F477788

General Info

Members Datasets Scaffolds Average Seq Length
728 324 720 184

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100036327|Ga0075428_1000363273
Length 216
Sequence MPRGMNSDYGPFSPWKASGRPTPLGERDIVMTSTFDATGTTQLSAGTWAIDPVHSSIGFSVRHLMVSKVRGNFEKFSGAIVVAEDGTPSVTAEIAVDSIHTNNEQRDGHIKSADFFEVEKYPTATFRSTGVRGNGDNYVVDGEFTLKGVTKPVSLDLEFNGVNPGMGHGEVAGFEASVVLNRKDFGIDIDMPLETGGTVVGDKVTITLEIEALKQS

Samples

Sample ID Description Type Environment
1 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
2 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
3 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
4 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
5 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
6 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
7 2929212328 Mycolicibacterium sp. R-73050 Hybrid assembly Isolate Unclassified
8 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
9 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
10 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
11 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
12 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
13 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
14 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
15 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
16 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
17 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
18 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
19 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
20 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
21 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
22 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
23 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
24 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
25 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
26 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
27 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
36 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
37 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
38 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
39 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
40 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
51 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
52 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
53 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
54 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
55 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
56 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
57 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
58 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
59 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
60 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
61 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
62 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
63 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
68 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
69 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
70 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
71 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
72 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
73 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
79 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
83 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
84 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
85 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
86 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
87 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
88 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
89 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
90 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
124 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
125 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
126 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
127 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
187 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
188 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
189 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
195 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
196 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
197 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
198 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
199 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
200 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
201 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
202 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
203 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
204 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
205 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
206 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
207 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
208 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
209 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
210 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
211 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
212 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
213 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
214 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
215 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
216 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
217 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
218 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
219 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
220 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
221 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
222 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
223 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
224 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
225 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
226 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
227 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
228 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
229 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
230 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
231 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
232 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
233 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
234 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
235 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
236 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
237 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
238 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
239 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
240 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
241 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
242 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
243 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
244 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
245 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
246 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
247 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
248 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
249 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
250 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
251 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
252 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
253 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
254 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
255 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
256 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
257 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
258 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
259 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
260 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
261 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
262 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
263 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
264 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
265 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
266 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
267 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
268 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
269 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
270 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
271 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
272 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
273 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
275 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
276 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
277 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
278 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
279 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
280 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
281 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
282 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
283 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
284 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
285 3300049541 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
286 3300049553 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_A_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
287 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
288 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
289 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
290 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
291 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
292 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
293 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
294 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
295 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
296 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
297 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
298 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
299 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
300 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
301 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
302 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
303 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
304 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
305 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
308 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
309 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
310 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
311 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
312 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
313 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
314 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
315 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
316 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
317 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
318 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
319 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
320 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
321 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
322 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
323 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
324 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.21
Metatranscriptomes 7.69
Isolates 1.1

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 12.09
Nodule 0.14
Rhizoplane 10.99
Rhizosphere 73.21
Stem 0
Stem Tuber 0
Unclassified 3.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 LJNas_1018574 3300000546 Bacteria 741
2 JGI24737J22298_10021976 3300001990 Bacteria 2028
3 JGI24743J22301_10011739 3300001991 Bacteria 1584
4 JGI24735J21928_10121258 3300002067 Bacteria 753
5 JGI24735J21928_10153785 3300002067 Bacteria 664
6 JGI24750J21931_1012170 3300002070 Bacteria 1138
7 JGI24750J21931_1039533 3300002070 Bacteria 714
8 JGI24745J21846_1018873 3300002073 Bacteria 805
9 JGI24745J21846_1025744 3300002073 Bacteria 700
10 JGI24749J21850_1004338 3300002076 Bacteria 1984
11 JGI24749J21850_1013474 3300002076 Bacteria 1148
12 JGI24744J21845_10005501 3300002077 Bacteria 2620
13 JGI24034J26672_10019414 3300002239 Bacteria 1061
14 JGI24034J26672_10027865 3300002239 Bacteria 910
15 JGI24742J22300_10031322 3300002244 Bacteria 930
16 JGI24742J22300_10036909 3300002244 Bacteria 864
17 Ga0032354_1033891 3300003693 Bacteria 655
18 Ga0055540_1010143 3300003792 Bacteria 3160
19 Ga0058863_10032663 3300004799 Bacteria 606
20 Ga0070676_10102805 3300005328 Bacteria 1768
21 Ga0070676_10911926 3300005328 Bacteria 655
22 Ga0070683_100882524 3300005329 Bacteria 858
23 Ga0070690_100004256 3300005330 Bacteria 7927
24 Ga0070670_100568953 3300005331 Bacteria 1012
25 Ga0068869_100013186 3300005334 Bacteria 5491
26 Ga0070666_10087130 3300005335 Bacteria 2140
27 Ga0070666_10098790 3300005335 Bacteria 2010
28 Ga0070666_10353360 3300005335 Bacteria 1052
29 Ga0070682_100037450 3300005337 Bacteria 2970
30 Ga0070682_100090388 3300005337 Bacteria 2002
31 Ga0068868_100074492 3300005338 Bacteria 2711
32 Ga0068868_100243604 3300005338 Bacteria 1511
33 Ga0070660_100232835 3300005339 Bacteria 1499
34 Ga0070689_100057637 3300005340 Bacteria 3015
35 Ga0070691_10032605 3300005341 Bacteria 2448
36 Ga0070691_10056829 3300005341 Bacteria 1876
37 Ga0070692_10107224 3300005345 Bacteria 1540
38 Ga0070692_10189241 3300005345 Bacteria 1198
39 Ga0070668_100030471 3300005347 Bacteria 4101
40 Ga0070668_100043322 3300005347 Bacteria 3451
41 Ga0070668_100110895 3300005347 Bacteria 2183
42 Ga0070668_100228698 3300005347 Bacteria 1536
43 Ga0070668_100693076 3300005347 Bacteria 898
44 Ga0070669_100021617 3300005353 Bacteria 4599
45 Ga0070669_100519257 3300005353 Bacteria 990
46 Ga0070675_100583799 3300005354 Bacteria 1013
47 Ga0070671_100009944 3300005355 Bacteria 7640
48 Ga0070671_100410624 3300005355 Bacteria 1159
49 Ga0070674_100003857 3300005356 Bacteria 8485
50 Ga0070674_100150845 3300005356 Bacteria 1754
51 Ga0070674_100339908 3300005356 Bacteria 1209
52 Ga0070674_100393497 3300005356 Bacteria 1130
53 Ga0070673_100114987 3300005364 Bacteria 2237
54 Ga0070673_100201963 3300005364 Bacteria 1712
55 Ga0070688_100026148 3300005365 Bacteria 3464
56 Ga0070659_100064462 3300005366 Bacteria 2900
57 Ga0070659_100604300 3300005366 Bacteria 943
58 Ga0070667_100000109 3300005367 Bacteria 105260
59 Ga0070667_100031290 3300005367 Bacteria 4437
60 Ga0070667_100177096 3300005367 Bacteria 1885
61 Ga0070667_101134747 3300005367 Unclassified 731
62 Ga0070709_10046663 3300005434 Bacteria 2694
63 Ga0070709_10087622 3300005434 Bacteria 2046
64 Ga0070710_10017236 3300005437 Bacteria 3692
65 Ga0070710_10027027 3300005437 Bacteria 3056
66 Ga0070701_10017488 3300005438 Bacteria 3352
67 Ga0070701_10185872 3300005438 Bacteria 1219
68 Ga0070711_100013970 3300005439 Bacteria 5051
69 Ga0070711_100291994 3300005439 Bacteria 1293
70 Ga0070705_100005850 3300005440 Bacteria 6016
71 Ga0070705_100347135 3300005440 Bacteria 1081
72 Ga0070700_100000774 3300005441 Bacteria 15725
73 Ga0070700_100289983 3300005441 Bacteria 1190
74 Ga0070694_100034274 3300005444 Bacteria 3347
75 Ga0070694_100055365 3300005444 Bacteria 2690
76 Ga0070694_100392479 3300005444 Bacteria 1085
77 Ga0070663_100116656 3300005455 Bacteria 2012
78 Ga0070663_100163966 3300005455 Bacteria 1713
79 Ga0070663_100395176 3300005455 Bacteria 1129
80 Ga0070678_100000467 3300005456 Bacteria 19301
81 Ga0070678_100068302 3300005456 Bacteria 2649
82 Ga0070678_100373688 3300005456 Bacteria 1231
83 Ga0070662_100004295 3300005457 Bacteria 8997
84 Ga0070662_100053295 3300005457 Bacteria 2928
85 Ga0070662_100712708 3300005457 Bacteria 849
86 Ga0070681_10381510 3300005458 Bacteria 1320
87 Ga0068867_100010615 3300005459 Bacteria 6497
88 Ga0070685_10036832 3300005466 Bacteria 2767
89 Ga0070685_10065814 3300005466 Bacteria 2134
90 Ga0070685_10142469 3300005466 Bacteria 1511
91 Ga0068853_100010343 3300005539 Bacteria 7548
92 Ga0068853_100205543 3300005539 Bacteria 1793
93 Ga0070672_100212603 3300005543 Bacteria 1620
94 Ga0070686_100586134 3300005544 Bacteria 877
95 Ga0070695_100019332 3300005545 Bacteria 4147
96 Ga0070695_100206322 3300005545 Bacteria 1408
97 Ga0070696_100019409 3300005546 Bacteria 4603
98 Ga0070696_100034631 3300005546 Bacteria 3475
99 Ga0070696_100162450 3300005546 Bacteria 1646
100 Ga0070693_100023123 3300005547 Bacteria 3317
101 Ga0070693_100068429 3300005547 Bacteria 2084
102 Ga0070665_100029440 3300005548 Bacteria 5527
103 Ga0070665_100088385 3300005548 Bacteria 3104
104 Ga0070665_100496237 3300005548 Bacteria 1232
105 Ga0070704_100000602 3300005549 Bacteria 17305
106 Ga0070704_100852500 3300005549 Bacteria 817
107 Ga0068855_100086873 3300005563 Bacteria 3616
108 Ga0068855_100420681 3300005563 Bacteria 1461
109 Ga0068854_100027736 3300005578 Bacteria 3906
110 Ga0068854_100366206 3300005578 Bacteria 1184
111 Ga0068854_100516834 3300005578 Bacteria 1008
112 Ga0068856_100311049 3300005614 Bacteria 1593
113 Ga0070702_100024239 3300005615 Bacteria 3235
114 Ga0070702_100093144 3300005615 Bacteria 1831
115 Ga0070702_101022321 3300005615 Bacteria 656
116 Ga0068852_100432707 3300005616 Bacteria 1299
117 Ga0068859_100012076 3300005617 Bacteria 8678
118 Ga0068859_100027373 3300005617 Bacteria 5718
119 Ga0068859_100898920 3300005617 Bacteria 970
120 Ga0068859_101012472 3300005617 Bacteria 912
121 Ga0068864_100122050 3300005618 Bacteria 2331
122 Ga0068864_100128775 3300005618 Bacteria 2271
123 Ga0068864_100187107 3300005618 Bacteria 1896
124 Ga0068866_10004586 3300005718 Bacteria 5662
125 Ga0068866_10029927 3300005718 Bacteria 2608
126 Ga0068861_100001402 3300005719 Bacteria 15149
127 Ga0068861_100001939 3300005719 Bacteria 13330
128 Ga0068861_100769013 3300005719 Bacteria 901
129 Ga0068851_10254997 3300005834 Bacteria 996
130 Ga0068863_100000123 3300005841 Bacteria 80999
131 Ga0068863_100017800 3300005841 Bacteria 6801
132 Ga0068863_100300146 3300005841 Bacteria 1558
133 Ga0068863_100302053 3300005841 Bacteria 1553
134 Ga0068858_100016034 3300005842 Bacteria 7039
135 Ga0068858_100018249 3300005842 Bacteria 6569
136 Ga0068858_100045698 3300005842 Bacteria 4059
137 Ga0068858_100341778 3300005842 Bacteria 1432
138 Ga0068860_100000175 3300005843 Bacteria 105260
139 Ga0068860_100392541 3300005843 Bacteria 1371
140 Ga0068862_100000091 3300005844 Bacteria 107015
141 Ga0068862_100029527 3300005844 Bacteria 4620
142 Ga0068862_100263752 3300005844 Bacteria 1573
143 Ga0068862_100422900 3300005844 Bacteria 1251
144 Ga0081455_10054955 3300005937 Bacteria 3390
145 Ga0081455_10064617 3300005937 Bacteria 3063
146 Ga0081455_10141119 3300005937 Bacteria 1871
147 Ga0081538_10014611 3300005981 Bacteria 6137
148 Ga0081538_10265695 3300005981 Bacteria 645
149 Ga0070717_11244780 3300006028 Bacteria 677
150 Ga0075365_10020584 3300006038 Bacteria 4094
151 Ga0075365_10038915 3300006038 Bacteria 3093
152 Ga0075365_10073547 3300006038 Bacteria 2304
153 Ga0075365_10108768 3300006038 Bacteria 1904
154 Ga0075365_10167765 3300006038 Bacteria 1532
155 Ga0075365_10603080 3300006038 Bacteria 776
156 Ga0075363_100002791 3300006048 Bacteria 7252
157 Ga0075363_100016652 3300006048 Bacteria 3634
158 Ga0075363_100201518 3300006048 Bacteria 1137
159 Ga0075363_100206764 3300006048 Bacteria 1123
160 Ga0075363_100215773 3300006048 Bacteria 1099
161 Ga0075364_10000762 3300006051 Bacteria 16897
162 Ga0075364_10001395 3300006051 Bacteria 13068
163 Ga0075364_10003431 3300006051 Bacteria 9010
164 Ga0075364_10008380 3300006051 Bacteria 6177
165 Ga0075364_10015168 3300006051 Bacteria 4772
166 Ga0075364_10017487 3300006051 Bacteria 4480
167 Ga0075364_10040928 3300006051 Bacteria 3007
168 Ga0075364_10130589 3300006051 Bacteria 1686
169 Ga0075364_10223573 3300006051 Bacteria 1278
170 Ga0070715_10075789 3300006163 Bacteria 1514
171 Ga0070716_100002625 3300006173 Bacteria 8302
172 Ga0070716_100054217 3300006173 Bacteria 2290
173 Ga0070716_100229007 3300006173 Bacteria 1253
174 Ga0070712_100001775 3300006175 Bacteria 13202
175 Ga0070712_100264976 3300006175 Bacteria 1378
176 Ga0075362_10190588 3300006177 Bacteria 996
177 Ga0075362_10291022 3300006177 Bacteria 809
178 Ga0075367_10001437 3300006178 Bacteria 10225
179 Ga0075367_10015293 3300006178 Bacteria 4166
180 Ga0075367_10268471 3300006178 Bacteria 1072
181 Ga0075369_10000249 3300006186 Bacteria 16010
182 Ga0075369_10004145 3300006186 Bacteria 5333
183 Ga0075369_10012480 3300006186 Bacteria 3358
184 Ga0075369_10029780 3300006186 Bacteria 2296
185 Ga0075369_10057303 3300006186 Bacteria 1694
186 Ga0075369_10128795 3300006186 Bacteria 1149
187 Ga0075369_10203413 3300006186 Bacteria 914
188 Ga0075369_10369966 3300006186 Bacteria 674
189 Ga0097621_100067322 3300006237 Bacteria 2952
190 Ga0097621_100116404 3300006237 Bacteria 2264
191 Ga0075370_10000542 3300006353 Bacteria 14466
192 Ga0075370_10002048 3300006353 Bacteria 9160
193 Ga0075370_10046882 3300006353 Bacteria 2447
194 Ga0075370_10094858 3300006353 Bacteria 1723
195 Ga0075370_10233718 3300006353 Bacteria 1088
196 Ga0068871_100399658 3300006358 Bacteria 1223
197 Ga0075428_100036327 3300006844 Bacteria 5427
198 Ga0075428_100261383 3300006844 Bacteria 1864
199 Ga0075428_100511916 3300006844 Bacteria 1284
200 Ga0075428_101001046 3300006844 Bacteria 885
201 Ga0075430_100026355 3300006846 Bacteria 4946
202 Ga0075431_100026836 3300006847 Bacteria 5907
203 Ga0075433_10588802 3300006852 Bacteria 977
204 Ga0068865_100000967 3300006881 Bacteria 16399
205 Ga0068865_100561222 3300006881 Bacteria 960
206 Ga0097620_100012076 3300006931 Bacteria 8678
207 Ga0097620_100027373 3300006931 Bacteria 5718
208 Ga0097620_100898954 3300006931 Bacteria 970
209 Ga0097620_101012500 3300006931 Bacteria 912
210 Ga0105240_11166682 3300009093 Bacteria 817
211 Ga0111539_11032732 3300009094 Bacteria 956
212 Ga0111539_11070195 3300009094 Bacteria 937
213 Ga0105245_10013928 3300009098 Bacteria 7004
214 Ga0105245_10036967 3300009098 Bacteria 4340
215 Ga0105245_11007420 3300009098 Bacteria 877
216 Ga0105247_10000070 3300009101 Bacteria 115098
217 Ga0105247_10001004 3300009101 Bacteria 21323
218 Ga0105247_10192652 3300009101 Bacteria 1365
219 Ga0114129_10039851 3300009147 Bacteria 6626
220 Ga0114129_10114182 3300009147 Bacteria 3724
221 Ga0105243_10091839 3300009148 Bacteria 2501
222 Ga0105243_10257989 3300009148 Bacteria 1559
223 Ga0105243_10307247 3300009148 Bacteria 1440
224 Ga0105243_10616415 3300009148 Bacteria 1047
225 Ga0105241_10342966 3300009174 Bacteria 1295
226 Ga0105242_10003084 3300009176 Bacteria 13004
227 Ga0105242_10138791 3300009176 Bacteria 2107
228 Ga0105242_10144002 3300009176 Bacteria 2071
229 Ga0105242_11111525 3300009176 Bacteria 805
230 Ga0105248_10000331 3300009177 Bacteria 55929
231 Ga0105248_10018065 3300009177 Bacteria 7784
232 Ga0105248_10140868 3300009177 Bacteria 2720
233 Ga0105248_10151686 3300009177 Bacteria 2615
234 Ga0105248_11975435 3300009177 Unclassified 662
235 Ga0105237_10004474 3300009545 Bacteria 16157
236 Ga0105237_10421647 3300009545 Bacteria 1340
237 Ga0105237_10734976 3300009545 Bacteria 993
238 Ga0105237_10962051 3300009545 Unclassified 861
239 Ga0105238_10849248 3300009551 Bacteria 930
240 Ga0105238_10966261 3300009551 Bacteria 872
241 Ga0105249_10000020 3300009553 Bacteria 260634
242 Ga0105249_10002803 3300009553 Bacteria 15055
243 Ga0105249_10004907 3300009553 Bacteria 11545
244 Ga0105249_10008623 3300009553 Bacteria 8886
245 Ga0099796_10006080 3300010159 Bacteria 3068
246 Ga0105239_10008898 3300010375 Bacteria 11364
247 Ga0105239_10009529 3300010375 Bacteria 10930
248 Ga0105239_10092653 3300010375 Bacteria 3335
249 Ga0105239_10274913 3300010375 Bacteria 1895
250 Ga0105239_11041816 3300010375 Bacteria 941
251 Ga0105246_10006036 3300011119 Bacteria 7394
252 Ga0105246_10099422 3300011119 Bacteria 2115
253 Ga0157371_10386374 3300013102 Bacteria 1023
254 Ga0157369_10301792 3300013105 Bacteria 1666
255 Ga0157374_10016118 3300013296 Bacteria 6566
256 Ga0157374_10224822 3300013296 Bacteria 1843
257 Ga0157378_10186518 3300013297 Bacteria 1954
258 Ga0157378_10208473 3300013297 Bacteria 1852
259 Ga0157378_10227120 3300013297 Bacteria 1777
260 Ga0163162_10046855 3300013306 Bacteria 4334
261 Ga0163162_10084896 3300013306 Bacteria 3242
262 Ga0163162_10094586 3300013306 Bacteria 3074
263 Ga0163162_10159827 3300013306 Bacteria 2375
264 Ga0163162_10195635 3300013306 Bacteria 2150
265 Ga0157372_10345414 3300013307 Bacteria 1734
266 Ga0157372_10504153 3300013307 Bacteria 1411
267 Ga0157375_10002631 3300013308 Bacteria 15547
268 Ga0163163_10032410 3300014325 Bacteria 5046
269 Ga0163163_10108336 3300014325 Bacteria 2805
270 Ga0163163_10278820 3300014325 Bacteria 1723
271 Ga0157380_10013790 3300014326 Bacteria 5903
272 Ga0157380_10150109 3300014326 Bacteria 2013
273 Ga0157377_10081520 3300014745 Bacteria 1892
274 Ga0157377_10194505 3300014745 Bacteria 1284
275 Ga0157379_10011897 3300014968 Bacteria 7604
276 Ga0157379_10076438 3300014968 Bacteria 2998
277 Ga0157379_10144291 3300014968 Bacteria 2147
278 Ga0157376_10177790 3300014969 Bacteria 1943
279 Ga0157376_10502151 3300014969 Bacteria 1192
280 Ga0163161_10000957 3300017792 Bacteria 22171
281 Ga0163161_10845423 3300017792 Bacteria 772
282 Ga0197907_10667919 3300020069 Bacteria 847
283 Ga0206355_1005082 3300020076 Bacteria 786
284 Ga0209673_1013692 3300025273 Bacteria 3188
285 Ga0209051_1000582 3300025303 Bacteria 43455
286 Ga0209051_1015812 3300025303 Bacteria 3455
287 Ga0209051_1036607 3300025303 Bacteria 1810
288 Ga0207656_10342499 3300025321 Bacteria 745
289 Ga0207682_10117257 3300025893 Bacteria 1178
290 Ga0207692_10004952 3300025898 Bacteria 5299
291 Ga0207692_10021451 3300025898 Bacteria 2955
292 Ga0207642_10001479 3300025899 Bacteria 7265
293 Ga0207642_10018899 3300025899 Bacteria 2656
294 Ga0207710_10000010 3300025900 Bacteria 482087
295 Ga0207710_10017264 3300025900 Bacteria 3061
296 Ga0207710_10061556 3300025900 Bacteria 1704
297 Ga0207710_10265589 3300025900 Bacteria 861
298 Ga0207688_10015416 3300025901 Bacteria 4145
299 Ga0207688_10032873 3300025901 Bacteria 2867
300 Ga0207688_10241667 3300025901 Bacteria 1092
301 Ga0207680_10195473 3300025903 Bacteria 1375
302 Ga0207680_10472538 3300025903 Bacteria 891
303 Ga0207647_10014832 3300025904 Bacteria 5360
304 Ga0207647_10084790 3300025904 Bacteria 1896
305 Ga0207685_10018085 3300025905 Bacteria 2294
306 Ga0207685_10074473 3300025905 Bacteria 1386
307 Ga0207699_10037896 3300025906 Bacteria 2759
308 Ga0207699_10168344 3300025906 Bacteria 1464
309 Ga0207654_10185811 3300025911 Bacteria 1359
310 Ga0207671_10020596 3300025914 Bacteria 5017
311 Ga0207671_10334140 3300025914 Bacteria 1200
312 Ga0207671_10962015 3300025914 Bacteria 674
313 Ga0207693_10000776 3300025915 Bacteria 28688
314 Ga0207693_10003141 3300025915 Bacteria 14203
315 Ga0207663_10005574 3300025916 Bacteria 6354
316 Ga0207663_10542544 3300025916 Bacteria 908
317 Ga0207660_10749943 3300025917 Bacteria 797
318 Ga0207657_10124940 3300025919 Bacteria 2114
319 Ga0207681_10008663 3300025923 Bacteria 6211
320 Ga0207681_10029215 3300025923 Bacteria 3578
321 Ga0207681_10474244 3300025923 Bacteria 1021
322 Ga0207650_10716240 3300025925 Bacteria 846
323 Ga0207659_10075210 3300025926 Bacteria 2477
324 Ga0207687_10007808 3300025927 Bacteria 7014
325 Ga0207687_10116220 3300025927 Bacteria 1994
326 Ga0207687_10237674 3300025927 Bacteria 1442
327 Ga0207687_11341062 3300025927 Unclassified 615
328 Ga0207664_10352063 3300025929 Bacteria 1304
329 Ga0207644_10185055 3300025931 Bacteria 1635
330 Ga0207644_10276354 3300025931 Bacteria 1347
331 Ga0207644_10346566 3300025931 Bacteria 1205
332 Ga0207690_10726140 3300025932 Bacteria 818
333 Ga0207706_10000901 3300025933 Bacteria 30536
334 Ga0207706_10204498 3300025933 Bacteria 1731
335 Ga0207706_10518107 3300025933 Bacteria 1028
336 Ga0207686_10080764 3300025934 Bacteria 2120
337 Ga0207686_10196986 3300025934 Bacteria 1440
338 Ga0207686_10226285 3300025934 Bacteria 1353
339 Ga0207709_10051308 3300025935 Bacteria 2528
340 Ga0207709_10158067 3300025935 Bacteria 1578
341 Ga0207709_10191045 3300025935 Bacteria 1454
342 Ga0207709_10423327 3300025935 Bacteria 1023
343 Ga0207670_10139009 3300025936 Bacteria 1789
344 Ga0207669_10004518 3300025937 Bacteria 6136
345 Ga0207669_10037198 3300025937 Bacteria 2790
346 Ga0207669_10213879 3300025937 Bacteria 1409
347 Ga0207669_10218277 3300025937 Bacteria 1398
348 Ga0207669_10862606 3300025937 Unclassified 754
349 Ga0207704_10000988 3300025938 Bacteria 12633
350 Ga0207665_10006327 3300025939 Bacteria 7854
351 Ga0207665_10025264 3300025939 Bacteria 3918
352 Ga0207665_10286792 3300025939 Bacteria 1227
353 Ga0207691_10086182 3300025940 Bacteria 2818
354 Ga0207711_10000522 3300025941 Bacteria 39517
355 Ga0207711_10060427 3300025941 Bacteria 3266
356 Ga0207711_10090999 3300025941 Bacteria 2683
357 Ga0207711_10524748 3300025941 Bacteria 1104
358 Ga0207689_10125362 3300025942 Bacteria 2113
359 Ga0207661_10287463 3300025944 Bacteria 1471
360 Ga0207651_10291364 3300025960 Bacteria 1353
361 Ga0207651_10310304 3300025960 Bacteria 1315
362 Ga0207712_10000010 3300025961 Bacteria 455972
363 Ga0207712_10022342 3300025961 Bacteria 4164
364 Ga0207712_10034930 3300025961 Bacteria 3411
365 Ga0207712_10062636 3300025961 Bacteria 2645
366 Ga0207712_10908024 3300025961 Bacteria 779
367 Ga0207668_10000836 3300025972 Bacteria 18603
368 Ga0207668_10034168 3300025972 Bacteria 3374
369 Ga0207668_10830296 3300025972 Bacteria 819
370 Ga0207640_10017430 3300025981 Bacteria 4202
371 Ga0207640_10089478 3300025981 Bacteria 2128
372 Ga0207640_10395211 3300025981 Bacteria 1124
373 Ga0207658_10000257 3300025986 Bacteria 55345
374 Ga0207658_10057414 3300025986 Bacteria 2892
375 Ga0207658_10081847 3300025986 Bacteria 2477
376 Ga0207658_10132775 3300025986 Bacteria 2003
377 Ga0207658_10994181 3300025986 Bacteria 765
378 Ga0207677_10020520 3300026023 Bacteria 4013
379 Ga0207677_10935949 3300026023 Bacteria 783
380 Ga0207677_11211658 3300026023 Bacteria 691
381 Ga0207703_10028860 3300026035 Bacteria 4378
382 Ga0207703_10100312 3300026035 Bacteria 2453
383 Ga0207703_10104576 3300026035 Bacteria 2405
384 Ga0207703_10327003 3300026035 Bacteria 1405
385 Ga0207639_10021438 3300026041 Bacteria 4641
386 Ga0207639_10021450 3300026041 Bacteria 4640
387 Ga0207678_10004074 3300026067 Bacteria 13148
388 Ga0207678_10020372 3300026067 Bacteria 5818
389 Ga0207678_10466722 3300026067 Bacteria 1098
390 Ga0207708_10008819 3300026075 Bacteria 7462
391 Ga0207708_10340004 3300026075 Bacteria 1229
392 Ga0207708_10822474 3300026075 Bacteria 801
393 Ga0207702_10336090 3300026078 Bacteria 1442
394 Ga0207641_10004205 3300026088 Bacteria 12548
395 Ga0207641_10007166 3300026088 Bacteria 9304
396 Ga0207641_10506739 3300026088 Bacteria 1173
397 Ga0207641_10536965 3300026088 Bacteria 1139
398 Ga0207648_10033528 3300026089 Bacteria 4529
399 Ga0207676_10373619 3300026095 Bacteria 1325
400 Ga0207675_100000701 3300026118 Bacteria 33161
401 Ga0207675_100000834 3300026118 Bacteria 30656
402 Ga0207675_100276977 3300026118 Bacteria 1629
403 Ga0207683_10002401 3300026121 Bacteria 16354
404 Ga0207683_10005298 3300026121 Bacteria 11060
405 Ga0207683_10045141 3300026121 Bacteria 3853
406 Ga0207698_10304403 3300026142 Bacteria 1485
407 Ga0207428_10143286 3300027907 Bacteria 1822
408 Ga0207428_10265075 3300027907 Bacteria 1279
409 Ga0268266_10061902 3300028379 Bacteria 3228
410 Ga0268266_10754738 3300028379 Bacteria 939
411 Ga0268265_10000105 3300028380 Bacteria 105463
412 Ga0268265_10070377 3300028380 Bacteria 2720
413 Ga0268264_10000237 3300028381 Bacteria 105274
414 Ga0268264_10018348 3300028381 Bacteria 5721
415 Ga0265319_1000005 3300028563 Bacteria 249025
416 Ga0265338_10287097 3300028800 Bacteria 1200
417 Ga0265330_10133386 3300031235 Bacteria 1057
418 Ga0265320_10011523 3300031240 Bacteria 5199
419 Ga0307405_11298838 3300031731 Bacteria 633
420 Ga0307410_10302789 3300031852 Bacteria 1262
421 Ga0307410_10574587 3300031852 Bacteria 937
422 Ga0307406_10207778 3300031901 Bacteria 1446
423 Ga0307406_10269240 3300031901 Bacteria 1293
424 Ga0307407_10285423 3300031903 Bacteria 1145
425 Ga0307409_100040233 3300031995 Bacteria 3478
426 Ga0307409_100323386 3300031995 Bacteria 1445
427 Ga0307409_100383410 3300031995 Bacteria 1337
428 Ga0307409_100497255 3300031995 Bacteria 1187
429 Ga0307409_100798126 3300031995 Bacteria 951
430 Ga0307409_101226481 3300031995 Bacteria 774
431 Ga0307416_100083690 3300032002 Bacteria 2708
432 Ga0307416_100405712 3300032002 Bacteria 1402
433 Ga0307416_100737181 3300032002 Bacteria 1077
434 Ga0307416_101961401 3300032002 Bacteria 688
435 Ga0307414_10242230 3300032004 Bacteria 1494
436 Ga0307411_10151754 3300032005 Bacteria 1723
437 Ga0307411_10390722 3300032005 Bacteria 1147
438 Ga0307415_100160281 3300032126 Bacteria 1743
439 Ga0307415_100298847 3300032126 Bacteria 1333
440 Ga0373932_0008993 3300035112 Bacteria 2395
441 Ga0373961_0221006 3300035241 Bacteria 675
442 Ga0373931_0018961 3300035691 Bacteria 3428
443 Ga0395900_0247364 3300037418 Bacteria 1786
444 Ga0395898_0451223 3300037466 Bacteria 1225
445 Ga0395905_0681913 3300037471 Unclassified 930
446 Ga0395901_0330205 3300038443 Bacteria 1577
447 Ga0395901_0406786 3300038443 Bacteria 1398
448 Ga0436361_1114931 3300039447 Bacteria 1929
449 Ga0439461_0000881 3300041410 Bacteria 4453
450 Ga0439461_0047958 3300041410 Bacteria 940
451 Ga0439461_0061462 3300041410 Bacteria 854
452 Ga0439466_0002859 3300041411 Bacteria 6753
453 Ga0439466_0074359 3300041411 Bacteria 1078
454 Ga0439466_0142601 3300041411 Bacteria 735
455 Ga0439465_0000074 3300041413 Bacteria 21675
456 Ga0439465_0003465 3300041413 Bacteria 5144
457 Ga0439465_0010780 3300041413 Bacteria 2867
458 Ga0439465_0012061 3300041413 Bacteria 2707
459 Ga0451789_1281002 3300041443 Bacteria 938
460 Ga0451793_1189180 3300041452 Bacteria 1539
461 Ga0451795_1670815 3300041456 Bacteria 2285
462 Ga0451802_1056342 3300041460 Bacteria 1504
463 Ga0439431_0005313 3300041997 Bacteria 2842
464 Ga0439431_0145957 3300041997 Bacteria 670
465 Ga0439442_021882 3300042002 Bacteria 1326
466 Ga0439445_0086116 3300042004 Bacteria 882
467 Ga0439459_0118249 3300042438 Bacteria 665
468 Ga0439459_0127327 3300042438 Bacteria 648
469 Ga0466969_0180186 3300044656 Bacteria 967
470 Ga0466972_0016461 3300044658 Bacteria 3699
471 Ga0466972_0068734 3300044658 Bacteria 1692
472 Ga0466972_0128564 3300044658 Bacteria 1193
473 Ga0466966_0372774 3300044684 Bacteria 858
474 Ga0466964_0353449 3300044706 Bacteria 756
475 Ga0466964_0432715 3300044706 Bacteria 694
476 Ga0466970_0199723 3300044765 Bacteria 1112
477 Ga0466957_0049766 3300044842 Bacteria 2548
478 Ga0466957_0108328 3300044842 Bacteria 1759
479 Ga0466960_0000761 3300044901 Bacteria 11330
480 Ga0466960_0035811 3300044901 Bacteria 2321
481 Ga0466960_0333942 3300044901 Unclassified 861
482 Ga0466960_0349590 3300044901 Bacteria 843
483 Ga0466959_0146105 3300045049 Bacteria 1668
484 Ga0466959_0452253 3300045049 Bacteria 870
485 Ga0466958_0005722 3300045836 Bacteria 6714
486 Ga0466967_0442758 3300045976 Unclassified 1269
487 Ga0466967_0521402 3300045976 Bacteria 1168
488 Ga0466967_0728371 3300045976 Bacteria 983
489 Ga0466967_1018022 3300045976 Bacteria 825
490 Ga0495638_0004264 3300046460 Bacteria 10875
491 Ga0495584_0149841 3300046491 Bacteria 1185
492 Ga0495644_0285006 3300046523 Bacteria 645
493 Ga0495648_0032953 3300046524 Bacteria 3391
494 Ga0495625_0089206 3300046660 Bacteria 2135
495 Ga0495635_0276102 3300046663 Bacteria 1129
496 Ga0495671_0305686 3300046692 Bacteria 765
497 Ga0495649_0390553 3300046694 Bacteria 699
498 Ga0495672_0241223 3300047320 Bacteria 882
499 Ga0495686_0004460 3300047472 Bacteria 11522
500 Ga0495686_0083876 3300047472 Bacteria 1943
501 Ga0496100_0006859 3300048903 Bacteria 6239
502 Ga0496100_0009905 3300048903 Bacteria 5373
503 Ga0496100_0010785 3300048903 Bacteria 5184
504 Ga0496100_0085705 3300048903 Bacteria 2138
505 Ga0496100_0168202 3300048903 Bacteria 1576
506 Ga0496100_0198076 3300048903 Unclassified 1462
507 Ga0496101_0000126 3300048904 Bacteria 74316
508 Ga0496101_0001097 3300048904 Bacteria 16080
509 Ga0496101_0004633 3300048904 Bacteria 8694
510 Ga0496101_0035495 3300048904 Bacteria 3526
511 Ga0496101_0108718 3300048904 Bacteria 2085
512 Ga0496101_0109252 3300048904 Bacteria 2080
513 Ga0496101_0119992 3300048904 Bacteria 1987
514 Ga0496101_0441933 3300048904 Bacteria 1026
515 Ga0496102_0000006 3300048905 Bacteria 471494
516 Ga0496102_0000985 3300048905 Bacteria 26750
517 Ga0496102_0010400 3300048905 Bacteria 8008
518 Ga0496102_0060754 3300048905 Bacteria 3457
519 Ga0496102_0102696 3300048905 Bacteria 2658
520 Ga0496102_0129219 3300048905 Bacteria 2363
521 Ga0496102_0170814 3300048905 Bacteria 2047
522 Ga0496102_0175238 3300048905 Bacteria 2019
523 Ga0496102_0287011 3300048905 Bacteria 1551
524 Ga0496102_0487509 3300048905 Bacteria 1154
525 Ga0496102_0999098 3300048905 Bacteria 757
526 Ga0496102_1152718 3300048905 Bacteria 695
527 Ga0496103_0000006 3300048906 Bacteria 470539
528 Ga0496103_0000356 3300048906 Bacteria 41484
529 Ga0496103_0004805 3300048906 Bacteria 8167
530 Ga0496104_0003054 3300048907 Bacteria 14429
531 Ga0496104_0050164 3300048907 Bacteria 3938
532 Ga0496104_0074043 3300048907 Bacteria 3241
533 Ga0496105_0042538 3300048908 Bacteria 3745
534 Ga0496105_0110323 3300048908 Bacteria 2271
535 Ga0496105_0216709 3300048908 Bacteria 1559
536 Ga0496106_0002555 3300048909 Bacteria 13530
537 Ga0496106_0006632 3300048909 Bacteria 8571
538 Ga0496106_0086490 3300048909 Bacteria 2414
539 Ga0496106_0443798 3300048909 Bacteria 1043
540 Ga0496107_0008645 3300048910 Bacteria 7053
541 Ga0496107_0014104 3300048910 Bacteria 5594
542 Ga0496107_0021207 3300048910 Bacteria 4592
543 Ga0496107_0077817 3300048910 Bacteria 2416
544 Ga0496107_0243696 3300048910 Bacteria 1337
545 Ga0496107_0361635 3300048910 Unclassified 1080
546 Ga0496108_0008982 3300048911 Bacteria 8100
547 Ga0496108_0063414 3300048911 Bacteria 3112
548 Ga0496108_0223217 3300048911 Bacteria 1637
549 Ga0496108_0264486 3300048911 Bacteria 1497
550 Ga0496108_0420405 3300048911 Bacteria 1167
551 Ga0496108_0528460 3300048911 Bacteria 1030
552 Ga0496108_0705377 3300048911 Bacteria 875
553 Ga0496109_0000990 3300048912 Bacteria 23432
554 Ga0496109_0513291 3300048912 Bacteria 1131
555 Ga0496109_0721542 3300048912 Bacteria 934
556 Ga0496110_0042461 3300048913 Bacteria 3969
557 Ga0496110_0200075 3300048913 Bacteria 1815
558 Ga0496110_0346671 3300048913 Bacteria 1353
559 Ga0496111_0454805 3300048914 Bacteria 944
560 Ga0496112_0012991 3300048915 Bacteria 7677
561 Ga0496112_0035783 3300048915 Bacteria 4839
562 Ga0496112_0227724 3300048915 Bacteria 1819
563 Ga0496112_0336228 3300048915 Bacteria 1454
564 Ga0496112_0482604 3300048915 Unclassified 1176
565 Ga0496112_0601322 3300048915 Bacteria 1032
566 Ga0496112_1396336 3300048915 Bacteria 615
567 Ga0496113_0013559 3300048916 Bacteria 5528
568 Ga0496113_0287142 3300048916 Bacteria 1316
569 Ga0496114_0003652 3300048917 Bacteria 11834
570 Ga0496114_0013084 3300048917 Bacteria 6647
571 Ga0496114_0816988 3300048917 Bacteria 811
572 Ga0496114_1106185 3300048917 Bacteria 677
573 Ga0496115_0013721 3300048918 Bacteria 6135
574 Ga0496115_0027744 3300048918 Bacteria 4432
575 Ga0496115_0136768 3300048918 Bacteria 2020
576 Ga0496115_0834122 3300048918 Bacteria 715
577 Ga0496116_0000025 3300048919 Bacteria 470539
578 Ga0496116_0015243 3300048919 Bacteria 6084
579 Ga0496117_0000006 3300048920 Bacteria 758420
580 Ga0496117_0006504 3300048920 Bacteria 11785
581 Ga0496117_0301678 3300048920 Bacteria 848
582 Ga0496118_0000004 3300048921 Bacteria 758420
583 Ga0496118_0009842 3300048921 Bacteria 9568
584 Ga0496118_0351433 3300048921 Bacteria 785
585 Ga0496119_0000041 3300048922 Bacteria 203687
586 Ga0496119_0006040 3300048922 Bacteria 11360
587 Ga0496120_0000027 3300048923 Bacteria 231507
588 Ga0496121_0001735 3300048924 Bacteria 35599
589 Ga0496121_0015445 3300048924 Bacteria 8001
590 Ga0496122_0027173 3300048925 Bacteria 4901
591 Ga0496123_0052150 3300048926 Bacteria 2717
592 Ga0496124_0058977 3300048927 Bacteria 3225
593 Ga0496125_0012549 3300048928 Bacteria 8402
594 Ga0496126_0001191 3300048929 Bacteria 42415
595 Ga0496126_0011848 3300048929 Bacteria 8971
596 Ga0496126_0053729 3300048929 Bacteria 3652
597 Ga0501306_018684 3300049127 Bacteria 950
598 Ga0501306_021866 3300049127 Bacteria 898
599 Ga0501306_039120 3300049127 Bacteria 730
600 Ga0501306_048803 3300049127 Bacteria 674
601 Ga0501308_008905 3300049128 Bacteria 1085
602 Ga0501308_029067 3300049128 Bacteria 733
603 Ga0501308_043901 3300049128 Bacteria 637
604 Ga0501309_030873 3300049129 Bacteria 790
605 Ga0501309_036316 3300049129 Bacteria 741
606 Ga0501309_044840 3300049129 Bacteria 683
607 Ga0501310_030357 3300049130 Bacteria 715
608 Ga0501304_013780 3300049160 Bacteria 743
609 Ga0501304_029111 3300049160 Unclassified 580
610 Ga0501305_040270 3300049161 Bacteria 758
611 Ga0501305_041038 3300049161 Bacteria 753
612 Ga0501305_046680 3300049161 Bacteria 718
613 Ga0501305_058429 3300049161 Bacteria 660
614 Ga0501307_011312 3300049162 Bacteria 1047
615 Ga0501307_020896 3300049162 Bacteria 851
616 Ga0501307_025960 3300049162 Bacteria 789
617 Ga0501307_036957 3300049162 Bacteria 698
618 Ga0501311_050754 3300049527 Bacteria 650
619 Ga0501311_051704 3300049527 Unclassified 645
620 Ga0501311_051961 3300049527 Bacteria 644
621 Ga0501312_020106 3300049528 Bacteria 986
622 Ga0501312_025969 3300049528 Bacteria 895
623 Ga0501312_079042 3300049528 Unclassified 593
624 Ga0501313_015634 3300049529 Bacteria 906
625 Ga0501313_037972 3300049529 Bacteria 641
626 Ga0501314_005481 3300049530 Bacteria 1082
627 Ga0501314_016123 3300049530 Bacteria 743
628 Ga0501315_013314 3300049531 Bacteria 1029
629 Ga0501315_054358 3300049531 Bacteria 635
630 Ga0501316_028380 3300049532 Bacteria 739
631 Ga0501316_032069 3300049532 Bacteria 707
632 Ga0501317_015333 3300049533 Bacteria 982
633 Ga0501318_017268 3300049534 Bacteria 880
634 Ga0501318_023858 3300049534 Bacteria 792
635 Ga0501319_015700 3300049535 Bacteria 645
636 Ga0501319_018636 3300049535 Bacteria 609
637 Ga0501320_015637 3300049536 Bacteria 831
638 Ga0501320_016686 3300049536 Bacteria 814
639 Ga0501320_018805 3300049536 Bacteria 783
640 Ga0501320_043626 3300049536 Bacteria 594
641 Ga0501321_007004 3300049537 Bacteria 1161
642 Ga0501321_021359 3300049537 Bacteria 807
643 Ga0501321_027165 3300049537 Bacteria 746
644 Ga0501321_027753 3300049537 Bacteria 741
645 Ga0501322_014919 3300049538 Bacteria 638
646 Ga0501323_048159 3300049539 Bacteria 641
647 Ga0501325_024754 3300049541 Unclassified 655
648 Ga0501337_011751 3300049553 Bacteria 650
649 Ga0501031_0329590 3300049568 Bacteria 988
650 Ga0501033_0647306 3300049570 Bacteria 722
651 Ga0501034_0229493 3300049571 Bacteria 1806
652 Ga0501038_0793102 3300049574 Bacteria 704
653 Ga0501039_0224693 3300049575 Bacteria 1476
654 Ga0501041_0123615 3300049577 Bacteria 1609
655 Ga0501046_0177315 3300049580 Bacteria 1595
656 Ga0501048_0328028 3300049582 Bacteria 1090
657 Ga0501071_0062745 3300049587 Bacteria 2693
658 Ga0501072_0035214 3300049588 Bacteria 3924
659 Ga0501074_0238225 3300049590 Bacteria 1295
660 Ga0501075_0035821 3300049591 Bacteria 3702
661 Ga0501076_0024151 3300049592 Bacteria 4695
662 Ga0501077_0313060 3300049593 Bacteria 1001
663 Ga0501081_0147102 3300049743 Bacteria 1691
664 nmdc:mga03683_229265_c1 3300050489 Bacteria 858
665 nmdc:mga03683_279118_c1 3300050489 Bacteria 780
666 nmdc:mga03n38_4088_c1 3300050490 Bacteria 4785
667 nmdc:mga03n38_496_c1 3300050490 Bacteria 9900
668 nmdc:mga03n38_5038_c1 3300050490 Bacteria 4454
669 nmdc:mga03n38_6690_c1 3300050490 Bacteria 4026
670 nmdc:mga00v17_23627_c1 3300050491 Bacteria 3557
671 nmdc:mga00v17_303294_c1 3300050491 Bacteria 1037
672 nmdc:mga00v17_467228_c1 3300050491 Bacteria 819
673 nmdc:mga00v17_657_c1 3300050491 Bacteria 19065
674 nmdc:mga00v17_69638_c1 3300050491 Bacteria 2178
675 nmdc:mga00v17_79796_c1 3300050491 Bacteria 2041
676 nmdc:mga00v17_8556_c1 3300050491 Bacteria 5508
677 nmdc:mga00v17_93718_c1 3300050491 Bacteria 1889
678 nmdc:mga0yw44_101229_c1 3300050492 Bacteria 1835
679 nmdc:mga0yw44_151545_c1 3300050492 Bacteria 1513
680 nmdc:mga0yw44_42478_c1 3300050492 Bacteria 2711
681 nmdc:mga0yw44_427385_c1 3300050492 Bacteria 897
682 nmdc:mga0yw44_43067_c1 3300050492 Bacteria 2694
683 nmdc:mga0yw44_453204_c1 3300050492 Bacteria 869
684 nmdc:mga0yw44_61426_c1 3300050492 Bacteria 2305
685 nmdc:mga0yw44_92088_c1 3300050492 Bacteria 1918
686 nmdc:mga0k408_212451_c1 3300050493 Bacteria 1155
687 nmdc:mga06z11_2967_c1 3300050494 Bacteria 6535
688 nmdc:mga06z11_35162_c1 3300050494 Bacteria 2464
689 nmdc:mga07m45_151238_c1 3300050496 Bacteria 1346
690 nmdc:mga07m45_22945_c1 3300050496 Bacteria 3409
691 nmdc:mga07m45_46189_c1 3300050496 Bacteria 2446
692 nmdc:mga05p37_114951_c1 3300050507 Bacteria 3308
693 nmdc:mga05p37_57571_c1 3300050507 Bacteria 4787
694 nmdc:mga0qj67_9159_c1 3300050509 Bacteria 7351
695 nmdc:mga06r32_35137_c1 3300050510 Bacteria 4729
696 nmdc:mga08y16_1438007_c1 3300050511 Bacteria 652
697 nmdc:mga08y16_267708_c1 3300050511 Bacteria 1764
698 nmdc:mga0sz30_10357_c1 3300050516 Bacteria 3573
699 nmdc:mga0sz30_160593_c1 3300050516 Bacteria 996
700 nmdc:mga0sz30_179944_c1 3300050516 Bacteria 938
701 nmdc:mga0sz30_299653_c1 3300050516 Bacteria 717
702 nmdc:mga0sz30_51860_c1 3300050516 Bacteria 1741
703 nmdc:mga0sz30_947_c2 3300050516 Bacteria 1690
704 nmdc:mga0sz30_967_c1 3300050516 Bacteria 10309
705 Ga0500610_0019519 3300053079 Bacteria 3296
706 Ga0500643_000926 3300053087 Bacteria 18414
707 Ga0500556_0000384 3300053104 Bacteria 32324
708 Ga0500556_0094967 3300053104 Bacteria 1142
709 Ga0500562_018730 3300053108 Bacteria 1788
710 Ga0500562_027255 3300053108 Bacteria 1499
711 Ga0500616_0003891 3300053153 Bacteria 10981
712 Ga0500616_0009538 3300053153 Bacteria 5899
713 Ga0500616_0214514 3300053153 Bacteria 843
714 Ga0500599_004219 3300053736 Bacteria 1776
715 Ga0590071_016445 3300059421 Bacteria 1735
716 Ga0590075_001865 3300059424 Bacteria 5123
717 Ga0590075_046096 3300059424 Bacteria 1117
718 Ga0590077_042196 3300059426 Bacteria 1015
719 Ga0466962_0062793 3300061719 Bacteria 1774
720 Ga0530510_0037928 3300061734 Bacteria 3477

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046491 Ga0495584_0149841 Ga0495584_0149841_89_631 154
2 3300014969 Ga0157376_10177790 Ga0157376_101777904 157
3 3300025937 Ga0207669_10218277 Ga0207669_102182772 158
4 3300049532 Ga0501316_032069 Ga0501316_032069_178_681 166
5 3300005329 Ga0070683_100882524 Ga0070683_1008825241 173
6 3300005367 Ga0070667_101134747 Ga0070667_1011347471 173
7 3300009098 Ga0105245_11007420 Ga0105245_110074201 173
8 3300025944 Ga0207661_10287463 Ga0207661_102874632 173
9 3300048905 Ga0496102_1152718 Ga0496102_1152718_108_650 173
10 3300048910 Ga0496107_0243696 Ga0496107_0243696_608_1150 173
11 3300048913 Ga0496110_0346671 Ga0496110_0346671_138_680 173
12 3300045976 Ga0466967_0442758 Ga0466967_0442758_253_801 174
13 3300049128 Ga0501308_029067 Ga0501308_029067_190_720 174
14 3300049129 Ga0501309_036316 Ga0501309_036316_186_716 174
15 3300049130 Ga0501310_030357 Ga0501310_030357_27_557 174
16 3300049528 Ga0501312_079042 Ga0501312_079042_27_557 174
17 3300049533 Ga0501317_015333 Ga0501317_015333_27_557 174
18 3300049534 Ga0501318_023858 Ga0501318_023858_18_548 174
19 3300049536 Ga0501320_016686 Ga0501320_016686_27_557 174
20 3300049537 Ga0501321_021359 Ga0501321_021359_258_788 174
21 3300053104 Ga0500556_0000384 Ga0500556_0000384_15077_15607 174
22 3300053153 Ga0500616_0003891 Ga0500616_0003891_7191_7721 174
23 3300053736 Ga0500599_004219 Ga0500599_004219_790_1320 174
24 3300005335 Ga0070666_10353360 Ga0070666_103533602 175
25 3300031995 Ga0307409_100497255 Ga0307409_1004972552 175
26 3300041410 Ga0439461_0000881 Ga0439461_0000881_3263_3796 175
27 3300049127 Ga0501306_021866 Ga0501306_021866_340_873 175
28 3300049127 Ga0501306_048803 Ga0501306_048803_116_649 175
29 3300049128 Ga0501308_008905 Ga0501308_008905_20_553 175
30 3300049129 Ga0501309_030873 Ga0501309_030873_21_554 175
31 3300049160 Ga0501304_029111 Ga0501304_029111_21_554 175
32 3300049161 Ga0501305_040270 Ga0501305_040270_203_736 175
33 3300049162 Ga0501307_011312 Ga0501307_011312_21_554 175
34 3300049162 Ga0501307_020896 Ga0501307_020896_292_825 175
35 3300049162 Ga0501307_025960 Ga0501307_025960_20_553 175
36 3300049527 Ga0501311_050754 Ga0501311_050754_95_628 175
37 3300049527 Ga0501311_051704 Ga0501311_051704_89_622 175
38 3300049528 Ga0501312_020106 Ga0501312_020106_436_969 175
39 3300049529 Ga0501313_015634 Ga0501313_015634_21_554 175
40 3300049530 Ga0501314_005481 Ga0501314_005481_523_1056 175
41 3300049531 Ga0501315_013314 Ga0501315_013314_24_557 175
42 3300049534 Ga0501318_017268 Ga0501318_017268_21_554 175
43 3300049536 Ga0501320_018805 Ga0501320_018805_237_770 175
44 3300049537 Ga0501321_007004 Ga0501321_007004_21_554 175
45 3300049541 Ga0501325_024754 Ga0501325_024754_20_553 175
46 3300059421 Ga0590071_016445 Ga0590071_016445_141_677 175
47 3300059424 Ga0590075_046096 Ga0590075_046096_565_1098 175
48 3300009177 Ga0105248_11975435 Ga0105248_119754351 176
49 3300025927 Ga0207687_11341062 Ga0207687_113410621 176
50 3300031995 Ga0307409_100323386 Ga0307409_1003233862 176
51 3300032002 Ga0307416_100405712 Ga0307416_1004057122 176
52 3300048903 Ga0496100_0198076 Ga0496100_0198076_857_1405 176
53 3300048904 Ga0496101_0108718 Ga0496101_0108718_385_933 176
54 3300048911 Ga0496108_0223217 Ga0496108_0223217_703_1251 176
55 3300048912 Ga0496109_0721542 Ga0496109_0721542_325_873 176
56 3300048914 Ga0496111_0454805 Ga0496111_0454805_329_877 176
57 3300048915 Ga0496112_0482604 Ga0496112_0482604_22_570 176
58 3300048916 Ga0496113_0287142 Ga0496113_0287142_167_715 176
59 3300049127 Ga0501306_039120 Ga0501306_039120_111_659 176
60 3300049129 Ga0501309_044840 Ga0501309_044840_69_617 176
61 3300059424 Ga0590075_001865 Ga0590075_001865_77_613 176
62 3300059426 Ga0590077_042196 Ga0590077_042196_67_606 176
63 iso_pu_bacteria 2929212328 2929217124 177
64 iso_pu_bacteria 2643221687 2644490982 178
65 iso_pu_bacteria 2643221715 2644634392 178
66 iso_pu_bacteria 2842134933 2842140580 178
67 iso_pu_bacteria 2902792274 2902798989 178
68 iso_pu_bacteria 2902810491 2902816877 178
69 iso_pu_bacteria 2902837492 2902843872 178
70 iso_pu_bacteria 2939582691 2939584343 178
71 3300005457 Ga0070662_100712708 Ga0070662_1007127082 179
72 3300005937 Ga0081455_10064617 Ga0081455_100646172 179
73 3300006353 Ga0075370_10094858 Ga0075370_100948583 179
74 3300009094 Ga0111539_11070195 Ga0111539_110701952 179
75 3300010159 Ga0099796_10006080 Ga0099796_100060803 179
76 3300013306 Ga0163162_10046855 Ga0163162_100468553 179
77 3300014325 Ga0163163_10278820 Ga0163163_102788202 179
78 3300020069 Ga0197907_10667919 Ga0197907_106679192 179
79 3300020076 Ga0206355_1005082 Ga0206355_10050821 179
80 3300026023 Ga0207677_10935949 Ga0207677_109359492 179
81 3300027907 Ga0207428_10143286 Ga0207428_101432862 179
82 3300037471 Ga0395905_0681913 Ga0395905_0681913_162_707 179
83 3300048905 Ga0496102_0999098 Ga0496102_0999098_86_631 179
84 3300050511 nmdc:mga08y16_267708_c1 nmdc:mga08y16_267708_c1_290_835 179
85 3300005347 Ga0070668_100693076 Ga0070668_1006930762 180
86 3300005356 Ga0070674_100339908 Ga0070674_1003399081 180
87 3300005548 Ga0070665_100496237 Ga0070665_1004962372 180
88 3300005549 Ga0070704_100852500 Ga0070704_1008525002 180
89 3300005578 Ga0068854_100516834 Ga0068854_1005168341 180
90 3300005618 Ga0068864_100128775 Ga0068864_1001287753 180
91 3300005719 Ga0068861_100769013 Ga0068861_1007690132 180
92 3300006175 Ga0070712_100264976 Ga0070712_1002649761 180
93 3300006881 Ga0068865_100561222 Ga0068865_1005612222 180
94 3300009148 Ga0105243_10307247 Ga0105243_103072472 180
95 3300009545 Ga0105237_10962051 Ga0105237_109620512 180
96 3300010375 Ga0105239_11041816 Ga0105239_110418162 180
97 3300025927 Ga0207687_10237674 Ga0207687_102376742 180
98 3300025935 Ga0207709_10191045 Ga0207709_101910452 180
99 3300025937 Ga0207669_10862606 Ga0207669_108626061 180
100 3300026088 Ga0207641_10536965 Ga0207641_105369651 180
101 3300028379 Ga0268266_10754738 Ga0268266_107547381 180
102 3300037418 Ga0395900_0247364 Ga0395900_0247364_982_1533 180
103 3300045976 Ga0466967_0728371 Ga0466967_0728371_145_696 180
104 3300046523 Ga0495644_0285006 Ga0495644_0285006_54_605 180
105 3300048905 Ga0496102_0102696 Ga0496102_0102696_939_1487 180
106 3300048910 Ga0496107_0361635 Ga0496107_0361635_217_765 180
107 3300048911 Ga0496108_0063414 Ga0496108_0063414_1422_1967 180
108 3300048918 Ga0496115_0834122 Ga0496115_0834122_55_603 180
109 3300003693 Ga0032354_1033891 Ga0032354_10338911 181
110 3300004799 Ga0058863_10032663 Ga0058863_100326631 181
111 3300005331 Ga0070670_100568953 Ga0070670_1005689532 181
112 3300005347 Ga0070668_100043322 Ga0070668_1000433222 181
113 3300005355 Ga0070671_100009944 Ga0070671_1000099444 181
114 3300005366 Ga0070659_100604300 Ga0070659_1006043002 181
115 3300005444 Ga0070694_100055365 Ga0070694_1000553652 181
116 3300005457 Ga0070662_100053295 Ga0070662_1000532952 181
117 3300005544 Ga0070686_100586134 Ga0070686_1005861342 181
118 3300005546 Ga0070696_100034631 Ga0070696_1000346313 181
119 3300005578 Ga0068854_100366206 Ga0068854_1003662062 181
120 3300005617 Ga0068859_100898920 Ga0068859_1008989202 181
121 3300005618 Ga0068864_100187107 Ga0068864_1001871071 181
122 3300005719 Ga0068861_100001402 Ga0068861_10000140214 181
123 3300005841 Ga0068863_100017800 Ga0068863_1000178004 181
124 3300005844 Ga0068862_100422900 Ga0068862_1004229002 181
125 3300005981 Ga0081538_10014611 Ga0081538_100146114 181
126 3300006038 Ga0075365_10038915 Ga0075365_100389152 181
127 3300006038 Ga0075365_10603080 Ga0075365_106030802 181
128 3300006051 Ga0075364_10001395 Ga0075364_1000139513 181
129 3300006051 Ga0075364_10040928 Ga0075364_100409282 181
130 3300006051 Ga0075364_10223573 Ga0075364_102235732 181
131 3300006177 Ga0075362_10190588 Ga0075362_101905882 181
132 3300006177 Ga0075362_10291022 Ga0075362_102910221 181
133 3300006178 Ga0075367_10268471 Ga0075367_102684712 181
134 3300006844 Ga0075428_100261383 Ga0075428_1002613832 181
135 3300006844 Ga0075428_100511916 Ga0075428_1005119162 181
136 3300006844 Ga0075428_101001046 Ga0075428_1010010462 181
137 3300006852 Ga0075433_10588802 Ga0075433_105888022 181
138 3300006931 Ga0097620_100898954 Ga0097620_1008989542 181
139 3300009094 Ga0111539_11032732 Ga0111539_110327322 181
140 3300009098 Ga0105245_10013928 Ga0105245_100139286 181
141 3300009101 Ga0105247_10192652 Ga0105247_101926522 181
142 3300009176 Ga0105242_11111525 Ga0105242_111115251 181
143 3300009553 Ga0105249_10008623 Ga0105249_100086237 181
144 3300010375 Ga0105239_10092653 Ga0105239_100926533 181
145 3300013297 Ga0157378_10208473 Ga0157378_102084732 181
146 3300013306 Ga0163162_10094586 Ga0163162_100945863 181
147 3300013307 Ga0157372_10345414 Ga0157372_103454142 181
148 3300014325 Ga0163163_10032410 Ga0163163_100324104 181
149 3300025901 Ga0207688_10241667 Ga0207688_102416671 181
150 3300025925 Ga0207650_10716240 Ga0207650_107162402 181
151 3300025931 Ga0207644_10276354 Ga0207644_102763542 181
152 3300025932 Ga0207690_10726140 Ga0207690_107261401 181
153 3300025933 Ga0207706_10000901 Ga0207706_100009012 181
154 3300025961 Ga0207712_10908024 Ga0207712_109080241 181
155 3300025981 Ga0207640_10089478 Ga0207640_100894782 181
156 3300026075 Ga0207708_10340004 Ga0207708_103400042 181
157 3300026088 Ga0207641_10007166 Ga0207641_1000716610 181
158 3300026118 Ga0207675_100000701 Ga0207675_1000007011 181
159 3300027907 Ga0207428_10265075 Ga0207428_102650752 181
160 3300028563 Ga0265319_1000005 Ga0265319_1000005118 181
161 3300028800 Ga0265338_10287097 Ga0265338_102870971 181
162 3300031235 Ga0265330_10133386 Ga0265330_101333861 181
163 3300031240 Ga0265320_10011523 Ga0265320_100115232 181
164 3300031852 Ga0307410_10302789 Ga0307410_103027892 181
165 3300031901 Ga0307406_10207778 Ga0307406_102077781 181
166 3300031995 Ga0307409_100798126 Ga0307409_1007981262 181
167 3300032002 Ga0307416_100083690 Ga0307416_1000836902 181
168 3300032002 Ga0307416_100737181 Ga0307416_1007371812 181
169 3300032004 Ga0307414_10242230 Ga0307414_102422301 181
170 3300037466 Ga0395898_0451223 Ga0395898_0451223_635_1192 181
171 3300038443 Ga0395901_0330205 Ga0395901_0330205_799_1356 181
172 3300038443 Ga0395901_0406786 Ga0395901_0406786_189_746 181
173 3300044901 Ga0466960_0333942 Ga0466960_0333942_170_730 181
174 3300048903 Ga0496100_0168202 Ga0496100_0168202_844_1404 181
175 3300048904 Ga0496101_0109252 Ga0496101_0109252_635_1195 181
176 3300048905 Ga0496102_0060754 Ga0496102_0060754_2195_2755 181
177 3300048905 Ga0496102_0175238 Ga0496102_0175238_1253_1810 181
178 3300048907 Ga0496104_0074043 Ga0496104_0074043_2388_2945 181
179 3300048908 Ga0496105_0110323 Ga0496105_0110323_1112_1669 181
180 3300048909 Ga0496106_0002555 Ga0496106_0002555_851_1411 181
181 3300048910 Ga0496107_0008645 Ga0496107_0008645_995_1555 181
182 3300048911 Ga0496108_0264486 Ga0496108_0264486_538_1095 181
183 3300048915 Ga0496112_0601322 Ga0496112_0601322_89_727 181
184 3300048917 Ga0496114_1106185 Ga0496114_1106185_81_641 181
185 3300048918 Ga0496115_0027744 Ga0496115_0027744_827_1387 181
186 3300049127 Ga0501306_018684 Ga0501306_018684_20_577 181
187 3300049128 Ga0501308_043901 Ga0501308_043901_20_577 181
188 3300049160 Ga0501304_013780 Ga0501304_013780_25_582 181
189 3300049161 Ga0501305_041038 Ga0501305_041038_25_582 181
190 3300049161 Ga0501305_046680 Ga0501305_046680_133_693 181
191 3300049161 Ga0501305_058429 Ga0501305_058429_59_616 181
192 3300049162 Ga0501307_036957 Ga0501307_036957_117_677 181
193 3300049527 Ga0501311_051961 Ga0501311_051961_26_583 181
194 3300049528 Ga0501312_025969 Ga0501312_025969_21_578 181
195 3300049529 Ga0501313_037972 Ga0501313_037972_25_582 181
196 3300049530 Ga0501314_016123 Ga0501314_016123_161_718 181
197 3300049531 Ga0501315_054358 Ga0501315_054358_16_573 181
198 3300049532 Ga0501316_028380 Ga0501316_028380_21_578 181
199 3300049535 Ga0501319_015700 Ga0501319_015700_28_585 181
200 3300049535 Ga0501319_018636 Ga0501319_018636_28_579 181
201 3300049536 Ga0501320_015637 Ga0501320_015637_21_578 181
202 3300049536 Ga0501320_043626 Ga0501320_043626_12_569 181
203 3300049537 Ga0501321_027165 Ga0501321_027165_161_718 181
204 3300049537 Ga0501321_027753 Ga0501321_027753_13_570 181
205 3300049538 Ga0501322_014919 Ga0501322_014919_22_579 181
206 3300049539 Ga0501323_048159 Ga0501323_048159_25_582 181
207 3300049568 Ga0501031_0329590 Ga0501031_0329590_303_860 181
208 3300049570 Ga0501033_0647306 Ga0501033_0647306_113_670 181
209 3300049574 Ga0501038_0793102 Ga0501038_0793102_90_647 181
210 3300049575 Ga0501039_0224693 Ga0501039_0224693_68_625 181
211 3300049577 Ga0501041_0123615 Ga0501041_0123615_112_669 181
212 3300049580 Ga0501046_0177315 Ga0501046_0177315_202_759 181
213 3300049582 Ga0501048_0328028 Ga0501048_0328028_131_688 181
214 3300049587 Ga0501071_0062745 Ga0501071_0062745_525_1082 181
215 3300049588 Ga0501072_0035214 Ga0501072_0035214_2216_2773 181
216 3300049590 Ga0501074_0238225 Ga0501074_0238225_632_1189 181
217 3300049591 Ga0501075_0035821 Ga0501075_0035821_54_611 181
218 3300049592 Ga0501076_0024151 Ga0501076_0024151_557_1114 181
219 3300049593 Ga0501077_0313060 Ga0501077_0313060_358_915 181
220 3300049743 Ga0501081_0147102 Ga0501081_0147102_126_683 181
221 3300050489 nmdc:mga03683_229265_c1 nmdc:mga03683_229265_c1_177_734 181
222 3300050490 nmdc:mga03n38_496_c1 nmdc:mga03n38_496_c1_186_737 181
223 3300050491 nmdc:mga00v17_79796_c1 nmdc:mga00v17_79796_c1_620_1177 181
224 3300050491 nmdc:mga00v17_93718_c1 nmdc:mga00v17_93718_c1_1328_1879 181
225 3300050492 nmdc:mga0yw44_42478_c1 nmdc:mga0yw44_42478_c1_862_1419 181
226 3300050492 nmdc:mga0yw44_92088_c1 nmdc:mga0yw44_92088_c1_186_737 181
227 3300050493 nmdc:mga0k408_212451_c1 nmdc:mga0k408_212451_c1_530_1081 181
228 3300050511 nmdc:mga08y16_1438007_c1 nmdc:mga08y16_1438007_c1_31_588 181
229 3300050516 nmdc:mga0sz30_10357_c1 nmdc:mga0sz30_10357_c1_1909_2487 181
230 3300050516 nmdc:mga0sz30_160593_c1 nmdc:mga0sz30_160593_c1_253_810 181
231 3300050516 nmdc:mga0sz30_947_c2 nmdc:mga0sz30_947_c2_1027_1584 181
232 3300061719 Ga0466962_0062793 Ga0466962_0062793_61_624 181
233 3300061734 Ga0530510_0037928 Ga0530510_0037928_1028_1585 181
234 3300000546 LJNas_1018574 LJNas_10185742 182
235 3300001990 JGI24737J22298_10021976 JGI24737J22298_100219762 182
236 3300001991 JGI24743J22301_10011739 JGI24743J22301_100117392 182
237 3300002067 JGI24735J21928_10121258 JGI24735J21928_101212581 182
238 3300002067 JGI24735J21928_10153785 JGI24735J21928_101537851 182
239 3300002070 JGI24750J21931_1012170 JGI24750J21931_10121702 182
240 3300002070 JGI24750J21931_1039533 JGI24750J21931_10395331 182
241 3300002073 JGI24745J21846_1018873 JGI24745J21846_10188732 182
242 3300002073 JGI24745J21846_1025744 JGI24745J21846_10257442 182
243 3300002076 JGI24749J21850_1004338 JGI24749J21850_10043381 182
244 3300002076 JGI24749J21850_1013474 JGI24749J21850_10134742 182
245 3300002077 JGI24744J21845_10005501 JGI24744J21845_100055013 182
246 3300002239 JGI24034J26672_10019414 JGI24034J26672_100194142 182
247 3300002239 JGI24034J26672_10027865 JGI24034J26672_100278652 182
248 3300002244 JGI24742J22300_10031322 JGI24742J22300_100313222 182
249 3300002244 JGI24742J22300_10036909 JGI24742J22300_100369091 182
250 3300003792 Ga0055540_1010143 Ga0055540_10101432 182
251 3300005328 Ga0070676_10102805 Ga0070676_101028053 182
252 3300005328 Ga0070676_10911926 Ga0070676_109119261 182
253 3300005330 Ga0070690_100004256 Ga0070690_1000042563 182
254 3300005334 Ga0068869_100013186 Ga0068869_1000131864 182
255 3300005335 Ga0070666_10087130 Ga0070666_100871302 182
256 3300005335 Ga0070666_10098790 Ga0070666_100987903 182
257 3300005337 Ga0070682_100037450 Ga0070682_1000374502 182
258 3300005337 Ga0070682_100090388 Ga0070682_1000903882 182
259 3300005338 Ga0068868_100074492 Ga0068868_1000744922 182
260 3300005338 Ga0068868_100243604 Ga0068868_1002436042 182
261 3300005339 Ga0070660_100232835 Ga0070660_1002328351 182
262 3300005340 Ga0070689_100057637 Ga0070689_1000576372 182
263 3300005341 Ga0070691_10032605 Ga0070691_100326052 182
264 3300005341 Ga0070691_10056829 Ga0070691_100568293 182
265 3300005345 Ga0070692_10107224 Ga0070692_101072242 182
266 3300005345 Ga0070692_10189241 Ga0070692_101892411 182
267 3300005347 Ga0070668_100030471 Ga0070668_1000304713 182
268 3300005347 Ga0070668_100110895 Ga0070668_1001108953 182
269 3300005347 Ga0070668_100228698 Ga0070668_1002286981 182
270 3300005353 Ga0070669_100021617 Ga0070669_1000216173 182
271 3300005353 Ga0070669_100519257 Ga0070669_1005192571 182
272 3300005354 Ga0070675_100583799 Ga0070675_1005837992 182
273 3300005355 Ga0070671_100410624 Ga0070671_1004106241 182
274 3300005356 Ga0070674_100003857 Ga0070674_1000038577 182
275 3300005356 Ga0070674_100150845 Ga0070674_1001508453 182
276 3300005356 Ga0070674_100393497 Ga0070674_1003934971 182
277 3300005364 Ga0070673_100114987 Ga0070673_1001149873 182
278 3300005364 Ga0070673_100201963 Ga0070673_1002019633 182
279 3300005365 Ga0070688_100026148 Ga0070688_1000261483 182
280 3300005366 Ga0070659_100064462 Ga0070659_1000644622 182
281 3300005367 Ga0070667_100000109 Ga0070667_10000010981 182
282 3300005367 Ga0070667_100031290 Ga0070667_1000312904 182
283 3300005367 Ga0070667_100177096 Ga0070667_1001770963 182
284 3300005434 Ga0070709_10046663 Ga0070709_100466632 182
285 3300005434 Ga0070709_10087622 Ga0070709_100876222 182
286 3300005437 Ga0070710_10017236 Ga0070710_100172362 182
287 3300005437 Ga0070710_10027027 Ga0070710_100270272 182
288 3300005438 Ga0070701_10017488 Ga0070701_100174883 182
289 3300005438 Ga0070701_10185872 Ga0070701_101858722 182
290 3300005439 Ga0070711_100013970 Ga0070711_1000139703 182
291 3300005439 Ga0070711_100291994 Ga0070711_1002919941 182
292 3300005440 Ga0070705_100005850 Ga0070705_1000058503 182
293 3300005440 Ga0070705_100347135 Ga0070705_1003471351 182
294 3300005441 Ga0070700_100000774 Ga0070700_1000007747 182
295 3300005441 Ga0070700_100289983 Ga0070700_1002899831 182
296 3300005444 Ga0070694_100034274 Ga0070694_1000342742 182
297 3300005444 Ga0070694_100392479 Ga0070694_1003924791 182
298 3300005455 Ga0070663_100116656 Ga0070663_1001166561 182
299 3300005455 Ga0070663_100163966 Ga0070663_1001639663 182
300 3300005455 Ga0070663_100395176 Ga0070663_1003951762 182
301 3300005456 Ga0070678_100000467 Ga0070678_1000004673 182
302 3300005456 Ga0070678_100068302 Ga0070678_1000683022 182
303 3300005456 Ga0070678_100373688 Ga0070678_1003736882 182
304 3300005457 Ga0070662_100004295 Ga0070662_1000042955 182
305 3300005458 Ga0070681_10381510 Ga0070681_103815103 182
306 3300005459 Ga0068867_100010615 Ga0068867_1000106153 182
307 3300005466 Ga0070685_10036832 Ga0070685_100368322 182
308 3300005466 Ga0070685_10065814 Ga0070685_100658142 182
309 3300005466 Ga0070685_10142469 Ga0070685_101424692 182
310 3300005539 Ga0068853_100010343 Ga0068853_1000103432 182
311 3300005539 Ga0068853_100205543 Ga0068853_1002055433 182
312 3300005543 Ga0070672_100212603 Ga0070672_1002126032 182
313 3300005545 Ga0070695_100019332 Ga0070695_1000193323 182
314 3300005545 Ga0070695_100206322 Ga0070695_1002063222 182
315 3300005546 Ga0070696_100019409 Ga0070696_1000194093 182
316 3300005546 Ga0070696_100162450 Ga0070696_1001624502 182
317 3300005547 Ga0070693_100023123 Ga0070693_1000231233 182
318 3300005547 Ga0070693_100068429 Ga0070693_1000684294 182
319 3300005548 Ga0070665_100029440 Ga0070665_1000294406 182
320 3300005548 Ga0070665_100088385 Ga0070665_1000883855 182
321 3300005549 Ga0070704_100000602 Ga0070704_1000006023 182
322 3300005563 Ga0068855_100086873 Ga0068855_1000868733 182
323 3300005563 Ga0068855_100420681 Ga0068855_1004206812 182
324 3300005578 Ga0068854_100027736 Ga0068854_1000277361 182
325 3300005614 Ga0068856_100311049 Ga0068856_1003110492 182
326 3300005615 Ga0070702_100024239 Ga0070702_1000242392 182
327 3300005615 Ga0070702_100093144 Ga0070702_1000931443 182
328 3300005615 Ga0070702_101022321 Ga0070702_1010223211 182
329 3300005616 Ga0068852_100432707 Ga0068852_1004327072 182
330 3300005617 Ga0068859_100012076 Ga0068859_1000120768 182
331 3300005617 Ga0068859_100027373 Ga0068859_1000273735 182
332 3300005617 Ga0068859_101012472 Ga0068859_1010124722 182
333 3300005618 Ga0068864_100122050 Ga0068864_1001220504 182
334 3300005718 Ga0068866_10004586 Ga0068866_100045862 182
335 3300005718 Ga0068866_10029927 Ga0068866_100299272 182
336 3300005719 Ga0068861_100001939 Ga0068861_1000019398 182
337 3300005834 Ga0068851_10254997 Ga0068851_102549972 182
338 3300005841 Ga0068863_100000123 Ga0068863_10000012341 182
339 3300005841 Ga0068863_100300146 Ga0068863_1003001461 182
340 3300005841 Ga0068863_100302053 Ga0068863_1003020533 182
341 3300005842 Ga0068858_100016034 Ga0068858_1000160346 182
342 3300005842 Ga0068858_100018249 Ga0068858_1000182496 182
343 3300005842 Ga0068858_100045698 Ga0068858_1000456984 182
344 3300005842 Ga0068858_100341778 Ga0068858_1003417783 182
345 3300005843 Ga0068860_100000175 Ga0068860_10000017539 182
346 3300005843 Ga0068860_100392541 Ga0068860_1003925412 182
347 3300005844 Ga0068862_100000091 Ga0068862_10000009183 182
348 3300005844 Ga0068862_100029527 Ga0068862_1000295272 182
349 3300005844 Ga0068862_100263752 Ga0068862_1002637522 182
350 3300005937 Ga0081455_10054955 Ga0081455_100549553 182
351 3300005937 Ga0081455_10141119 Ga0081455_101411193 182
352 3300005981 Ga0081538_10265695 Ga0081538_102656951 182
353 3300006028 Ga0070717_11244780 Ga0070717_112447801 182
354 3300006038 Ga0075365_10020584 Ga0075365_100205843 182
355 3300006038 Ga0075365_10073547 Ga0075365_100735472 182
356 3300006038 Ga0075365_10108768 Ga0075365_101087683 182
357 3300006038 Ga0075365_10167765 Ga0075365_101677652 182
358 3300006048 Ga0075363_100002791 Ga0075363_1000027913 182
359 3300006048 Ga0075363_100016652 Ga0075363_1000166522 182
360 3300006048 Ga0075363_100201518 Ga0075363_1002015182 182
361 3300006048 Ga0075363_100206764 Ga0075363_1002067641 182
362 3300006048 Ga0075363_100215773 Ga0075363_1002157732 182
363 3300006051 Ga0075364_10000762 Ga0075364_1000076210 182
364 3300006051 Ga0075364_10003431 Ga0075364_100034314 182
365 3300006051 Ga0075364_10008380 Ga0075364_100083805 182
366 3300006051 Ga0075364_10015168 Ga0075364_100151682 182
367 3300006051 Ga0075364_10017487 Ga0075364_100174874 182
368 3300006051 Ga0075364_10130589 Ga0075364_101305893 182
369 3300006163 Ga0070715_10075789 Ga0070715_100757892 182
370 3300006173 Ga0070716_100002625 Ga0070716_1000026256 182
371 3300006173 Ga0070716_100054217 Ga0070716_1000542173 182
372 3300006173 Ga0070716_100229007 Ga0070716_1002290073 182
373 3300006175 Ga0070712_100001775 Ga0070712_1000017753 182
374 3300006178 Ga0075367_10001437 Ga0075367_100014376 182
375 3300006178 Ga0075367_10015293 Ga0075367_100152931 182
376 3300006186 Ga0075369_10000249 Ga0075369_100002499 182
377 3300006186 Ga0075369_10004145 Ga0075369_100041455 182
378 3300006186 Ga0075369_10012480 Ga0075369_100124802 182
379 3300006186 Ga0075369_10029780 Ga0075369_100297803 182
380 3300006186 Ga0075369_10057303 Ga0075369_100573032 182
381 3300006186 Ga0075369_10128795 Ga0075369_101287952 182
382 3300006186 Ga0075369_10203413 Ga0075369_102034132 182
383 3300006186 Ga0075369_10369966 Ga0075369_103699661 182
384 3300006237 Ga0097621_100067322 Ga0097621_1000673223 182
385 3300006237 Ga0097621_100116404 Ga0097621_1001164043 182
386 3300006353 Ga0075370_10000542 Ga0075370_1000054210 182
387 3300006353 Ga0075370_10002048 Ga0075370_100020487 182
388 3300006353 Ga0075370_10046882 Ga0075370_100468822 182
389 3300006353 Ga0075370_10233718 Ga0075370_102337181 182
390 3300006358 Ga0068871_100399658 Ga0068871_1003996581 182
391 3300006844 Ga0075428_100036327 Ga0075428_1000363273 182
392 3300006846 Ga0075430_100026355 Ga0075430_1000263554 182
393 3300006847 Ga0075431_100026836 Ga0075431_1000268367 182
394 3300006881 Ga0068865_100000967 Ga0068865_10000096712 182
395 3300006931 Ga0097620_100012076 Ga0097620_1000120768 182
396 3300006931 Ga0097620_100027373 Ga0097620_1000273735 182
397 3300006931 Ga0097620_101012500 Ga0097620_1010125002 182
398 3300009093 Ga0105240_11166682 Ga0105240_111666821 182
399 3300009098 Ga0105245_10036967 Ga0105245_100369671 182
400 3300009101 Ga0105247_10000070 Ga0105247_1000007038 182
401 3300009101 Ga0105247_10001004 Ga0105247_1000100419 182
402 3300009147 Ga0114129_10039851 Ga0114129_100398513 182
403 3300009147 Ga0114129_10114182 Ga0114129_101141822 182
404 3300009148 Ga0105243_10091839 Ga0105243_100918392 182
405 3300009148 Ga0105243_10257989 Ga0105243_102579892 182
406 3300009148 Ga0105243_10616415 Ga0105243_106164152 182
407 3300009174 Ga0105241_10342966 Ga0105241_103429661 182
408 3300009176 Ga0105242_10003084 Ga0105242_100030844 182
409 3300009176 Ga0105242_10138791 Ga0105242_101387913 182
410 3300009176 Ga0105242_10144002 Ga0105242_101440023 182
411 3300009177 Ga0105248_10000331 Ga0105248_1000033122 182
412 3300009177 Ga0105248_10018065 Ga0105248_100180657 182
413 3300009177 Ga0105248_10140868 Ga0105248_101408682 182
414 3300009177 Ga0105248_10151686 Ga0105248_101516863 182
415 3300009545 Ga0105237_10004474 Ga0105237_100044741 182
416 3300009545 Ga0105237_10421647 Ga0105237_104216472 182
417 3300009545 Ga0105237_10734976 Ga0105237_107349761 182
418 3300009551 Ga0105238_10849248 Ga0105238_108492481 182
419 3300009551 Ga0105238_10966261 Ga0105238_109662611 182
420 3300009553 Ga0105249_10000020 Ga0105249_10000020226 182
421 3300009553 Ga0105249_10002803 Ga0105249_1000280312 182
422 3300009553 Ga0105249_10004907 Ga0105249_100049073 182
423 3300010375 Ga0105239_10008898 Ga0105239_100088982 182
424 3300010375 Ga0105239_10009529 Ga0105239_100095291 182
425 3300010375 Ga0105239_10274913 Ga0105239_102749132 182
426 3300011119 Ga0105246_10006036 Ga0105246_100060363 182
427 3300011119 Ga0105246_10099422 Ga0105246_100994223 182
428 3300013102 Ga0157371_10386374 Ga0157371_103863741 182
429 3300013105 Ga0157369_10301792 Ga0157369_103017922 182
430 3300013296 Ga0157374_10016118 Ga0157374_100161182 182
431 3300013296 Ga0157374_10224822 Ga0157374_102248222 182
432 3300013297 Ga0157378_10186518 Ga0157378_101865183 182
433 3300013297 Ga0157378_10227120 Ga0157378_102271202 182
434 3300013306 Ga0163162_10084896 Ga0163162_100848964 182
435 3300013306 Ga0163162_10159827 Ga0163162_101598273 182
436 3300013306 Ga0163162_10195635 Ga0163162_101956353 182
437 3300013307 Ga0157372_10504153 Ga0157372_105041533 182
438 3300013308 Ga0157375_10002631 Ga0157375_100026313 182
439 3300014325 Ga0163163_10108336 Ga0163163_101083362 182
440 3300014326 Ga0157380_10013790 Ga0157380_100137903 182
441 3300014326 Ga0157380_10150109 Ga0157380_101501093 182
442 3300014745 Ga0157377_10081520 Ga0157377_100815202 182
443 3300014745 Ga0157377_10194505 Ga0157377_101945051 182
444 3300014968 Ga0157379_10011897 Ga0157379_100118973 182
445 3300014968 Ga0157379_10076438 Ga0157379_100764384 182
446 3300014968 Ga0157379_10144291 Ga0157379_101442912 182
447 3300014969 Ga0157376_10502151 Ga0157376_105021511 182
448 3300017792 Ga0163161_10000957 Ga0163161_1000095712 182
449 3300017792 Ga0163161_10845423 Ga0163161_108454231 182
450 3300025273 Ga0209673_1013692 Ga0209673_10136923 182
451 3300025303 Ga0209051_1000582 Ga0209051_100058228 182
452 3300025303 Ga0209051_1015812 Ga0209051_10158122 182
453 3300025303 Ga0209051_1036607 Ga0209051_10366073 182
454 3300025321 Ga0207656_10342499 Ga0207656_103424991 182
455 3300025893 Ga0207682_10117257 Ga0207682_101172571 182
456 3300025898 Ga0207692_10004952 Ga0207692_100049522 182
457 3300025898 Ga0207692_10021451 Ga0207692_100214513 182
458 3300025899 Ga0207642_10001479 Ga0207642_100014793 182
459 3300025899 Ga0207642_10018899 Ga0207642_100188993 182
460 3300025900 Ga0207710_10000010 Ga0207710_10000010356 182
461 3300025900 Ga0207710_10017264 Ga0207710_100172641 182
462 3300025900 Ga0207710_10061556 Ga0207710_100615563 182
463 3300025900 Ga0207710_10265589 Ga0207710_102655892 182
464 3300025901 Ga0207688_10015416 Ga0207688_100154162 182
465 3300025901 Ga0207688_10032873 Ga0207688_100328732 182
466 3300025903 Ga0207680_10195473 Ga0207680_101954732 182
467 3300025903 Ga0207680_10472538 Ga0207680_104725381 182
468 3300025904 Ga0207647_10014832 Ga0207647_100148323 182
469 3300025904 Ga0207647_10084790 Ga0207647_100847903 182
470 3300025905 Ga0207685_10018085 Ga0207685_100180851 182
471 3300025905 Ga0207685_10074473 Ga0207685_100744732 182
472 3300025906 Ga0207699_10037896 Ga0207699_100378961 182
473 3300025906 Ga0207699_10168344 Ga0207699_101683443 182
474 3300025911 Ga0207654_10185811 Ga0207654_101858112 182
475 3300025914 Ga0207671_10020596 Ga0207671_100205964 182
476 3300025914 Ga0207671_10334140 Ga0207671_103341402 182
477 3300025914 Ga0207671_10962015 Ga0207671_109620151 182
478 3300025915 Ga0207693_10000776 Ga0207693_1000077629 182
479 3300025915 Ga0207693_10003141 Ga0207693_1000314114 182
480 3300025916 Ga0207663_10005574 Ga0207663_100055744 182
481 3300025916 Ga0207663_10542544 Ga0207663_105425441 182
482 3300025917 Ga0207660_10749943 Ga0207660_107499431 182
483 3300025919 Ga0207657_10124940 Ga0207657_101249403 182
484 3300025923 Ga0207681_10008663 Ga0207681_100086634 182
485 3300025923 Ga0207681_10029215 Ga0207681_100292153 182
486 3300025923 Ga0207681_10474244 Ga0207681_104742442 182
487 3300025926 Ga0207659_10075210 Ga0207659_100752102 182
488 3300025927 Ga0207687_10007808 Ga0207687_100078084 182
489 3300025927 Ga0207687_10116220 Ga0207687_101162202 182
490 3300025929 Ga0207664_10352063 Ga0207664_103520633 182
491 3300025931 Ga0207644_10185055 Ga0207644_101850551 182
492 3300025931 Ga0207644_10346566 Ga0207644_103465662 182
493 3300025933 Ga0207706_10204498 Ga0207706_102044982 182
494 3300025933 Ga0207706_10518107 Ga0207706_105181071 182
495 3300025934 Ga0207686_10080764 Ga0207686_100807643 182
496 3300025934 Ga0207686_10196986 Ga0207686_101969862 182
497 3300025934 Ga0207686_10226285 Ga0207686_102262852 182
498 3300025935 Ga0207709_10051308 Ga0207709_100513083 182
499 3300025935 Ga0207709_10158067 Ga0207709_101580672 182
500 3300025935 Ga0207709_10423327 Ga0207709_104233272 182
501 3300025936 Ga0207670_10139009 Ga0207670_101390091 182
502 3300025937 Ga0207669_10004518 Ga0207669_100045183 182
503 3300025937 Ga0207669_10037198 Ga0207669_100371982 182
504 3300025937 Ga0207669_10213879 Ga0207669_102138793 182
505 3300025938 Ga0207704_10000988 Ga0207704_100009886 182
506 3300025939 Ga0207665_10006327 Ga0207665_100063273 182
507 3300025939 Ga0207665_10025264 Ga0207665_100252641 182
508 3300025939 Ga0207665_10286792 Ga0207665_102867922 182
509 3300025940 Ga0207691_10086182 Ga0207691_100861822 182
510 3300025941 Ga0207711_10000522 Ga0207711_1000052221 182
511 3300025941 Ga0207711_10060427 Ga0207711_100604273 182
512 3300025941 Ga0207711_10090999 Ga0207711_100909992 182
513 3300025941 Ga0207711_10524748 Ga0207711_105247483 182
514 3300025942 Ga0207689_10125362 Ga0207689_101253622 182
515 3300025960 Ga0207651_10291364 Ga0207651_102913641 182
516 3300025960 Ga0207651_10310304 Ga0207651_103103041 182
517 3300025961 Ga0207712_10000010 Ga0207712_1000001038 182
518 3300025961 Ga0207712_10022342 Ga0207712_100223421 182
519 3300025961 Ga0207712_10034930 Ga0207712_100349303 182
520 3300025961 Ga0207712_10062636 Ga0207712_100626363 182
521 3300025972 Ga0207668_10000836 Ga0207668_1000083612 182
522 3300025972 Ga0207668_10034168 Ga0207668_100341681 182
523 3300025972 Ga0207668_10830296 Ga0207668_108302961 182
524 3300025981 Ga0207640_10017430 Ga0207640_100174303 182
525 3300025981 Ga0207640_10395211 Ga0207640_103952112 182
526 3300025986 Ga0207658_10000257 Ga0207658_1000025722 182
527 3300025986 Ga0207658_10057414 Ga0207658_100574142 182
528 3300025986 Ga0207658_10081847 Ga0207658_100818473 182
529 3300025986 Ga0207658_10132775 Ga0207658_101327753 182
530 3300025986 Ga0207658_10994181 Ga0207658_109941812 182
531 3300026023 Ga0207677_10020520 Ga0207677_100205203 182
532 3300026023 Ga0207677_11211658 Ga0207677_112116582 182
533 3300026035 Ga0207703_10028860 Ga0207703_100288603 182
534 3300026035 Ga0207703_10100312 Ga0207703_101003121 182
535 3300026035 Ga0207703_10104576 Ga0207703_101045763 182
536 3300026035 Ga0207703_10327003 Ga0207703_103270032 182
537 3300026041 Ga0207639_10021438 Ga0207639_100214383 182
538 3300026041 Ga0207639_10021450 Ga0207639_100214504 182
539 3300026067 Ga0207678_10004074 Ga0207678_100040742 182
540 3300026067 Ga0207678_10020372 Ga0207678_100203723 182
541 3300026067 Ga0207678_10466722 Ga0207678_104667222 182
542 3300026075 Ga0207708_10008819 Ga0207708_100088193 182
543 3300026075 Ga0207708_10822474 Ga0207708_108224741 182
544 3300026078 Ga0207702_10336090 Ga0207702_103360902 182
545 3300026088 Ga0207641_10004205 Ga0207641_1000420510 182
546 3300026088 Ga0207641_10506739 Ga0207641_105067392 182
547 3300026089 Ga0207648_10033528 Ga0207648_100335283 182
548 3300026095 Ga0207676_10373619 Ga0207676_103736191 182
549 3300026118 Ga0207675_100000834 Ga0207675_10000083428 182
550 3300026118 Ga0207675_100276977 Ga0207675_1002769773 182
551 3300026121 Ga0207683_10002401 Ga0207683_1000240114 182
552 3300026121 Ga0207683_10005298 Ga0207683_100052983 182
553 3300026121 Ga0207683_10045141 Ga0207683_100451413 182
554 3300026142 Ga0207698_10304403 Ga0207698_103044033 182
555 3300028379 Ga0268266_10061902 Ga0268266_100619025 182
556 3300028380 Ga0268265_10000105 Ga0268265_1000010538 182
557 3300028380 Ga0268265_10070377 Ga0268265_100703773 182
558 3300028381 Ga0268264_10000237 Ga0268264_1000023780 182
559 3300028381 Ga0268264_10018348 Ga0268264_100183483 182
560 3300031731 Ga0307405_11298838 Ga0307405_112988381 182
561 3300031852 Ga0307410_10574587 Ga0307410_105745872 182
562 3300031901 Ga0307406_10269240 Ga0307406_102692402 182
563 3300031903 Ga0307407_10285423 Ga0307407_102854231 182
564 3300031995 Ga0307409_100040233 Ga0307409_1000402332 182
565 3300031995 Ga0307409_100383410 Ga0307409_1003834101 182
566 3300031995 Ga0307409_101226481 Ga0307409_1012264811 182
567 3300032002 Ga0307416_101961401 Ga0307416_1019614011 182
568 3300032005 Ga0307411_10151754 Ga0307411_101517542 182
569 3300032005 Ga0307411_10390722 Ga0307411_103907222 182
570 3300032126 Ga0307415_100160281 Ga0307415_1001602812 182
571 3300032126 Ga0307415_100298847 Ga0307415_1002988472 182
572 3300035112 Ga0373932_0008993 Ga0373932_0008993_1550_2110 182
573 3300035241 Ga0373961_0221006 Ga0373961_0221006_34_594 182
574 3300035691 Ga0373931_0018961 Ga0373931_0018961_325_885 182
575 3300039447 Ga0436361_1114931 Ga0436361_1114931_808_1356 182
576 3300041410 Ga0439461_0047958 Ga0439461_0047958_46_606 182
577 3300041410 Ga0439461_0061462 Ga0439461_0061462_122_670 182
578 3300041411 Ga0439466_0002859 Ga0439466_0002859_4813_5361 182
579 3300041411 Ga0439466_0074359 Ga0439466_0074359_274_834 182
580 3300041411 Ga0439466_0142601 Ga0439466_0142601_82_642 182
581 3300041413 Ga0439465_0000074 Ga0439465_0000074_19407_19967 182
582 3300041413 Ga0439465_0003465 Ga0439465_0003465_1459_2007 182
583 3300041413 Ga0439465_0010780 Ga0439465_0010780_794_1342 182
584 3300041413 Ga0439465_0012061 Ga0439465_0012061_2038_2598 182
585 3300041443 Ga0451789_1281002 Ga0451789_1281002_213_761 182
586 3300041452 Ga0451793_1189180 Ga0451793_1189180_375_923 182
587 3300041456 Ga0451795_1670815 Ga0451795_1670815_1478_2026 182
588 3300041460 Ga0451802_1056342 Ga0451802_1056342_424_972 182
589 3300041997 Ga0439431_0005313 Ga0439431_0005313_809_1369 182
590 3300041997 Ga0439431_0145957 Ga0439431_0145957_95_643 182
591 3300042002 Ga0439442_021882 Ga0439442_021882_716_1276 182
592 3300042004 Ga0439445_0086116 Ga0439445_0086116_228_788 182
593 3300042438 Ga0439459_0118249 Ga0439459_0118249_82_630 182
594 3300042438 Ga0439459_0127327 Ga0439459_0127327_63_623 182
595 3300044656 Ga0466969_0180186 Ga0466969_0180186_403_951 182
596 3300044658 Ga0466972_0016461 Ga0466972_0016461_1829_2389 182
597 3300044658 Ga0466972_0068734 Ga0466972_0068734_864_1424 182
598 3300044658 Ga0466972_0128564 Ga0466972_0128564_82_630 182
599 3300044684 Ga0466966_0372774 Ga0466966_0372774_286_834 182
600 3300044706 Ga0466964_0353449 Ga0466964_0353449_95_658 182
601 3300044706 Ga0466964_0432715 Ga0466964_0432715_117_677 182
602 3300044765 Ga0466970_0199723 Ga0466970_0199723_97_657 182
603 3300044842 Ga0466957_0049766 Ga0466957_0049766_518_1066 182
604 3300044842 Ga0466957_0108328 Ga0466957_0108328_652_1212 182
605 3300044901 Ga0466960_0000761 Ga0466960_0000761_133_681 182
606 3300044901 Ga0466960_0035811 Ga0466960_0035811_1528_2076 182
607 3300044901 Ga0466960_0349590 Ga0466960_0349590_174_737 182
608 3300045049 Ga0466959_0146105 Ga0466959_0146105_653_1213 182
609 3300045049 Ga0466959_0452253 Ga0466959_0452253_204_752 182
610 3300045836 Ga0466958_0005722 Ga0466958_0005722_568_1128 182
611 3300045976 Ga0466967_0521402 Ga0466967_0521402_132_689 182
612 3300045976 Ga0466967_1018022 Ga0466967_1018022_248_796 182
613 3300046460 Ga0495638_0004264 Ga0495638_0004264_3494_4042 182
614 3300046524 Ga0495648_0032953 Ga0495648_0032953_2053_2601 182
615 3300046660 Ga0495625_0089206 Ga0495625_0089206_381_929 182
616 3300046663 Ga0495635_0276102 Ga0495635_0276102_425_973 182
617 3300046692 Ga0495671_0305686 Ga0495671_0305686_45_593 182
618 3300046694 Ga0495649_0390553 Ga0495649_0390553_127_675 182
619 3300047320 Ga0495672_0241223 Ga0495672_0241223_27_575 182
620 3300047472 Ga0495686_0004460 Ga0495686_0004460_2855_3403 182
621 3300047472 Ga0495686_0083876 Ga0495686_0083876_1327_1875 182
622 3300048903 Ga0496100_0006859 Ga0496100_0006859_5599_6147 182
623 3300048903 Ga0496100_0009905 Ga0496100_0009905_59_607 182
624 3300048903 Ga0496100_0010785 Ga0496100_0010785_3480_4028 182
625 3300048903 Ga0496100_0085705 Ga0496100_0085705_376_936 182
626 3300048904 Ga0496101_0000126 Ga0496101_0000126_41809_42357 182
627 3300048904 Ga0496101_0001097 Ga0496101_0001097_2468_3028 182
628 3300048904 Ga0496101_0004633 Ga0496101_0004633_3089_3637 182
629 3300048904 Ga0496101_0035495 Ga0496101_0035495_2181_2729 182
630 3300048904 Ga0496101_0119992 Ga0496101_0119992_444_992 182
631 3300048904 Ga0496101_0441933 Ga0496101_0441933_310_870 182
632 3300048905 Ga0496102_0000006 Ga0496102_0000006_30521_31069 182
633 3300048905 Ga0496102_0000985 Ga0496102_0000985_10809_11357 182
634 3300048905 Ga0496102_0010400 Ga0496102_0010400_1543_2103 182
635 3300048905 Ga0496102_0129219 Ga0496102_0129219_256_816 182
636 3300048905 Ga0496102_0170814 Ga0496102_0170814_538_1095 182
637 3300048905 Ga0496102_0287011 Ga0496102_0287011_981_1529 182
638 3300048905 Ga0496102_0487509 Ga0496102_0487509_388_948 182
639 3300048906 Ga0496103_0000006 Ga0496103_0000006_30348_30896 182
640 3300048906 Ga0496103_0000356 Ga0496103_0000356_6514_7062 182
641 3300048906 Ga0496103_0004805 Ga0496103_0004805_301_861 182
642 3300048907 Ga0496104_0003054 Ga0496104_0003054_8741_9289 182
643 3300048907 Ga0496104_0050164 Ga0496104_0050164_2702_3262 182
644 3300048908 Ga0496105_0042538 Ga0496105_0042538_53_601 182
645 3300048908 Ga0496105_0216709 Ga0496105_0216709_885_1445 182
646 3300048909 Ga0496106_0006632 Ga0496106_0006632_3233_3793 182
647 3300048909 Ga0496106_0086490 Ga0496106_0086490_1759_2307 182
648 3300048909 Ga0496106_0443798 Ga0496106_0443798_141_698 182
649 3300048910 Ga0496107_0014104 Ga0496107_0014104_2862_3410 182
650 3300048910 Ga0496107_0021207 Ga0496107_0021207_3794_4354 182
651 3300048910 Ga0496107_0077817 Ga0496107_0077817_1030_1578 182
652 3300048911 Ga0496108_0008982 Ga0496108_0008982_6218_6778 182
653 3300048911 Ga0496108_0420405 Ga0496108_0420405_294_842 182
654 3300048911 Ga0496108_0528460 Ga0496108_0528460_140_700 182
655 3300048911 Ga0496108_0705377 Ga0496108_0705377_46_597 182
656 3300048912 Ga0496109_0000990 Ga0496109_0000990_2688_3248 182
657 3300048912 Ga0496109_0513291 Ga0496109_0513291_233_793 182
658 3300048913 Ga0496110_0042461 Ga0496110_0042461_412_972 182
659 3300048913 Ga0496110_0200075 Ga0496110_0200075_1022_1582 182
660 3300048915 Ga0496112_0012991 Ga0496112_0012991_1630_2190 182
661 3300048915 Ga0496112_0035783 Ga0496112_0035783_1904_2464 182
662 3300048915 Ga0496112_0227724 Ga0496112_0227724_266_814 182
663 3300048915 Ga0496112_0336228 Ga0496112_0336228_10_558 182
664 3300048915 Ga0496112_1396336 Ga0496112_1396336_34_582 182
665 3300048916 Ga0496113_0013559 Ga0496113_0013559_4323_4871 182
666 3300048917 Ga0496114_0003652 Ga0496114_0003652_1647_2207 182
667 3300048917 Ga0496114_0013084 Ga0496114_0013084_5175_5723 182
668 3300048917 Ga0496114_0816988 Ga0496114_0816988_133_681 182
669 3300048918 Ga0496115_0013721 Ga0496115_0013721_2043_2603 182
670 3300048918 Ga0496115_0136768 Ga0496115_0136768_507_1055 182
671 3300048919 Ga0496116_0000025 Ga0496116_0000025_439644_440192 182
672 3300048919 Ga0496116_0015243 Ga0496116_0015243_1513_2061 182
673 3300048920 Ga0496117_0000006 Ga0496117_0000006_439673_440221 182
674 3300048920 Ga0496117_0006504 Ga0496117_0006504_4024_4572 182
675 3300048920 Ga0496117_0301678 Ga0496117_0301678_24_572 182
676 3300048921 Ga0496118_0000004 Ga0496118_0000004_439673_440221 182
677 3300048921 Ga0496118_0009842 Ga0496118_0009842_6057_6605 182
678 3300048921 Ga0496118_0351433 Ga0496118_0351433_113_673 182
679 3300048922 Ga0496119_0000041 Ga0496119_0000041_1413_1961 182
680 3300048922 Ga0496119_0006040 Ga0496119_0006040_9296_9844 182
681 3300048923 Ga0496120_0000027 Ga0496120_0000027_199044_199592 182
682 3300048924 Ga0496121_0001735 Ga0496121_0001735_31849_32397 182
683 3300048924 Ga0496121_0015445 Ga0496121_0015445_6705_7253 182
684 3300048925 Ga0496122_0027173 Ga0496122_0027173_2619_3167 182
685 3300048926 Ga0496123_0052150 Ga0496123_0052150_2069_2617 182
686 3300048927 Ga0496124_0058977 Ga0496124_0058977_1336_1884 182
687 3300048928 Ga0496125_0012549 Ga0496125_0012549_7266_7814 182
688 3300048929 Ga0496126_0001191 Ga0496126_0001191_22803_23351 182
689 3300048929 Ga0496126_0011848 Ga0496126_0011848_3375_3923 182
690 3300048929 Ga0496126_0053729 Ga0496126_0053729_511_1059 182
691 3300049553 Ga0501337_011751 Ga0501337_011751_50_604 182
692 3300049571 Ga0501034_0229493 Ga0501034_0229493_675_1223 182
693 3300050489 nmdc:mga03683_279118_c1 nmdc:mga03683_279118_c1_122_670 182
694 3300050490 nmdc:mga03n38_4088_c1 nmdc:mga03n38_4088_c1_43_597 182
695 3300050490 nmdc:mga03n38_5038_c1 nmdc:mga03n38_5038_c1_86_649 182
696 3300050490 nmdc:mga03n38_6690_c1 nmdc:mga03n38_6690_c1_159_707 182
697 3300050491 nmdc:mga00v17_23627_c1 nmdc:mga00v17_23627_c1_1579_2133 182
698 3300050491 nmdc:mga00v17_303294_c1 nmdc:mga00v17_303294_c1_329_877 182
699 3300050491 nmdc:mga00v17_467228_c1 nmdc:mga00v17_467228_c1_231_779 182
700 3300050491 nmdc:mga00v17_657_c1 nmdc:mga00v17_657_c1_11756_12316 182
701 3300050491 nmdc:mga00v17_69638_c1 nmdc:mga00v17_69638_c1_800_1348 182
702 3300050491 nmdc:mga00v17_8556_c1 nmdc:mga00v17_8556_c1_2509_3072 182
703 3300050492 nmdc:mga0yw44_101229_c1 nmdc:mga0yw44_101229_c1_1025_1585 182
704 3300050492 nmdc:mga0yw44_151545_c1 nmdc:mga0yw44_151545_c1_835_1383 182
705 3300050492 nmdc:mga0yw44_427385_c1 nmdc:mga0yw44_427385_c1_288_836 182
706 3300050492 nmdc:mga0yw44_43067_c1 nmdc:mga0yw44_43067_c1_1189_1743 182
707 3300050492 nmdc:mga0yw44_453204_c1 nmdc:mga0yw44_453204_c1_161_805 182
708 3300050492 nmdc:mga0yw44_61426_c1 nmdc:mga0yw44_61426_c1_527_1075 182
709 3300050494 nmdc:mga06z11_2967_c1 nmdc:mga06z11_2967_c1_1367_1921 182
710 3300050494 nmdc:mga06z11_35162_c1 nmdc:mga06z11_35162_c1_1840_2403 182
711 3300050496 nmdc:mga07m45_151238_c1 nmdc:mga07m45_151238_c1_119_667 182
712 3300050496 nmdc:mga07m45_22945_c1 nmdc:mga07m45_22945_c1_1488_2042 182
713 3300050496 nmdc:mga07m45_46189_c1 nmdc:mga07m45_46189_c1_1328_1891 182
714 3300050507 nmdc:mga05p37_114951_c1 nmdc:mga05p37_114951_c1_1910_2470 182
715 3300050507 nmdc:mga05p37_57571_c1 nmdc:mga05p37_57571_c1_2396_2956 182
716 3300050509 nmdc:mga0qj67_9159_c1 nmdc:mga0qj67_9159_c1_1752_2312 182
717 3300050510 nmdc:mga06r32_35137_c1 nmdc:mga06r32_35137_c1_746_1306 182
718 3300050516 nmdc:mga0sz30_179944_c1 nmdc:mga0sz30_179944_c1_258_806 182
719 3300050516 nmdc:mga0sz30_299653_c1 nmdc:mga0sz30_299653_c1_34_588 182
720 3300050516 nmdc:mga0sz30_51860_c1 nmdc:mga0sz30_51860_c1_495_1043 182
721 3300050516 nmdc:mga0sz30_967_c1 nmdc:mga0sz30_967_c1_9521_10081 182
722 3300053079 Ga0500610_0019519 Ga0500610_0019519_2715_3263 182
723 3300053087 Ga0500643_000926 Ga0500643_000926_14713_15261 182
724 3300053104 Ga0500556_0094967 Ga0500556_0094967_26_574 182
725 3300053108 Ga0500562_018730 Ga0500562_018730_1103_1651 182
726 3300053108 Ga0500562_027255 Ga0500562_027255_456_1007 182
727 3300053153 Ga0500616_0009538 Ga0500616_0009538_4991_5539 182
728 3300053153 Ga0500616_0214514 Ga0500616_0214514_61_609 182

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

48

212

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
1wub-assembly1.cif.gz_A crystal structure of the polyisoprenoid-binding protein, tt1927b, from thermus thermophilus hb8 0.9374 13 182
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9263 12 181
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.921 12 181
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9177 12 182
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9125 12 182
ID Description Score Start End Superfamily
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9416 16 177 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9374 13 182 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9224 12 182 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9171 12 182 2.40.128.110
af_Q2FUS9_3_167_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9138 16 177 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A7I9ZUA4-F1-model_v4 Polyisoprenoid-binding protein 0.9901 3 182
AF-K8X665-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9885 1 153
AF-A0A1B1KI26-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9875 8 182
AF-K6UYZ8-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.9871 46 182
AF-A0A1X3P6B0-F1-model_v4 Polyisoprenoid-binding protein 0.9861 9 182

Feature Viewer

pLDDT pTM Quality
93.75 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map