603
719 nmdc:mga0a205_264671_c1 3300050515 Bacteria 1597
720 nmdc:mga0a205_512107_c1 3300050515 Bacteria 1057
721 nmdc:mga0a205_81897_c1 3300050515 Unclassified 3118
722 Ga0495601_0394760 3300053077 Bacteria 897
723 Ga0495595_0459255 3300053084 Bacteria 648
724 Ga0495619_0252207 3300053085 Bacteria 1223
725 Ga0501084_0057240 3300054114 Bacteria 3262
726 Ga0501082_0518123 3300060353 Bacteria 1042
727 Ga0530510_0013041 3300061734 Bacteria 5846
728 Ga0530510_0301087 3300061734 Bacteria 1200
729 Ga0501081_0502625
730 MBSR1b_contig_9788204
731 Ga0007417J51691_1010683
732 Ga0007416J51690_1010618
733 Ga0007429J51699_1021454
734 Ga0032354_1011261
735 Ga0058859_10072345
736 Ga0058859_11186929
737 Ga0058859_11638730
738 Ga0058859_11818803
739 Ga0058861_10023400
740 Ga0058861_10048849
741 Ga0058860_10201134
742 Ga0058860_11904063
743 Ga0058862_10075301
744 Ga0065714_10253403
745 Ga0065704_10109465
746 Ga0065704_10409004
747 Ga0065704_10547703
748 Ga0065715_10001092
749 Ga0065715_10247462
750 Ga0065707_10022615
751 Ga0065707_10086330
752 Ga0065707_10194827
753 Ga0065707_10206502
754 Ga0065707_10323440
755 Ga0065707_10413985
756 Ga0065707_10684438
757 Ga0070676_10602851
758 Ga0070683_100349204
759 Ga0070690_100529067
760 Ga0070670_100033200
761 Ga0070670_100919199
762 Ga0070677_10290701
763 Ga0070677_10374411
764 Ga0070666_10148813
765 Ga0070680_100042783
766 Ga0070680_100172200
767 Ga0070680_100436596
768 Ga0070682_100280247
769 Ga0070682_101447962
770 Ga0068868_100062622
771 Ga0068868_101338418
772 Ga0070660_100003979
773 Ga0070660_100047214
774 Ga0070689_100136244
775 Ga0070689_100143951
776 Ga0070689_100145929
777 Ga0070689_101695813
778 Ga0070691_10297354
779 Ga0070691_11077953
780 Ga0070661_100122593
781 Ga0070661_100246223
782 Ga0070669_100687534
783 Ga0070669_100796583
784 Ga0070669_101643444
785 Ga0070675_100119451
786 Ga0070675_100333163
787 Ga0070675_100926968
788 Ga0070675_101717037
789 Ga0070671_100017195
790 Ga0070671_100032305
791 Ga0070671_100468479
792 Ga0070674_100076726
793 Ga0070674_100432313
794 Ga0070674_100565255
795 Ga0070674_101030270
796 Ga0070674_101747642
797 Ga0070673_100528608
798 Ga0070673_101420803
799 Ga0070659_100176669
800 Ga0070659_100360526
801 Ga0070713_100453459
802 Ga0070710_10478074
803 Ga0070710_10887745
804 Ga0070711_100164558
805 Ga0070705_100000232
806 Ga0070705_100528945
807 Ga0070705_101113241
808 Ga0070700_100523189
809 Ga0070700_100991746
810 Ga0070694_100004381
811 Ga0070694_100005469
812 Ga0070694_100105045
813 Ga0070694_100546533
814 Ga0070694_100768087
815 Ga0070694_101539946
816 Ga0070708_100497461
817 Ga0070708_100729465
818 Ga0070708_100793447
819 Ga0070708_100888626
820 Ga0070708_100926403
821 Ga0070663_100549838
822 Ga0070663_100660729
823 Ga0070678_100191289
824 Ga0070662_101234249
825 Ga0070681_10086182
826 Ga0070681_10493676
827 Ga0070685_10301797
828 Ga0070706_100059472
829 Ga0070706_101248504
830 Ga0070707_100115761
831 Ga0070707_100442238
832 Ga0070707_100580562
833 Ga0070698_100147906
834 Ga0070698_100176146
835 Ga0070698_100265364
836 Ga0070698_100293122
837 Ga0070698_100413878
838 Ga0070698_100436111
839 Ga0070698_100460188
840 Ga0070698_100727429
841 Ga0070698_101541784
842 Ga0070699_100013808
843 Ga0070699_100405465
844 Ga0070699_100702222
845 Ga0070699_100901620
846 Ga0070679_100250167
847 Ga0070679_100369068
848 Ga0070684_101822605
849 Ga0070697_100028041
850 Ga0070697_100254200
851 Ga0070697_100338892
852 Ga0070697_101827031
853 Ga0070697_101973147
854 Ga0068853_101725249
855 Ga0070672_100297359
856 Ga0070672_100954671
857 Ga0070686_100274879
858 Ga0070686_100557679
859 Ga0070695_100001588
860 Ga0070695_100022124
861 Ga0070695_100177742
862 Ga0070695_100355221
863 Ga0070695_100566121
864 Ga0070695_100632025
865 Ga0070696_100000411
866 Ga0070696_100186800
867 Ga0070696_100256152
868 Ga0070696_100348547
869 Ga0070696_101151088
870 Ga0070665_100008061
871 Ga0070665_102115938
872 Ga0070704_100030551
873 Ga0070704_100050782
874 Ga0070704_100062970
875 Ga0070704_100342372
876 Ga0068855_100120246
877 Ga0068855_100139219
878 Ga0070664_100122008
879 Ga0070664_100417775
880 Ga0070664_100824690
881 Ga0070664_101108056
882 Ga0068857_100234999
883 Ga0068857_101035527
884 Ga0068854_100156301
885 Ga0068854_101232842
886 Ga0068854_101475482
887 Ga0070702_100347464
888 Ga0068852_100002606
889 Ga0068859_100028296
890 Ga0068859_100164723
891 Ga0068859_100776823
892 Ga0068859_100800577
893 Ga0068861_100185259
894 Ga0068861_100799908
895 Ga0068851_10226663
896 Ga0068863_100036196
897 Ga0068863_100376561
898 Ga0068858_100260294
899 Ga0068858_100324162
900 Ga0068860_101138172
901 Ga0068860_101491355
902 Ga0068862_100041044
903 Ga0068862_100062270
904 Ga0068862_100211234
905 Ga0068862_100764274
906 Ga0068862_100794106
907 Ga0081455_10076217
908 Ga0075432_10275847
909 Ga0075427_10011414
910 Ga0097621_100022525
911 Ga0097621_100214148
912 Ga0097621_101226914
913 Ga0097621_101316266
914 Ga0097621_101334619
915 Ga0068871_100013231
916 Ga0068871_100016898
917 Ga0068871_101459849
918 Ga0075428_100274049
919 Ga0075428_100284100
920 Ga0075428_100682649
921 Ga0075428_100715222
922 Ga0075430_100045905
923 Ga0075430_100121606
924 Ga0075430_100132031
925 Ga0075430_100176975
926 Ga0075430_100306757
927 Ga0075430_100436957
928 Ga0075431_100029028
929 Ga0075431_100967474
930 Ga0075431_100998855
931 Ga0075431_101128958
932 Ga0075431_101440366
933 Ga0075433_10038967
934 Ga0075433_10087269
935 Ga0075433_10103135
936 Ga0075433_10696253
937 Ga0075433_11654195
938 Ga0075434_100008102
939 Ga0075434_100008471
940 Ga0075434_100022183
941 Ga0075434_100115659
942 Ga0075434_100296563
943 Ga0075434_100406577
944 Ga0075434_100582709
945 Ga0075434_101084233
946 Ga0075429_100082944
947 Ga0075429_100301250
948 Ga0075429_100597800
949 Ga0075429_100744344
950 Ga0068865_100511232
951 Ga0068865_102067162
952 Ga0075436_100158395
953 Ga0075436_100188123
954 Ga0097620_100028296
955 Ga0097620_100164716
956 Ga0097620_100776708
957 Ga0097620_100800387
958 Ga0075435_100013021
959 Ga0075435_100013547
960 Ga0075435_100014122
961 Ga0075435_100186562
962 Ga0075435_100196693
963 Ga0075435_100197827
964 Ga0075435_100230807
965 Ga0075435_100623317
966 Ga0075435_101309768
967 Ga0099794_10427052
968 Ga0099794_10748895
969 Ga0111539_10005857
970 Ga0111539_10007902
971 Ga0111539_10026839
972 Ga0111539_10068618
973 Ga0111539_10086047
974 Ga0111539_10629223
975 Ga0105245_10030994
976 Ga0105245_11862405
977 Ga0105247_10283615
978 Ga0105247_11077657
979 Ga0114129_10004689
980 Ga0114129_10016710
981 Ga0114129_10022112
982 Ga0114129_10022514
983 Ga0114129_10026052
984 Ga0114129_10043505
985 Ga0114129_10073273
986 Ga0114129_10139813
987 Ga0114129_10172932
988 Ga0114129_10230246
989 Ga0114129_10385371
990 Ga0114129_10394371
991 Ga0114129_10397821
992 Ga0114129_10490094
993 Ga0114129_10826849
994 Ga0114129_11016356
995 Ga0114129_11306984
996 Ga0114129_11703402
997 Ga0114129_12288817
998 Ga0105243_10197418
999 Ga0105243_10902189
1000 Ga0105243_10977212
1001 Ga0105243_11683883
1002 Ga0105241_10408916
1003 Ga0105241_11513930
1004 Ga0105242_10003868
1005 Ga0105242_10126639
1006 Ga0105242_10190550
1007 Ga0105242_10261267
1008 Ga0105248_10014933
1009 Ga0105248_10108988
1010 Ga0105248_10520042
1011 Ga0105248_11345451
1012 Ga0105238_10011270
1013 Ga0105238_10170006
1014 Ga0105238_10809741
1015 Ga0105238_11462849
1016 Ga0105249_10029389
1017 Ga0105249_10288439
1018 Ga0099796_10016922
1019 Ga0105239_10042669
1020 Ga0105239_13087922
1021 Ga0105246_10047489
1022 Ga0105246_10609626
1023 Ga0157320_1031879
1024 Ga0157371_11137339
1025 Ga0157374_10029941
1026 Ga0157374_10398714
1027 Ga0157374_10551557
1028 Ga0157378_10303308
1029 Ga0157378_10575913
1030 Ga0157378_10951275
1031 Ga0157378_11073801
1032 Ga0157378_12206366
1033 Ga0163162_10028638
1034 Ga0163162_10033094
1035 Ga0163162_10570737
1036 Ga0157372_10537862
1037 Ga0157375_10448790
1038 Ga0163163_10016188
1039 Ga0157380_10032202
1040 Ga0157380_10135639
1041 Ga0157380_10570134
1042 Ga0157380_10754057
1043 Ga0157380_12585105
1044 Ga0182008_10693451
1045 Ga0157377_10556432
1046 Ga0157379_10056291
1047 Ga0157379_12426644
1048 Ga0157376_10187168
1049 Ga0157376_10314177
1050 Ga0157376_10860404
1051 Ga0157376_11413627
1052 Ga0163161_10242627
1053 Ga0163161_10691052
1054 Ga0184595_112250
1055 Ga0184594_107199
1056 Ga0184598_107632
1057 Ga0184598_132634
1058 Ga0184601_130196
1059 Ga0184601_132320
1060 Ga0184599_123219
1061 Ga0184600_108622
1062 Ga0184600_138350
1063 Ga0184600_148188
1064 Ga0184603_116527
1065 Ga0184603_120065
1066 Ga0184603_135405
1067 Ga0213875_10115506
1068 Ga0247552_100601
1069 Ga0247555_100187
1070 Ga0247555_100771
1071 Ga0247554_100978
1072 Ga0247551_102899
1073 Ga0247550_101646
1074 Ga0247553_100295
1075 Ga0247553_101951
1076 Ga0247553_109403
1077 Ga0207697_10031113
1078 Ga0207656_10628137
1079 Ga0207682_10012968
1080 Ga0207682_10611429
1081 Ga0207680_10791828
1082 Ga0207699_10842330
1083 Ga0207645_10531481
1084 Ga0207705_10010062
1085 Ga0207684_10103785
1086 Ga0207684_10913061
1087 Ga0207654_10033685
1088 Ga0207654_10319151
1089 Ga0207707_10078538
1090 Ga0207707_10411601
1091 Ga0207695_10004930
1092 Ga0207671_10512189
1093 Ga0207663_10439212
1094 Ga0207660_10097651
1095 Ga0207660_10204570
1096 Ga0207657_10009853
1097 Ga0207657_10032222
1098 Ga0207649_10094350
1099 Ga0207652_10283055
1100 Ga0207646_10085149
1101 Ga0207646_10141967
1102 Ga0207646_10413636
1103 Ga0207646_10504998
1104 Ga0207646_10513978
1105 Ga0207681_10213413
1106 Ga0207681_10723226
1107 Ga0207694_10014997
1108 Ga0207694_10237608
1109 Ga0207694_10246003
1110 Ga0207650_10116726
1111 Ga0207650_10831328
1112 Ga0207659_10098946
1113 Ga0207659_10137841
1114 Ga0207659_10460176
1115 Ga0207659_11229936
1116 Ga0207687_10229087
1117 Ga0207700_10334508
1118 Ga0207644_10166695
1119 Ga0207644_10257409
1120 Ga0207644_10586941
1121 Ga0207706_10053218
1122 Ga0207686_10026763
1123 Ga0207709_10014511
1124 Ga0207670_10104663
1125 Ga0207670_10110754
1126 Ga0207670_10232159
1127 Ga0207670_10846348
1128 Ga0207669_10191634
1129 Ga0207669_10328195
1130 Ga0207704_10455603
1131 Ga0207704_10464280
1132 Ga0207665_10201907
1133 Ga0207691_10367728
1134 Ga0207691_10445501
1135 Ga0207691_10545683
1136 Ga0207711_10036120
1137 Ga0207711_10064889
1138 Ga0207711_10118915
1139 Ga0207711_10274728
1140 Ga0207711_10449749
1141 Ga0207711_11511971
1142 Ga0207689_10113735
1143 Ga0207689_10544458
1144 Ga0207679_10400332
1145 Ga0207679_10501797
1146 Ga0207679_11632045
1147 Ga0207667_10002175
1148 Ga0207667_10119591
1149 Ga0207651_10013919
1150 Ga0207651_10115547
1151 Ga0207651_10121173
1152 Ga0207651_10789743
1153 Ga0207712_10080540
1154 Ga0207712_10915002
1155 Ga0207668_10909009
1156 Ga0207640_11071864
1157 Ga0207658_10499799
1158 Ga0207703_10174779
1159 Ga0207703_10181482
1160 Ga0207703_10715430
1161 Ga0207678_10728428
1162 Ga0207678_10928271
1163 Ga0207708_10372967
1164 Ga0207708_10426875
1165 Ga0207708_10714464
1166 Ga0207641_10025938
1167 Ga0207641_10295961
1168 Ga0207641_11059529
1169 Ga0207648_10856467
1170 Ga0207676_10035182
1171 Ga0207676_10071567
1172 Ga0207674_10938990
1173 Ga0207675_100129929
1174 Ga0207675_100300710
1175 Ga0207675_100364736
1176 Ga0207675_100904106
1177 Ga0207683_10052578
1178 Ga0207683_10094083
1179 Ga0207683_10493224
1180 Ga0207683_10704753
1181 Ga0207698_10011155
1182 Ga0209981_1076324
1183 Ga0209179_1065973
1184 Ga0209588_1195391
1185 Ga0207428_10008384
1186 Ga0207428_10049823
1187 Ga0207428_10064040
1188 Ga0207428_10357147
1189 Ga0207428_10371157
1190 Ga0207428_11026552
1191 Ga0268266_10040434
1192 Ga0268266_10066674
1193 Ga0268266_10321823
1194 Ga0268265_10136854
1195 Ga0268265_10393376
1196 Ga0268265_10791883
1197 Ga0268265_10902150
1198 Ga0268265_11282323
1199 Ga0268265_11373262
1200 Ga0268264_10138975
1201 Ga0268264_10426773
1202 Ga0268264_11425281
1203 Ga0265775_106454
1204 Ga0265763_1049028
1205 Ga0265767_113947
1206 Ga0265766_1002073
1207 Ga0265766_1006154
1208 Ga0265766_1013719
1209 Ga0265777_119631
1210 Ga0265777_123331
1211 Ga0265776_105535
1212 Ga0265764_104876
1213 Ga0265769_102478
1214 Ga0265769_102982
1215 Ga0247549_100112
1216 Ga0247549_105024
1217 Ga0265768_103308
1218 Ga0265768_109198
1219 Ga0265779_103728
1220 Ga0265779_104602
1221 Ga0265779_105332
1222 Ga0265779_106571
1223 Ga0265760_10059748
1224 Ga0265760_10063407
1225 Ga0307408_100069574
1226 Ga0310116_117713
1227 Ga0310117_119121
1228 Ga0307405_10015882
1229 Ga0307405_10215506
1230 Ga0307407_11164326
1231 Ga0307412_10100000
1232 Ga0307409_100112170
1233 Ga0307409_100170094
1234 Ga0307416_100129773
1235 Ga0307416_100321619
1236 Ga0307416_100692375
1237 Ga0307416_102434030
1238 Ga0307411_12062408
1239 Ga0316053_100759
1240 Ga0307415_100084836
1241 Ga0307415_101174591
1242 Ga0307415_101412329
1243 Ga0373928_0228002
1244 Ga0373934_0168045
1245 Ga0373951_0015341
1246 Ga0373945_0183782
1247 Ga0373960_0132419
1248 Ga0373943_0123123
1249 Ga0373946_0162384
1250 Ga0373955_0073647
1251 Ga0373955_0244947
1252 Ga0373942_0039485
1253 Ga0373942_0340802
1254 Ga0373935_0882798
1255 Ga0373933_0222351
1256 Ga0373947_0166200
1257 Ga0373947_0180322
1258 Ga0310104_18783
1259 Ga0373937_0033021
1260 Ga0373937_0124517
1261 Ga0373937_0314271
1262 Ga0373937_1267584
1263 Ga0265778_010184
1264 Ga0265778_027875
1265 Ga0372808_066545
1266 Ga0310109_053158
1267 Ga0310109_055582
1268 Ga0373925_0135852
1269 Ga0373925_0155400
1270 Ga0373925_0545658
1271 Ga0373925_0871551
1272 Ga0436360_0025296
1273 Ga0439439_0172699
1274 Ga0439453_0013711
1275 Ga0439431_0078572
1276 Ga0439433_0055396
1277 Ga0439433_0145944
1278 Ga0439450_159757
1279 Ga0439446_0208232
1280 Ga0439434_0021034
1281 Ga0453683_0622410
1282 Ga0453683_0643986
1283 Ga0453684_1843416
1284 Ga0451576_0607933
1285 Ga0451576_0639388
1286 Ga0451576_1535988
1287 Ga0495592_0812871
1288 Ga0495603_0089832
1289 Ga0495603_0301166
1290 Ga0495603_0429874
1291 Ga0495590_0176043
1292 Ga0495629_0830132
1293 Ga0495582_0438002
1294 Ga0495639_0380625
1295 Ga0495594_0006349
1296 Ga0495628_0266329
1297 Ga0495586_0269810
1298 Ga0495586_0330952
1299 Ga0495598_0029991
1300 Ga0495621_0011706
1301 Ga0495621_0041558
1302 Ga0495621_0058587
1303 Ga0495633_0030114
1304 Ga0495634_0264774
1305 Ga0495634_0325178
1306 Ga0495659_0076570
1307 Ga0495659_0099361
1308 Ga0495659_0271282
1309 Ga0495658_0161725
1310 Ga0495658_0370172
1311 Ga0495669_0010464
1312 Ga0495613_0454192
1313 Ga0495670_0033036
1314 Ga0495670_0208131
1315 Ga0495604_0917378
1316 Ga0495674_0463658
1317 Ga0495680_0154216
1318 Ga0495680_0482588
1319 Ga0495684_0464386
1320 Ga0496100_0005498
1321 Ga0496100_0516292
1322 Ga0496101_0008662
1323 Ga0496101_0027005
1324 Ga0496102_0229555
1325 Ga0496102_0287660
1326 Ga0496104_0010259
1327 Ga0496104_0016643
1328 Ga0496104_0104141
1329 Ga0496105_0087909
1330 Ga0496105_0120558
1331 Ga0496105_0624728
1332 Ga0496106_0067224
1333 Ga0496106_0206449
1334 Ga0496106_0405750
1335 Ga0496106_0407984
1336 Ga0496107_0193032
1337 Ga0496107_0259849
1338 Ga0496108_0294163
1339 Ga0496108_0479289
1340 Ga0496109_0178490
1341 Ga0496109_0312398
1342 Ga0496109_0599018
1343 Ga0496109_2000175
1344 Ga0496110_0128183
1345 Ga0496110_0258916
1346 Ga0496110_0809927
1347 Ga0496111_0104638
1348 Ga0496112_0181630
1349 Ga0496114_0004904
1350 Ga0496114_0094550
1351 Ga0496114_0687783
1352 Ga0496115_0078321
1353 Ga0496115_0080044
1354 Ga0496115_0198357
1355 Ga0501031_0514476
1356 Ga0501031_0957352
1357 Ga0501036_0731340
1358 Ga0501037_0321447
1359 Ga0501039_0035645
1360 Ga0501040_0033237
1361 Ga0501041_0017130
1362 Ga0501042_0011416
1363 Ga0501042_0443035
1364 Ga0501042_0667096
1365 Ga0501043_0491405
1366 Ga0501071_0235496
1367 Ga0501071_0402852
1368 Ga0501072_0035297
1369 Ga0501072_0277117
1370 Ga0501072_1422346
1371 Ga0501073_0740765
1372 Ga0501074_0730890
1373 Ga0501074_1171426
1374 Ga0501075_0251217
1375 Ga0501075_1267201
1376 Ga0501076_0169070
1377 Ga0501076_0638541
1378 Ga0501076_0895285
1379 Ga0501223_096475
1380 Ga0501079_0064092
1381 Ga0501081_0022795
1382 Ga0501081_0604839
1383 Ga0501035_0052013
1384 Ga0501044_0012159
1385 Ga0501045_0323642
1386 Ga0501045_0433102
1387 nmdc:mga06z11_70305_c1
1388 nmdc:mga05p37_104305_c1
1389 nmdc:mga05p37_16049_c1
1390 nmdc:mga05p37_164064_c1
1391 nmdc:mga05p37_165121_c1
1392 nmdc:mga05p37_1682771_c1
1393 nmdc:mga05p37_202512_c1
1394 nmdc:mga05p37_203243_c1
1395 nmdc:mga05p37_21453_c1
1396 nmdc:mga05p37_251876_c1
1397 nmdc:mga05p37_38392_c1
1398 nmdc:mga05p37_421901_c1
1399 nmdc:mga05p37_679600_c1
1400 nmdc:mga05p37_77318_c2
1401 nmdc:mga05p37_826202_c1
1402 nmdc:mga05p37_9751_c1
1403 nmdc:mga09592_1379951_c1
1404 nmdc:mga09592_348428_c1
1405 nmdc:mga09592_49904_c1
1406 nmdc:mga09592_82523_c1
1407 nmdc:mga0qj67_1048677_c1
1408 nmdc:mga0qj67_281623_c1
1409 nmdc:mga0qj67_456712_c1
1410 nmdc:mga0qj67_52997_c1
1411 nmdc:mga0qj67_587285_c1
1412 nmdc:mga0qj67_898246_c1
1413 nmdc:mga06r32_178929_c1
1414 nmdc:mga06r32_283153_c1
1415 nmdc:mga06r32_286057_c1
1416 nmdc:mga06r32_462937_c1
1417 nmdc:mga06r32_612759_c1
1418 nmdc:mga08y16_100527_c1
1419 nmdc:mga08y16_11311_c1
1420 nmdc:mga08y16_305880_c1
1421 nmdc:mga08y16_36274_c1
1422 nmdc:mga08y16_4787_c1
1423 nmdc:mga08y16_9627_c1
1424 nmdc:mga0n895_126200_c1
1425 nmdc:mga0n895_1458923_c1
1426 nmdc:mga0n895_172670_c1
1427 nmdc:mga0n895_30816_c1
1428 nmdc:mga0n895_5069_c1
1429 nmdc:mga0n895_555621_c1
1430 nmdc:mga0n895_622549_c1
1431 nmdc:mga0n895_652747_c1
1432 nmdc:mga0n895_66030_c1
1433 nmdc:mga0rr50_1144678_c1
1434 nmdc:mga0rr50_26762_c1
1435 nmdc:mga0rr50_36464_c1
1436 nmdc:mga0rr50_457100_c1
1437 nmdc:mga0rr50_6413_c1
1438 nmdc:mga08x19_107256_c1
1439 nmdc:mga08x19_142807_c1
1440 nmdc:mga08x19_247_c1
1441 nmdc:mga08x19_281480_c1
1442 nmdc:mga08x19_371815_c1
1443 nmdc:mga08x19_84750_c1
1444 nmdc:mga0a205_1261970_c1
1445 nmdc:mga0a205_1272311_c1
1446 nmdc:mga0a205_263027_c1
1447 nmdc:mga0a205_264671_c1
1448 nmdc:mga0a205_512107_c1
1449 nmdc:mga0a205_81897_c1
1450 Ga0495601_0394760
1451 Ga0495595_0459255
1452 Ga0495619_0252207
1453 Ga0501084_0057240
1454 Ga0501082_0518123
1455 Ga0530510_0013041
1456 Ga0530510_0301087

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19649

DUF6152

Family of unknown function (DUF6152)

38

139

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
4fxd-assembly1.cif.gz_A crystal structure of yeast dna polymerase alpha bound to dna/rna 0.8172 41 74
4fxd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna 0.8154 41 74
2jjd-assembly6.cif.gz_F protein tyrosine phosphatase, receptor type, e isoform 0.8116 45 74
8fok-assembly1.cif.gz_1 cryo-em structure of s. cerevisiae dna polymerase alpha-primase complex in the dna elongation state 0.7765 41 74
4fyd-assembly2.cif.gz_B crystal structure of yeast dna polymerase alpha bound to dna/rna and dgtp 0.7647 40 74
ID Description Score Start End Superfamily
af_B2RYE5_272_368_2.30.29.30 Mainly Beta;Roll;PH-domain like;Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 0.8724 45 74 2.30.29.30
4fxdB01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P); 0.8154 41 74 2.40.50.730
2jjdF02 Alpha Beta;Alpha-Beta Complex;Protein-Tyrosine Phosphatase; Chain A;Protein tyrosine phosphatase superfamily 0.8116 45 74 3.90.190.10
2awoD03 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8038 39 98 2.40.50.140
af_P87307_123_212_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.787 38 120 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A7Y4WDA8-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9543 18 126
AF-A0A1F2TBZ2-F1-model_v4 DUF5666 domain-containing protein 0.9533 18 128
AF-A0A832QAW7-F1-model_v4 OB-fold nucleic acid binding domain-containing protein 0.9497 18 128
AF-A0A381VHI2-F1-model_v4 Uncharacterized protein 0.9463 37 128
AF-A0A383CUF3-F1-model_v4 OB domain-containing protein 0.9456 33 127

Map