F477788
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 728 | 324 | 720 | 184 |
Family's Representative Sequence
| Representative Sequence | 3300006844|Ga0075428_100036327|Ga0075428_1000363273 |
| Length | 216 |
| Sequence | MPRGMNSDYGPFSPWKASGRPTPLGERDIVMTSTFDATGTTQLSAGTWAIDPVHSSIGFSVRHLMVSKVRGNFEKFSGAIVVAEDGTPSVTAEIAVDSIHTNNEQRDGHIKSADFFEVEKYPTATFRSTGVRGNGDNYVVDGEFTLKGVTKPVSLDLEFNGVNPGMGHGEVAGFEASVVLNRKDFGIDIDMPLETGGTVVGDKVTITLEIEALKQS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2643221687 | Mycobacterium sp. Root135 | Isolate | Unclassified |
| 2 | 2643221715 | Mycobacterium sp. Root265 | Isolate | Unclassified |
| 3 | 2842134933 | Mycolicibacterium obuense SEMIA 442 | Isolate | Nodule |
| 4 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
| 5 | 2902810491 | Mycolicibacterium sp. P9-22 | Isolate | Unclassified |
| 6 | 2902837492 | Mycolicibacterium sp. P1-18 | Isolate | Unclassified |
| 7 | 2929212328 | Mycolicibacterium sp. R-73050 Hybrid assembly | Isolate | Unclassified |
| 8 | 2939582691 | Mycolicibacterium sp. 624 | Isolate | Rhizosphere |
| 9 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 10 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 11 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 12 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 13 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 14 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 15 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 16 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 17 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 18 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 19 | 3300003693 | Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 20 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 21 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 22 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 24 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 27 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 30 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 33 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 49 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 54 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 55 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 57 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 65 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 66 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 67 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 69 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 70 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 71 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 72 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 73 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 74 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 75 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 76 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 77 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 78 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 79 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 80 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 81 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 82 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 83 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 84 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 86 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 88 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 89 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 128 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 187 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 188 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 189 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 190 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 191 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 192 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 193 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 194 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 195 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 196 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 197 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 198 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 199 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 200 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 201 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 202 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 203 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 204 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 205 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 206 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 207 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 208 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 209 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 210 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 211 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 212 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 213 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 214 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 215 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 216 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 217 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 218 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 219 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 220 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 221 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 222 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 223 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 224 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 225 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 226 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 227 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 228 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 239 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 240 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 241 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 242 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 243 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 244 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 245 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 246 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 247 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 248 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 249 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 250 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 251 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 252 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 253 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 254 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 255 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 256 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 257 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 258 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 259 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 260 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 261 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 262 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 263 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 264 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 265 | 3300049127 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 266 | 3300049128 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 267 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 268 | 3300049130 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 269 | 3300049160 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 270 | 3300049161 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 271 | 3300049162 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 272 | 3300049527 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 273 | 3300049528 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 274 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 275 | 3300049530 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 276 | 3300049531 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 277 | 3300049532 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 278 | 3300049533 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 279 | 3300049534 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 280 | 3300049535 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 281 | 3300049536 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 282 | 3300049537 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 283 | 3300049538 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 284 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 285 | 3300049541 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 286 | 3300049553 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 287 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 288 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 289 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 290 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 291 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 292 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 293 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 294 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 295 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 296 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 297 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 298 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 299 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 300 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 301 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 302 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 303 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 304 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 305 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 306 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 307 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 308 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 309 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 310 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 311 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 312 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 313 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 314 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 315 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 316 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 317 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 318 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 319 | 3300053736 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere | Metagenome | Endosphere |
| 320 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 321 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 322 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 323 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 324 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 91.21 |
| Metatranscriptomes | 7.69 |
| Isolates | 1.1 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 12.09 |
| Nodule | 0.14 |
| Rhizoplane | 10.99 |
| Rhizosphere | 73.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 3.57 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | LJNas_1018574 | 3300000546 | Bacteria | 741 |
| 2 | JGI24737J22298_10021976 | 3300001990 | Bacteria | 2028 |
| 3 | JGI24743J22301_10011739 | 3300001991 | Bacteria | 1584 |
| 4 | JGI24735J21928_10121258 | 3300002067 | Bacteria | 753 |
| 5 | JGI24735J21928_10153785 | 3300002067 | Bacteria | 664 |
| 6 | JGI24750J21931_1012170 | 3300002070 | Bacteria | 1138 |
| 7 | JGI24750J21931_1039533 | 3300002070 | Bacteria | 714 |
| 8 | JGI24745J21846_1018873 | 3300002073 | Bacteria | 805 |
| 9 | JGI24745J21846_1025744 | 3300002073 | Bacteria | 700 |
| 10 | JGI24749J21850_1004338 | 3300002076 | Bacteria | 1984 |
| 11 | JGI24749J21850_1013474 | 3300002076 | Bacteria | 1148 |
| 12 | JGI24744J21845_10005501 | 3300002077 | Bacteria | 2620 |
| 13 | JGI24034J26672_10019414 | 3300002239 | Bacteria | 1061 |
| 14 | JGI24034J26672_10027865 | 3300002239 | Bacteria | 910 |
| 15 | JGI24742J22300_10031322 | 3300002244 | Bacteria | 930 |
| 16 | JGI24742J22300_10036909 | 3300002244 | Bacteria | 864 |
| 17 | Ga0032354_1033891 | 3300003693 | Bacteria | 655 |
| 18 | Ga0055540_1010143 | 3300003792 | Bacteria | 3160 |
| 19 | Ga0058863_10032663 | 3300004799 | Bacteria | 606 |
| 20 | Ga0070676_10102805 | 3300005328 | Bacteria | 1768 |
| 21 | Ga0070676_10911926 | 3300005328 | Bacteria | 655 |
| 22 | Ga0070683_100882524 | 3300005329 | Bacteria | 858 |
| 23 | Ga0070690_100004256 | 3300005330 | Bacteria | 7927 |
| 24 | Ga0070670_100568953 | 3300005331 | Bacteria | 1012 |
| 25 | Ga0068869_100013186 | 3300005334 | Bacteria | 5491 |
| 26 | Ga0070666_10087130 | 3300005335 | Bacteria | 2140 |
| 27 | Ga0070666_10098790 | 3300005335 | Bacteria | 2010 |
| 28 | Ga0070666_10353360 | 3300005335 | Bacteria | 1052 |
| 29 | Ga0070682_100037450 | 3300005337 | Bacteria | 2970 |
| 30 | Ga0070682_100090388 | 3300005337 | Bacteria | 2002 |
| 31 | Ga0068868_100074492 | 3300005338 | Bacteria | 2711 |
| 32 | Ga0068868_100243604 | 3300005338 | Bacteria | 1511 |
| 33 | Ga0070660_100232835 | 3300005339 | Bacteria | 1499 |
| 34 | Ga0070689_100057637 | 3300005340 | Bacteria | 3015 |
| 35 | Ga0070691_10032605 | 3300005341 | Bacteria | 2448 |
| 36 | Ga0070691_10056829 | 3300005341 | Bacteria | 1876 |
| 37 | Ga0070692_10107224 | 3300005345 | Bacteria | 1540 |
| 38 | Ga0070692_10189241 | 3300005345 | Bacteria | 1198 |
| 39 | Ga0070668_100030471 | 3300005347 | Bacteria | 4101 |
| 40 | Ga0070668_100043322 | 3300005347 | Bacteria | 3451 |
| 41 | Ga0070668_100110895 | 3300005347 | Bacteria | 2183 |
| 42 | Ga0070668_100228698 | 3300005347 | Bacteria | 1536 |
| 43 | Ga0070668_100693076 | 3300005347 | Bacteria | 898 |
| 44 | Ga0070669_100021617 | 3300005353 | Bacteria | 4599 |
| 45 | Ga0070669_100519257 | 3300005353 | Bacteria | 990 |
| 46 | Ga0070675_100583799 | 3300005354 | Bacteria | 1013 |
| 47 | Ga0070671_100009944 | 3300005355 | Bacteria | 7640 |
| 48 | Ga0070671_100410624 | 3300005355 | Bacteria | 1159 |
| 49 | Ga0070674_100003857 | 3300005356 | Bacteria | 8485 |
| 50 | Ga0070674_100150845 | 3300005356 | Bacteria | 1754 |
| 51 | Ga0070674_100339908 | 3300005356 | Bacteria | 1209 |
| 52 | Ga0070674_100393497 | 3300005356 | Bacteria | 1130 |
| 53 | Ga0070673_100114987 | 3300005364 | Bacteria | 2237 |
| 54 | Ga0070673_100201963 | 3300005364 | Bacteria | 1712 |
| 55 | Ga0070688_100026148 | 3300005365 | Bacteria | 3464 |
| 56 | Ga0070659_100064462 | 3300005366 | Bacteria | 2900 |
| 57 | Ga0070659_100604300 | 3300005366 | Bacteria | 943 |
| 58 | Ga0070667_100000109 | 3300005367 | Bacteria | 105260 |
| 59 | Ga0070667_100031290 | 3300005367 | Bacteria | 4437 |
| 60 | Ga0070667_100177096 | 3300005367 | Bacteria | 1885 |
| 61 | Ga0070667_101134747 | 3300005367 | Unclassified | 731 |
| 62 | Ga0070709_10046663 | 3300005434 | Bacteria | 2694 |
| 63 | Ga0070709_10087622 | 3300005434 | Bacteria | 2046 |
| 64 | Ga0070710_10017236 | 3300005437 | Bacteria | 3692 |
| 65 | Ga0070710_10027027 | 3300005437 | Bacteria | 3056 |
| 66 | Ga0070701_10017488 | 3300005438 | Bacteria | 3352 |
| 67 | Ga0070701_10185872 | 3300005438 | Bacteria | 1219 |
| 68 | Ga0070711_100013970 | 3300005439 | Bacteria | 5051 |
| 69 | Ga0070711_100291994 | 3300005439 | Bacteria | 1293 |
| 70 | Ga0070705_100005850 | 3300005440 | Bacteria | 6016 |
| 71 | Ga0070705_100347135 | 3300005440 | Bacteria | 1081 |
| 72 | Ga0070700_100000774 | 3300005441 | Bacteria | 15725 |
| 73 | Ga0070700_100289983 | 3300005441 | Bacteria | 1190 |
| 74 | Ga0070694_100034274 | 3300005444 | Bacteria | 3347 |
| 75 | Ga0070694_100055365 | 3300005444 | Bacteria | 2690 |
| 76 | Ga0070694_100392479 | 3300005444 | Bacteria | 1085 |
| 77 | Ga0070663_100116656 | 3300005455 | Bacteria | 2012 |
| 78 | Ga0070663_100163966 | 3300005455 | Bacteria | 1713 |
| 79 | Ga0070663_100395176 | 3300005455 | Bacteria | 1129 |
| 80 | Ga0070678_100000467 | 3300005456 | Bacteria | 19301 |
| 81 | Ga0070678_100068302 | 3300005456 | Bacteria | 2649 |
| 82 | Ga0070678_100373688 | 3300005456 | Bacteria | 1231 |
| 83 | Ga0070662_100004295 | 3300005457 | Bacteria | 8997 |
| 84 | Ga0070662_100053295 | 3300005457 | Bacteria | 2928 |
| 85 | Ga0070662_100712708 | 3300005457 | Bacteria | 849 |
| 86 | Ga0070681_10381510 | 3300005458 | Bacteria | 1320 |
| 87 | Ga0068867_100010615 | 3300005459 | Bacteria | 6497 |
| 88 | Ga0070685_10036832 | 3300005466 | Bacteria | 2767 |
| 89 | Ga0070685_10065814 | 3300005466 | Bacteria | 2134 |
| 90 | Ga0070685_10142469 | 3300005466 | Bacteria | 1511 |
| 91 | Ga0068853_100010343 | 3300005539 | Bacteria | 7548 |
| 92 | Ga0068853_100205543 | 3300005539 | Bacteria | 1793 |
| 93 | Ga0070672_100212603 | 3300005543 | Bacteria | 1620 |
| 94 | Ga0070686_100586134 | 3300005544 | Bacteria | 877 |
| 95 | Ga0070695_100019332 | 3300005545 | Bacteria | 4147 |
| 96 | Ga0070695_100206322 | 3300005545 | Bacteria | 1408 |
| 97 | Ga0070696_100019409 | 3300005546 | Bacteria | 4603 |
| 98 | Ga0070696_100034631 | 3300005546 | Bacteria | 3475 |
| 99 | Ga0070696_100162450 | 3300005546 | Bacteria | 1646 |
| 100 | Ga0070693_100023123 | 3300005547 | Bacteria | 3317 |
| 101 | Ga0070693_100068429 | 3300005547 | Bacteria | 2084 |
| 102 | Ga0070665_100029440 | 3300005548 | Bacteria | 5527 |
| 103 | Ga0070665_100088385 | 3300005548 | Bacteria | 3104 |
| 104 | Ga0070665_100496237 | 3300005548 | Bacteria | 1232 |
| 105 | Ga0070704_100000602 | 3300005549 | Bacteria | 17305 |
| 106 | Ga0070704_100852500 | 3300005549 | Bacteria | 817 |
| 107 | Ga0068855_100086873 | 3300005563 | Bacteria | 3616 |
| 108 | Ga0068855_100420681 | 3300005563 | Bacteria | 1461 |
| 109 | Ga0068854_100027736 | 3300005578 | Bacteria | 3906 |
| 110 | Ga0068854_100366206 | 3300005578 | Bacteria | 1184 |
| 111 | Ga0068854_100516834 | 3300005578 | Bacteria | 1008 |
| 112 | Ga0068856_100311049 | 3300005614 | Bacteria | 1593 |
| 113 | Ga0070702_100024239 | 3300005615 | Bacteria | 3235 |
| 114 | Ga0070702_100093144 | 3300005615 | Bacteria | 1831 |
| 115 | Ga0070702_101022321 | 3300005615 | Bacteria | 656 |
| 116 | Ga0068852_100432707 | 3300005616 | Bacteria | 1299 |
| 117 | Ga0068859_100012076 | 3300005617 | Bacteria | 8678 |
| 118 | Ga0068859_100027373 | 3300005617 | Bacteria | 5718 |
| 119 | Ga0068859_100898920 | 3300005617 | Bacteria | 970 |
| 120 | Ga0068859_101012472 | 3300005617 | Bacteria | 912 |
| 121 | Ga0068864_100122050 | 3300005618 | Bacteria | 2331 |
| 122 | Ga0068864_100128775 | 3300005618 | Bacteria | 2271 |
| 123 | Ga0068864_100187107 | 3300005618 | Bacteria | 1896 |
| 124 | Ga0068866_10004586 | 3300005718 | Bacteria | 5662 |
| 125 | Ga0068866_10029927 | 3300005718 | Bacteria | 2608 |
| 126 | Ga0068861_100001402 | 3300005719 | Bacteria | 15149 |
| 127 | Ga0068861_100001939 | 3300005719 | Bacteria | 13330 |
| 128 | Ga0068861_100769013 | 3300005719 | Bacteria | 901 |
| 129 | Ga0068851_10254997 | 3300005834 | Bacteria | 996 |
| 130 | Ga0068863_100000123 | 3300005841 | Bacteria | 80999 |
| 131 | Ga0068863_100017800 | 3300005841 | Bacteria | 6801 |
| 132 | Ga0068863_100300146 | 3300005841 | Bacteria | 1558 |
| 133 | Ga0068863_100302053 | 3300005841 | Bacteria | 1553 |
| 134 | Ga0068858_100016034 | 3300005842 | Bacteria | 7039 |
| 135 | Ga0068858_100018249 | 3300005842 | Bacteria | 6569 |
| 136 | Ga0068858_100045698 | 3300005842 | Bacteria | 4059 |
| 137 | Ga0068858_100341778 | 3300005842 | Bacteria | 1432 |
| 138 | Ga0068860_100000175 | 3300005843 | Bacteria | 105260 |
| 139 | Ga0068860_100392541 | 3300005843 | Bacteria | 1371 |
| 140 | Ga0068862_100000091 | 3300005844 | Bacteria | 107015 |
| 141 | Ga0068862_100029527 | 3300005844 | Bacteria | 4620 |
| 142 | Ga0068862_100263752 | 3300005844 | Bacteria | 1573 |
| 143 | Ga0068862_100422900 | 3300005844 | Bacteria | 1251 |
| 144 | Ga0081455_10054955 | 3300005937 | Bacteria | 3390 |
| 145 | Ga0081455_10064617 | 3300005937 | Bacteria | 3063 |
| 146 | Ga0081455_10141119 | 3300005937 | Bacteria | 1871 |
| 147 | Ga0081538_10014611 | 3300005981 | Bacteria | 6137 |
| 148 | Ga0081538_10265695 | 3300005981 | Bacteria | 645 |
| 149 | Ga0070717_11244780 | 3300006028 | Bacteria | 677 |
| 150 | Ga0075365_10020584 | 3300006038 | Bacteria | 4094 |
| 151 | Ga0075365_10038915 | 3300006038 | Bacteria | 3093 |
| 152 | Ga0075365_10073547 | 3300006038 | Bacteria | 2304 |
| 153 | Ga0075365_10108768 | 3300006038 | Bacteria | 1904 |
| 154 | Ga0075365_10167765 | 3300006038 | Bacteria | 1532 |
| 155 | Ga0075365_10603080 | 3300006038 | Bacteria | 776 |
| 156 | Ga0075363_100002791 | 3300006048 | Bacteria | 7252 |
| 157 | Ga0075363_100016652 | 3300006048 | Bacteria | 3634 |
| 158 | Ga0075363_100201518 | 3300006048 | Bacteria | 1137 |
| 159 | Ga0075363_100206764 | 3300006048 | Bacteria | 1123 |
| 160 | Ga0075363_100215773 | 3300006048 | Bacteria | 1099 |
| 161 | Ga0075364_10000762 | 3300006051 | Bacteria | 16897 |
| 162 | Ga0075364_10001395 | 3300006051 | Bacteria | 13068 |
| 163 | Ga0075364_10003431 | 3300006051 | Bacteria | 9010 |
| 164 | Ga0075364_10008380 | 3300006051 | Bacteria | 6177 |
| 165 | Ga0075364_10015168 | 3300006051 | Bacteria | 4772 |
| 166 | Ga0075364_10017487 | 3300006051 | Bacteria | 4480 |
| 167 | Ga0075364_10040928 | 3300006051 | Bacteria | 3007 |
| 168 | Ga0075364_10130589 | 3300006051 | Bacteria | 1686 |
| 169 | Ga0075364_10223573 | 3300006051 | Bacteria | 1278 |
| 170 | Ga0070715_10075789 | 3300006163 | Bacteria | 1514 |
| 171 | Ga0070716_100002625 | 3300006173 | Bacteria | 8302 |
| 172 | Ga0070716_100054217 | 3300006173 | Bacteria | 2290 |
| 173 | Ga0070716_100229007 | 3300006173 | Bacteria | 1253 |
| 174 | Ga0070712_100001775 | 3300006175 | Bacteria | 13202 |
| 175 | Ga0070712_100264976 | 3300006175 | Bacteria | 1378 |
| 176 | Ga0075362_10190588 | 3300006177 | Bacteria | 996 |
| 177 | Ga0075362_10291022 | 3300006177 | Bacteria | 809 |
| 178 | Ga0075367_10001437 | 3300006178 | Bacteria | 10225 |
| 179 | Ga0075367_10015293 | 3300006178 | Bacteria | 4166 |
| 180 | Ga0075367_10268471 | 3300006178 | Bacteria | 1072 |
| 181 | Ga0075369_10000249 | 3300006186 | Bacteria | 16010 |
| 182 | Ga0075369_10004145 | 3300006186 | Bacteria | 5333 |
| 183 | Ga0075369_10012480 | 3300006186 | Bacteria | 3358 |
| 184 | Ga0075369_10029780 | 3300006186 | Bacteria | 2296 |
| 185 | Ga0075369_10057303 | 3300006186 | Bacteria | 1694 |
| 186 | Ga0075369_10128795 | 3300006186 | Bacteria | 1149 |
| 187 | Ga0075369_10203413 | 3300006186 | Bacteria | 914 |
| 188 | Ga0075369_10369966 | 3300006186 | Bacteria | 674 |
| 189 | Ga0097621_100067322 | 3300006237 | Bacteria | 2952 |
| 190 | Ga0097621_100116404 | 3300006237 | Bacteria | 2264 |
| 191 | Ga0075370_10000542 | 3300006353 | Bacteria | 14466 |
| 192 | Ga0075370_10002048 | 3300006353 | Bacteria | 9160 |
| 193 | Ga0075370_10046882 | 3300006353 | Bacteria | 2447 |
| 194 | Ga0075370_10094858 | 3300006353 | Bacteria | 1723 |
| 195 | Ga0075370_10233718 | 3300006353 | Bacteria | 1088 |
| 196 | Ga0068871_100399658 | 3300006358 | Bacteria | 1223 |
| 197 | Ga0075428_100036327 | 3300006844 | Bacteria | 5427 |
| 198 | Ga0075428_100261383 | 3300006844 | Bacteria | 1864 |
| 199 | Ga0075428_100511916 | 3300006844 | Bacteria | 1284 |
| 200 | Ga0075428_101001046 | 3300006844 | Bacteria | 885 |
| 201 | Ga0075430_100026355 | 3300006846 | Bacteria | 4946 |
| 202 | Ga0075431_100026836 | 3300006847 | Bacteria | 5907 |
| 203 | Ga0075433_10588802 | 3300006852 | Bacteria | 977 |
| 204 | Ga0068865_100000967 | 3300006881 | Bacteria | 16399 |
| 205 | Ga0068865_100561222 | 3300006881 | Bacteria | 960 |
| 206 | Ga0097620_100012076 | 3300006931 | Bacteria | 8678 |
| 207 | Ga0097620_100027373 | 3300006931 | Bacteria | 5718 |
| 208 | Ga0097620_100898954 | 3300006931 | Bacteria | 970 |
| 209 | Ga0097620_101012500 | 3300006931 | Bacteria | 912 |
| 210 | Ga0105240_11166682 | 3300009093 | Bacteria | 817 |
| 211 | Ga0111539_11032732 | 3300009094 | Bacteria | 956 |
| 212 | Ga0111539_11070195 | 3300009094 | Bacteria | 937 |
| 213 | Ga0105245_10013928 | 3300009098 | Bacteria | 7004 |
| 214 | Ga0105245_10036967 | 3300009098 | Bacteria | 4340 |
| 215 | Ga0105245_11007420 | 3300009098 | Bacteria | 877 |
| 216 | Ga0105247_10000070 | 3300009101 | Bacteria | 115098 |
| 217 | Ga0105247_10001004 | 3300009101 | Bacteria | 21323 |
| 218 | Ga0105247_10192652 | 3300009101 | Bacteria | 1365 |
| 219 | Ga0114129_10039851 | 3300009147 | Bacteria | 6626 |
| 220 | Ga0114129_10114182 | 3300009147 | Bacteria | 3724 |
| 221 | Ga0105243_10091839 | 3300009148 | Bacteria | 2501 |
| 222 | Ga0105243_10257989 | 3300009148 | Bacteria | 1559 |
| 223 | Ga0105243_10307247 | 3300009148 | Bacteria | 1440 |
| 224 | Ga0105243_10616415 | 3300009148 | Bacteria | 1047 |
| 225 | Ga0105241_10342966 | 3300009174 | Bacteria | 1295 |
| 226 | Ga0105242_10003084 | 3300009176 | Bacteria | 13004 |
| 227 | Ga0105242_10138791 | 3300009176 | Bacteria | 2107 |
| 228 | Ga0105242_10144002 | 3300009176 | Bacteria | 2071 |
| 229 | Ga0105242_11111525 | 3300009176 | Bacteria | 805 |
| 230 | Ga0105248_10000331 | 3300009177 | Bacteria | 55929 |
| 231 | Ga0105248_10018065 | 3300009177 | Bacteria | 7784 |
| 232 | Ga0105248_10140868 | 3300009177 | Bacteria | 2720 |
| 233 | Ga0105248_10151686 | 3300009177 | Bacteria | 2615 |
| 234 | Ga0105248_11975435 | 3300009177 | Unclassified | 662 |
| 235 | Ga0105237_10004474 | 3300009545 | Bacteria | 16157 |
| 236 | Ga0105237_10421647 | 3300009545 | Bacteria | 1340 |
| 237 | Ga0105237_10734976 | 3300009545 | Bacteria | 993 |
| 238 | Ga0105237_10962051 | 3300009545 | Unclassified | 861 |
| 239 | Ga0105238_10849248 | 3300009551 | Bacteria | 930 |
| 240 | Ga0105238_10966261 | 3300009551 | Bacteria | 872 |
| 241 | Ga0105249_10000020 | 3300009553 | Bacteria | 260634 |
| 242 | Ga0105249_10002803 | 3300009553 | Bacteria | 15055 |
| 243 | Ga0105249_10004907 | 3300009553 | Bacteria | 11545 |
| 244 | Ga0105249_10008623 | 3300009553 | Bacteria | 8886 |
| 245 | Ga0099796_10006080 | 3300010159 | Bacteria | 3068 |
| 246 | Ga0105239_10008898 | 3300010375 | Bacteria | 11364 |
| 247 | Ga0105239_10009529 | 3300010375 | Bacteria | 10930 |
| 248 | Ga0105239_10092653 | 3300010375 | Bacteria | 3335 |
| 249 | Ga0105239_10274913 | 3300010375 | Bacteria | 1895 |
| 250 | Ga0105239_11041816 | 3300010375 | Bacteria | 941 |
| 251 | Ga0105246_10006036 | 3300011119 | Bacteria | 7394 |
| 252 | Ga0105246_10099422 | 3300011119 | Bacteria | 2115 |
| 253 | Ga0157371_10386374 | 3300013102 | Bacteria | 1023 |
| 254 | Ga0157369_10301792 | 3300013105 | Bacteria | 1666 |
| 255 | Ga0157374_10016118 | 3300013296 | Bacteria | 6566 |
| 256 | Ga0157374_10224822 | 3300013296 | Bacteria | 1843 |
| 257 | Ga0157378_10186518 | 3300013297 | Bacteria | 1954 |
| 258 | Ga0157378_10208473 | 3300013297 | Bacteria | 1852 |
| 259 | Ga0157378_10227120 | 3300013297 | Bacteria | 1777 |
| 260 | Ga0163162_10046855 | 3300013306 | Bacteria | 4334 |
| 261 | Ga0163162_10084896 | 3300013306 | Bacteria | 3242 |
| 262 | Ga0163162_10094586 | 3300013306 | Bacteria | 3074 |
| 263 | Ga0163162_10159827 | 3300013306 | Bacteria | 2375 |
| 264 | Ga0163162_10195635 | 3300013306 | Bacteria | 2150 |
| 265 | Ga0157372_10345414 | 3300013307 | Bacteria | 1734 |
| 266 | Ga0157372_10504153 | 3300013307 | Bacteria | 1411 |
| 267 | Ga0157375_10002631 | 3300013308 | Bacteria | 15547 |
| 268 | Ga0163163_10032410 | 3300014325 | Bacteria | 5046 |
| 269 | Ga0163163_10108336 | 3300014325 | Bacteria | 2805 |
| 270 | Ga0163163_10278820 | 3300014325 | Bacteria | 1723 |
| 271 | Ga0157380_10013790 | 3300014326 | Bacteria | 5903 |
| 272 | Ga0157380_10150109 | 3300014326 | Bacteria | 2013 |
| 273 | Ga0157377_10081520 | 3300014745 | Bacteria | 1892 |
| 274 | Ga0157377_10194505 | 3300014745 | Bacteria | 1284 |
| 275 | Ga0157379_10011897 | 3300014968 | Bacteria | 7604 |
| 276 | Ga0157379_10076438 | 3300014968 | Bacteria | 2998 |
| 277 | Ga0157379_10144291 | 3300014968 | Bacteria | 2147 |
| 278 | Ga0157376_10177790 | 3300014969 | Bacteria | 1943 |
| 279 | Ga0157376_10502151 | 3300014969 | Bacteria | 1192 |
| 280 | Ga0163161_10000957 | 3300017792 | Bacteria | 22171 |
| 281 | Ga0163161_10845423 | 3300017792 | Bacteria | 772 |
| 282 | Ga0197907_10667919 | 3300020069 | Bacteria | 847 |
| 283 | Ga0206355_1005082 | 3300020076 | Bacteria | 786 |
| 284 | Ga0209673_1013692 | 3300025273 | Bacteria | 3188 |
| 285 | Ga0209051_1000582 | 3300025303 | Bacteria | 43455 |
| 286 | Ga0209051_1015812 | 3300025303 | Bacteria | 3455 |
| 287 | Ga0209051_1036607 | 3300025303 | Bacteria | 1810 |
| 288 | Ga0207656_10342499 | 3300025321 | Bacteria | 745 |
| 289 | Ga0207682_10117257 | 3300025893 | Bacteria | 1178 |
| 290 | Ga0207692_10004952 | 3300025898 | Bacteria | 5299 |
| 291 | Ga0207692_10021451 | 3300025898 | Bacteria | 2955 |
| 292 | Ga0207642_10001479 | 3300025899 | Bacteria | 7265 |
| 293 | Ga0207642_10018899 | 3300025899 | Bacteria | 2656 |
| 294 | Ga0207710_10000010 | 3300025900 | Bacteria | 482087 |
| 295 | Ga0207710_10017264 | 3300025900 | Bacteria | 3061 |
| 296 | Ga0207710_10061556 | 3300025900 | Bacteria | 1704 |
| 297 | Ga0207710_10265589 | 3300025900 | Bacteria | 861 |
| 298 | Ga0207688_10015416 | 3300025901 | Bacteria | 4145 |
| 299 | Ga0207688_10032873 | 3300025901 | Bacteria | 2867 |
| 300 | Ga0207688_10241667 | 3300025901 | Bacteria | 1092 |
| 301 | Ga0207680_10195473 | 3300025903 | Bacteria | 1375 |
| 302 | Ga0207680_10472538 | 3300025903 | Bacteria | 891 |
| 303 | Ga0207647_10014832 | 3300025904 | Bacteria | 5360 |
| 304 | Ga0207647_10084790 | 3300025904 | Bacteria | 1896 |
| 305 | Ga0207685_10018085 | 3300025905 | Bacteria | 2294 |
| 306 | Ga0207685_10074473 | 3300025905 | Bacteria | 1386 |
| 307 | Ga0207699_10037896 | 3300025906 | Bacteria | 2759 |
| 308 | Ga0207699_10168344 | 3300025906 | Bacteria | 1464 |
| 309 | Ga0207654_10185811 | 3300025911 | Bacteria | 1359 |
| 310 | Ga0207671_10020596 | 3300025914 | Bacteria | 5017 |
| 311 | Ga0207671_10334140 | 3300025914 | Bacteria | 1200 |
| 312 | Ga0207671_10962015 | 3300025914 | Bacteria | 674 |
| 313 | Ga0207693_10000776 | 3300025915 | Bacteria | 28688 |
| 314 | Ga0207693_10003141 | 3300025915 | Bacteria | 14203 |
| 315 | Ga0207663_10005574 | 3300025916 | Bacteria | 6354 |
| 316 | Ga0207663_10542544 | 3300025916 | Bacteria | 908 |
| 317 | Ga0207660_10749943 | 3300025917 | Bacteria | 797 |
| 318 | Ga0207657_10124940 | 3300025919 | Bacteria | 2114 |
| 319 | Ga0207681_10008663 | 3300025923 | Bacteria | 6211 |
| 320 | Ga0207681_10029215 | 3300025923 | Bacteria | 3578 |
| 321 | Ga0207681_10474244 | 3300025923 | Bacteria | 1021 |
| 322 | Ga0207650_10716240 | 3300025925 | Bacteria | 846 |
| 323 | Ga0207659_10075210 | 3300025926 | Bacteria | 2477 |
| 324 | Ga0207687_10007808 | 3300025927 | Bacteria | 7014 |
| 325 | Ga0207687_10116220 | 3300025927 | Bacteria | 1994 |
| 326 | Ga0207687_10237674 | 3300025927 | Bacteria | 1442 |
| 327 | Ga0207687_11341062 | 3300025927 | Unclassified | 615 |
| 328 | Ga0207664_10352063 | 3300025929 | Bacteria | 1304 |
| 329 | Ga0207644_10185055 | 3300025931 | Bacteria | 1635 |
| 330 | Ga0207644_10276354 | 3300025931 | Bacteria | 1347 |
| 331 | Ga0207644_10346566 | 3300025931 | Bacteria | 1205 |
| 332 | Ga0207690_10726140 | 3300025932 | Bacteria | 818 |
| 333 | Ga0207706_10000901 | 3300025933 | Bacteria | 30536 |
| 334 | Ga0207706_10204498 | 3300025933 | Bacteria | 1731 |
| 335 | Ga0207706_10518107 | 3300025933 | Bacteria | 1028 |
| 336 | Ga0207686_10080764 | 3300025934 | Bacteria | 2120 |
| 337 | Ga0207686_10196986 | 3300025934 | Bacteria | 1440 |
| 338 | Ga0207686_10226285 | 3300025934 | Bacteria | 1353 |
| 339 | Ga0207709_10051308 | 3300025935 | Bacteria | 2528 |
| 340 | Ga0207709_10158067 | 3300025935 | Bacteria | 1578 |
| 341 | Ga0207709_10191045 | 3300025935 | Bacteria | 1454 |
| 342 | Ga0207709_10423327 | 3300025935 | Bacteria | 1023 |
| 343 | Ga0207670_10139009 | 3300025936 | Bacteria | 1789 |
| 344 | Ga0207669_10004518 | 3300025937 | Bacteria | 6136 |
| 345 | Ga0207669_10037198 | 3300025937 | Bacteria | 2790 |
| 346 | Ga0207669_10213879 | 3300025937 | Bacteria | 1409 |
| 347 | Ga0207669_10218277 | 3300025937 | Bacteria | 1398 |
| 348 | Ga0207669_10862606 | 3300025937 | Unclassified | 754 |
| 349 | Ga0207704_10000988 | 3300025938 | Bacteria | 12633 |
| 350 | Ga0207665_10006327 | 3300025939 | Bacteria | 7854 |
| 351 | Ga0207665_10025264 | 3300025939 | Bacteria | 3918 |
| 352 | Ga0207665_10286792 | 3300025939 | Bacteria | 1227 |
| 353 | Ga0207691_10086182 | 3300025940 | Bacteria | 2818 |
| 354 | Ga0207711_10000522 | 3300025941 | Bacteria | 39517 |
| 355 | Ga0207711_10060427 | 3300025941 | Bacteria | 3266 |
| 356 | Ga0207711_10090999 | 3300025941 | Bacteria | 2683 |
| 357 | Ga0207711_10524748 | 3300025941 | Bacteria | 1104 |
| 358 | Ga0207689_10125362 | 3300025942 | Bacteria | 2113 |
| 359 | Ga0207661_10287463 | 3300025944 | Bacteria | 1471 |
| 360 | Ga0207651_10291364 | 3300025960 | Bacteria | 1353 |
| 361 | Ga0207651_10310304 | 3300025960 | Bacteria | 1315 |
| 362 | Ga0207712_10000010 | 3300025961 | Bacteria | 455972 |
| 363 | Ga0207712_10022342 | 3300025961 | Bacteria | 4164 |
| 364 | Ga0207712_10034930 | 3300025961 | Bacteria | 3411 |
| 365 | Ga0207712_10062636 | 3300025961 | Bacteria | 2645 |
| 366 | Ga0207712_10908024 | 3300025961 | Bacteria | 779 |
| 367 | Ga0207668_10000836 | 3300025972 | Bacteria | 18603 |
| 368 | Ga0207668_10034168 | 3300025972 | Bacteria | 3374 |
| 369 | Ga0207668_10830296 | 3300025972 | Bacteria | 819 |
| 370 | Ga0207640_10017430 | 3300025981 | Bacteria | 4202 |
| 371 | Ga0207640_10089478 | 3300025981 | Bacteria | 2128 |
| 372 | Ga0207640_10395211 | 3300025981 | Bacteria | 1124 |
| 373 | Ga0207658_10000257 | 3300025986 | Bacteria | 55345 |
| 374 | Ga0207658_10057414 | 3300025986 | Bacteria | 2892 |
| 375 | Ga0207658_10081847 | 3300025986 | Bacteria | 2477 |
| 376 | Ga0207658_10132775 | 3300025986 | Bacteria | 2003 |
| 377 | Ga0207658_10994181 | 3300025986 | Bacteria | 765 |
| 378 | Ga0207677_10020520 | 3300026023 | Bacteria | 4013 |
| 379 | Ga0207677_10935949 | 3300026023 | Bacteria | 783 |
| 380 | Ga0207677_11211658 | 3300026023 | Bacteria | 691 |
| 381 | Ga0207703_10028860 | 3300026035 | Bacteria | 4378 |
| 382 | Ga0207703_10100312 | 3300026035 | Bacteria | 2453 |
| 383 | Ga0207703_10104576 | 3300026035 | Bacteria | 2405 |
| 384 | Ga0207703_10327003 | 3300026035 | Bacteria | 1405 |
| 385 | Ga0207639_10021438 | 3300026041 | Bacteria | 4641 |
| 386 | Ga0207639_10021450 | 3300026041 | Bacteria | 4640 |
| 387 | Ga0207678_10004074 | 3300026067 | Bacteria | 13148 |
| 388 | Ga0207678_10020372 | 3300026067 | Bacteria | 5818 |
| 389 | Ga0207678_10466722 | 3300026067 | Bacteria | 1098 |
| 390 | Ga0207708_10008819 | 3300026075 | Bacteria | 7462 |
| 391 | Ga0207708_10340004 | 3300026075 | Bacteria | 1229 |
| 392 | Ga0207708_10822474 | 3300026075 | Bacteria | 801 |
| 393 | Ga0207702_10336090 | 3300026078 | Bacteria | 1442 |
| 394 | Ga0207641_10004205 | 3300026088 | Bacteria | 12548 |
| 395 | Ga0207641_10007166 | 3300026088 | Bacteria | 9304 |
| 396 | Ga0207641_10506739 | 3300026088 | Bacteria | 1173 |
| 397 | Ga0207641_10536965 | 3300026088 | Bacteria | 1139 |
| 398 | Ga0207648_10033528 | 3300026089 | Bacteria | 4529 |
| 399 | Ga0207676_10373619 | 3300026095 | Bacteria | 1325 |
| 400 | Ga0207675_100000701 | 3300026118 | Bacteria | 33161 |
| 401 | Ga0207675_100000834 | 3300026118 | Bacteria | 30656 |
| 402 | Ga0207675_100276977 | 3300026118 | Bacteria | 1629 |
| 403 | Ga0207683_10002401 | 3300026121 | Bacteria | 16354 |
| 404 | Ga0207683_10005298 | 3300026121 | Bacteria | 11060 |
| 405 | Ga0207683_10045141 | 3300026121 | Bacteria | 3853 |
| 406 | Ga0207698_10304403 | 3300026142 | Bacteria | 1485 |
| 407 | Ga0207428_10143286 | 3300027907 | Bacteria | 1822 |
| 408 | Ga0207428_10265075 | 3300027907 | Bacteria | 1279 |
| 409 | Ga0268266_10061902 | 3300028379 | Bacteria | 3228 |
| 410 | Ga0268266_10754738 | 3300028379 | Bacteria | 939 |
| 411 | Ga0268265_10000105 | 3300028380 | Bacteria | 105463 |
| 412 | Ga0268265_10070377 | 3300028380 | Bacteria | 2720 |
| 413 | Ga0268264_10000237 | 3300028381 | Bacteria | 105274 |
| 414 | Ga0268264_10018348 | 3300028381 | Bacteria | 5721 |
| 415 | Ga0265319_1000005 | 3300028563 | Bacteria | 249025 |
| 416 | Ga0265338_10287097 | 3300028800 | Bacteria | 1200 |
| 417 | Ga0265330_10133386 | 3300031235 | Bacteria | 1057 |
| 418 | Ga0265320_10011523 | 3300031240 | Bacteria | 5199 |
| 419 | Ga0307405_11298838 | 3300031731 | Bacteria | 633 |
| 420 | Ga0307410_10302789 | 3300031852 | Bacteria | 1262 |
| 421 | Ga0307410_10574587 | 3300031852 | Bacteria | 937 |
| 422 | Ga0307406_10207778 | 3300031901 | Bacteria | 1446 |
| 423 | Ga0307406_10269240 | 3300031901 | Bacteria | 1293 |
| 424 | Ga0307407_10285423 | 3300031903 | Bacteria | 1145 |
| 425 | Ga0307409_100040233 | 3300031995 | Bacteria | 3478 |
| 426 | Ga0307409_100323386 | 3300031995 | Bacteria | 1445 |
| 427 | Ga0307409_100383410 | 3300031995 | Bacteria | 1337 |
| 428 | Ga0307409_100497255 | 3300031995 | Bacteria | 1187 |
| 429 | Ga0307409_100798126 | 3300031995 | Bacteria | 951 |
| 430 | Ga0307409_101226481 | 3300031995 | Bacteria | 774 |
| 431 | Ga0307416_100083690 | 3300032002 | Bacteria | 2708 |
| 432 | Ga0307416_100405712 | 3300032002 | Bacteria | 1402 |
| 433 | Ga0307416_100737181 | 3300032002 | Bacteria | 1077 |
| 434 | Ga0307416_101961401 | 3300032002 | Bacteria | 688 |
| 435 | Ga0307414_10242230 | 3300032004 | Bacteria | 1494 |
| 436 | Ga0307411_10151754 | 3300032005 | Bacteria | 1723 |
| 437 | Ga0307411_10390722 | 3300032005 | Bacteria | 1147 |
| 438 | Ga0307415_100160281 | 3300032126 | Bacteria | 1743 |
| 439 | Ga0307415_100298847 | 3300032126 | Bacteria | 1333 |
| 440 | Ga0373932_0008993 | 3300035112 | Bacteria | 2395 |
| 441 | Ga0373961_0221006 | 3300035241 | Bacteria | 675 |
| 442 | Ga0373931_0018961 | 3300035691 | Bacteria | 3428 |
| 443 | Ga0395900_0247364 | 3300037418 | Bacteria | 1786 |
| 444 | Ga0395898_0451223 | 3300037466 | Bacteria | 1225 |
| 445 | Ga0395905_0681913 | 3300037471 | Unclassified | 930 |
| 446 | Ga0395901_0330205 | 3300038443 | Bacteria | 1577 |
| 447 | Ga0395901_0406786 | 3300038443 | Bacteria | 1398 |
| 448 | Ga0436361_1114931 | 3300039447 | Bacteria | 1929 |
| 449 | Ga0439461_0000881 | 3300041410 | Bacteria | 4453 |
| 450 | Ga0439461_0047958 | 3300041410 | Bacteria | 940 |
| 451 | Ga0439461_0061462 | 3300041410 | Bacteria | 854 |
| 452 | Ga0439466_0002859 | 3300041411 | Bacteria | 6753 |
| 453 | Ga0439466_0074359 | 3300041411 | Bacteria | 1078 |
| 454 | Ga0439466_0142601 | 3300041411 | Bacteria | 735 |
| 455 | Ga0439465_0000074 | 3300041413 | Bacteria | 21675 |
| 456 | Ga0439465_0003465 | 3300041413 | Bacteria | 5144 |
| 457 | Ga0439465_0010780 | 3300041413 | Bacteria | 2867 |
| 458 | Ga0439465_0012061 | 3300041413 | Bacteria | 2707 |
| 459 | Ga0451789_1281002 | 3300041443 | Bacteria | 938 |
| 460 | Ga0451793_1189180 | 3300041452 | Bacteria | 1539 |
| 461 | Ga0451795_1670815 | 3300041456 | Bacteria | 2285 |
| 462 | Ga0451802_1056342 | 3300041460 | Bacteria | 1504 |
| 463 | Ga0439431_0005313 | 3300041997 | Bacteria | 2842 |
| 464 | Ga0439431_0145957 | 3300041997 | Bacteria | 670 |
| 465 | Ga0439442_021882 | 3300042002 | Bacteria | 1326 |
| 466 | Ga0439445_0086116 | 3300042004 | Bacteria | 882 |
| 467 | Ga0439459_0118249 | 3300042438 | Bacteria | 665 |
| 468 | Ga0439459_0127327 | 3300042438 | Bacteria | 648 |
| 469 | Ga0466969_0180186 | 3300044656 | Bacteria | 967 |
| 470 | Ga0466972_0016461 | 3300044658 | Bacteria | 3699 |
| 471 | Ga0466972_0068734 | 3300044658 | Bacteria | 1692 |
| 472 | Ga0466972_0128564 | 3300044658 | Bacteria | 1193 |
| 473 | Ga0466966_0372774 | 3300044684 | Bacteria | 858 |
| 474 | Ga0466964_0353449 | 3300044706 | Bacteria | 756 |
| 475 | Ga0466964_0432715 | 3300044706 | Bacteria | 694 |
| 476 | Ga0466970_0199723 | 3300044765 | Bacteria | 1112 |
| 477 | Ga0466957_0049766 | 3300044842 | Bacteria | 2548 |
| 478 | Ga0466957_0108328 | 3300044842 | Bacteria | 1759 |
| 479 | Ga0466960_0000761 | 3300044901 | Bacteria | 11330 |
| 480 | Ga0466960_0035811 | 3300044901 | Bacteria | 2321 |
| 481 | Ga0466960_0333942 | 3300044901 | Unclassified | 861 |
| 482 | Ga0466960_0349590 | 3300044901 | Bacteria | 843 |
| 483 | Ga0466959_0146105 | 3300045049 | Bacteria | 1668 |
| 484 | Ga0466959_0452253 | 3300045049 | Bacteria | 870 |
| 485 | Ga0466958_0005722 | 3300045836 | Bacteria | 6714 |
| 486 | Ga0466967_0442758 | 3300045976 | Unclassified | 1269 |
| 487 | Ga0466967_0521402 | 3300045976 | Bacteria | 1168 |
| 488 | Ga0466967_0728371 | 3300045976 | Bacteria | 983 |
| 489 | Ga0466967_1018022 | 3300045976 | Bacteria | 825 |
| 490 | Ga0495638_0004264 | 3300046460 | Bacteria | 10875 |
| 491 | Ga0495584_0149841 | 3300046491 | Bacteria | 1185 |
| 492 | Ga0495644_0285006 | 3300046523 | Bacteria | 645 |
| 493 | Ga0495648_0032953 | 3300046524 | Bacteria | 3391 |
| 494 | Ga0495625_0089206 | 3300046660 | Bacteria | 2135 |
| 495 | Ga0495635_0276102 | 3300046663 | Bacteria | 1129 |
| 496 | Ga0495671_0305686 | 3300046692 | Bacteria | 765 |
| 497 | Ga0495649_0390553 | 3300046694 | Bacteria | 699 |
| 498 | Ga0495672_0241223 | 3300047320 | Bacteria | 882 |
| 499 | Ga0495686_0004460 | 3300047472 | Bacteria | 11522 |
| 500 | Ga0495686_0083876 | 3300047472 | Bacteria | 1943 |
| 501 | Ga0496100_0006859 | 3300048903 | Bacteria | 6239 |
| 502 | Ga0496100_0009905 | 3300048903 | Bacteria | 5373 |
| 503 | Ga0496100_0010785 | 3300048903 | Bacteria | 5184 |
| 504 | Ga0496100_0085705 | 3300048903 | Bacteria | 2138 |
| 505 | Ga0496100_0168202 | 3300048903 | Bacteria | 1576 |
| 506 | Ga0496100_0198076 | 3300048903 | Unclassified | 1462 |
| 507 | Ga0496101_0000126 | 3300048904 | Bacteria | 74316 |
| 508 | Ga0496101_0001097 | 3300048904 | Bacteria | 16080 |
| 509 | Ga0496101_0004633 | 3300048904 | Bacteria | 8694 |
| 510 | Ga0496101_0035495 | 3300048904 | Bacteria | 3526 |
| 511 | Ga0496101_0108718 | 3300048904 | Bacteria | 2085 |
| 512 | Ga0496101_0109252 | 3300048904 | Bacteria | 2080 |
| 513 | Ga0496101_0119992 | 3300048904 | Bacteria | 1987 |
| 514 | Ga0496101_0441933 | 3300048904 | Bacteria | 1026 |
| 515 | Ga0496102_0000006 | 3300048905 | Bacteria | 471494 |
| 516 | Ga0496102_0000985 | 3300048905 | Bacteria | 26750 |
| 517 | Ga0496102_0010400 | 3300048905 | Bacteria | 8008 |
| 518 | Ga0496102_0060754 | 3300048905 | Bacteria | 3457 |
| 519 | Ga0496102_0102696 | 3300048905 | Bacteria | 2658 |
| 520 | Ga0496102_0129219 | 3300048905 | Bacteria | 2363 |
| 521 | Ga0496102_0170814 | 3300048905 | Bacteria | 2047 |
| 522 | Ga0496102_0175238 | 3300048905 | Bacteria | 2019 |
| 523 | Ga0496102_0287011 | 3300048905 | Bacteria | 1551 |
| 524 | Ga0496102_0487509 | 3300048905 | Bacteria | 1154 |
| 525 | Ga0496102_0999098 | 3300048905 | Bacteria | 757 |
| 526 | Ga0496102_1152718 | 3300048905 | Bacteria | 695 |
| 527 | Ga0496103_0000006 | 3300048906 | Bacteria | 470539 |
| 528 | Ga0496103_0000356 | 3300048906 | Bacteria | 41484 |
| 529 | Ga0496103_0004805 | 3300048906 | Bacteria | 8167 |
| 530 | Ga0496104_0003054 | 3300048907 | Bacteria | 14429 |
| 531 | Ga0496104_0050164 | 3300048907 | Bacteria | 3938 |
| 532 | Ga0496104_0074043 | 3300048907 | Bacteria | 3241 |
| 533 | Ga0496105_0042538 | 3300048908 | Bacteria | 3745 |
| 534 | Ga0496105_0110323 | 3300048908 | Bacteria | 2271 |
| 535 | Ga0496105_0216709 | 3300048908 | Bacteria | 1559 |
| 536 | Ga0496106_0002555 | 3300048909 | Bacteria | 13530 |
| 537 | Ga0496106_0006632 | 3300048909 | Bacteria | 8571 |
| 538 | Ga0496106_0086490 | 3300048909 | Bacteria | 2414 |
| 539 | Ga0496106_0443798 | 3300048909 | Bacteria | 1043 |
| 540 | Ga0496107_0008645 | 3300048910 | Bacteria | 7053 |
| 541 | Ga0496107_0014104 | 3300048910 | Bacteria | 5594 |
| 542 | Ga0496107_0021207 | 3300048910 | Bacteria | 4592 |
| 543 | Ga0496107_0077817 | 3300048910 | Bacteria | 2416 |
| 544 | Ga0496107_0243696 | 3300048910 | Bacteria | 1337 |
| 545 | Ga0496107_0361635 | 3300048910 | Unclassified | 1080 |
| 546 | Ga0496108_0008982 | 3300048911 | Bacteria | 8100 |
| 547 | Ga0496108_0063414 | 3300048911 | Bacteria | 3112 |
| 548 | Ga0496108_0223217 | 3300048911 | Bacteria | 1637 |
| 549 | Ga0496108_0264486 | 3300048911 | Bacteria | 1497 |
| 550 | Ga0496108_0420405 | 3300048911 | Bacteria | 1167 |
| 551 | Ga0496108_0528460 | 3300048911 | Bacteria | 1030 |
| 552 | Ga0496108_0705377 | 3300048911 | Bacteria | 875 |
| 553 | Ga0496109_0000990 | 3300048912 | Bacteria | 23432 |
| 554 | Ga0496109_0513291 | 3300048912 | Bacteria | 1131 |
| 555 | Ga0496109_0721542 | 3300048912 | Bacteria | 934 |
| 556 | Ga0496110_0042461 | 3300048913 | Bacteria | 3969 |
| 557 | Ga0496110_0200075 | 3300048913 | Bacteria | 1815 |
| 558 | Ga0496110_0346671 | 3300048913 | Bacteria | 1353 |
| 559 | Ga0496111_0454805 | 3300048914 | Bacteria | 944 |
| 560 | Ga0496112_0012991 | 3300048915 | Bacteria | 7677 |
| 561 | Ga0496112_0035783 | 3300048915 | Bacteria | 4839 |
| 562 | Ga0496112_0227724 | 3300048915 | Bacteria | 1819 |
| 563 | Ga0496112_0336228 | 3300048915 | Bacteria | 1454 |
| 564 | Ga0496112_0482604 | 3300048915 | Unclassified | 1176 |
| 565 | Ga0496112_0601322 | 3300048915 | Bacteria | 1032 |
| 566 | Ga0496112_1396336 | 3300048915 | Bacteria | 615 |
| 567 | Ga0496113_0013559 | 3300048916 | Bacteria | 5528 |
| 568 | Ga0496113_0287142 | 3300048916 | Bacteria | 1316 |
| 569 | Ga0496114_0003652 | 3300048917 | Bacteria | 11834 |
| 570 | Ga0496114_0013084 | 3300048917 | Bacteria | 6647 |
| 571 | Ga0496114_0816988 | 3300048917 | Bacteria | 811 |
| 572 | Ga0496114_1106185 | 3300048917 | Bacteria | 677 |
| 573 | Ga0496115_0013721 | 3300048918 | Bacteria | 6135 |
| 574 | Ga0496115_0027744 | 3300048918 | Bacteria | 4432 |
| 575 | Ga0496115_0136768 | 3300048918 | Bacteria | 2020 |
| 576 | Ga0496115_0834122 | 3300048918 | Bacteria | 715 |
| 577 | Ga0496116_0000025 | 3300048919 | Bacteria | 470539 |
| 578 | Ga0496116_0015243 | 3300048919 | Bacteria | 6084 |
| 579 | Ga0496117_0000006 | 3300048920 | Bacteria | 758420 |
| 580 | Ga0496117_0006504 | 3300048920 | Bacteria | 11785 |
| 581 | Ga0496117_0301678 | 3300048920 | Bacteria | 848 |
| 582 | Ga0496118_0000004 | 3300048921 | Bacteria | 758420 |
| 583 | Ga0496118_0009842 | 3300048921 | Bacteria | 9568 |
| 584 | Ga0496118_0351433 | 3300048921 | Bacteria | 785 |
| 585 | Ga0496119_0000041 | 3300048922 | Bacteria | 203687 |
| 586 | Ga0496119_0006040 | 3300048922 | Bacteria | 11360 |
| 587 | Ga0496120_0000027 | 3300048923 | Bacteria | 231507 |
| 588 | Ga0496121_0001735 | 3300048924 | Bacteria | 35599 |
| 589 | Ga0496121_0015445 | 3300048924 | Bacteria | 8001 |
| 590 | Ga0496122_0027173 | 3300048925 | Bacteria | 4901 |
| 591 | Ga0496123_0052150 | 3300048926 | Bacteria | 2717 |
| 592 | Ga0496124_0058977 | 3300048927 | Bacteria | 3225 |
| 593 | Ga0496125_0012549 | 3300048928 | Bacteria | 8402 |
| 594 | Ga0496126_0001191 | 3300048929 | Bacteria | 42415 |
| 595 | Ga0496126_0011848 | 3300048929 | Bacteria | 8971 |
| 596 | Ga0496126_0053729 | 3300048929 | Bacteria | 3652 |
| 597 | Ga0501306_018684 | 3300049127 | Bacteria | 950 |
| 598 | Ga0501306_021866 | 3300049127 | Bacteria | 898 |
| 599 | Ga0501306_039120 | 3300049127 | Bacteria | 730 |
| 600 | Ga0501306_048803 | 3300049127 | Bacteria | 674 |
| 601 | Ga0501308_008905 | 3300049128 | Bacteria | 1085 |
| 602 | Ga0501308_029067 | 3300049128 | Bacteria | 733 |
| 603 | Ga0501308_043901 | 3300049128 | Bacteria | 637 |
| 604 | Ga0501309_030873 | 3300049129 | Bacteria | 790 |
| 605 | Ga0501309_036316 | 3300049129 | Bacteria | 741 |
| 606 | Ga0501309_044840 | 3300049129 | Bacteria | 683 |
| 607 | Ga0501310_030357 | 3300049130 | Bacteria | 715 |
| 608 | Ga0501304_013780 | 3300049160 | Bacteria | 743 |
| 609 | Ga0501304_029111 | 3300049160 | Unclassified | 580 |
| 610 | Ga0501305_040270 | 3300049161 | Bacteria | 758 |
| 611 | Ga0501305_041038 | 3300049161 | Bacteria | 753 |
| 612 | Ga0501305_046680 | 3300049161 | Bacteria | 718 |
| 613 | Ga0501305_058429 | 3300049161 | Bacteria | 660 |
| 614 | Ga0501307_011312 | 3300049162 | Bacteria | 1047 |
| 615 | Ga0501307_020896 | 3300049162 | Bacteria | 851 |
| 616 | Ga0501307_025960 | 3300049162 | Bacteria | 789 |
| 617 | Ga0501307_036957 | 3300049162 | Bacteria | 698 |
| 618 | Ga0501311_050754 | 3300049527 | Bacteria | 650 |
| 619 | Ga0501311_051704 | 3300049527 | Unclassified | 645 |
| 620 | Ga0501311_051961 | 3300049527 | Bacteria | 644 |
| 621 | Ga0501312_020106 | 3300049528 | Bacteria | 986 |
| 622 | Ga0501312_025969 | 3300049528 | Bacteria | 895 |
| 623 | Ga0501312_079042 | 3300049528 | Unclassified | 593 |
| 624 | Ga0501313_015634 | 3300049529 | Bacteria | 906 |
| 625 | Ga0501313_037972 | 3300049529 | Bacteria | 641 |
| 626 | Ga0501314_005481 | 3300049530 | Bacteria | 1082 |
| 627 | Ga0501314_016123 | 3300049530 | Bacteria | 743 |
| 628 | Ga0501315_013314 | 3300049531 | Bacteria | 1029 |
| 629 | Ga0501315_054358 | 3300049531 | Bacteria | 635 |
| 630 | Ga0501316_028380 | 3300049532 | Bacteria | 739 |
| 631 | Ga0501316_032069 | 3300049532 | Bacteria | 707 |
| 632 | Ga0501317_015333 | 3300049533 | Bacteria | 982 |
| 633 | Ga0501318_017268 | 3300049534 | Bacteria | 880 |
| 634 | Ga0501318_023858 | 3300049534 | Bacteria | 792 |
| 635 | Ga0501319_015700 | 3300049535 | Bacteria | 645 |
| 636 | Ga0501319_018636 | 3300049535 | Bacteria | 609 |
| 637 | Ga0501320_015637 | 3300049536 | Bacteria | 831 |
| 638 | Ga0501320_016686 | 3300049536 | Bacteria | 814 |
| 639 | Ga0501320_018805 | 3300049536 | Bacteria | 783 |
| 640 | Ga0501320_043626 | 3300049536 | Bacteria | 594 |
| 641 | Ga0501321_007004 | 3300049537 | Bacteria | 1161 |
| 642 | Ga0501321_021359 | 3300049537 | Bacteria | 807 |
| 643 | Ga0501321_027165 | 3300049537 | Bacteria | 746 |
| 644 | Ga0501321_027753 | 3300049537 | Bacteria | 741 |
| 645 | Ga0501322_014919 | 3300049538 | Bacteria | 638 |
| 646 | Ga0501323_048159 | 3300049539 | Bacteria | 641 |
| 647 | Ga0501325_024754 | 3300049541 | Unclassified | 655 |
| 648 | Ga0501337_011751 | 3300049553 | Bacteria | 650 |
| 649 | Ga0501031_0329590 | 3300049568 | Bacteria | 988 |
| 650 | Ga0501033_0647306 | 3300049570 | Bacteria | 722 |
| 651 | Ga0501034_0229493 | 3300049571 | Bacteria | 1806 |
| 652 | Ga0501038_0793102 | 3300049574 | Bacteria | 704 |
| 653 | Ga0501039_0224693 | 3300049575 | Bacteria | 1476 |
| 654 | Ga0501041_0123615 | 3300049577 | Bacteria | 1609 |
| 655 | Ga0501046_0177315 | 3300049580 | Bacteria | 1595 |
| 656 | Ga0501048_0328028 | 3300049582 | Bacteria | 1090 |
| 657 | Ga0501071_0062745 | 3300049587 | Bacteria | 2693 |
| 658 | Ga0501072_0035214 | 3300049588 | Bacteria | 3924 |
| 659 | Ga0501074_0238225 | 3300049590 | Bacteria | 1295 |
| 660 | Ga0501075_0035821 | 3300049591 | Bacteria | 3702 |
| 661 | Ga0501076_0024151 | 3300049592 | Bacteria | 4695 |
| 662 | Ga0501077_0313060 | 3300049593 | Bacteria | 1001 |
| 663 | Ga0501081_0147102 | 3300049743 | Bacteria | 1691 |
| 664 | nmdc:mga03683_229265_c1 | 3300050489 | Bacteria | 858 |
| 665 | nmdc:mga03683_279118_c1 | 3300050489 | Bacteria | 780 |
| 666 | nmdc:mga03n38_4088_c1 | 3300050490 | Bacteria | 4785 |
| 667 | nmdc:mga03n38_496_c1 | 3300050490 | Bacteria | 9900 |
| 668 | nmdc:mga03n38_5038_c1 | 3300050490 | Bacteria | 4454 |
| 669 | nmdc:mga03n38_6690_c1 | 3300050490 | Bacteria | 4026 |
| 670 | nmdc:mga00v17_23627_c1 | 3300050491 | Bacteria | 3557 |
| 671 | nmdc:mga00v17_303294_c1 | 3300050491 | Bacteria | 1037 |
| 672 | nmdc:mga00v17_467228_c1 | 3300050491 | Bacteria | 819 |
| 673 | nmdc:mga00v17_657_c1 | 3300050491 | Bacteria | 19065 |
| 674 | nmdc:mga00v17_69638_c1 | 3300050491 | Bacteria | 2178 |
| 675 | nmdc:mga00v17_79796_c1 | 3300050491 | Bacteria | 2041 |
| 676 | nmdc:mga00v17_8556_c1 | 3300050491 | Bacteria | 5508 |
| 677 | nmdc:mga00v17_93718_c1 | 3300050491 | Bacteria | 1889 |
| 678 | nmdc:mga0yw44_101229_c1 | 3300050492 | Bacteria | 1835 |
| 679 | nmdc:mga0yw44_151545_c1 | 3300050492 | Bacteria | 1513 |
| 680 | nmdc:mga0yw44_42478_c1 | 3300050492 | Bacteria | 2711 |
| 681 | nmdc:mga0yw44_427385_c1 | 3300050492 | Bacteria | 897 |
| 682 | nmdc:mga0yw44_43067_c1 | 3300050492 | Bacteria | 2694 |
| 683 | nmdc:mga0yw44_453204_c1 | 3300050492 | Bacteria | 869 |
| 684 | nmdc:mga0yw44_61426_c1 | 3300050492 | Bacteria | 2305 |
| 685 | nmdc:mga0yw44_92088_c1 | 3300050492 | Bacteria | 1918 |
| 686 | nmdc:mga0k408_212451_c1 | 3300050493 | Bacteria | 1155 |
| 687 | nmdc:mga06z11_2967_c1 | 3300050494 | Bacteria | 6535 |
| 688 | nmdc:mga06z11_35162_c1 | 3300050494 | Bacteria | 2464 |
| 689 | nmdc:mga07m45_151238_c1 | 3300050496 | Bacteria | 1346 |
| 690 | nmdc:mga07m45_22945_c1 | 3300050496 | Bacteria | 3409 |
| 691 | nmdc:mga07m45_46189_c1 | 3300050496 | Bacteria | 2446 |
| 692 | nmdc:mga05p37_114951_c1 | 3300050507 | Bacteria | 3308 |
| 693 | nmdc:mga05p37_57571_c1 | 3300050507 | Bacteria | 4787 |
| 694 | nmdc:mga0qj67_9159_c1 | 3300050509 | Bacteria | 7351 |
| 695 | nmdc:mga06r32_35137_c1 | 3300050510 | Bacteria | 4729 |
| 696 | nmdc:mga08y16_1438007_c1 | 3300050511 | Bacteria | 652 |
| 697 | nmdc:mga08y16_267708_c1 | 3300050511 | Bacteria | 1764 |
| 698 | nmdc:mga0sz30_10357_c1 | 3300050516 | Bacteria | 3573 |
| 699 | nmdc:mga0sz30_160593_c1 | 3300050516 | Bacteria | 996 |
| 700 | nmdc:mga0sz30_179944_c1 | 3300050516 | Bacteria | 938 |
| 701 | nmdc:mga0sz30_299653_c1 | 3300050516 | Bacteria | 717 |
| 702 | nmdc:mga0sz30_51860_c1 | 3300050516 | Bacteria | 1741 |
| 703 | nmdc:mga0sz30_947_c2 | 3300050516 | Bacteria | 1690 |
| 704 | nmdc:mga0sz30_967_c1 | 3300050516 | Bacteria | 10309 |
| 705 | Ga0500610_0019519 | 3300053079 | Bacteria | 3296 |
| 706 | Ga0500643_000926 | 3300053087 | Bacteria | 18414 |
| 707 | Ga0500556_0000384 | 3300053104 | Bacteria | 32324 |
| 708 | Ga0500556_0094967 | 3300053104 | Bacteria | 1142 |
| 709 | Ga0500562_018730 | 3300053108 | Bacteria | 1788 |
| 710 | Ga0500562_027255 | 3300053108 | Bacteria | 1499 |
| 711 | Ga0500616_0003891 | 3300053153 | Bacteria | 10981 |
| 712 | Ga0500616_0009538 | 3300053153 | Bacteria | 5899 |
| 713 | Ga0500616_0214514 | 3300053153 | Bacteria | 843 |
| 714 | Ga0500599_004219 | 3300053736 | Bacteria | 1776 |
| 715 | Ga0590071_016445 | 3300059421 | Bacteria | 1735 |
| 716 | Ga0590075_001865 | 3300059424 | Bacteria | 5123 |
| 717 | Ga0590075_046096 | 3300059424 | Bacteria | 1117 |
| 718 | Ga0590077_042196 | 3300059426 | Bacteria | 1015 |
| 719 | Ga0466962_0062793 | 3300061719 | Bacteria | 1774 |
| 720 | Ga0530510_0037928 | 3300061734 | Bacteria | 3477 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300046491 | Ga0495584_0149841 | Ga0495584_0149841_89_631 | 154 |
| 2 | 3300014969 | Ga0157376_10177790 | Ga0157376_101777904 | 157 |
| 3 | 3300025937 | Ga0207669_10218277 | Ga0207669_102182772 | 158 |
| 4 | 3300049532 | Ga0501316_032069 | Ga0501316_032069_178_681 | 166 |
| 5 | 3300005329 | Ga0070683_100882524 | Ga0070683_1008825241 | 173 |
| 6 | 3300005367 | Ga0070667_101134747 | Ga0070667_1011347471 | 173 |
| 7 | 3300009098 | Ga0105245_11007420 | Ga0105245_110074201 | 173 |
| 8 | 3300025944 | Ga0207661_10287463 | Ga0207661_102874632 | 173 |
| 9 | 3300048905 | Ga0496102_1152718 | Ga0496102_1152718_108_650 | 173 |
| 10 | 3300048910 | Ga0496107_0243696 | Ga0496107_0243696_608_1150 | 173 |
| 11 | 3300048913 | Ga0496110_0346671 | Ga0496110_0346671_138_680 | 173 |
| 12 | 3300045976 | Ga0466967_0442758 | Ga0466967_0442758_253_801 | 174 |
| 13 | 3300049128 | Ga0501308_029067 | Ga0501308_029067_190_720 | 174 |
| 14 | 3300049129 | Ga0501309_036316 | Ga0501309_036316_186_716 | 174 |
| 15 | 3300049130 | Ga0501310_030357 | Ga0501310_030357_27_557 | 174 |
| 16 | 3300049528 | Ga0501312_079042 | Ga0501312_079042_27_557 | 174 |
| 17 | 3300049533 | Ga0501317_015333 | Ga0501317_015333_27_557 | 174 |
| 18 | 3300049534 | Ga0501318_023858 | Ga0501318_023858_18_548 | 174 |
| 19 | 3300049536 | Ga0501320_016686 | Ga0501320_016686_27_557 | 174 |
| 20 | 3300049537 | Ga0501321_021359 | Ga0501321_021359_258_788 | 174 |
| 21 | 3300053104 | Ga0500556_0000384 | Ga0500556_0000384_15077_15607 | 174 |
| 22 | 3300053153 | Ga0500616_0003891 | Ga0500616_0003891_7191_7721 | 174 |
| 23 | 3300053736 | Ga0500599_004219 | Ga0500599_004219_790_1320 | 174 |
| 24 | 3300005335 | Ga0070666_10353360 | Ga0070666_103533602 | 175 |
| 25 | 3300031995 | Ga0307409_100497255 | Ga0307409_1004972552 | 175 |
| 26 | 3300041410 | Ga0439461_0000881 | Ga0439461_0000881_3263_3796 | 175 |
| 27 | 3300049127 | Ga0501306_021866 | Ga0501306_021866_340_873 | 175 |
| 28 | 3300049127 | Ga0501306_048803 | Ga0501306_048803_116_649 | 175 |
| 29 | 3300049128 | Ga0501308_008905 | Ga0501308_008905_20_553 | 175 |
| 30 | 3300049129 | Ga0501309_030873 | Ga0501309_030873_21_554 | 175 |
| 31 | 3300049160 | Ga0501304_029111 | Ga0501304_029111_21_554 | 175 |
| 32 | 3300049161 | Ga0501305_040270 | Ga0501305_040270_203_736 | 175 |
| 33 | 3300049162 | Ga0501307_011312 | Ga0501307_011312_21_554 | 175 |
| 34 | 3300049162 | Ga0501307_020896 | Ga0501307_020896_292_825 | 175 |
| 35 | 3300049162 | Ga0501307_025960 | Ga0501307_025960_20_553 | 175 |
| 36 | 3300049527 | Ga0501311_050754 | Ga0501311_050754_95_628 | 175 |
| 37 | 3300049527 | Ga0501311_051704 | Ga0501311_051704_89_622 | 175 |
| 38 | 3300049528 | Ga0501312_020106 | Ga0501312_020106_436_969 | 175 |
| 39 | 3300049529 | Ga0501313_015634 | Ga0501313_015634_21_554 | 175 |
| 40 | 3300049530 | Ga0501314_005481 | Ga0501314_005481_523_1056 | 175 |
| 41 | 3300049531 | Ga0501315_013314 | Ga0501315_013314_24_557 | 175 |
| 42 | 3300049534 | Ga0501318_017268 | Ga0501318_017268_21_554 | 175 |
| 43 | 3300049536 | Ga0501320_018805 | Ga0501320_018805_237_770 | 175 |
| 44 | 3300049537 | Ga0501321_007004 | Ga0501321_007004_21_554 | 175 |
| 45 | 3300049541 | Ga0501325_024754 | Ga0501325_024754_20_553 | 175 |
| 46 | 3300059421 | Ga0590071_016445 | Ga0590071_016445_141_677 | 175 |
| 47 | 3300059424 | Ga0590075_046096 | Ga0590075_046096_565_1098 | 175 |
| 48 | 3300009177 | Ga0105248_11975435 | Ga0105248_119754351 | 176 |
| 49 | 3300025927 | Ga0207687_11341062 | Ga0207687_113410621 | 176 |
| 50 | 3300031995 | Ga0307409_100323386 | Ga0307409_1003233862 | 176 |
| 51 | 3300032002 | Ga0307416_100405712 | Ga0307416_1004057122 | 176 |
| 52 | 3300048903 | Ga0496100_0198076 | Ga0496100_0198076_857_1405 | 176 |
| 53 | 3300048904 | Ga0496101_0108718 | Ga0496101_0108718_385_933 | 176 |
| 54 | 3300048911 | Ga0496108_0223217 | Ga0496108_0223217_703_1251 | 176 |
| 55 | 3300048912 | Ga0496109_0721542 | Ga0496109_0721542_325_873 | 176 |
| 56 | 3300048914 | Ga0496111_0454805 | Ga0496111_0454805_329_877 | 176 |
| 57 | 3300048915 | Ga0496112_0482604 | Ga0496112_0482604_22_570 | 176 |
| 58 | 3300048916 | Ga0496113_0287142 | Ga0496113_0287142_167_715 | 176 |
| 59 | 3300049127 | Ga0501306_039120 | Ga0501306_039120_111_659 | 176 |
| 60 | 3300049129 | Ga0501309_044840 | Ga0501309_044840_69_617 | 176 |
| 61 | 3300059424 | Ga0590075_001865 | Ga0590075_001865_77_613 | 176 |
| 62 | 3300059426 | Ga0590077_042196 | Ga0590077_042196_67_606 | 176 |
| 63 | iso_pu_bacteria | 2929212328 | 2929217124 | 177 |
| 64 | iso_pu_bacteria | 2643221687 | 2644490982 | 178 |
| 65 | iso_pu_bacteria | 2643221715 | 2644634392 | 178 |
| 66 | iso_pu_bacteria | 2842134933 | 2842140580 | 178 |
| 67 | iso_pu_bacteria | 2902792274 | 2902798989 | 178 |
| 68 | iso_pu_bacteria | 2902810491 | 2902816877 | 178 |
| 69 | iso_pu_bacteria | 2902837492 | 2902843872 | 178 |
| 70 | iso_pu_bacteria | 2939582691 | 2939584343 | 178 |
| 71 | 3300005457 | Ga0070662_100712708 | Ga0070662_1007127082 | 179 |
| 72 | 3300005937 | Ga0081455_10064617 | Ga0081455_100646172 | 179 |
| 73 | 3300006353 | Ga0075370_10094858 | Ga0075370_100948583 | 179 |
| 74 | 3300009094 | Ga0111539_11070195 | Ga0111539_110701952 | 179 |
| 75 | 3300010159 | Ga0099796_10006080 | Ga0099796_100060803 | 179 |
| 76 | 3300013306 | Ga0163162_10046855 | Ga0163162_100468553 | 179 |
| 77 | 3300014325 | Ga0163163_10278820 | Ga0163163_102788202 | 179 |
| 78 | 3300020069 | Ga0197907_10667919 | Ga0197907_106679192 | 179 |
| 79 | 3300020076 | Ga0206355_1005082 | Ga0206355_10050821 | 179 |
| 80 | 3300026023 | Ga0207677_10935949 | Ga0207677_109359492 | 179 |
| 81 | 3300027907 | Ga0207428_10143286 | Ga0207428_101432862 | 179 |
| 82 | 3300037471 | Ga0395905_0681913 | Ga0395905_0681913_162_707 | 179 |
| 83 | 3300048905 | Ga0496102_0999098 | Ga0496102_0999098_86_631 | 179 |
| 84 | 3300050511 | nmdc:mga08y16_267708_c1 | nmdc:mga08y16_267708_c1_290_835 | 179 |
| 85 | 3300005347 | Ga0070668_100693076 | Ga0070668_1006930762 | 180 |
| 86 | 3300005356 | Ga0070674_100339908 | Ga0070674_1003399081 | 180 |
| 87 | 3300005548 | Ga0070665_100496237 | Ga0070665_1004962372 | 180 |
| 88 | 3300005549 | Ga0070704_100852500 | Ga0070704_1008525002 | 180 |
| 89 | 3300005578 | Ga0068854_100516834 | Ga0068854_1005168341 | 180 |
| 90 | 3300005618 | Ga0068864_100128775 | Ga0068864_1001287753 | 180 |
| 91 | 3300005719 | Ga0068861_100769013 | Ga0068861_1007690132 | 180 |
| 92 | 3300006175 | Ga0070712_100264976 | Ga0070712_1002649761 | 180 |
| 93 | 3300006881 | Ga0068865_100561222 | Ga0068865_1005612222 | 180 |
| 94 | 3300009148 | Ga0105243_10307247 | Ga0105243_103072472 | 180 |
| 95 | 3300009545 | Ga0105237_10962051 | Ga0105237_109620512 | 180 |
| 96 | 3300010375 | Ga0105239_11041816 | Ga0105239_110418162 | 180 |
| 97 | 3300025927 | Ga0207687_10237674 | Ga0207687_102376742 | 180 |
| 98 | 3300025935 | Ga0207709_10191045 | Ga0207709_101910452 | 180 |
| 99 | 3300025937 | Ga0207669_10862606 | Ga0207669_108626061 | 180 |
| 100 | 3300026088 | Ga0207641_10536965 | Ga0207641_105369651 | 180 |
| 101 | 3300028379 | Ga0268266_10754738 | Ga0268266_107547381 | 180 |
| 102 | 3300037418 | Ga0395900_0247364 | Ga0395900_0247364_982_1533 | 180 |
| 103 | 3300045976 | Ga0466967_0728371 | Ga0466967_0728371_145_696 | 180 |
| 104 | 3300046523 | Ga0495644_0285006 | Ga0495644_0285006_54_605 | 180 |
| 105 | 3300048905 | Ga0496102_0102696 | Ga0496102_0102696_939_1487 | 180 |
| 106 | 3300048910 | Ga0496107_0361635 | Ga0496107_0361635_217_765 | 180 |
| 107 | 3300048911 | Ga0496108_0063414 | Ga0496108_0063414_1422_1967 | 180 |
| 108 | 3300048918 | Ga0496115_0834122 | Ga0496115_0834122_55_603 | 180 |
| 109 | 3300003693 | Ga0032354_1033891 | Ga0032354_10338911 | 181 |
| 110 | 3300004799 | Ga0058863_10032663 | Ga0058863_100326631 | 181 |
| 111 | 3300005331 | Ga0070670_100568953 | Ga0070670_1005689532 | 181 |
| 112 | 3300005347 | Ga0070668_100043322 | Ga0070668_1000433222 | 181 |
| 113 | 3300005355 | Ga0070671_100009944 | Ga0070671_1000099444 | 181 |
| 114 | 3300005366 | Ga0070659_100604300 | Ga0070659_1006043002 | 181 |
| 115 | 3300005444 | Ga0070694_100055365 | Ga0070694_1000553652 | 181 |
| 116 | 3300005457 | Ga0070662_100053295 | Ga0070662_1000532952 | 181 |
| 117 | 3300005544 | Ga0070686_100586134 | Ga0070686_1005861342 | 181 |
| 118 | 3300005546 | Ga0070696_100034631 | Ga0070696_1000346313 | 181 |
| 119 | 3300005578 | Ga0068854_100366206 | Ga0068854_1003662062 | 181 |
| 120 | 3300005617 | Ga0068859_100898920 | Ga0068859_1008989202 | 181 |
| 121 | 3300005618 | Ga0068864_100187107 | Ga0068864_1001871071 | 181 |
| 122 | 3300005719 | Ga0068861_100001402 | Ga0068861_10000140214 | 181 |
| 123 | 3300005841 | Ga0068863_100017800 | Ga0068863_1000178004 | 181 |
| 124 | 3300005844 | Ga0068862_100422900 | Ga0068862_1004229002 | 181 |
| 125 | 3300005981 | Ga0081538_10014611 | Ga0081538_100146114 | 181 |
| 126 | 3300006038 | Ga0075365_10038915 | Ga0075365_100389152 | 181 |
| 127 | 3300006038 | Ga0075365_10603080 | Ga0075365_106030802 | 181 |
| 128 | 3300006051 | Ga0075364_10001395 | Ga0075364_1000139513 | 181 |
| 129 | 3300006051 | Ga0075364_10040928 | Ga0075364_100409282 | 181 |
| 130 | 3300006051 | Ga0075364_10223573 | Ga0075364_102235732 | 181 |
| 131 | 3300006177 | Ga0075362_10190588 | Ga0075362_101905882 | 181 |
| 132 | 3300006177 | Ga0075362_10291022 | Ga0075362_102910221 | 181 |
| 133 | 3300006178 | Ga0075367_10268471 | Ga0075367_102684712 | 181 |
| 134 | 3300006844 | Ga0075428_100261383 | Ga0075428_1002613832 | 181 |
| 135 | 3300006844 | Ga0075428_100511916 | Ga0075428_1005119162 | 181 |
| 136 | 3300006844 | Ga0075428_101001046 | Ga0075428_1010010462 | 181 |
| 137 | 3300006852 | Ga0075433_10588802 | Ga0075433_105888022 | 181 |
| 138 | 3300006931 | Ga0097620_100898954 | Ga0097620_1008989542 | 181 |
| 139 | 3300009094 | Ga0111539_11032732 | Ga0111539_110327322 | 181 |
| 140 | 3300009098 | Ga0105245_10013928 | Ga0105245_100139286 | 181 |
| 141 | 3300009101 | Ga0105247_10192652 | Ga0105247_101926522 | 181 |
| 142 | 3300009176 | Ga0105242_11111525 | Ga0105242_111115251 | 181 |
| 143 | 3300009553 | Ga0105249_10008623 | Ga0105249_100086237 | 181 |
| 144 | 3300010375 | Ga0105239_10092653 | Ga0105239_100926533 | 181 |
| 145 | 3300013297 | Ga0157378_10208473 | Ga0157378_102084732 | 181 |
| 146 | 3300013306 | Ga0163162_10094586 | Ga0163162_100945863 | 181 |
| 147 | 3300013307 | Ga0157372_10345414 | Ga0157372_103454142 | 181 |
| 148 | 3300014325 | Ga0163163_10032410 | Ga0163163_100324104 | 181 |
| 149 | 3300025901 | Ga0207688_10241667 | Ga0207688_102416671 | 181 |
| 150 | 3300025925 | Ga0207650_10716240 | Ga0207650_107162402 | 181 |
| 151 | 3300025931 | Ga0207644_10276354 | Ga0207644_102763542 | 181 |
| 152 | 3300025932 | Ga0207690_10726140 | Ga0207690_107261401 | 181 |
| 153 | 3300025933 | Ga0207706_10000901 | Ga0207706_100009012 | 181 |
| 154 | 3300025961 | Ga0207712_10908024 | Ga0207712_109080241 | 181 |
| 155 | 3300025981 | Ga0207640_10089478 | Ga0207640_100894782 | 181 |
| 156 | 3300026075 | Ga0207708_10340004 | Ga0207708_103400042 | 181 |
| 157 | 3300026088 | Ga0207641_10007166 | Ga0207641_1000716610 | 181 |
| 158 | 3300026118 | Ga0207675_100000701 | Ga0207675_1000007011 | 181 |
| 159 | 3300027907 | Ga0207428_10265075 | Ga0207428_102650752 | 181 |
| 160 | 3300028563 | Ga0265319_1000005 | Ga0265319_1000005118 | 181 |
| 161 | 3300028800 | Ga0265338_10287097 | Ga0265338_102870971 | 181 |
| 162 | 3300031235 | Ga0265330_10133386 | Ga0265330_101333861 | 181 |
| 163 | 3300031240 | Ga0265320_10011523 | Ga0265320_100115232 | 181 |
| 164 | 3300031852 | Ga0307410_10302789 | Ga0307410_103027892 | 181 |
| 165 | 3300031901 | Ga0307406_10207778 | Ga0307406_102077781 | 181 |
| 166 | 3300031995 | Ga0307409_100798126 | Ga0307409_1007981262 | 181 |
| 167 | 3300032002 | Ga0307416_100083690 | Ga0307416_1000836902 | 181 |
| 168 | 3300032002 | Ga0307416_100737181 | Ga0307416_1007371812 | 181 |
| 169 | 3300032004 | Ga0307414_10242230 | Ga0307414_102422301 | 181 |
| 170 | 3300037466 | Ga0395898_0451223 | Ga0395898_0451223_635_1192 | 181 |
| 171 | 3300038443 | Ga0395901_0330205 | Ga0395901_0330205_799_1356 | 181 |
| 172 | 3300038443 | Ga0395901_0406786 | Ga0395901_0406786_189_746 | 181 |
| 173 | 3300044901 | Ga0466960_0333942 | Ga0466960_0333942_170_730 | 181 |
| 174 | 3300048903 | Ga0496100_0168202 | Ga0496100_0168202_844_1404 | 181 |
| 175 | 3300048904 | Ga0496101_0109252 | Ga0496101_0109252_635_1195 | 181 |
| 176 | 3300048905 | Ga0496102_0060754 | Ga0496102_0060754_2195_2755 | 181 |
| 177 | 3300048905 | Ga0496102_0175238 | Ga0496102_0175238_1253_1810 | 181 |
| 178 | 3300048907 | Ga0496104_0074043 | Ga0496104_0074043_2388_2945 | 181 |
| 179 | 3300048908 | Ga0496105_0110323 | Ga0496105_0110323_1112_1669 | 181 |
| 180 | 3300048909 | Ga0496106_0002555 | Ga0496106_0002555_851_1411 | 181 |
| 181 | 3300048910 | Ga0496107_0008645 | Ga0496107_0008645_995_1555 | 181 |
| 182 | 3300048911 | Ga0496108_0264486 | Ga0496108_0264486_538_1095 | 181 |
| 183 | 3300048915 | Ga0496112_0601322 | Ga0496112_0601322_89_727 | 181 |
| 184 | 3300048917 | Ga0496114_1106185 | Ga0496114_1106185_81_641 | 181 |
| 185 | 3300048918 | Ga0496115_0027744 | Ga0496115_0027744_827_1387 | 181 |
| 186 | 3300049127 | Ga0501306_018684 | Ga0501306_018684_20_577 | 181 |
| 187 | 3300049128 | Ga0501308_043901 | Ga0501308_043901_20_577 | 181 |
| 188 | 3300049160 | Ga0501304_013780 | Ga0501304_013780_25_582 | 181 |
| 189 | 3300049161 | Ga0501305_041038 | Ga0501305_041038_25_582 | 181 |
| 190 | 3300049161 | Ga0501305_046680 | Ga0501305_046680_133_693 | 181 |
| 191 | 3300049161 | Ga0501305_058429 | Ga0501305_058429_59_616 | 181 |
| 192 | 3300049162 | Ga0501307_036957 | Ga0501307_036957_117_677 | 181 |
| 193 | 3300049527 | Ga0501311_051961 | Ga0501311_051961_26_583 | 181 |
| 194 | 3300049528 | Ga0501312_025969 | Ga0501312_025969_21_578 | 181 |
| 195 | 3300049529 | Ga0501313_037972 | Ga0501313_037972_25_582 | 181 |
| 196 | 3300049530 | Ga0501314_016123 | Ga0501314_016123_161_718 | 181 |
| 197 | 3300049531 | Ga0501315_054358 | Ga0501315_054358_16_573 | 181 |
| 198 | 3300049532 | Ga0501316_028380 | Ga0501316_028380_21_578 | 181 |
| 199 | 3300049535 | Ga0501319_015700 | Ga0501319_015700_28_585 | 181 |
| 200 | 3300049535 | Ga0501319_018636 | Ga0501319_018636_28_579 | 181 |
| 201 | 3300049536 | Ga0501320_015637 | Ga0501320_015637_21_578 | 181 |
| 202 | 3300049536 | Ga0501320_043626 | Ga0501320_043626_12_569 | 181 |
| 203 | 3300049537 | Ga0501321_027165 | Ga0501321_027165_161_718 | 181 |
| 204 | 3300049537 | Ga0501321_027753 | Ga0501321_027753_13_570 | 181 |
| 205 | 3300049538 | Ga0501322_014919 | Ga0501322_014919_22_579 | 181 |
| 206 | 3300049539 | Ga0501323_048159 | Ga0501323_048159_25_582 | 181 |
| 207 | 3300049568 | Ga0501031_0329590 | Ga0501031_0329590_303_860 | 181 |
| 208 | 3300049570 | Ga0501033_0647306 | Ga0501033_0647306_113_670 | 181 |
| 209 | 3300049574 | Ga0501038_0793102 | Ga0501038_0793102_90_647 | 181 |
| 210 | 3300049575 | Ga0501039_0224693 | Ga0501039_0224693_68_625 | 181 |
| 211 | 3300049577 | Ga0501041_0123615 | Ga0501041_0123615_112_669 | 181 |
| 212 | 3300049580 | Ga0501046_0177315 | Ga0501046_0177315_202_759 | 181 |
| 213 | 3300049582 | Ga0501048_0328028 | Ga0501048_0328028_131_688 | 181 |
| 214 | 3300049587 | Ga0501071_0062745 | Ga0501071_0062745_525_1082 | 181 |
| 215 | 3300049588 | Ga0501072_0035214 | Ga0501072_0035214_2216_2773 | 181 |
| 216 | 3300049590 | Ga0501074_0238225 | Ga0501074_0238225_632_1189 | 181 |
| 217 | 3300049591 | Ga0501075_0035821 | Ga0501075_0035821_54_611 | 181 |
| 218 | 3300049592 | Ga0501076_0024151 | Ga0501076_0024151_557_1114 | 181 |
| 219 | 3300049593 | Ga0501077_0313060 | Ga0501077_0313060_358_915 | 181 |
| 220 | 3300049743 | Ga0501081_0147102 | Ga0501081_0147102_126_683 | 181 |
| 221 | 3300050489 | nmdc:mga03683_229265_c1 | nmdc:mga03683_229265_c1_177_734 | 181 |
| 222 | 3300050490 | nmdc:mga03n38_496_c1 | nmdc:mga03n38_496_c1_186_737 | 181 |
| 223 | 3300050491 | nmdc:mga00v17_79796_c1 | nmdc:mga00v17_79796_c1_620_1177 | 181 |
| 224 | 3300050491 | nmdc:mga00v17_93718_c1 | nmdc:mga00v17_93718_c1_1328_1879 | 181 |
| 225 | 3300050492 | nmdc:mga0yw44_42478_c1 | nmdc:mga0yw44_42478_c1_862_1419 | 181 |
| 226 | 3300050492 | nmdc:mga0yw44_92088_c1 | nmdc:mga0yw44_92088_c1_186_737 | 181 |
| 227 | 3300050493 | nmdc:mga0k408_212451_c1 | nmdc:mga0k408_212451_c1_530_1081 | 181 |
| 228 | 3300050511 | nmdc:mga08y16_1438007_c1 | nmdc:mga08y16_1438007_c1_31_588 | 181 |
| 229 | 3300050516 | nmdc:mga0sz30_10357_c1 | nmdc:mga0sz30_10357_c1_1909_2487 | 181 |
| 230 | 3300050516 | nmdc:mga0sz30_160593_c1 | nmdc:mga0sz30_160593_c1_253_810 | 181 |
| 231 | 3300050516 | nmdc:mga0sz30_947_c2 | nmdc:mga0sz30_947_c2_1027_1584 | 181 |
| 232 | 3300061719 | Ga0466962_0062793 | Ga0466962_0062793_61_624 | 181 |
| 233 | 3300061734 | Ga0530510_0037928 | Ga0530510_0037928_1028_1585 | 181 |
| 234 | 3300000546 | LJNas_1018574 | LJNas_10185742 | 182 |
| 235 | 3300001990 | JGI24737J22298_10021976 | JGI24737J22298_100219762 | 182 |
| 236 | 3300001991 | JGI24743J22301_10011739 | JGI24743J22301_100117392 | 182 |
| 237 | 3300002067 | JGI24735J21928_10121258 | JGI24735J21928_101212581 | 182 |
| 238 | 3300002067 | JGI24735J21928_10153785 | JGI24735J21928_101537851 | 182 |
| 239 | 3300002070 | JGI24750J21931_1012170 | JGI24750J21931_10121702 | 182 |
| 240 | 3300002070 | JGI24750J21931_1039533 | JGI24750J21931_10395331 | 182 |
| 241 | 3300002073 | JGI24745J21846_1018873 | JGI24745J21846_10188732 | 182 |
| 242 | 3300002073 | JGI24745J21846_1025744 | JGI24745J21846_10257442 | 182 |
| 243 | 3300002076 | JGI24749J21850_1004338 | JGI24749J21850_10043381 | 182 |
| 244 | 3300002076 | JGI24749J21850_1013474 | JGI24749J21850_10134742 | 182 |
| 245 | 3300002077 | JGI24744J21845_10005501 | JGI24744J21845_100055013 | 182 |
| 246 | 3300002239 | JGI24034J26672_10019414 | JGI24034J26672_100194142 | 182 |
| 247 | 3300002239 | JGI24034J26672_10027865 | JGI24034J26672_100278652 | 182 |
| 248 | 3300002244 | JGI24742J22300_10031322 | JGI24742J22300_100313222 | 182 |
| 249 | 3300002244 | JGI24742J22300_10036909 | JGI24742J22300_100369091 | 182 |
| 250 | 3300003792 | Ga0055540_1010143 | Ga0055540_10101432 | 182 |
| 251 | 3300005328 | Ga0070676_10102805 | Ga0070676_101028053 | 182 |
| 252 | 3300005328 | Ga0070676_10911926 | Ga0070676_109119261 | 182 |
| 253 | 3300005330 | Ga0070690_100004256 | Ga0070690_1000042563 | 182 |
| 254 | 3300005334 | Ga0068869_100013186 | Ga0068869_1000131864 | 182 |
| 255 | 3300005335 | Ga0070666_10087130 | Ga0070666_100871302 | 182 |
| 256 | 3300005335 | Ga0070666_10098790 | Ga0070666_100987903 | 182 |
| 257 | 3300005337 | Ga0070682_100037450 | Ga0070682_1000374502 | 182 |
| 258 | 3300005337 | Ga0070682_100090388 | Ga0070682_1000903882 | 182 |
| 259 | 3300005338 | Ga0068868_100074492 | Ga0068868_1000744922 | 182 |
| 260 | 3300005338 | Ga0068868_100243604 | Ga0068868_1002436042 | 182 |
| 261 | 3300005339 | Ga0070660_100232835 | Ga0070660_1002328351 | 182 |
| 262 | 3300005340 | Ga0070689_100057637 | Ga0070689_1000576372 | 182 |
| 263 | 3300005341 | Ga0070691_10032605 | Ga0070691_100326052 | 182 |
| 264 | 3300005341 | Ga0070691_10056829 | Ga0070691_100568293 | 182 |
| 265 | 3300005345 | Ga0070692_10107224 | Ga0070692_101072242 | 182 |
| 266 | 3300005345 | Ga0070692_10189241 | Ga0070692_101892411 | 182 |
| 267 | 3300005347 | Ga0070668_100030471 | Ga0070668_1000304713 | 182 |
| 268 | 3300005347 | Ga0070668_100110895 | Ga0070668_1001108953 | 182 |
| 269 | 3300005347 | Ga0070668_100228698 | Ga0070668_1002286981 | 182 |
| 270 | 3300005353 | Ga0070669_100021617 | Ga0070669_1000216173 | 182 |
| 271 | 3300005353 | Ga0070669_100519257 | Ga0070669_1005192571 | 182 |
| 272 | 3300005354 | Ga0070675_100583799 | Ga0070675_1005837992 | 182 |
| 273 | 3300005355 | Ga0070671_100410624 | Ga0070671_1004106241 | 182 |
| 274 | 3300005356 | Ga0070674_100003857 | Ga0070674_1000038577 | 182 |
| 275 | 3300005356 | Ga0070674_100150845 | Ga0070674_1001508453 | 182 |
| 276 | 3300005356 | Ga0070674_100393497 | Ga0070674_1003934971 | 182 |
| 277 | 3300005364 | Ga0070673_100114987 | Ga0070673_1001149873 | 182 |
| 278 | 3300005364 | Ga0070673_100201963 | Ga0070673_1002019633 | 182 |
| 279 | 3300005365 | Ga0070688_100026148 | Ga0070688_1000261483 | 182 |
| 280 | 3300005366 | Ga0070659_100064462 | Ga0070659_1000644622 | 182 |
| 281 | 3300005367 | Ga0070667_100000109 | Ga0070667_10000010981 | 182 |
| 282 | 3300005367 | Ga0070667_100031290 | Ga0070667_1000312904 | 182 |
| 283 | 3300005367 | Ga0070667_100177096 | Ga0070667_1001770963 | 182 |
| 284 | 3300005434 | Ga0070709_10046663 | Ga0070709_100466632 | 182 |
| 285 | 3300005434 | Ga0070709_10087622 | Ga0070709_100876222 | 182 |
| 286 | 3300005437 | Ga0070710_10017236 | Ga0070710_100172362 | 182 |
| 287 | 3300005437 | Ga0070710_10027027 | Ga0070710_100270272 | 182 |
| 288 | 3300005438 | Ga0070701_10017488 | Ga0070701_100174883 | 182 |
| 289 | 3300005438 | Ga0070701_10185872 | Ga0070701_101858722 | 182 |
| 290 | 3300005439 | Ga0070711_100013970 | Ga0070711_1000139703 | 182 |
| 291 | 3300005439 | Ga0070711_100291994 | Ga0070711_1002919941 | 182 |
| 292 | 3300005440 | Ga0070705_100005850 | Ga0070705_1000058503 | 182 |
| 293 | 3300005440 | Ga0070705_100347135 | Ga0070705_1003471351 | 182 |
| 294 | 3300005441 | Ga0070700_100000774 | Ga0070700_1000007747 | 182 |
| 295 | 3300005441 | Ga0070700_100289983 | Ga0070700_1002899831 | 182 |
| 296 | 3300005444 | Ga0070694_100034274 | Ga0070694_1000342742 | 182 |
| 297 | 3300005444 | Ga0070694_100392479 | Ga0070694_1003924791 | 182 |
| 298 | 3300005455 | Ga0070663_100116656 | Ga0070663_1001166561 | 182 |
| 299 | 3300005455 | Ga0070663_100163966 | Ga0070663_1001639663 | 182 |
| 300 | 3300005455 | Ga0070663_100395176 | Ga0070663_1003951762 | 182 |
| 301 | 3300005456 | Ga0070678_100000467 | Ga0070678_1000004673 | 182 |
| 302 | 3300005456 | Ga0070678_100068302 | Ga0070678_1000683022 | 182 |
| 303 | 3300005456 | Ga0070678_100373688 | Ga0070678_1003736882 | 182 |
| 304 | 3300005457 | Ga0070662_100004295 | Ga0070662_1000042955 | 182 |
| 305 | 3300005458 | Ga0070681_10381510 | Ga0070681_103815103 | 182 |
| 306 | 3300005459 | Ga0068867_100010615 | Ga0068867_1000106153 | 182 |
| 307 | 3300005466 | Ga0070685_10036832 | Ga0070685_100368322 | 182 |
| 308 | 3300005466 | Ga0070685_10065814 | Ga0070685_100658142 | 182 |
| 309 | 3300005466 | Ga0070685_10142469 | Ga0070685_101424692 | 182 |
| 310 | 3300005539 | Ga0068853_100010343 | Ga0068853_1000103432 | 182 |
| 311 | 3300005539 | Ga0068853_100205543 | Ga0068853_1002055433 | 182 |
| 312 | 3300005543 | Ga0070672_100212603 | Ga0070672_1002126032 | 182 |
| 313 | 3300005545 | Ga0070695_100019332 | Ga0070695_1000193323 | 182 |
| 314 | 3300005545 | Ga0070695_100206322 | Ga0070695_1002063222 | 182 |
| 315 | 3300005546 | Ga0070696_100019409 | Ga0070696_1000194093 | 182 |
| 316 | 3300005546 | Ga0070696_100162450 | Ga0070696_1001624502 | 182 |
| 317 | 3300005547 | Ga0070693_100023123 | Ga0070693_1000231233 | 182 |
| 318 | 3300005547 | Ga0070693_100068429 | Ga0070693_1000684294 | 182 |
| 319 | 3300005548 | Ga0070665_100029440 | Ga0070665_1000294406 | 182 |
| 320 | 3300005548 | Ga0070665_100088385 | Ga0070665_1000883855 | 182 |
| 321 | 3300005549 | Ga0070704_100000602 | Ga0070704_1000006023 | 182 |
| 322 | 3300005563 | Ga0068855_100086873 | Ga0068855_1000868733 | 182 |
| 323 | 3300005563 | Ga0068855_100420681 | Ga0068855_1004206812 | 182 |
| 324 | 3300005578 | Ga0068854_100027736 | Ga0068854_1000277361 | 182 |
| 325 | 3300005614 | Ga0068856_100311049 | Ga0068856_1003110492 | 182 |
| 326 | 3300005615 | Ga0070702_100024239 | Ga0070702_1000242392 | 182 |
| 327 | 3300005615 | Ga0070702_100093144 | Ga0070702_1000931443 | 182 |
| 328 | 3300005615 | Ga0070702_101022321 | Ga0070702_1010223211 | 182 |
| 329 | 3300005616 | Ga0068852_100432707 | Ga0068852_1004327072 | 182 |
| 330 | 3300005617 | Ga0068859_100012076 | Ga0068859_1000120768 | 182 |
| 331 | 3300005617 | Ga0068859_100027373 | Ga0068859_1000273735 | 182 |
| 332 | 3300005617 | Ga0068859_101012472 | Ga0068859_1010124722 | 182 |
| 333 | 3300005618 | Ga0068864_100122050 | Ga0068864_1001220504 | 182 |
| 334 | 3300005718 | Ga0068866_10004586 | Ga0068866_100045862 | 182 |
| 335 | 3300005718 | Ga0068866_10029927 | Ga0068866_100299272 | 182 |
| 336 | 3300005719 | Ga0068861_100001939 | Ga0068861_1000019398 | 182 |
| 337 | 3300005834 | Ga0068851_10254997 | Ga0068851_102549972 | 182 |
| 338 | 3300005841 | Ga0068863_100000123 | Ga0068863_10000012341 | 182 |
| 339 | 3300005841 | Ga0068863_100300146 | Ga0068863_1003001461 | 182 |
| 340 | 3300005841 | Ga0068863_100302053 | Ga0068863_1003020533 | 182 |
| 341 | 3300005842 | Ga0068858_100016034 | Ga0068858_1000160346 | 182 |
| 342 | 3300005842 | Ga0068858_100018249 | Ga0068858_1000182496 | 182 |
| 343 | 3300005842 | Ga0068858_100045698 | Ga0068858_1000456984 | 182 |
| 344 | 3300005842 | Ga0068858_100341778 | Ga0068858_1003417783 | 182 |
| 345 | 3300005843 | Ga0068860_100000175 | Ga0068860_10000017539 | 182 |
| 346 | 3300005843 | Ga0068860_100392541 | Ga0068860_1003925412 | 182 |
| 347 | 3300005844 | Ga0068862_100000091 | Ga0068862_10000009183 | 182 |
| 348 | 3300005844 | Ga0068862_100029527 | Ga0068862_1000295272 | 182 |
| 349 | 3300005844 | Ga0068862_100263752 | Ga0068862_1002637522 | 182 |
| 350 | 3300005937 | Ga0081455_10054955 | Ga0081455_100549553 | 182 |
| 351 | 3300005937 | Ga0081455_10141119 | Ga0081455_101411193 | 182 |
| 352 | 3300005981 | Ga0081538_10265695 | Ga0081538_102656951 | 182 |
| 353 | 3300006028 | Ga0070717_11244780 | Ga0070717_112447801 | 182 |
| 354 | 3300006038 | Ga0075365_10020584 | Ga0075365_100205843 | 182 |
| 355 | 3300006038 | Ga0075365_10073547 | Ga0075365_100735472 | 182 |
| 356 | 3300006038 | Ga0075365_10108768 | Ga0075365_101087683 | 182 |
| 357 | 3300006038 | Ga0075365_10167765 | Ga0075365_101677652 | 182 |
| 358 | 3300006048 | Ga0075363_100002791 | Ga0075363_1000027913 | 182 |
| 359 | 3300006048 | Ga0075363_100016652 | Ga0075363_1000166522 | 182 |
| 360 | 3300006048 | Ga0075363_100201518 | Ga0075363_1002015182 | 182 |
| 361 | 3300006048 | Ga0075363_100206764 | Ga0075363_1002067641 | 182 |
| 362 | 3300006048 | Ga0075363_100215773 | Ga0075363_1002157732 | 182 |
| 363 | 3300006051 | Ga0075364_10000762 | Ga0075364_1000076210 | 182 |
| 364 | 3300006051 | Ga0075364_10003431 | Ga0075364_100034314 | 182 |
| 365 | 3300006051 | Ga0075364_10008380 | Ga0075364_100083805 | 182 |
| 366 | 3300006051 | Ga0075364_10015168 | Ga0075364_100151682 | 182 |
| 367 | 3300006051 | Ga0075364_10017487 | Ga0075364_100174874 | 182 |
| 368 | 3300006051 | Ga0075364_10130589 | Ga0075364_101305893 | 182 |
| 369 | 3300006163 | Ga0070715_10075789 | Ga0070715_100757892 | 182 |
| 370 | 3300006173 | Ga0070716_100002625 | Ga0070716_1000026256 | 182 |
| 371 | 3300006173 | Ga0070716_100054217 | Ga0070716_1000542173 | 182 |
| 372 | 3300006173 | Ga0070716_100229007 | Ga0070716_1002290073 | 182 |
| 373 | 3300006175 | Ga0070712_100001775 | Ga0070712_1000017753 | 182 |
| 374 | 3300006178 | Ga0075367_10001437 | Ga0075367_100014376 | 182 |
| 375 | 3300006178 | Ga0075367_10015293 | Ga0075367_100152931 | 182 |
| 376 | 3300006186 | Ga0075369_10000249 | Ga0075369_100002499 | 182 |
| 377 | 3300006186 | Ga0075369_10004145 | Ga0075369_100041455 | 182 |
| 378 | 3300006186 | Ga0075369_10012480 | Ga0075369_100124802 | 182 |
| 379 | 3300006186 | Ga0075369_10029780 | Ga0075369_100297803 | 182 |
| 380 | 3300006186 | Ga0075369_10057303 | Ga0075369_100573032 | 182 |
| 381 | 3300006186 | Ga0075369_10128795 | Ga0075369_101287952 | 182 |
| 382 | 3300006186 | Ga0075369_10203413 | Ga0075369_102034132 | 182 |
| 383 | 3300006186 | Ga0075369_10369966 | Ga0075369_103699661 | 182 |
| 384 | 3300006237 | Ga0097621_100067322 | Ga0097621_1000673223 | 182 |
| 385 | 3300006237 | Ga0097621_100116404 | Ga0097621_1001164043 | 182 |
| 386 | 3300006353 | Ga0075370_10000542 | Ga0075370_1000054210 | 182 |
| 387 | 3300006353 | Ga0075370_10002048 | Ga0075370_100020487 | 182 |
| 388 | 3300006353 | Ga0075370_10046882 | Ga0075370_100468822 | 182 |
| 389 | 3300006353 | Ga0075370_10233718 | Ga0075370_102337181 | 182 |
| 390 | 3300006358 | Ga0068871_100399658 | Ga0068871_1003996581 | 182 |
| 391 | 3300006844 | Ga0075428_100036327 | Ga0075428_1000363273 | 182 |
| 392 | 3300006846 | Ga0075430_100026355 | Ga0075430_1000263554 | 182 |
| 393 | 3300006847 | Ga0075431_100026836 | Ga0075431_1000268367 | 182 |
| 394 | 3300006881 | Ga0068865_100000967 | Ga0068865_10000096712 | 182 |
| 395 | 3300006931 | Ga0097620_100012076 | Ga0097620_1000120768 | 182 |
| 396 | 3300006931 | Ga0097620_100027373 | Ga0097620_1000273735 | 182 |
| 397 | 3300006931 | Ga0097620_101012500 | Ga0097620_1010125002 | 182 |
| 398 | 3300009093 | Ga0105240_11166682 | Ga0105240_111666821 | 182 |
| 399 | 3300009098 | Ga0105245_10036967 | Ga0105245_100369671 | 182 |
| 400 | 3300009101 | Ga0105247_10000070 | Ga0105247_1000007038 | 182 |
| 401 | 3300009101 | Ga0105247_10001004 | Ga0105247_1000100419 | 182 |
| 402 | 3300009147 | Ga0114129_10039851 | Ga0114129_100398513 | 182 |
| 403 | 3300009147 | Ga0114129_10114182 | Ga0114129_101141822 | 182 |
| 404 | 3300009148 | Ga0105243_10091839 | Ga0105243_100918392 | 182 |
| 405 | 3300009148 | Ga0105243_10257989 | Ga0105243_102579892 | 182 |
| 406 | 3300009148 | Ga0105243_10616415 | Ga0105243_106164152 | 182 |
| 407 | 3300009174 | Ga0105241_10342966 | Ga0105241_103429661 | 182 |
| 408 | 3300009176 | Ga0105242_10003084 | Ga0105242_100030844 | 182 |
| 409 | 3300009176 | Ga0105242_10138791 | Ga0105242_101387913 | 182 |
| 410 | 3300009176 | Ga0105242_10144002 | Ga0105242_101440023 | 182 |
| 411 | 3300009177 | Ga0105248_10000331 | Ga0105248_1000033122 | 182 |
| 412 | 3300009177 | Ga0105248_10018065 | Ga0105248_100180657 | 182 |
| 413 | 3300009177 | Ga0105248_10140868 | Ga0105248_101408682 | 182 |
| 414 | 3300009177 | Ga0105248_10151686 | Ga0105248_101516863 | 182 |
| 415 | 3300009545 | Ga0105237_10004474 | Ga0105237_100044741 | 182 |
| 416 | 3300009545 | Ga0105237_10421647 | Ga0105237_104216472 | 182 |
| 417 | 3300009545 | Ga0105237_10734976 | Ga0105237_107349761 | 182 |
| 418 | 3300009551 | Ga0105238_10849248 | Ga0105238_108492481 | 182 |
| 419 | 3300009551 | Ga0105238_10966261 | Ga0105238_109662611 | 182 |
| 420 | 3300009553 | Ga0105249_10000020 | Ga0105249_10000020226 | 182 |
| 421 | 3300009553 | Ga0105249_10002803 | Ga0105249_1000280312 | 182 |
| 422 | 3300009553 | Ga0105249_10004907 | Ga0105249_100049073 | 182 |
| 423 | 3300010375 | Ga0105239_10008898 | Ga0105239_100088982 | 182 |
| 424 | 3300010375 | Ga0105239_10009529 | Ga0105239_100095291 | 182 |
| 425 | 3300010375 | Ga0105239_10274913 | Ga0105239_102749132 | 182 |
| 426 | 3300011119 | Ga0105246_10006036 | Ga0105246_100060363 | 182 |
| 427 | 3300011119 | Ga0105246_10099422 | Ga0105246_100994223 | 182 |
| 428 | 3300013102 | Ga0157371_10386374 | Ga0157371_103863741 | 182 |
| 429 | 3300013105 | Ga0157369_10301792 | Ga0157369_103017922 | 182 |
| 430 | 3300013296 | Ga0157374_10016118 | Ga0157374_100161182 | 182 |
| 431 | 3300013296 | Ga0157374_10224822 | Ga0157374_102248222 | 182 |
| 432 | 3300013297 | Ga0157378_10186518 | Ga0157378_101865183 | 182 |
| 433 | 3300013297 | Ga0157378_10227120 | Ga0157378_102271202 | 182 |
| 434 | 3300013306 | Ga0163162_10084896 | Ga0163162_100848964 | 182 |
| 435 | 3300013306 | Ga0163162_10159827 | Ga0163162_101598273 | 182 |
| 436 | 3300013306 | Ga0163162_10195635 | Ga0163162_101956353 | 182 |
| 437 | 3300013307 | Ga0157372_10504153 | Ga0157372_105041533 | 182 |
| 438 | 3300013308 | Ga0157375_10002631 | Ga0157375_100026313 | 182 |
| 439 | 3300014325 | Ga0163163_10108336 | Ga0163163_101083362 | 182 |
| 440 | 3300014326 | Ga0157380_10013790 | Ga0157380_100137903 | 182 |
| 441 | 3300014326 | Ga0157380_10150109 | Ga0157380_101501093 | 182 |
| 442 | 3300014745 | Ga0157377_10081520 | Ga0157377_100815202 | 182 |
| 443 | 3300014745 | Ga0157377_10194505 | Ga0157377_101945051 | 182 |
| 444 | 3300014968 | Ga0157379_10011897 | Ga0157379_100118973 | 182 |
| 445 | 3300014968 | Ga0157379_10076438 | Ga0157379_100764384 | 182 |
| 446 | 3300014968 | Ga0157379_10144291 | Ga0157379_101442912 | 182 |
| 447 | 3300014969 | Ga0157376_10502151 | Ga0157376_105021511 | 182 |
| 448 | 3300017792 | Ga0163161_10000957 | Ga0163161_1000095712 | 182 |
| 449 | 3300017792 | Ga0163161_10845423 | Ga0163161_108454231 | 182 |
| 450 | 3300025273 | Ga0209673_1013692 | Ga0209673_10136923 | 182 |
| 451 | 3300025303 | Ga0209051_1000582 | Ga0209051_100058228 | 182 |
| 452 | 3300025303 | Ga0209051_1015812 | Ga0209051_10158122 | 182 |
| 453 | 3300025303 | Ga0209051_1036607 | Ga0209051_10366073 | 182 |
| 454 | 3300025321 | Ga0207656_10342499 | Ga0207656_103424991 | 182 |
| 455 | 3300025893 | Ga0207682_10117257 | Ga0207682_101172571 | 182 |
| 456 | 3300025898 | Ga0207692_10004952 | Ga0207692_100049522 | 182 |
| 457 | 3300025898 | Ga0207692_10021451 | Ga0207692_100214513 | 182 |
| 458 | 3300025899 | Ga0207642_10001479 | Ga0207642_100014793 | 182 |
| 459 | 3300025899 | Ga0207642_10018899 | Ga0207642_100188993 | 182 |
| 460 | 3300025900 | Ga0207710_10000010 | Ga0207710_10000010356 | 182 |
| 461 | 3300025900 | Ga0207710_10017264 | Ga0207710_100172641 | 182 |
| 462 | 3300025900 | Ga0207710_10061556 | Ga0207710_100615563 | 182 |
| 463 | 3300025900 | Ga0207710_10265589 | Ga0207710_102655892 | 182 |
| 464 | 3300025901 | Ga0207688_10015416 | Ga0207688_100154162 | 182 |
| 465 | 3300025901 | Ga0207688_10032873 | Ga0207688_100328732 | 182 |
| 466 | 3300025903 | Ga0207680_10195473 | Ga0207680_101954732 | 182 |
| 467 | 3300025903 | Ga0207680_10472538 | Ga0207680_104725381 | 182 |
| 468 | 3300025904 | Ga0207647_10014832 | Ga0207647_100148323 | 182 |
| 469 | 3300025904 | Ga0207647_10084790 | Ga0207647_100847903 | 182 |
| 470 | 3300025905 | Ga0207685_10018085 | Ga0207685_100180851 | 182 |
| 471 | 3300025905 | Ga0207685_10074473 | Ga0207685_100744732 | 182 |
| 472 | 3300025906 | Ga0207699_10037896 | Ga0207699_100378961 | 182 |
| 473 | 3300025906 | Ga0207699_10168344 | Ga0207699_101683443 | 182 |
| 474 | 3300025911 | Ga0207654_10185811 | Ga0207654_101858112 | 182 |
| 475 | 3300025914 | Ga0207671_10020596 | Ga0207671_100205964 | 182 |
| 476 | 3300025914 | Ga0207671_10334140 | Ga0207671_103341402 | 182 |
| 477 | 3300025914 | Ga0207671_10962015 | Ga0207671_109620151 | 182 |
| 478 | 3300025915 | Ga0207693_10000776 | Ga0207693_1000077629 | 182 |
| 479 | 3300025915 | Ga0207693_10003141 | Ga0207693_1000314114 | 182 |
| 480 | 3300025916 | Ga0207663_10005574 | Ga0207663_100055744 | 182 |
| 481 | 3300025916 | Ga0207663_10542544 | Ga0207663_105425441 | 182 |
| 482 | 3300025917 | Ga0207660_10749943 | Ga0207660_107499431 | 182 |
| 483 | 3300025919 | Ga0207657_10124940 | Ga0207657_101249403 | 182 |
| 484 | 3300025923 | Ga0207681_10008663 | Ga0207681_100086634 | 182 |
| 485 | 3300025923 | Ga0207681_10029215 | Ga0207681_100292153 | 182 |
| 486 | 3300025923 | Ga0207681_10474244 | Ga0207681_104742442 | 182 |
| 487 | 3300025926 | Ga0207659_10075210 | Ga0207659_100752102 | 182 |
| 488 | 3300025927 | Ga0207687_10007808 | Ga0207687_100078084 | 182 |
| 489 | 3300025927 | Ga0207687_10116220 | Ga0207687_101162202 | 182 |
| 490 | 3300025929 | Ga0207664_10352063 | Ga0207664_103520633 | 182 |
| 491 | 3300025931 | Ga0207644_10185055 | Ga0207644_101850551 | 182 |
| 492 | 3300025931 | Ga0207644_10346566 | Ga0207644_103465662 | 182 |
| 493 | 3300025933 | Ga0207706_10204498 | Ga0207706_102044982 | 182 |
| 494 | 3300025933 | Ga0207706_10518107 | Ga0207706_105181071 | 182 |
| 495 | 3300025934 | Ga0207686_10080764 | Ga0207686_100807643 | 182 |
| 496 | 3300025934 | Ga0207686_10196986 | Ga0207686_101969862 | 182 |
| 497 | 3300025934 | Ga0207686_10226285 | Ga0207686_102262852 | 182 |
| 498 | 3300025935 | Ga0207709_10051308 | Ga0207709_100513083 | 182 |
| 499 | 3300025935 | Ga0207709_10158067 | Ga0207709_101580672 | 182 |
| 500 | 3300025935 | Ga0207709_10423327 | Ga0207709_104233272 | 182 |
| 501 | 3300025936 | Ga0207670_10139009 | Ga0207670_101390091 | 182 |
| 502 | 3300025937 | Ga0207669_10004518 | Ga0207669_100045183 | 182 |
| 503 | 3300025937 | Ga0207669_10037198 | Ga0207669_100371982 | 182 |
| 504 | 3300025937 | Ga0207669_10213879 | Ga0207669_102138793 | 182 |
| 505 | 3300025938 | Ga0207704_10000988 | Ga0207704_100009886 | 182 |
| 506 | 3300025939 | Ga0207665_10006327 | Ga0207665_100063273 | 182 |
| 507 | 3300025939 | Ga0207665_10025264 | Ga0207665_100252641 | 182 |
| 508 | 3300025939 | Ga0207665_10286792 | Ga0207665_102867922 | 182 |
| 509 | 3300025940 | Ga0207691_10086182 | Ga0207691_100861822 | 182 |
| 510 | 3300025941 | Ga0207711_10000522 | Ga0207711_1000052221 | 182 |
| 511 | 3300025941 | Ga0207711_10060427 | Ga0207711_100604273 | 182 |
| 512 | 3300025941 | Ga0207711_10090999 | Ga0207711_100909992 | 182 |
| 513 | 3300025941 | Ga0207711_10524748 | Ga0207711_105247483 | 182 |
| 514 | 3300025942 | Ga0207689_10125362 | Ga0207689_101253622 | 182 |
| 515 | 3300025960 | Ga0207651_10291364 | Ga0207651_102913641 | 182 |
| 516 | 3300025960 | Ga0207651_10310304 | Ga0207651_103103041 | 182 |
| 517 | 3300025961 | Ga0207712_10000010 | Ga0207712_1000001038 | 182 |
| 518 | 3300025961 | Ga0207712_10022342 | Ga0207712_100223421 | 182 |
| 519 | 3300025961 | Ga0207712_10034930 | Ga0207712_100349303 | 182 |
| 520 | 3300025961 | Ga0207712_10062636 | Ga0207712_100626363 | 182 |
| 521 | 3300025972 | Ga0207668_10000836 | Ga0207668_1000083612 | 182 |
| 522 | 3300025972 | Ga0207668_10034168 | Ga0207668_100341681 | 182 |
| 523 | 3300025972 | Ga0207668_10830296 | Ga0207668_108302961 | 182 |
| 524 | 3300025981 | Ga0207640_10017430 | Ga0207640_100174303 | 182 |
| 525 | 3300025981 | Ga0207640_10395211 | Ga0207640_103952112 | 182 |
| 526 | 3300025986 | Ga0207658_10000257 | Ga0207658_1000025722 | 182 |
| 527 | 3300025986 | Ga0207658_10057414 | Ga0207658_100574142 | 182 |
| 528 | 3300025986 | Ga0207658_10081847 | Ga0207658_100818473 | 182 |
| 529 | 3300025986 | Ga0207658_10132775 | Ga0207658_101327753 | 182 |
| 530 | 3300025986 | Ga0207658_10994181 | Ga0207658_109941812 | 182 |
| 531 | 3300026023 | Ga0207677_10020520 | Ga0207677_100205203 | 182 |
| 532 | 3300026023 | Ga0207677_11211658 | Ga0207677_112116582 | 182 |
| 533 | 3300026035 | Ga0207703_10028860 | Ga0207703_100288603 | 182 |
| 534 | 3300026035 | Ga0207703_10100312 | Ga0207703_101003121 | 182 |
| 535 | 3300026035 | Ga0207703_10104576 | Ga0207703_101045763 | 182 |
| 536 | 3300026035 | Ga0207703_10327003 | Ga0207703_103270032 | 182 |
| 537 | 3300026041 | Ga0207639_10021438 | Ga0207639_100214383 | 182 |
| 538 | 3300026041 | Ga0207639_10021450 | Ga0207639_100214504 | 182 |
| 539 | 3300026067 | Ga0207678_10004074 | Ga0207678_100040742 | 182 |
| 540 | 3300026067 | Ga0207678_10020372 | Ga0207678_100203723 | 182 |
| 541 | 3300026067 | Ga0207678_10466722 | Ga0207678_104667222 | 182 |
| 542 | 3300026075 | Ga0207708_10008819 | Ga0207708_100088193 | 182 |
| 543 | 3300026075 | Ga0207708_10822474 | Ga0207708_108224741 | 182 |
| 544 | 3300026078 | Ga0207702_10336090 | Ga0207702_103360902 | 182 |
| 545 | 3300026088 | Ga0207641_10004205 | Ga0207641_1000420510 | 182 |
| 546 | 3300026088 | Ga0207641_10506739 | Ga0207641_105067392 | 182 |
| 547 | 3300026089 | Ga0207648_10033528 | Ga0207648_100335283 | 182 |
| 548 | 3300026095 | Ga0207676_10373619 | Ga0207676_103736191 | 182 |
| 549 | 3300026118 | Ga0207675_100000834 | Ga0207675_10000083428 | 182 |
| 550 | 3300026118 | Ga0207675_100276977 | Ga0207675_1002769773 | 182 |
| 551 | 3300026121 | Ga0207683_10002401 | Ga0207683_1000240114 | 182 |
| 552 | 3300026121 | Ga0207683_10005298 | Ga0207683_100052983 | 182 |
| 553 | 3300026121 | Ga0207683_10045141 | Ga0207683_100451413 | 182 |
| 554 | 3300026142 | Ga0207698_10304403 | Ga0207698_103044033 | 182 |
| 555 | 3300028379 | Ga0268266_10061902 | Ga0268266_100619025 | 182 |
| 556 | 3300028380 | Ga0268265_10000105 | Ga0268265_1000010538 | 182 |
| 557 | 3300028380 | Ga0268265_10070377 | Ga0268265_100703773 | 182 |
| 558 | 3300028381 | Ga0268264_10000237 | Ga0268264_1000023780 | 182 |
| 559 | 3300028381 | Ga0268264_10018348 | Ga0268264_100183483 | 182 |
| 560 | 3300031731 | Ga0307405_11298838 | Ga0307405_112988381 | 182 |
| 561 | 3300031852 | Ga0307410_10574587 | Ga0307410_105745872 | 182 |
| 562 | 3300031901 | Ga0307406_10269240 | Ga0307406_102692402 | 182 |
| 563 | 3300031903 | Ga0307407_10285423 | Ga0307407_102854231 | 182 |
| 564 | 3300031995 | Ga0307409_100040233 | Ga0307409_1000402332 | 182 |
| 565 | 3300031995 | Ga0307409_100383410 | Ga0307409_1003834101 | 182 |
| 566 | 3300031995 | Ga0307409_101226481 | Ga0307409_1012264811 | 182 |
| 567 | 3300032002 | Ga0307416_101961401 | Ga0307416_1019614011 | 182 |
| 568 | 3300032005 | Ga0307411_10151754 | Ga0307411_101517542 | 182 |
| 569 | 3300032005 | Ga0307411_10390722 | Ga0307411_103907222 | 182 |
| 570 | 3300032126 | Ga0307415_100160281 | Ga0307415_1001602812 | 182 |
| 571 | 3300032126 | Ga0307415_100298847 | Ga0307415_1002988472 | 182 |
| 572 | 3300035112 | Ga0373932_0008993 | Ga0373932_0008993_1550_2110 | 182 |
| 573 | 3300035241 | Ga0373961_0221006 | Ga0373961_0221006_34_594 | 182 |
| 574 | 3300035691 | Ga0373931_0018961 | Ga0373931_0018961_325_885 | 182 |
| 575 | 3300039447 | Ga0436361_1114931 | Ga0436361_1114931_808_1356 | 182 |
| 576 | 3300041410 | Ga0439461_0047958 | Ga0439461_0047958_46_606 | 182 |
| 577 | 3300041410 | Ga0439461_0061462 | Ga0439461_0061462_122_670 | 182 |
| 578 | 3300041411 | Ga0439466_0002859 | Ga0439466_0002859_4813_5361 | 182 |
| 579 | 3300041411 | Ga0439466_0074359 | Ga0439466_0074359_274_834 | 182 |
| 580 | 3300041411 | Ga0439466_0142601 | Ga0439466_0142601_82_642 | 182 |
| 581 | 3300041413 | Ga0439465_0000074 | Ga0439465_0000074_19407_19967 | 182 |
| 582 | 3300041413 | Ga0439465_0003465 | Ga0439465_0003465_1459_2007 | 182 |
| 583 | 3300041413 | Ga0439465_0010780 | Ga0439465_0010780_794_1342 | 182 |
| 584 | 3300041413 | Ga0439465_0012061 | Ga0439465_0012061_2038_2598 | 182 |
| 585 | 3300041443 | Ga0451789_1281002 | Ga0451789_1281002_213_761 | 182 |
| 586 | 3300041452 | Ga0451793_1189180 | Ga0451793_1189180_375_923 | 182 |
| 587 | 3300041456 | Ga0451795_1670815 | Ga0451795_1670815_1478_2026 | 182 |
| 588 | 3300041460 | Ga0451802_1056342 | Ga0451802_1056342_424_972 | 182 |
| 589 | 3300041997 | Ga0439431_0005313 | Ga0439431_0005313_809_1369 | 182 |
| 590 | 3300041997 | Ga0439431_0145957 | Ga0439431_0145957_95_643 | 182 |
| 591 | 3300042002 | Ga0439442_021882 | Ga0439442_021882_716_1276 | 182 |
| 592 | 3300042004 | Ga0439445_0086116 | Ga0439445_0086116_228_788 | 182 |
| 593 | 3300042438 | Ga0439459_0118249 | Ga0439459_0118249_82_630 | 182 |
| 594 | 3300042438 | Ga0439459_0127327 | Ga0439459_0127327_63_623 | 182 |
| 595 | 3300044656 | Ga0466969_0180186 | Ga0466969_0180186_403_951 | 182 |
| 596 | 3300044658 | Ga0466972_0016461 | Ga0466972_0016461_1829_2389 | 182 |
| 597 | 3300044658 | Ga0466972_0068734 | Ga0466972_0068734_864_1424 | 182 |
| 598 | 3300044658 | Ga0466972_0128564 | Ga0466972_0128564_82_630 | 182 |
| 599 | 3300044684 | Ga0466966_0372774 | Ga0466966_0372774_286_834 | 182 |
| 600 | 3300044706 | Ga0466964_0353449 | Ga0466964_0353449_95_658 | 182 |
| 601 | 3300044706 | Ga0466964_0432715 | Ga0466964_0432715_117_677 | 182 |
| 602 | 3300044765 | Ga0466970_0199723 | Ga0466970_0199723_97_657 | 182 |
| 603 | 3300044842 | Ga0466957_0049766 | Ga0466957_0049766_518_1066 | 182 |
| 604 | 3300044842 | Ga0466957_0108328 | Ga0466957_0108328_652_1212 | 182 |
| 605 | 3300044901 | Ga0466960_0000761 | Ga0466960_0000761_133_681 | 182 |
| 606 | 3300044901 | Ga0466960_0035811 | Ga0466960_0035811_1528_2076 | 182 |
| 607 | 3300044901 | Ga0466960_0349590 | Ga0466960_0349590_174_737 | 182 |
| 608 | 3300045049 | Ga0466959_0146105 | Ga0466959_0146105_653_1213 | 182 |
| 609 | 3300045049 | Ga0466959_0452253 | Ga0466959_0452253_204_752 | 182 |
| 610 | 3300045836 | Ga0466958_0005722 | Ga0466958_0005722_568_1128 | 182 |
| 611 | 3300045976 | Ga0466967_0521402 | Ga0466967_0521402_132_689 | 182 |
| 612 | 3300045976 | Ga0466967_1018022 | Ga0466967_1018022_248_796 | 182 |
| 613 | 3300046460 | Ga0495638_0004264 | Ga0495638_0004264_3494_4042 | 182 |
| 614 | 3300046524 | Ga0495648_0032953 | Ga0495648_0032953_2053_2601 | 182 |
| 615 | 3300046660 | Ga0495625_0089206 | Ga0495625_0089206_381_929 | 182 |
| 616 | 3300046663 | Ga0495635_0276102 | Ga0495635_0276102_425_973 | 182 |
| 617 | 3300046692 | Ga0495671_0305686 | Ga0495671_0305686_45_593 | 182 |
| 618 | 3300046694 | Ga0495649_0390553 | Ga0495649_0390553_127_675 | 182 |
| 619 | 3300047320 | Ga0495672_0241223 | Ga0495672_0241223_27_575 | 182 |
| 620 | 3300047472 | Ga0495686_0004460 | Ga0495686_0004460_2855_3403 | 182 |
| 621 | 3300047472 | Ga0495686_0083876 | Ga0495686_0083876_1327_1875 | 182 |
| 622 | 3300048903 | Ga0496100_0006859 | Ga0496100_0006859_5599_6147 | 182 |
| 623 | 3300048903 | Ga0496100_0009905 | Ga0496100_0009905_59_607 | 182 |
| 624 | 3300048903 | Ga0496100_0010785 | Ga0496100_0010785_3480_4028 | 182 |
| 625 | 3300048903 | Ga0496100_0085705 | Ga0496100_0085705_376_936 | 182 |
| 626 | 3300048904 | Ga0496101_0000126 | Ga0496101_0000126_41809_42357 | 182 |
| 627 | 3300048904 | Ga0496101_0001097 | Ga0496101_0001097_2468_3028 | 182 |
| 628 | 3300048904 | Ga0496101_0004633 | Ga0496101_0004633_3089_3637 | 182 |
| 629 | 3300048904 | Ga0496101_0035495 | Ga0496101_0035495_2181_2729 | 182 |
| 630 | 3300048904 | Ga0496101_0119992 | Ga0496101_0119992_444_992 | 182 |
| 631 | 3300048904 | Ga0496101_0441933 | Ga0496101_0441933_310_870 | 182 |
| 632 | 3300048905 | Ga0496102_0000006 | Ga0496102_0000006_30521_31069 | 182 |
| 633 | 3300048905 | Ga0496102_0000985 | Ga0496102_0000985_10809_11357 | 182 |
| 634 | 3300048905 | Ga0496102_0010400 | Ga0496102_0010400_1543_2103 | 182 |
| 635 | 3300048905 | Ga0496102_0129219 | Ga0496102_0129219_256_816 | 182 |
| 636 | 3300048905 | Ga0496102_0170814 | Ga0496102_0170814_538_1095 | 182 |
| 637 | 3300048905 | Ga0496102_0287011 | Ga0496102_0287011_981_1529 | 182 |
| 638 | 3300048905 | Ga0496102_0487509 | Ga0496102_0487509_388_948 | 182 |
| 639 | 3300048906 | Ga0496103_0000006 | Ga0496103_0000006_30348_30896 | 182 |
| 640 | 3300048906 | Ga0496103_0000356 | Ga0496103_0000356_6514_7062 | 182 |
| 641 | 3300048906 | Ga0496103_0004805 | Ga0496103_0004805_301_861 | 182 |
| 642 | 3300048907 | Ga0496104_0003054 | Ga0496104_0003054_8741_9289 | 182 |
| 643 | 3300048907 | Ga0496104_0050164 | Ga0496104_0050164_2702_3262 | 182 |
| 644 | 3300048908 | Ga0496105_0042538 | Ga0496105_0042538_53_601 | 182 |
| 645 | 3300048908 | Ga0496105_0216709 | Ga0496105_0216709_885_1445 | 182 |
| 646 | 3300048909 | Ga0496106_0006632 | Ga0496106_0006632_3233_3793 | 182 |
| 647 | 3300048909 | Ga0496106_0086490 | Ga0496106_0086490_1759_2307 | 182 |
| 648 | 3300048909 | Ga0496106_0443798 | Ga0496106_0443798_141_698 | 182 |
| 649 | 3300048910 | Ga0496107_0014104 | Ga0496107_0014104_2862_3410 | 182 |
| 650 | 3300048910 | Ga0496107_0021207 | Ga0496107_0021207_3794_4354 | 182 |
| 651 | 3300048910 | Ga0496107_0077817 | Ga0496107_0077817_1030_1578 | 182 |
| 652 | 3300048911 | Ga0496108_0008982 | Ga0496108_0008982_6218_6778 | 182 |
| 653 | 3300048911 | Ga0496108_0420405 | Ga0496108_0420405_294_842 | 182 |
| 654 | 3300048911 | Ga0496108_0528460 | Ga0496108_0528460_140_700 | 182 |
| 655 | 3300048911 | Ga0496108_0705377 | Ga0496108_0705377_46_597 | 182 |
| 656 | 3300048912 | Ga0496109_0000990 | Ga0496109_0000990_2688_3248 | 182 |
| 657 | 3300048912 | Ga0496109_0513291 | Ga0496109_0513291_233_793 | 182 |
| 658 | 3300048913 | Ga0496110_0042461 | Ga0496110_0042461_412_972 | 182 |
| 659 | 3300048913 | Ga0496110_0200075 | Ga0496110_0200075_1022_1582 | 182 |
| 660 | 3300048915 | Ga0496112_0012991 | Ga0496112_0012991_1630_2190 | 182 |
| 661 | 3300048915 | Ga0496112_0035783 | Ga0496112_0035783_1904_2464 | 182 |
| 662 | 3300048915 | Ga0496112_0227724 | Ga0496112_0227724_266_814 | 182 |
| 663 | 3300048915 | Ga0496112_0336228 | Ga0496112_0336228_10_558 | 182 |
| 664 | 3300048915 | Ga0496112_1396336 | Ga0496112_1396336_34_582 | 182 |
| 665 | 3300048916 | Ga0496113_0013559 | Ga0496113_0013559_4323_4871 | 182 |
| 666 | 3300048917 | Ga0496114_0003652 | Ga0496114_0003652_1647_2207 | 182 |
| 667 | 3300048917 | Ga0496114_0013084 | Ga0496114_0013084_5175_5723 | 182 |
| 668 | 3300048917 | Ga0496114_0816988 | Ga0496114_0816988_133_681 | 182 |
| 669 | 3300048918 | Ga0496115_0013721 | Ga0496115_0013721_2043_2603 | 182 |
| 670 | 3300048918 | Ga0496115_0136768 | Ga0496115_0136768_507_1055 | 182 |
| 671 | 3300048919 | Ga0496116_0000025 | Ga0496116_0000025_439644_440192 | 182 |
| 672 | 3300048919 | Ga0496116_0015243 | Ga0496116_0015243_1513_2061 | 182 |
| 673 | 3300048920 | Ga0496117_0000006 | Ga0496117_0000006_439673_440221 | 182 |
| 674 | 3300048920 | Ga0496117_0006504 | Ga0496117_0006504_4024_4572 | 182 |
| 675 | 3300048920 | Ga0496117_0301678 | Ga0496117_0301678_24_572 | 182 |
| 676 | 3300048921 | Ga0496118_0000004 | Ga0496118_0000004_439673_440221 | 182 |
| 677 | 3300048921 | Ga0496118_0009842 | Ga0496118_0009842_6057_6605 | 182 |
| 678 | 3300048921 | Ga0496118_0351433 | Ga0496118_0351433_113_673 | 182 |
| 679 | 3300048922 | Ga0496119_0000041 | Ga0496119_0000041_1413_1961 | 182 |
| 680 | 3300048922 | Ga0496119_0006040 | Ga0496119_0006040_9296_9844 | 182 |
| 681 | 3300048923 | Ga0496120_0000027 | Ga0496120_0000027_199044_199592 | 182 |
| 682 | 3300048924 | Ga0496121_0001735 | Ga0496121_0001735_31849_32397 | 182 |
| 683 | 3300048924 | Ga0496121_0015445 | Ga0496121_0015445_6705_7253 | 182 |
| 684 | 3300048925 | Ga0496122_0027173 | Ga0496122_0027173_2619_3167 | 182 |
| 685 | 3300048926 | Ga0496123_0052150 | Ga0496123_0052150_2069_2617 | 182 |
| 686 | 3300048927 | Ga0496124_0058977 | Ga0496124_0058977_1336_1884 | 182 |
| 687 | 3300048928 | Ga0496125_0012549 | Ga0496125_0012549_7266_7814 | 182 |
| 688 | 3300048929 | Ga0496126_0001191 | Ga0496126_0001191_22803_23351 | 182 |
| 689 | 3300048929 | Ga0496126_0011848 | Ga0496126_0011848_3375_3923 | 182 |
| 690 | 3300048929 | Ga0496126_0053729 | Ga0496126_0053729_511_1059 | 182 |
| 691 | 3300049553 | Ga0501337_011751 | Ga0501337_011751_50_604 | 182 |
| 692 | 3300049571 | Ga0501034_0229493 | Ga0501034_0229493_675_1223 | 182 |
| 693 | 3300050489 | nmdc:mga03683_279118_c1 | nmdc:mga03683_279118_c1_122_670 | 182 |
| 694 | 3300050490 | nmdc:mga03n38_4088_c1 | nmdc:mga03n38_4088_c1_43_597 | 182 |
| 695 | 3300050490 | nmdc:mga03n38_5038_c1 | nmdc:mga03n38_5038_c1_86_649 | 182 |
| 696 | 3300050490 | nmdc:mga03n38_6690_c1 | nmdc:mga03n38_6690_c1_159_707 | 182 |
| 697 | 3300050491 | nmdc:mga00v17_23627_c1 | nmdc:mga00v17_23627_c1_1579_2133 | 182 |
| 698 | 3300050491 | nmdc:mga00v17_303294_c1 | nmdc:mga00v17_303294_c1_329_877 | 182 |
| 699 | 3300050491 | nmdc:mga00v17_467228_c1 | nmdc:mga00v17_467228_c1_231_779 | 182 |
| 700 | 3300050491 | nmdc:mga00v17_657_c1 | nmdc:mga00v17_657_c1_11756_12316 | 182 |
| 701 | 3300050491 | nmdc:mga00v17_69638_c1 | nmdc:mga00v17_69638_c1_800_1348 | 182 |
| 702 | 3300050491 | nmdc:mga00v17_8556_c1 | nmdc:mga00v17_8556_c1_2509_3072 | 182 |
| 703 | 3300050492 | nmdc:mga0yw44_101229_c1 | nmdc:mga0yw44_101229_c1_1025_1585 | 182 |
| 704 | 3300050492 | nmdc:mga0yw44_151545_c1 | nmdc:mga0yw44_151545_c1_835_1383 | 182 |
| 705 | 3300050492 | nmdc:mga0yw44_427385_c1 | nmdc:mga0yw44_427385_c1_288_836 | 182 |
| 706 | 3300050492 | nmdc:mga0yw44_43067_c1 | nmdc:mga0yw44_43067_c1_1189_1743 | 182 |
| 707 | 3300050492 | nmdc:mga0yw44_453204_c1 | nmdc:mga0yw44_453204_c1_161_805 | 182 |
| 708 | 3300050492 | nmdc:mga0yw44_61426_c1 | nmdc:mga0yw44_61426_c1_527_1075 | 182 |
| 709 | 3300050494 | nmdc:mga06z11_2967_c1 | nmdc:mga06z11_2967_c1_1367_1921 | 182 |
| 710 | 3300050494 | nmdc:mga06z11_35162_c1 | nmdc:mga06z11_35162_c1_1840_2403 | 182 |
| 711 | 3300050496 | nmdc:mga07m45_151238_c1 | nmdc:mga07m45_151238_c1_119_667 | 182 |
| 712 | 3300050496 | nmdc:mga07m45_22945_c1 | nmdc:mga07m45_22945_c1_1488_2042 | 182 |
| 713 | 3300050496 | nmdc:mga07m45_46189_c1 | nmdc:mga07m45_46189_c1_1328_1891 | 182 |
| 714 | 3300050507 | nmdc:mga05p37_114951_c1 | nmdc:mga05p37_114951_c1_1910_2470 | 182 |
| 715 | 3300050507 | nmdc:mga05p37_57571_c1 | nmdc:mga05p37_57571_c1_2396_2956 | 182 |
| 716 | 3300050509 | nmdc:mga0qj67_9159_c1 | nmdc:mga0qj67_9159_c1_1752_2312 | 182 |
| 717 | 3300050510 | nmdc:mga06r32_35137_c1 | nmdc:mga06r32_35137_c1_746_1306 | 182 |
| 718 | 3300050516 | nmdc:mga0sz30_179944_c1 | nmdc:mga0sz30_179944_c1_258_806 | 182 |
| 719 | 3300050516 | nmdc:mga0sz30_299653_c1 | nmdc:mga0sz30_299653_c1_34_588 | 182 |
| 720 | 3300050516 | nmdc:mga0sz30_51860_c1 | nmdc:mga0sz30_51860_c1_495_1043 | 182 |
| 721 | 3300050516 | nmdc:mga0sz30_967_c1 | nmdc:mga0sz30_967_c1_9521_10081 | 182 |
| 722 | 3300053079 | Ga0500610_0019519 | Ga0500610_0019519_2715_3263 | 182 |
| 723 | 3300053087 | Ga0500643_000926 | Ga0500643_000926_14713_15261 | 182 |
| 724 | 3300053104 | Ga0500556_0094967 | Ga0500556_0094967_26_574 | 182 |
| 725 | 3300053108 | Ga0500562_018730 | Ga0500562_018730_1103_1651 | 182 |
| 726 | 3300053108 | Ga0500562_027255 | Ga0500562_027255_456_1007 | 182 |
| 727 | 3300053153 | Ga0500616_0009538 | Ga0500616_0009538_4991_5539 | 182 |
| 728 | 3300053153 | Ga0500616_0214514 | Ga0500616_0214514_61_609 | 182 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1wub-assembly1.cif.gz_A | crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 | 0.9374 | 13 | 182 |
| 7bwl-assembly1.cif.gz_A | structure of antibiotic sequester from pseudomonas aerurinosa | 0.9263 | 12 | 181 |
| 7bwl-assembly1.cif.gz_A | structure of antibiotic sequester from pseudomonas aerurinosa | 0.921 | 12 | 181 |
| 1y0g-assembly2.cif.gz_D | crystal structure of the escherichia coli ycei protein, structural genomics | 0.9177 | 12 | 182 |
| 1y0g-assembly2.cif.gz_D | crystal structure of the escherichia coli ycei protein, structural genomics | 0.9125 | 12 | 182 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FUS9_3_167_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.9416 | 16 | 177 | 2.40.128.110 |
| 1wubA00 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.9374 | 13 | 182 | 2.40.128.110 |
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.9224 | 12 | 182 | 2.40.128.110 |
| af_P0A8X2_23_191_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.9171 | 12 | 182 | 2.40.128.110 |
| af_Q2FUS9_3_167_2.40.128.110 | Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like | 0.9138 | 16 | 177 | 2.40.128.110 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7I9ZUA4-F1-model_v4 | Polyisoprenoid-binding protein | 0.9901 | 3 | 182 |
|
| AF-K8X665-F1-model_v4 | Lipid/polyisoprenoid-binding YceI-like domain-containing protein | 0.9885 | 1 | 153 |
|
| AF-A0A1B1KI26-F1-model_v4 | Lipid/polyisoprenoid-binding YceI-like domain-containing protein | 0.9875 | 8 | 182 |
|
| AF-K6UYZ8-F1-model_v4 | Lipid/polyisoprenoid-binding YceI-like domain-containing protein | 0.9871 | 46 | 182 |
|
| AF-A0A1X3P6B0-F1-model_v4 | Polyisoprenoid-binding protein | 0.9861 | 9 | 182 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar