F477754
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 727 | 304 | 717 | 253 |
Family's Representative Sequence
| Representative Sequence | 3300031730|Ga0307516_10005007|Ga0307516_100050071 |
| Length | 285 |
| Sequence | MTTPRSPSTSIDPPRGSRPAWGGPALGREAMSDTVLETRGLLKRFGGITPTNDVSIQVEKGARCALIGPNGAGKTTLINLLTGVIEPTAGSIWLDGADITQLTPHQRVRRGVVRTFQINQLFGELTPLQSLALSVSAQFGISAQWWKRLGTDARVAPRCDTLLKQFHLDDVADQQVKHLAYGKRRLLEIATALACEPRVLLLDEPVAGVPEGERQEIFDIINALPPEVSVLLIEHDMDLVFNFAKSVTVLVNGAVFAEGDVQTISNDPRVKAVYLGESAEGHAHG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 2 | 2585428058 | Methylibium sp. CF468 | Isolate | Rhizosphere |
| 3 | 2585428062 | Methylibium sp. CF059 | Isolate | Rhizosphere |
| 4 | 2588253510 | Rhizobacter sp. OV335 | Isolate | Rhizosphere |
| 5 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 6 | 2643221625 | Rhizobacter sp. Root29 | Isolate | Unclassified |
| 7 | 2643221644 | Rhizobacter sp. Root1221 | Isolate | Unclassified |
| 8 | 2643221648 | Rhizobacter sp. Root1238 | Isolate | Unclassified |
| 9 | 2643221654 | Rhizobacter sp. Root404 | Isolate | Unclassified |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 12 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 13 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 14 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 19 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 22 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 24 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 25 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 43 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 48 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 49 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 53 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 55 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 56 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 57 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 58 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 59 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 60 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 61 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 62 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 63 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 64 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 65 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 66 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 67 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 68 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 69 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 70 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 78 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 92 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 108 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 109 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 110 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 111 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 112 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 113 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 114 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 170 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 175 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 176 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 177 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 178 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 179 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 180 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 181 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 182 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 183 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 184 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 185 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 186 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 187 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 188 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 189 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 190 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 191 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 192 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 193 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 194 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 195 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 196 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 197 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 198 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 201 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 202 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 203 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 204 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 205 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 206 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 207 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 208 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 209 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 210 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 211 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 212 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 213 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 214 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 215 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 216 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 217 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 218 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 219 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 225 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 226 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 227 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 228 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 229 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 230 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 231 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 232 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 233 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 234 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 235 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 236 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 237 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 238 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 239 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 240 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 241 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 242 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 243 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 244 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 245 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 246 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 247 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 248 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 249 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 250 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 251 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 252 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 253 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 254 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 255 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 256 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 257 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 258 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 259 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 260 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 261 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 262 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 263 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 264 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 265 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 266 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 267 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 268 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 271 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 272 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 273 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 274 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 275 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 276 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 277 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 278 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 279 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 280 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 281 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 282 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 283 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 284 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 286 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 287 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 288 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 289 | 3300053126 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere | Metagenome | Endosphere |
| 290 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 291 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 292 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 293 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 294 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 295 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 296 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 297 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 298 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 299 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 300 | 3300053724 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere | Metagenome | Endosphere |
| 301 | 3300053726 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere | Metagenome | Endosphere |
| 302 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 303 | 3300053739 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere | Metagenome | Endosphere |
| 304 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.62 |
| Metatranscriptomes | 0 |
| Isolates | 1.38 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 13.07 |
| Nodule | 0 |
| Rhizoplane | 3.03 |
| Rhizosphere | 75.79 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 8.12 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI25406J46586_10048047 | 3300003203 | Bacteria | 1450 |
| 2 | JGI25153J46596_10004971 | 3300003215 | Bacteria | 7062 |
| 3 | rootH1_10004635 | 3300003323 | Bacteria | 23785 |
| 4 | Ga0055526_1001524 | 3300003771 | Bacteria | 16387 |
| 5 | Ga0055530_10009684 | 3300003791 | Bacteria | 3665 |
| 6 | Ga0065165_1004067 | 3300005262 | Bacteria | 9489 |
| 7 | Ga0070676_10056499 | 3300005328 | Bacteria | 2319 |
| 8 | Ga0070676_10068675 | 3300005328 | Bacteria | 2122 |
| 9 | Ga0070676_10133099 | 3300005328 | Bacteria | 1574 |
| 10 | Ga0070683_100135892 | 3300005329 | Bacteria | 2328 |
| 11 | Ga0070690_100009364 | 3300005330 | Bacteria | 5673 |
| 12 | Ga0070690_100251716 | 3300005330 | Bacteria | 1250 |
| 13 | Ga0070670_100011095 | 3300005331 | Bacteria | 7698 |
| 14 | Ga0070670_100091187 | 3300005331 | Bacteria | 2619 |
| 15 | Ga0070670_100091478 | 3300005331 | Bacteria | 2616 |
| 16 | Ga0070670_100359275 | 3300005331 | Bacteria | 1280 |
| 17 | Ga0070677_10013542 | 3300005333 | Bacteria | 2855 |
| 18 | Ga0070677_10037192 | 3300005333 | Bacteria | 1898 |
| 19 | Ga0070677_10121109 | 3300005333 | Bacteria | 1182 |
| 20 | Ga0068869_100003047 | 3300005334 | Bacteria | 10192 |
| 21 | Ga0068869_100027130 | 3300005334 | Bacteria | 3991 |
| 22 | Ga0068869_100077017 | 3300005334 | Bacteria | 2480 |
| 23 | Ga0068869_100630889 | 3300005334 | Bacteria | 908 |
| 24 | Ga0070666_10024991 | 3300005335 | Bacteria | 3893 |
| 25 | Ga0070666_10133252 | 3300005335 | Bacteria | 1728 |
| 26 | Ga0070680_100008447 | 3300005336 | Bacteria | 7884 |
| 27 | Ga0068868_100004842 | 3300005338 | Bacteria | 9451 |
| 28 | Ga0068868_100009130 | 3300005338 | Bacteria | 7119 |
| 29 | Ga0068868_100010695 | 3300005338 | Bacteria | 6651 |
| 30 | Ga0068868_100040286 | 3300005338 | Bacteria | 3635 |
| 31 | Ga0068868_100261141 | 3300005338 | Bacteria | 1460 |
| 32 | Ga0068868_100510933 | 3300005338 | Bacteria | 1054 |
| 33 | Ga0070660_100027643 | 3300005339 | Bacteria | 4235 |
| 34 | Ga0070660_100075481 | 3300005339 | Bacteria | 2639 |
| 35 | Ga0070660_100359103 | 3300005339 | Bacteria | 1200 |
| 36 | Ga0070661_100057990 | 3300005344 | Bacteria | 2837 |
| 37 | Ga0070661_100374109 | 3300005344 | Bacteria | 1122 |
| 38 | Ga0070661_100384755 | 3300005344 | Bacteria | 1107 |
| 39 | Ga0070668_100003082 | 3300005347 | Bacteria | 12319 |
| 40 | Ga0070668_100010749 | 3300005347 | Bacteria | 6805 |
| 41 | Ga0070669_100009023 | 3300005353 | Bacteria | 7111 |
| 42 | Ga0070669_100026311 | 3300005353 | Bacteria | 4185 |
| 43 | Ga0070669_100028366 | 3300005353 | Bacteria | 4031 |
| 44 | Ga0070669_100177676 | 3300005353 | Bacteria | 1663 |
| 45 | Ga0070669_100224028 | 3300005353 | Bacteria | 1488 |
| 46 | Ga0070675_100000249 | 3300005354 | Bacteria | 35004 |
| 47 | Ga0070675_100010591 | 3300005354 | Bacteria | 7208 |
| 48 | Ga0070675_100020503 | 3300005354 | Bacteria | 5274 |
| 49 | Ga0070675_100056889 | 3300005354 | Bacteria | 3224 |
| 50 | Ga0070675_100068183 | 3300005354 | Bacteria | 2945 |
| 51 | Ga0070675_100305064 | 3300005354 | Bacteria | 1403 |
| 52 | Ga0070675_100314782 | 3300005354 | Bacteria | 1382 |
| 53 | Ga0070671_100000628 | 3300005355 | Bacteria | 25190 |
| 54 | Ga0070671_100012361 | 3300005355 | Bacteria | 6875 |
| 55 | Ga0070671_100029117 | 3300005355 | Bacteria | 4553 |
| 56 | Ga0070671_100056122 | 3300005355 | Bacteria | 3276 |
| 57 | Ga0070671_100065378 | 3300005355 | Bacteria | 3029 |
| 58 | Ga0070671_100145202 | 3300005355 | Bacteria | 2002 |
| 59 | Ga0070671_100386465 | 3300005355 | Bacteria | 1196 |
| 60 | Ga0070674_100004463 | 3300005356 | Bacteria | 7980 |
| 61 | Ga0070674_100006826 | 3300005356 | Bacteria | 6689 |
| 62 | Ga0070674_100034985 | 3300005356 | Bacteria | 3360 |
| 63 | Ga0070674_100063730 | 3300005356 | Bacteria | 2581 |
| 64 | Ga0070674_100354621 | 3300005356 | Bacteria | 1186 |
| 65 | Ga0070673_100002947 | 3300005364 | Bacteria | 10491 |
| 66 | Ga0070673_100022385 | 3300005364 | Bacteria | 4598 |
| 67 | Ga0070673_100028531 | 3300005364 | Bacteria | 4152 |
| 68 | Ga0070673_100107848 | 3300005364 | Bacteria | 2304 |
| 69 | Ga0070688_100062634 | 3300005365 | Bacteria | 2355 |
| 70 | Ga0070659_100019462 | 3300005366 | Bacteria | 5145 |
| 71 | Ga0070659_100512291 | 3300005366 | Bacteria | 1024 |
| 72 | Ga0070667_100009011 | 3300005367 | Bacteria | 8258 |
| 73 | Ga0070667_100051335 | 3300005367 | Bacteria | 3477 |
| 74 | Ga0070667_100316176 | 3300005367 | Bacteria | 1408 |
| 75 | Ga0070667_100623018 | 3300005367 | Bacteria | 995 |
| 76 | Ga0070701_10032610 | 3300005438 | Bacteria | 2596 |
| 77 | Ga0070708_100026951 | 3300005445 | Bacteria | 4925 |
| 78 | Ga0070708_100037495 | 3300005445 | Bacteria | 4230 |
| 79 | Ga0070663_100180143 | 3300005455 | Bacteria | 1638 |
| 80 | Ga0070678_100012118 | 3300005456 | Bacteria | 5345 |
| 81 | Ga0070678_100039515 | 3300005456 | Bacteria | 3330 |
| 82 | Ga0070678_100083966 | 3300005456 | Bacteria | 2422 |
| 83 | Ga0070678_100270210 | 3300005456 | Bacteria | 1433 |
| 84 | Ga0070662_100005664 | 3300005457 | Bacteria | 7993 |
| 85 | Ga0070662_100089285 | 3300005457 | Bacteria | 2312 |
| 86 | Ga0070662_100097010 | 3300005457 | Bacteria | 2224 |
| 87 | Ga0070662_100175827 | 3300005457 | Bacteria | 1684 |
| 88 | Ga0070662_100583782 | 3300005457 | Bacteria | 939 |
| 89 | Ga0070681_10643798 | 3300005458 | Bacteria | 975 |
| 90 | Ga0068867_100000054 | 3300005459 | Bacteria | 69032 |
| 91 | Ga0068867_100013078 | 3300005459 | Bacteria | 5874 |
| 92 | Ga0068867_100017469 | 3300005459 | Bacteria | 5096 |
| 93 | Ga0068867_100061634 | 3300005459 | Bacteria | 2785 |
| 94 | Ga0068867_100074187 | 3300005459 | Bacteria | 2549 |
| 95 | Ga0068867_100139198 | 3300005459 | Bacteria | 1895 |
| 96 | Ga0068867_100175340 | 3300005459 | Bacteria | 1701 |
| 97 | Ga0068867_100247824 | 3300005459 | Bacteria | 1447 |
| 98 | Ga0070706_100008790 | 3300005467 | Bacteria | 9412 |
| 99 | Ga0070707_100020166 | 3300005468 | Bacteria | 6285 |
| 100 | Ga0070698_100001400 | 3300005471 | Bacteria | 26710 |
| 101 | Ga0070698_100033168 | 3300005471 | Bacteria | 5348 |
| 102 | Ga0070679_100006933 | 3300005530 | Bacteria | 10571 |
| 103 | Ga0070684_100256631 | 3300005535 | Bacteria | 1598 |
| 104 | Ga0070684_100459104 | 3300005535 | Bacteria | 1178 |
| 105 | Ga0068853_100199965 | 3300005539 | Bacteria | 1818 |
| 106 | Ga0068853_100213524 | 3300005539 | Bacteria | 1759 |
| 107 | Ga0068853_100304671 | 3300005539 | Bacteria | 1473 |
| 108 | Ga0070672_100002237 | 3300005543 | Bacteria | 12196 |
| 109 | Ga0070672_100003401 | 3300005543 | Bacteria | 10316 |
| 110 | Ga0070672_100004578 | 3300005543 | Bacteria | 9055 |
| 111 | Ga0070672_100011963 | 3300005543 | Bacteria | 6068 |
| 112 | Ga0070672_100021611 | 3300005543 | Bacteria | 4712 |
| 113 | Ga0070672_100023520 | 3300005543 | Bacteria | 4543 |
| 114 | Ga0070672_100040316 | 3300005543 | Bacteria | 3582 |
| 115 | Ga0070672_100092452 | 3300005543 | Bacteria | 2442 |
| 116 | Ga0070672_100128392 | 3300005543 | Bacteria | 2081 |
| 117 | Ga0070672_100155383 | 3300005543 | Bacteria | 1894 |
| 118 | Ga0070672_100293307 | 3300005543 | Bacteria | 1377 |
| 119 | Ga0070672_100302128 | 3300005543 | Bacteria | 1357 |
| 120 | Ga0070693_100061204 | 3300005547 | Bacteria | 2188 |
| 121 | Ga0070665_100038031 | 3300005548 | Bacteria | 4837 |
| 122 | Ga0070665_100438923 | 3300005548 | Bacteria | 1315 |
| 123 | Ga0070665_100582737 | 3300005548 | Bacteria | 1131 |
| 124 | Ga0070665_100634276 | 3300005548 | Bacteria | 1082 |
| 125 | Ga0068855_100161204 | 3300005563 | Bacteria | 2545 |
| 126 | Ga0070664_100002952 | 3300005564 | Bacteria | 13754 |
| 127 | Ga0070664_100253203 | 3300005564 | Bacteria | 1583 |
| 128 | Ga0070664_100645611 | 3300005564 | Bacteria | 983 |
| 129 | Ga0068857_100175120 | 3300005577 | Bacteria | 1951 |
| 130 | Ga0068857_100271455 | 3300005577 | Bacteria | 1559 |
| 131 | Ga0068854_100108970 | 3300005578 | Bacteria | 2086 |
| 132 | Ga0068854_100477116 | 3300005578 | Bacteria | 1046 |
| 133 | Ga0068856_100032045 | 3300005614 | Bacteria | 5144 |
| 134 | Ga0068856_100142022 | 3300005614 | Bacteria | 2408 |
| 135 | Ga0068856_100303839 | 3300005614 | Bacteria | 1613 |
| 136 | Ga0068852_100011556 | 3300005616 | Bacteria | 6655 |
| 137 | Ga0068852_100065358 | 3300005616 | Bacteria | 3173 |
| 138 | Ga0068852_100077781 | 3300005616 | Bacteria | 2933 |
| 139 | Ga0068852_100136227 | 3300005616 | Bacteria | 2267 |
| 140 | Ga0068852_100169633 | 3300005616 | Bacteria | 2044 |
| 141 | Ga0068852_100180959 | 3300005616 | Bacteria | 1982 |
| 142 | Ga0068852_100227482 | 3300005616 | Bacteria | 1777 |
| 143 | Ga0068852_100416451 | 3300005616 | Bacteria | 1324 |
| 144 | Ga0068852_100526912 | 3300005616 | Bacteria | 1179 |
| 145 | Ga0068852_100749468 | 3300005616 | Bacteria | 989 |
| 146 | Ga0068859_100010521 | 3300005617 | Bacteria | 9310 |
| 147 | Ga0068859_100076039 | 3300005617 | Bacteria | 3399 |
| 148 | Ga0068859_100656874 | 3300005617 | Bacteria | 1140 |
| 149 | Ga0068864_100001865 | 3300005618 | Bacteria | 17299 |
| 150 | Ga0068864_100003674 | 3300005618 | Bacteria | 12677 |
| 151 | Ga0068864_100014639 | 3300005618 | Bacteria | 6516 |
| 152 | Ga0068864_100103122 | 3300005618 | Bacteria | 2532 |
| 153 | Ga0068864_100277743 | 3300005618 | Bacteria | 1562 |
| 154 | Ga0068864_100284407 | 3300005618 | Bacteria | 1544 |
| 155 | Ga0068864_100392548 | 3300005618 | Bacteria | 1317 |
| 156 | Ga0068866_10003009 | 3300005718 | Bacteria | 6961 |
| 157 | Ga0068866_10078229 | 3300005718 | Bacteria | 1769 |
| 158 | Ga0068866_10103754 | 3300005718 | Bacteria | 1573 |
| 159 | Ga0068861_100018459 | 3300005719 | Bacteria | 4970 |
| 160 | Ga0068861_100044597 | 3300005719 | Bacteria | 3335 |
| 161 | Ga0068861_100048758 | 3300005719 | Bacteria | 3203 |
| 162 | Ga0068851_10033053 | 3300005834 | Bacteria | 2576 |
| 163 | Ga0068851_10033318 | 3300005834 | Bacteria | 2567 |
| 164 | Ga0068851_10033722 | 3300005834 | Bacteria | 2553 |
| 165 | Ga0068851_10125101 | 3300005834 | Bacteria | 1385 |
| 166 | Ga0068870_10088594 | 3300005840 | Bacteria | 1726 |
| 167 | Ga0068863_100002188 | 3300005841 | Bacteria | 19393 |
| 168 | Ga0068863_100015545 | 3300005841 | Bacteria | 7311 |
| 169 | Ga0068863_100034885 | 3300005841 | Bacteria | 4792 |
| 170 | Ga0068863_100152686 | 3300005841 | Bacteria | 2210 |
| 171 | Ga0068863_100277051 | 3300005841 | Bacteria | 1624 |
| 172 | Ga0068858_100006780 | 3300005842 | Bacteria | 11140 |
| 173 | Ga0068858_100009570 | 3300005842 | Bacteria | 9245 |
| 174 | Ga0068858_100026038 | 3300005842 | Bacteria | 5439 |
| 175 | Ga0068858_100106510 | 3300005842 | Bacteria | 2617 |
| 176 | Ga0068860_100074770 | 3300005843 | Bacteria | 3222 |
| 177 | Ga0068860_100124430 | 3300005843 | Bacteria | 2471 |
| 178 | Ga0068860_100365033 | 3300005843 | Bacteria | 1423 |
| 179 | Ga0068862_100066838 | 3300005844 | Bacteria | 3098 |
| 180 | Ga0068862_100080500 | 3300005844 | Bacteria | 2824 |
| 181 | Ga0081539_10006995 | 3300005985 | Bacteria | 10470 |
| 182 | Ga0075365_10021734 | 3300006038 | Bacteria | 4008 |
| 183 | Ga0075368_10029292 | 3300006042 | Bacteria | 2128 |
| 184 | Ga0075363_100038490 | 3300006048 | Bacteria | 2515 |
| 185 | Ga0075362_10004317 | 3300006177 | Bacteria | 5088 |
| 186 | Ga0075362_10004366 | 3300006177 | Bacteria | 5070 |
| 187 | Ga0075362_10018675 | 3300006177 | Bacteria | 2872 |
| 188 | Ga0075367_10029814 | 3300006178 | Bacteria | 3124 |
| 189 | Ga0075367_10038321 | 3300006178 | Bacteria | 2790 |
| 190 | Ga0075367_10109982 | 3300006178 | Bacteria | 1691 |
| 191 | Ga0075369_10000085 | 3300006186 | Bacteria | 24796 |
| 192 | Ga0075369_10048661 | 3300006186 | Bacteria | 1830 |
| 193 | Ga0075369_10075604 | 3300006186 | Bacteria | 1488 |
| 194 | Ga0075366_10003063 | 3300006195 | Bacteria | 8731 |
| 195 | Ga0075366_10035028 | 3300006195 | Bacteria | 2959 |
| 196 | Ga0075366_10068020 | 3300006195 | Bacteria | 2120 |
| 197 | Ga0075366_10079226 | 3300006195 | Bacteria | 1961 |
| 198 | Ga0075366_10079352 | 3300006195 | Bacteria | 1959 |
| 199 | Ga0075366_10121040 | 3300006195 | Bacteria | 1577 |
| 200 | Ga0075366_10139123 | 3300006195 | Bacteria | 1467 |
| 201 | Ga0075366_10317915 | 3300006195 | Bacteria | 953 |
| 202 | Ga0097621_100025701 | 3300006237 | Bacteria | 4609 |
| 203 | Ga0097621_100049541 | 3300006237 | Bacteria | 3413 |
| 204 | Ga0097621_100075809 | 3300006237 | Bacteria | 2788 |
| 205 | Ga0097621_100199701 | 3300006237 | Bacteria | 1735 |
| 206 | Ga0097621_100286768 | 3300006237 | Bacteria | 1450 |
| 207 | Ga0097621_100595616 | 3300006237 | Bacteria | 1010 |
| 208 | Ga0075370_10002925 | 3300006353 | Bacteria | 8026 |
| 209 | Ga0075370_10017191 | 3300006353 | Bacteria | 3904 |
| 210 | Ga0075370_10021997 | 3300006353 | Bacteria | 3497 |
| 211 | Ga0075370_10048720 | 3300006353 | Bacteria | 2401 |
| 212 | Ga0075370_10058506 | 3300006353 | Bacteria | 2192 |
| 213 | Ga0075370_10084214 | 3300006353 | Bacteria | 1830 |
| 214 | Ga0075370_10100631 | 3300006353 | Bacteria | 1672 |
| 215 | Ga0075370_10200673 | 3300006353 | Bacteria | 1176 |
| 216 | Ga0068871_100016932 | 3300006358 | Bacteria | 5503 |
| 217 | Ga0068871_100053607 | 3300006358 | Bacteria | 3269 |
| 218 | Ga0068871_100092690 | 3300006358 | Bacteria | 2520 |
| 219 | Ga0068871_100166655 | 3300006358 | Bacteria | 1886 |
| 220 | Ga0068871_100505753 | 3300006358 | Bacteria | 1090 |
| 221 | Ga0068871_100656889 | 3300006358 | Bacteria | 958 |
| 222 | Ga0075434_100085072 | 3300006871 | Bacteria | 3162 |
| 223 | Ga0068865_100003515 | 3300006881 | Bacteria | 9390 |
| 224 | Ga0097620_100010521 | 3300006931 | Bacteria | 9310 |
| 225 | Ga0097620_100076044 | 3300006931 | Bacteria | 3399 |
| 226 | Ga0097620_100656825 | 3300006931 | Bacteria | 1140 |
| 227 | Ga0105240_10349065 | 3300009093 | Bacteria | 1679 |
| 228 | Ga0105240_10776773 | 3300009093 | Bacteria | 1039 |
| 229 | Ga0111539_10619043 | 3300009094 | Bacteria | 1261 |
| 230 | Ga0105245_10012609 | 3300009098 | Bacteria | 7360 |
| 231 | Ga0105245_10122546 | 3300009098 | Bacteria | 2430 |
| 232 | Ga0105245_10247549 | 3300009098 | Bacteria | 1730 |
| 233 | Ga0105245_10365998 | 3300009098 | Bacteria | 1432 |
| 234 | Ga0105245_10395783 | 3300009098 | Bacteria | 1379 |
| 235 | Ga0105245_10654783 | 3300009098 | Bacteria | 1081 |
| 236 | Ga0105243_10001958 | 3300009148 | Bacteria | 17540 |
| 237 | Ga0105243_10004681 | 3300009148 | Bacteria | 10771 |
| 238 | Ga0105243_10028668 | 3300009148 | Bacteria | 4275 |
| 239 | Ga0105243_10201008 | 3300009148 | Bacteria | 1747 |
| 240 | Ga0105242_10145657 | 3300009176 | Bacteria | 2060 |
| 241 | Ga0105242_10528934 | 3300009176 | Bacteria | 1126 |
| 242 | Ga0105248_10013962 | 3300009177 | Bacteria | 8838 |
| 243 | Ga0105248_10147698 | 3300009177 | Bacteria | 2653 |
| 244 | Ga0105248_10162648 | 3300009177 | Bacteria | 2517 |
| 245 | Ga0105248_10223089 | 3300009177 | Bacteria | 2122 |
| 246 | Ga0105248_10255495 | 3300009177 | Bacteria | 1973 |
| 247 | Ga0105248_10541175 | 3300009177 | Bacteria | 1314 |
| 248 | Ga0105237_10195060 | 3300009545 | Bacteria | 2025 |
| 249 | Ga0105237_10204649 | 3300009545 | Bacteria | 1974 |
| 250 | Ga0105237_10633006 | 3300009545 | Bacteria | 1076 |
| 251 | Ga0105238_10414647 | 3300009551 | Bacteria | 1341 |
| 252 | Ga0105238_10456281 | 3300009551 | Bacteria | 1275 |
| 253 | Ga0105249_10082666 | 3300009553 | Bacteria | 2988 |
| 254 | Ga0105249_10307854 | 3300009553 | Bacteria | 1591 |
| 255 | Ga0105249_10515295 | 3300009553 | Bacteria | 1243 |
| 256 | Ga0099796_10005772 | 3300010159 | Bacteria | 3115 |
| 257 | Ga0105239_10058034 | 3300010375 | Bacteria | 4246 |
| 258 | Ga0105239_10186248 | 3300010375 | Bacteria | 2323 |
| 259 | Ga0157373_10084121 | 3300013100 | Bacteria | 2243 |
| 260 | Ga0157371_10055892 | 3300013102 | Bacteria | 2800 |
| 261 | Ga0157369_10267110 | 3300013105 | Bacteria | 1784 |
| 262 | Ga0157369_10593365 | 3300013105 | Bacteria | 1144 |
| 263 | Ga0157374_10014591 | 3300013296 | Bacteria | 6877 |
| 264 | Ga0157374_10221924 | 3300013296 | Bacteria | 1855 |
| 265 | Ga0157374_10300457 | 3300013296 | Bacteria | 1588 |
| 266 | Ga0157374_10409525 | 3300013296 | Bacteria | 1353 |
| 267 | Ga0157378_10077771 | 3300013297 | Bacteria | 2991 |
| 268 | Ga0157378_10254140 | 3300013297 | Bacteria | 1683 |
| 269 | Ga0157378_10402457 | 3300013297 | Bacteria | 1349 |
| 270 | Ga0157378_10546239 | 3300013297 | Bacteria | 1163 |
| 271 | Ga0163162_10001899 | 3300013306 | Bacteria | 19688 |
| 272 | Ga0163162_10039484 | 3300013306 | Bacteria | 4717 |
| 273 | Ga0163162_10202405 | 3300013306 | Bacteria | 2114 |
| 274 | Ga0163162_10578962 | 3300013306 | Bacteria | 1250 |
| 275 | Ga0163162_10819503 | 3300013306 | Bacteria | 1047 |
| 276 | Ga0163162_10849289 | 3300013306 | Bacteria | 1028 |
| 277 | Ga0157372_10013839 | 3300013307 | Bacteria | 8615 |
| 278 | Ga0157372_10277966 | 3300013307 | Bacteria | 1947 |
| 279 | Ga0157375_10003962 | 3300013308 | Bacteria | 12842 |
| 280 | Ga0157375_10007962 | 3300013308 | Bacteria | 9277 |
| 281 | Ga0157375_10120373 | 3300013308 | Bacteria | 2734 |
| 282 | Ga0157375_10161085 | 3300013308 | Bacteria | 2385 |
| 283 | Ga0157375_10205825 | 3300013308 | Bacteria | 2124 |
| 284 | Ga0157375_10507543 | 3300013308 | Bacteria | 1370 |
| 285 | Ga0163163_10005652 | 3300014325 | Bacteria | 10842 |
| 286 | Ga0163163_10061752 | 3300014325 | Bacteria | 3713 |
| 287 | Ga0163163_10553258 | 3300014325 | Bacteria | 1213 |
| 288 | Ga0157380_10015912 | 3300014326 | Bacteria | 5535 |
| 289 | Ga0157380_10215482 | 3300014326 | Bacteria | 1714 |
| 290 | Ga0157377_10000006 | 3300014745 | Bacteria | 419853 |
| 291 | Ga0157377_10052154 | 3300014745 | Bacteria | 2309 |
| 292 | Ga0157377_10188544 | 3300014745 | Bacteria | 1302 |
| 293 | Ga0157379_10001468 | 3300014968 | Bacteria | 19438 |
| 294 | Ga0157379_10002316 | 3300014968 | Bacteria | 15874 |
| 295 | Ga0157379_10025561 | 3300014968 | Bacteria | 5247 |
| 296 | Ga0157379_10072598 | 3300014968 | Bacteria | 3079 |
| 297 | Ga0157379_10300247 | 3300014968 | Bacteria | 1463 |
| 298 | Ga0157379_10352645 | 3300014968 | Bacteria | 1347 |
| 299 | Ga0157376_10063532 | 3300014969 | Bacteria | 3111 |
| 300 | Ga0157376_10075227 | 3300014969 | Bacteria | 2881 |
| 301 | Ga0163161_10031949 | 3300017792 | Bacteria | 3755 |
| 302 | Ga0163161_10036806 | 3300017792 | Bacteria | 3506 |
| 303 | Ga0163161_10348979 | 3300017792 | Bacteria | 1176 |
| 304 | Ga0213876_10060172 | 3300021384 | Bacteria | 2004 |
| 305 | Ga0213876_10115123 | 3300021384 | Bacteria | 1427 |
| 306 | Ga0207425_1000302 | 3300025245 | Bacteria | 35962 |
| 307 | Ga0209129_1000158 | 3300025258 | Bacteria | 103711 |
| 308 | Ga0209673_1033276 | 3300025273 | Bacteria | 1575 |
| 309 | Ga0209564_1000282 | 3300025295 | Bacteria | 103837 |
| 310 | Ga0209758_1000500 | 3300025297 | Bacteria | 63618 |
| 311 | Ga0209758_1000630 | 3300025297 | Bacteria | 54005 |
| 312 | Ga0209050_1000223 | 3300025298 | Bacteria | 125465 |
| 313 | Ga0207697_10016870 | 3300025315 | Bacteria | 3005 |
| 314 | Ga0207697_10071341 | 3300025315 | Bacteria | 1455 |
| 315 | Ga0207656_10022904 | 3300025321 | Bacteria | 2510 |
| 316 | Ga0207682_10042590 | 3300025893 | Bacteria | 1855 |
| 317 | Ga0207682_10080051 | 3300025893 | Bacteria | 1399 |
| 318 | Ga0207642_10046230 | 3300025899 | Bacteria | 1938 |
| 319 | Ga0207642_10046513 | 3300025899 | Bacteria | 1934 |
| 320 | Ga0207710_10130760 | 3300025900 | Bacteria | 1205 |
| 321 | Ga0207688_10060401 | 3300025901 | Bacteria | 2135 |
| 322 | Ga0207688_10190790 | 3300025901 | Bacteria | 1225 |
| 323 | Ga0207680_10025936 | 3300025903 | Bacteria | 3240 |
| 324 | Ga0207680_10256189 | 3300025903 | Bacteria | 1210 |
| 325 | Ga0207645_10046365 | 3300025907 | Bacteria | 2777 |
| 326 | Ga0207645_10049550 | 3300025907 | Bacteria | 2682 |
| 327 | Ga0207645_10128492 | 3300025907 | Bacteria | 1648 |
| 328 | Ga0207643_10022089 | 3300025908 | Bacteria | 3501 |
| 329 | Ga0207643_10060815 | 3300025908 | Bacteria | 2157 |
| 330 | Ga0207705_10234014 | 3300025909 | Bacteria | 1398 |
| 331 | Ga0207684_10002610 | 3300025910 | Bacteria | 18019 |
| 332 | Ga0207684_10298425 | 3300025910 | Bacteria | 1389 |
| 333 | Ga0207654_10237821 | 3300025911 | Bacteria | 1216 |
| 334 | Ga0207707_10524278 | 3300025912 | Bacteria | 1009 |
| 335 | Ga0207695_10201497 | 3300025913 | Bacteria | 1904 |
| 336 | Ga0207671_10093340 | 3300025914 | Bacteria | 2270 |
| 337 | Ga0207671_10163429 | 3300025914 | Bacteria | 1725 |
| 338 | Ga0207660_10007163 | 3300025917 | Bacteria | 7222 |
| 339 | Ga0207657_10030102 | 3300025919 | Bacteria | 4932 |
| 340 | Ga0207657_10094413 | 3300025919 | Bacteria | 2491 |
| 341 | Ga0207649_10005844 | 3300025920 | Bacteria | 6665 |
| 342 | Ga0207652_10042834 | 3300025921 | Bacteria | 3854 |
| 343 | Ga0207646_10110916 | 3300025922 | Bacteria | 2462 |
| 344 | Ga0207681_10000162 | 3300025923 | Bacteria | 55291 |
| 345 | Ga0207681_10014276 | 3300025923 | Bacteria | 4932 |
| 346 | Ga0207681_10032620 | 3300025923 | Bacteria | 3411 |
| 347 | Ga0207681_10033129 | 3300025923 | Bacteria | 3386 |
| 348 | Ga0207681_10065120 | 3300025923 | Bacteria | 2518 |
| 349 | Ga0207681_10224028 | 3300025923 | Bacteria | 1456 |
| 350 | Ga0207694_10093653 | 3300025924 | Bacteria | 2373 |
| 351 | Ga0207650_10000382 | 3300025925 | Bacteria | 41562 |
| 352 | Ga0207650_10000754 | 3300025925 | Bacteria | 24910 |
| 353 | Ga0207650_10093215 | 3300025925 | Bacteria | 2305 |
| 354 | Ga0207659_10000204 | 3300025926 | Bacteria | 35509 |
| 355 | Ga0207659_10003968 | 3300025926 | Bacteria | 8929 |
| 356 | Ga0207659_10006399 | 3300025926 | Bacteria | 7212 |
| 357 | Ga0207659_10009378 | 3300025926 | Bacteria | 6112 |
| 358 | Ga0207659_10031152 | 3300025926 | Bacteria | 3648 |
| 359 | Ga0207659_10046267 | 3300025926 | Bacteria | 3071 |
| 360 | Ga0207659_10068395 | 3300025926 | Bacteria | 2583 |
| 361 | Ga0207659_10083175 | 3300025926 | Bacteria | 2372 |
| 362 | Ga0207687_10021190 | 3300025927 | Bacteria | 4316 |
| 363 | Ga0207687_10299085 | 3300025927 | Bacteria | 1296 |
| 364 | Ga0207687_10328336 | 3300025927 | Bacteria | 1240 |
| 365 | Ga0207687_10372891 | 3300025927 | Bacteria | 1167 |
| 366 | Ga0207644_10000236 | 3300025931 | Bacteria | 37953 |
| 367 | Ga0207644_10004066 | 3300025931 | Bacteria | 9485 |
| 368 | Ga0207644_10028206 | 3300025931 | Bacteria | 3884 |
| 369 | Ga0207644_10036202 | 3300025931 | Bacteria | 3463 |
| 370 | Ga0207644_10044009 | 3300025931 | Bacteria | 3170 |
| 371 | Ga0207644_10076148 | 3300025931 | Bacteria | 2468 |
| 372 | Ga0207690_10273473 | 3300025932 | Bacteria | 1313 |
| 373 | Ga0207706_10007280 | 3300025933 | Bacteria | 10230 |
| 374 | Ga0207706_10037126 | 3300025933 | Bacteria | 4327 |
| 375 | Ga0207706_10067468 | 3300025933 | Bacteria | 3147 |
| 376 | Ga0207706_10096910 | 3300025933 | Bacteria | 2594 |
| 377 | Ga0207686_10096350 | 3300025934 | Bacteria | 1966 |
| 378 | Ga0207686_10148715 | 3300025934 | Bacteria | 1628 |
| 379 | Ga0207686_10167968 | 3300025934 | Bacteria | 1544 |
| 380 | Ga0207709_10007856 | 3300025935 | Bacteria | 5914 |
| 381 | Ga0207709_10010271 | 3300025935 | Bacteria | 5157 |
| 382 | Ga0207709_10049010 | 3300025935 | Bacteria | 2576 |
| 383 | Ga0207709_10136119 | 3300025935 | Bacteria | 1682 |
| 384 | Ga0207669_10023239 | 3300025937 | Bacteria | 3308 |
| 385 | Ga0207669_10077110 | 3300025937 | Bacteria | 2118 |
| 386 | Ga0207669_10195918 | 3300025937 | Bacteria | 1462 |
| 387 | Ga0207704_10004815 | 3300025938 | Bacteria | 6193 |
| 388 | Ga0207691_10008820 | 3300025940 | Bacteria | 9674 |
| 389 | Ga0207691_10010845 | 3300025940 | Bacteria | 8746 |
| 390 | Ga0207691_10022374 | 3300025940 | Bacteria | 5962 |
| 391 | Ga0207691_10065023 | 3300025940 | Bacteria | 3303 |
| 392 | Ga0207691_10067702 | 3300025940 | Bacteria | 3228 |
| 393 | Ga0207691_10185830 | 3300025940 | Bacteria | 1814 |
| 394 | Ga0207691_10214838 | 3300025940 | Bacteria | 1669 |
| 395 | Ga0207691_10217763 | 3300025940 | Bacteria | 1656 |
| 396 | Ga0207691_10313507 | 3300025940 | Bacteria | 1346 |
| 397 | Ga0207691_10354666 | 3300025940 | Bacteria | 1255 |
| 398 | Ga0207711_10019439 | 3300025941 | Bacteria | 5655 |
| 399 | Ga0207711_10055718 | 3300025941 | Bacteria | 3394 |
| 400 | Ga0207711_10119531 | 3300025941 | Bacteria | 2351 |
| 401 | Ga0207711_10428204 | 3300025941 | Bacteria | 1231 |
| 402 | Ga0207711_10444042 | 3300025941 | Bacteria | 1207 |
| 403 | Ga0207689_10000996 | 3300025942 | Bacteria | 27158 |
| 404 | Ga0207689_10039049 | 3300025942 | Bacteria | 3930 |
| 405 | Ga0207689_10083161 | 3300025942 | Bacteria | 2632 |
| 406 | Ga0207689_10593914 | 3300025942 | Bacteria | 931 |
| 407 | Ga0207661_10197145 | 3300025944 | Bacteria | 1768 |
| 408 | Ga0207679_10016215 | 3300025945 | Bacteria | 4943 |
| 409 | Ga0207679_10509009 | 3300025945 | Bacteria | 1075 |
| 410 | Ga0207679_10630811 | 3300025945 | Bacteria | 968 |
| 411 | Ga0207679_10678524 | 3300025945 | Bacteria | 934 |
| 412 | Ga0207651_10000175 | 3300025960 | Bacteria | 27877 |
| 413 | Ga0207651_10001535 | 3300025960 | Bacteria | 10540 |
| 414 | Ga0207651_10009344 | 3300025960 | Bacteria | 5360 |
| 415 | Ga0207651_10042464 | 3300025960 | Bacteria | 3026 |
| 416 | Ga0207651_10138750 | 3300025960 | Bacteria | 1874 |
| 417 | Ga0207651_10299112 | 3300025960 | Bacteria | 1337 |
| 418 | Ga0207651_10305691 | 3300025960 | Bacteria | 1324 |
| 419 | Ga0207712_10022242 | 3300025961 | Bacteria | 4172 |
| 420 | Ga0207668_10007819 | 3300025972 | Bacteria | 6361 |
| 421 | Ga0207668_10023396 | 3300025972 | Bacteria | 3969 |
| 422 | Ga0207668_10088303 | 3300025972 | Bacteria | 2270 |
| 423 | Ga0207668_10597638 | 3300025972 | Bacteria | 961 |
| 424 | Ga0207640_10180524 | 3300025981 | Bacteria | 1582 |
| 425 | Ga0207658_10000181 | 3300025986 | Bacteria | 67700 |
| 426 | Ga0207658_10005878 | 3300025986 | Bacteria | 8390 |
| 427 | Ga0207658_10169038 | 3300025986 | Bacteria | 1799 |
| 428 | Ga0207658_10245744 | 3300025986 | Bacteria | 1518 |
| 429 | Ga0207677_10005136 | 3300026023 | Bacteria | 7084 |
| 430 | Ga0207677_10015401 | 3300026023 | Bacteria | 4497 |
| 431 | Ga0207677_10113321 | 3300026023 | Bacteria | 2024 |
| 432 | Ga0207677_10153693 | 3300026023 | Bacteria | 1779 |
| 433 | Ga0207703_10001940 | 3300026035 | Bacteria | 18305 |
| 434 | Ga0207703_10003292 | 3300026035 | Bacteria | 13554 |
| 435 | Ga0207703_10004491 | 3300026035 | Bacteria | 11456 |
| 436 | Ga0207703_10063519 | 3300026035 | Bacteria | 3028 |
| 437 | Ga0207703_10224404 | 3300026035 | Bacteria | 1682 |
| 438 | Ga0207639_10107951 | 3300026041 | Bacteria | 2262 |
| 439 | Ga0207639_10272739 | 3300026041 | Bacteria | 1485 |
| 440 | Ga0207639_10368718 | 3300026041 | Bacteria | 1287 |
| 441 | Ga0207678_10032683 | 3300026067 | Bacteria | 4535 |
| 442 | Ga0207678_10043973 | 3300026067 | Bacteria | 3865 |
| 443 | Ga0207678_10135866 | 3300026067 | Bacteria | 2098 |
| 444 | Ga0207678_10245976 | 3300026067 | Bacteria | 1532 |
| 445 | Ga0207708_10104594 | 3300026075 | Bacteria | 2194 |
| 446 | Ga0207702_10012210 | 3300026078 | Bacteria | 7148 |
| 447 | Ga0207702_10179161 | 3300026078 | Bacteria | 1950 |
| 448 | Ga0207641_10001945 | 3300026088 | Bacteria | 19820 |
| 449 | Ga0207641_10008762 | 3300026088 | Bacteria | 8356 |
| 450 | Ga0207641_10171371 | 3300026088 | Bacteria | 1981 |
| 451 | Ga0207641_10410810 | 3300026088 | Bacteria | 1301 |
| 452 | Ga0207648_10000254 | 3300026089 | Bacteria | 57696 |
| 453 | Ga0207648_10006063 | 3300026089 | Bacteria | 12052 |
| 454 | Ga0207648_10011724 | 3300026089 | Bacteria | 8243 |
| 455 | Ga0207648_10017985 | 3300026089 | Bacteria | 6409 |
| 456 | Ga0207648_10025241 | 3300026089 | Bacteria | 5295 |
| 457 | Ga0207648_10037669 | 3300026089 | Bacteria | 4260 |
| 458 | Ga0207648_10044748 | 3300026089 | Bacteria | 3884 |
| 459 | Ga0207648_10442264 | 3300026089 | Bacteria | 1183 |
| 460 | Ga0207676_10000459 | 3300026095 | Bacteria | 34117 |
| 461 | Ga0207676_10004639 | 3300026095 | Bacteria | 9727 |
| 462 | Ga0207676_10092427 | 3300026095 | Bacteria | 2488 |
| 463 | Ga0207674_10007474 | 3300026116 | Bacteria | 12734 |
| 464 | Ga0207674_10200584 | 3300026116 | Bacteria | 1944 |
| 465 | Ga0207674_10213474 | 3300026116 | Bacteria | 1878 |
| 466 | Ga0207674_10244585 | 3300026116 | Bacteria | 1741 |
| 467 | Ga0207674_10297656 | 3300026116 | Bacteria | 1562 |
| 468 | Ga0207675_100004099 | 3300026118 | Bacteria | 14104 |
| 469 | Ga0207675_100008352 | 3300026118 | Bacteria | 9756 |
| 470 | Ga0207675_100034268 | 3300026118 | Bacteria | 4733 |
| 471 | Ga0207675_100451451 | 3300026118 | Bacteria | 1274 |
| 472 | Ga0207683_10001583 | 3300026121 | Bacteria | 20527 |
| 473 | Ga0207683_10003340 | 3300026121 | Bacteria | 13988 |
| 474 | Ga0207683_10187716 | 3300026121 | Bacteria | 1876 |
| 475 | Ga0207683_10292796 | 3300026121 | Bacteria | 1489 |
| 476 | Ga0207683_10316733 | 3300026121 | Bacteria | 1428 |
| 477 | Ga0207698_10012242 | 3300026142 | Bacteria | 5604 |
| 478 | Ga0207698_10044685 | 3300026142 | Bacteria | 3331 |
| 479 | Ga0207698_10152355 | 3300026142 | Bacteria | 2009 |
| 480 | Ga0207698_10161229 | 3300026142 | Bacteria | 1961 |
| 481 | Ga0207698_10368196 | 3300026142 | Bacteria | 1363 |
| 482 | Ga0209813_10079002 | 3300027866 | Bacteria | 1084 |
| 483 | Ga0209974_10000572 | 3300027876 | Bacteria | 12285 |
| 484 | Ga0268266_10168039 | 3300028379 | Bacteria | 1989 |
| 485 | Ga0268266_10313015 | 3300028379 | Bacteria | 1467 |
| 486 | Ga0268266_10340147 | 3300028379 | Bacteria | 1408 |
| 487 | Ga0268266_10496754 | 3300028379 | Bacteria | 1164 |
| 488 | Ga0268265_10015703 | 3300028380 | Bacteria | 5187 |
| 489 | Ga0268265_10069832 | 3300028380 | Bacteria | 2729 |
| 490 | Ga0268264_10001738 | 3300028381 | Bacteria | 20024 |
| 491 | Ga0268264_10083069 | 3300028381 | Bacteria | 2743 |
| 492 | Ga0268264_10155269 | 3300028381 | Bacteria | 2056 |
| 493 | Ga0268264_10328773 | 3300028381 | Bacteria | 1448 |
| 494 | Ga0307517_10004361 | 3300028786 | Bacteria | 21778 |
| 495 | Ga0307517_10160963 | 3300028786 | Bacteria | 1507 |
| 496 | Ga0307515_10000911 | 3300028794 | Bacteria | 68106 |
| 497 | Ga0307515_10002263 | 3300028794 | Bacteria | 42131 |
| 498 | Ga0307515_10002980 | 3300028794 | Bacteria | 35948 |
| 499 | Ga0307515_10007802 | 3300028794 | Bacteria | 21061 |
| 500 | Ga0307515_10034317 | 3300028794 | Bacteria | 8313 |
| 501 | Ga0307515_10093328 | 3300028794 | Bacteria | 3733 |
| 502 | Ga0307515_10125748 | 3300028794 | Bacteria | 2865 |
| 503 | Ga0307515_10319198 | 3300028794 | Bacteria | 1221 |
| 504 | Ga0307512_10008490 | 3300030522 | Bacteria | 10003 |
| 505 | Ga0307512_10015306 | 3300030522 | Bacteria | 7117 |
| 506 | Ga0307512_10043701 | 3300030522 | Bacteria | 3692 |
| 507 | Ga0307512_10076911 | 3300030522 | Bacteria | 2429 |
| 508 | Ga0307512_10172472 | 3300030522 | Bacteria | 1236 |
| 509 | Ga0307512_10197122 | 3300030522 | Bacteria | 1098 |
| 510 | Ga0265327_10027464 | 3300031251 | Bacteria | 3275 |
| 511 | Ga0307513_10013217 | 3300031456 | Bacteria | 10135 |
| 512 | Ga0307513_10041281 | 3300031456 | Bacteria | 5094 |
| 513 | Ga0307509_10001647 | 3300031507 | Bacteria | 37422 |
| 514 | Ga0307509_10010682 | 3300031507 | Bacteria | 11203 |
| 515 | Ga0307509_10012990 | 3300031507 | Bacteria | 9893 |
| 516 | Ga0307509_10028187 | 3300031507 | Bacteria | 6246 |
| 517 | Ga0307509_10058927 | 3300031507 | Bacteria | 4064 |
| 518 | Ga0307509_10076354 | 3300031507 | Bacteria | 3477 |
| 519 | Ga0307509_10146968 | 3300031507 | Bacteria | 2281 |
| 520 | Ga0307408_100377317 | 3300031548 | Bacteria | 1211 |
| 521 | Ga0307508_10000101 | 3300031616 | Bacteria | 100858 |
| 522 | Ga0307508_10041346 | 3300031616 | Bacteria | 4137 |
| 523 | Ga0307508_10043133 | 3300031616 | Bacteria | 4042 |
| 524 | Ga0307508_10095632 | 3300031616 | Bacteria | 2561 |
| 525 | Ga0307514_10009380 | 3300031649 | Bacteria | 8236 |
| 526 | Ga0307514_10015754 | 3300031649 | Bacteria | 6233 |
| 527 | Ga0307514_10027344 | 3300031649 | Bacteria | 4608 |
| 528 | Ga0307514_10095565 | 3300031649 | Bacteria | 2149 |
| 529 | Ga0307516_10000394 | 3300031730 | Bacteria | 57048 |
| 530 | Ga0307516_10004894 | 3300031730 | Bacteria | 16300 |
| 531 | Ga0307516_10005007 | 3300031730 | Bacteria | 16073 |
| 532 | Ga0307516_10080188 | 3300031730 | Bacteria | 3108 |
| 533 | Ga0307516_10115443 | 3300031730 | Bacteria | 2481 |
| 534 | Ga0307516_10127244 | 3300031730 | Bacteria | 2331 |
| 535 | Ga0307516_10278211 | 3300031730 | Bacteria | 1356 |
| 536 | Ga0307516_10347117 | 3300031730 | Bacteria | 1150 |
| 537 | Ga0307405_10002583 | 3300031731 | Bacteria | 8033 |
| 538 | Ga0307413_10606873 | 3300031824 | Bacteria | 896 |
| 539 | Ga0307518_10061365 | 3300031838 | Bacteria | 2730 |
| 540 | Ga0307410_10034667 | 3300031852 | Bacteria | 3271 |
| 541 | Ga0307407_10189634 | 3300031903 | Bacteria | 1369 |
| 542 | Ga0307412_10001564 | 3300031911 | Bacteria | 12595 |
| 543 | Ga0307412_10482582 | 3300031911 | Bacteria | 1028 |
| 544 | Ga0307409_100215767 | 3300031995 | Bacteria | 1728 |
| 545 | Ga0307416_100343687 | 3300032002 | Bacteria | 1506 |
| 546 | Ga0307414_10040943 | 3300032004 | Bacteria | 3133 |
| 547 | Ga0307411_10002722 | 3300032005 | Bacteria | 7930 |
| 548 | Ga0307411_10055879 | 3300032005 | Bacteria | 2599 |
| 549 | Ga0307411_10385444 | 3300032005 | Bacteria | 1154 |
| 550 | Ga0307415_100173641 | 3300032126 | Bacteria | 1683 |
| 551 | Ga0307507_10064419 | 3300033179 | Bacteria | 3383 |
| 552 | Ga0307507_10084296 | 3300033179 | Bacteria | 2771 |
| 553 | Ga0307510_10018239 | 3300033180 | Bacteria | 8262 |
| 554 | Ga0307510_10038889 | 3300033180 | Bacteria | 5251 |
| 555 | Ga0307510_10043177 | 3300033180 | Bacteria | 4903 |
| 556 | Ga0307510_10054969 | 3300033180 | Bacteria | 4162 |
| 557 | Ga0373940_0060066 | 3300035088 | Bacteria | 1086 |
| 558 | Ga0373953_0021688 | 3300035117 | Bacteria | 2414 |
| 559 | Ga0373946_0079609 | 3300035171 | Bacteria | 1432 |
| 560 | Ga0373931_0003906 | 3300035691 | Bacteria | 6739 |
| 561 | Ga0373931_0004827 | 3300035691 | Bacteria | 6191 |
| 562 | Ga0373931_0462038 | 3300035691 | Bacteria | 813 |
| 563 | Ga0373937_0018749 | 3300036401 | Bacteria | 6185 |
| 564 | Ga0373937_0058153 | 3300036401 | Bacteria | 3552 |
| 565 | Ga0373937_0329761 | 3300036401 | Bacteria | 1444 |
| 566 | Ga0373937_0536810 | 3300036401 | Bacteria | 1111 |
| 567 | Ga0395905_0063276 | 3300037471 | Bacteria | 3461 |
| 568 | Ga0436365_0359116 | 3300039437 | Bacteria | 4582 |
| 569 | Ga0436361_0493106 | 3300039447 | Bacteria | 1951 |
| 570 | Ga0436363_0700246 | 3300039450 | Bacteria | 3126 |
| 571 | Ga0451795_0627575 | 3300041456 | Bacteria | 1362 |
| 572 | Ga0451802_1369130 | 3300041460 | Bacteria | 1133 |
| 573 | Ga0450918_000126 | 3300042531 | Bacteria | 16451 |
| 574 | Ga0466969_0022247 | 3300044656 | Bacteria | 3273 |
| 575 | Ga0466961_0061111 | 3300044693 | Bacteria | 2394 |
| 576 | Ga0453684_0226562 | 3300044712 | Bacteria | 2161 |
| 577 | Ga0466971_0043006 | 3300044719 | Bacteria | 2030 |
| 578 | Ga0466970_0153506 | 3300044765 | Bacteria | 1272 |
| 579 | Ga0466957_0044543 | 3300044842 | Bacteria | 2689 |
| 580 | Ga0466960_0074485 | 3300044901 | Bacteria | 1696 |
| 581 | Ga0451576_0213295 | 3300045051 | Bacteria | 2016 |
| 582 | Ga0451576_0463418 | 3300045051 | Bacteria | 1331 |
| 583 | Ga0495592_0038461 | 3300046454 | Bacteria | 3600 |
| 584 | Ga0495590_0001361 | 3300046457 | Bacteria | 10613 |
| 585 | Ga0495638_0045454 | 3300046460 | Bacteria | 2762 |
| 586 | Ga0495641_0133279 | 3300046461 | Bacteria | 1109 |
| 587 | Ga0495582_0193012 | 3300046473 | Bacteria | 1162 |
| 588 | Ga0495606_0168850 | 3300046507 | Bacteria | 1271 |
| 589 | Ga0495606_0324451 | 3300046507 | Bacteria | 826 |
| 590 | Ga0495610_0040317 | 3300046512 | Bacteria | 2355 |
| 591 | Ga0495620_0038992 | 3300046515 | Bacteria | 2104 |
| 592 | Ga0495632_0052575 | 3300046519 | Bacteria | 2002 |
| 593 | Ga0495632_0061943 | 3300046519 | Bacteria | 1814 |
| 594 | Ga0495632_0120333 | 3300046519 | Bacteria | 1227 |
| 595 | Ga0495643_0028131 | 3300046522 | Bacteria | 3155 |
| 596 | Ga0495648_0059864 | 3300046524 | Bacteria | 2269 |
| 597 | Ga0495666_0009201 | 3300046526 | Bacteria | 4939 |
| 598 | Ga0495609_0113743 | 3300046538 | Bacteria | 1167 |
| 599 | Ga0495621_0050964 | 3300046539 | Bacteria | 1480 |
| 600 | Ga0495621_0084366 | 3300046539 | Bacteria | 1189 |
| 601 | Ga0495621_0097672 | 3300046539 | Bacteria | 1114 |
| 602 | Ga0495597_0017952 | 3300046542 | Bacteria | 3323 |
| 603 | Ga0495597_0064827 | 3300046542 | Bacteria | 1586 |
| 604 | Ga0495645_0096454 | 3300046543 | Bacteria | 2107 |
| 605 | Ga0495668_0093447 | 3300046616 | Bacteria | 1647 |
| 606 | Ga0495625_0002419 | 3300046660 | Bacteria | 20222 |
| 607 | Ga0495625_0018284 | 3300046660 | Bacteria | 5475 |
| 608 | Ga0495635_0133585 | 3300046663 | Bacteria | 1692 |
| 609 | Ga0495657_0380110 | 3300046675 | Bacteria | 833 |
| 610 | Ga0495647_0178235 | 3300046681 | Bacteria | 923 |
| 611 | Ga0495658_0004477 | 3300046683 | Bacteria | 6874 |
| 612 | Ga0495658_0197604 | 3300046683 | Bacteria | 1252 |
| 613 | Ga0495658_0199547 | 3300046683 | Bacteria | 1246 |
| 614 | Ga0495658_0212033 | 3300046683 | Bacteria | 1210 |
| 615 | Ga0495613_0097650 | 3300046689 | Bacteria | 2123 |
| 616 | Ga0495624_0022385 | 3300046690 | Bacteria | 4177 |
| 617 | Ga0495649_0004222 | 3300046694 | Bacteria | 9424 |
| 618 | Ga0495660_0070270 | 3300046810 | Bacteria | 1859 |
| 619 | Ga0495674_0298307 | 3300047319 | Bacteria | 1317 |
| 620 | Ga0495676_0097621 | 3300047321 | Bacteria | 2182 |
| 621 | Ga0495687_000761 | 3300047443 | Bacteria | 34838 |
| 622 | Ga0495687_003669 | 3300047443 | Bacteria | 10931 |
| 623 | Ga0495687_010060 | 3300047443 | Bacteria | 5219 |
| 624 | Ga0495687_026673 | 3300047443 | Bacteria | 2715 |
| 625 | Ga0495675_0181189 | 3300047444 | Bacteria | 1290 |
| 626 | Ga0495677_0100876 | 3300047445 | Bacteria | 1093 |
| 627 | Ga0495686_0003001 | 3300047472 | Bacteria | 14998 |
| 628 | Ga0495593_0027579 | 3300047673 | Bacteria | 3125 |
| 629 | Ga0495602_0235640 | 3300048088 | Bacteria | 1372 |
| 630 | Ga0496100_0663588 | 3300048903 | Bacteria | 812 |
| 631 | Ga0496101_0184606 | 3300048904 | Bacteria | 1607 |
| 632 | Ga0496101_0243385 | 3300048904 | Bacteria | 1400 |
| 633 | Ga0496102_0006650 | 3300048905 | Bacteria | 9882 |
| 634 | Ga0496104_0050692 | 3300048907 | Bacteria | 3917 |
| 635 | Ga0496104_0235830 | 3300048907 | Bacteria | 1741 |
| 636 | Ga0496105_0156926 | 3300048908 | Bacteria | 1869 |
| 637 | Ga0496106_0007661 | 3300048909 | Bacteria | 7986 |
| 638 | Ga0496106_0197714 | 3300048909 | Bacteria | 1600 |
| 639 | Ga0496106_0273000 | 3300048909 | Bacteria | 1354 |
| 640 | Ga0496107_0105164 | 3300048910 | Bacteria | 2072 |
| 641 | Ga0496108_0056965 | 3300048911 | Bacteria | 3284 |
| 642 | Ga0496108_0130532 | 3300048911 | Bacteria | 2160 |
| 643 | Ga0496109_0118533 | 3300048912 | Bacteria | 2464 |
| 644 | Ga0496110_0034706 | 3300048913 | Bacteria | 4372 |
| 645 | Ga0496111_0257705 | 3300048914 | Bacteria | 1294 |
| 646 | Ga0496112_0206036 | 3300048915 | Bacteria | 1925 |
| 647 | Ga0496113_0498914 | 3300048916 | Bacteria | 977 |
| 648 | Ga0496114_0119780 | 3300048917 | Bacteria | 2263 |
| 649 | Ga0496115_0094142 | 3300048918 | Bacteria | 2451 |
| 650 | Ga0496121_0029040 | 3300048924 | Bacteria | 5128 |
| 651 | Ga0501298_029343 | 3300049521 | Bacteria | 1072 |
| 652 | Ga0501042_0154730 | 3300049578 | Bacteria | 1654 |
| 653 | Ga0501043_0005821 | 3300049579 | Bacteria | 9914 |
| 654 | Ga0501046_0007722 | 3300049580 | Bacteria | 9430 |
| 655 | Ga0501047_0008175 | 3300049581 | Bacteria | 9880 |
| 656 | Ga0501048_0005642 | 3300049582 | Bacteria | 9519 |
| 657 | Ga0501044_0412661 | 3300049823 | Bacteria | 1261 |
| 658 | Ga0501045_0004845 | 3300049824 | Bacteria | 9310 |
| 659 | nmdc:mga03683_19828_c1 | 3300050489 | Bacteria | 2572 |
| 660 | nmdc:mga03683_8328_c1 | 3300050489 | Bacteria | 3641 |
| 661 | nmdc:mga0yw44_20132_c1 | 3300050492 | Bacteria | 3697 |
| 662 | nmdc:mga0k408_100661_c1 | 3300050493 | Bacteria | 1704 |
| 663 | nmdc:mga0k408_100737_c2 | 3300050493 | Bacteria | 1001 |
| 664 | nmdc:mga0k408_119654_c1 | 3300050493 | Bacteria | 1559 |
| 665 | nmdc:mga0k408_17713_c1 | 3300050493 | Bacteria | 2978 |
| 666 | nmdc:mga0k408_2426_c1 | 3300050493 | Bacteria | 9910 |
| 667 | nmdc:mga0k408_295893_c1 | 3300050493 | Bacteria | 966 |
| 668 | nmdc:mga0k408_3909_c1 | 3300050493 | Bacteria | 7898 |
| 669 | nmdc:mga0k408_4594_c1 | 3300050493 | Bacteria | 7324 |
| 670 | nmdc:mga0k408_65134_c1 | 3300050493 | Bacteria | 2121 |
| 671 | nmdc:mga0k408_6858_c1 | 3300050493 | Bacteria | 6075 |
| 672 | nmdc:mga0k408_68982_c1 | 3300050493 | Bacteria | 2063 |
| 673 | nmdc:mga0k408_93143_c1 | 3300050493 | Bacteria | 1772 |
| 674 | nmdc:mga06z11_16131_c1 | 3300050494 | Bacteria | 3356 |
| 675 | nmdc:mga06z11_18417_c1 | 3300050494 | Bacteria | 3189 |
| 676 | nmdc:mga06z11_20069_c1 | 3300050494 | Bacteria | 3084 |
| 677 | nmdc:mga06z11_38707_c1 | 3300050494 | Bacteria | 2369 |
| 678 | nmdc:mga04h51_93877_c1 | 3300050495 | Bacteria | 1084 |
| 679 | nmdc:mga07m45_103442_c1 | 3300050496 | Bacteria | 1637 |
| 680 | nmdc:mga07m45_1192_c1 | 3300050496 | Bacteria | 11727 |
| 681 | nmdc:mga07m45_13851_c1 | 3300050496 | Bacteria | 4285 |
| 682 | nmdc:mga07m45_26288_c1 | 3300050496 | Bacteria | 3199 |
| 683 | nmdc:mga07m45_31891_c1 | 3300050496 | Bacteria | 2921 |
| 684 | nmdc:mga07m45_7812_c1 | 3300050496 | Bacteria | 5473 |
| 685 | nmdc:mga07m45_90112_c1 | 3300050496 | Bacteria | 1757 |
| 686 | nmdc:mga0n895_146326_c1 | 3300050512 | Bacteria | 2392 |
| 687 | nmdc:mga0rr50_143765_c1 | 3300050513 | Bacteria | 1921 |
| 688 | nmdc:mga0sz30_1958_c1 | 3300050516 | Bacteria | 7364 |
| 689 | nmdc:mga0sz30_20041_c1 | 3300050516 | Bacteria | 2452 |
| 690 | nmdc:mga0sz30_78691_c1 | 3300050516 | Bacteria | 1425 |
| 691 | Ga0495601_0010509 | 3300053077 | Bacteria | 5512 |
| 692 | Ga0500578_0000549 | 3300053086 | Bacteria | 45594 |
| 693 | Ga0500578_0041292 | 3300053086 | Bacteria | 2963 |
| 694 | Ga0500644_0008317 | 3300053088 | Bacteria | 2736 |
| 695 | Ga0500651_0037943 | 3300053093 | Bacteria | 3036 |
| 696 | Ga0500651_0178242 | 3300053093 | Bacteria | 1263 |
| 697 | Ga0500651_0180826 | 3300053093 | Bacteria | 1252 |
| 698 | Ga0500594_0053420 | 3300053118 | Bacteria | 1144 |
| 699 | Ga0500621_042430 | 3300053126 | Bacteria | 1837 |
| 700 | Ga0500642_0073538 | 3300053130 | Bacteria | 1558 |
| 701 | Ga0500652_001324 | 3300053131 | Bacteria | 7788 |
| 702 | Ga0500655_011390 | 3300053133 | Bacteria | 1611 |
| 703 | Ga0500658_0095036 | 3300053134 | Bacteria | 1294 |
| 704 | Ga0500559_0000116 | 3300053136 | Bacteria | 63080 |
| 705 | Ga0500577_0031584 | 3300053142 | Bacteria | 1854 |
| 706 | Ga0500590_013660 | 3300053148 | Bacteria | 4171 |
| 707 | Ga0500616_0139944 | 3300053153 | Bacteria | 1133 |
| 708 | Ga0500619_002889 | 3300053154 | Bacteria | 3405 |
| 709 | Ga0500622_0000146 | 3300053156 | Bacteria | 74615 |
| 710 | Ga0500622_0005791 | 3300053156 | Bacteria | 7328 |
| 711 | Ga0500622_0052347 | 3300053156 | Bacteria | 2099 |
| 712 | Ga0500570_088615 | 3300053724 | Bacteria | 1358 |
| 713 | Ga0500584_134309 | 3300053726 | Bacteria | 956 |
| 714 | Ga0500645_006914 | 3300053730 | Bacteria | 4003 |
| 715 | Ga0500587_006386 | 3300053739 | Bacteria | 1562 |
| 716 | Ga0500587_008574 | 3300053739 | Bacteria | 1314 |
| 717 | Ga0466962_0103830 | 3300061719 | Bacteria | 1365 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300035691 | Ga0373931_0462038 | Ga0373931_0462038_44_688 | 205 |
| 2 | 3300048915 | Ga0496112_0206036 | Ga0496112_0206036_707_1465 | 231 |
| 3 | 3300048916 | Ga0496113_0498914 | Ga0496113_0498914_166_936 | 231 |
| 4 | 3300028794 | Ga0307515_10093328 | Ga0307515_100933282 | 234 |
| 5 | 3300033180 | Ga0307510_10054969 | Ga0307510_100549694 | 239 |
| 6 | 3300048907 | Ga0496104_0050692 | Ga0496104_0050692_377_1099 | 240 |
| 7 | 3300048909 | Ga0496106_0273000 | Ga0496106_0273000_97_819 | 240 |
| 8 | 3300005367 | Ga0070667_100623018 | Ga0070667_1006230181 | 245 |
| 9 | iso_pu_bacteria | 2643221644 | 2644244594 | 245 |
| 10 | 3300005459 | Ga0068867_100000054 | Ga0068867_10000005422 | 246 |
| 11 | 3300005616 | Ga0068852_100011556 | Ga0068852_1000115563 | 246 |
| 12 | 3300005616 | Ga0068852_100749468 | Ga0068852_1007494682 | 246 |
| 13 | 3300006353 | Ga0075370_10021997 | Ga0075370_100219973 | 246 |
| 14 | 3300009148 | Ga0105243_10004681 | Ga0105243_100046812 | 246 |
| 15 | 3300014745 | Ga0157377_10000006 | Ga0157377_10000006354 | 246 |
| 16 | 3300025935 | Ga0207709_10007856 | Ga0207709_100078566 | 246 |
| 17 | 3300026089 | Ga0207648_10000254 | Ga0207648_100002542 | 246 |
| 18 | 3300026142 | Ga0207698_10012242 | Ga0207698_100122424 | 246 |
| 19 | 3300030522 | Ga0307512_10172472 | Ga0307512_101724722 | 246 |
| 20 | 3300044765 | Ga0466970_0153506 | Ga0466970_0153506_307_1089 | 246 |
| 21 | 3300044901 | Ga0466960_0074485 | Ga0466960_0074485_348_1154 | 246 |
| 22 | 3300048910 | Ga0496107_0105164 | Ga0496107_0105164_1067_1807 | 246 |
| 23 | 3300048913 | Ga0496110_0034706 | Ga0496110_0034706_2118_2858 | 246 |
| 24 | 3300050496 | nmdc:mga07m45_13851_c1 | nmdc:mga07m45_13851_c1_428_1180 | 246 |
| 25 | iso_pu_bacteria | 2585428057 | 2587725871 | 246 |
| 26 | iso_pu_bacteria | 2585428058 | 2587736162 | 246 |
| 27 | iso_pu_bacteria | 2588253510 | 2588292918 | 246 |
| 28 | iso_pu_bacteria | 2643221592 | 2643968025 | 246 |
| 29 | iso_pu_bacteria | 2643221625 | 2644143051 | 246 |
| 30 | iso_pu_bacteria | 2643221648 | 2644271861 | 246 |
| 31 | 3300005338 | Ga0068868_100261141 | Ga0068868_1002611412 | 247 |
| 32 | 3300005354 | Ga0070675_100314782 | Ga0070675_1003147822 | 247 |
| 33 | 3300005355 | Ga0070671_100145202 | Ga0070671_1001452022 | 247 |
| 34 | 3300005367 | Ga0070667_100009011 | Ga0070667_1000090116 | 247 |
| 35 | 3300005457 | Ga0070662_100583782 | Ga0070662_1005837821 | 247 |
| 36 | 3300005548 | Ga0070665_100038031 | Ga0070665_1000380313 | 247 |
| 37 | 3300005548 | Ga0070665_100438923 | Ga0070665_1004389232 | 247 |
| 38 | 3300005548 | Ga0070665_100582737 | Ga0070665_1005827372 | 247 |
| 39 | 3300005617 | Ga0068859_100656874 | Ga0068859_1006568742 | 247 |
| 40 | 3300005841 | Ga0068863_100015545 | Ga0068863_1000155451 | 247 |
| 41 | 3300006195 | Ga0075366_10317915 | Ga0075366_103179151 | 247 |
| 42 | 3300006931 | Ga0097620_100656825 | Ga0097620_1006568252 | 247 |
| 43 | 3300009098 | Ga0105245_10122546 | Ga0105245_101225462 | 247 |
| 44 | 3300009098 | Ga0105245_10395783 | Ga0105245_103957832 | 247 |
| 45 | 3300009545 | Ga0105237_10633006 | Ga0105237_106330061 | 247 |
| 46 | 3300013296 | Ga0157374_10409525 | Ga0157374_104095252 | 247 |
| 47 | 3300013306 | Ga0163162_10849289 | Ga0163162_108492891 | 247 |
| 48 | 3300013308 | Ga0157375_10161085 | Ga0157375_101610852 | 247 |
| 49 | 3300014325 | Ga0163163_10553258 | Ga0163163_105532582 | 247 |
| 50 | 3300014968 | Ga0157379_10300247 | Ga0157379_103002472 | 247 |
| 51 | 3300025900 | Ga0207710_10130760 | Ga0207710_101307602 | 247 |
| 52 | 3300025927 | Ga0207687_10328336 | Ga0207687_103283362 | 247 |
| 53 | 3300025941 | Ga0207711_10444042 | Ga0207711_104440422 | 247 |
| 54 | 3300025986 | Ga0207658_10005878 | Ga0207658_100058786 | 247 |
| 55 | 3300026023 | Ga0207677_10153693 | Ga0207677_101536932 | 247 |
| 56 | 3300028379 | Ga0268266_10313015 | Ga0268266_103130152 | 247 |
| 57 | 3300028379 | Ga0268266_10340147 | Ga0268266_103401472 | 247 |
| 58 | 3300028794 | Ga0307515_10007802 | Ga0307515_100078027 | 247 |
| 59 | 3300030522 | Ga0307512_10076911 | Ga0307512_100769113 | 247 |
| 60 | 3300031649 | Ga0307514_10027344 | Ga0307514_100273445 | 247 |
| 61 | 3300031649 | Ga0307514_10095565 | Ga0307514_100955652 | 247 |
| 62 | 3300031730 | Ga0307516_10127244 | Ga0307516_101272442 | 247 |
| 63 | 3300039447 | Ga0436361_0493106 | Ga0436361_0493106_746_1489 | 247 |
| 64 | 3300046461 | Ga0495641_0133279 | Ga0495641_0133279_186_941 | 247 |
| 65 | 3300046616 | Ga0495668_0093447 | Ga0495668_0093447_497_1249 | 247 |
| 66 | 3300046690 | Ga0495624_0022385 | Ga0495624_0022385_924_1694 | 247 |
| 67 | 3300047321 | Ga0495676_0097621 | Ga0495676_0097621_289_1059 | 247 |
| 68 | 3300047444 | Ga0495675_0181189 | Ga0495675_0181189_208_981 | 247 |
| 69 | 3300047673 | Ga0495593_0027579 | Ga0495593_0027579_856_1626 | 247 |
| 70 | 3300048088 | Ga0495602_0235640 | Ga0495602_0235640_396_1169 | 247 |
| 71 | iso_pu_bacteria | 2585428062 | 2587754294 | 247 |
| 72 | iso_pu_bacteria | 2643221654 | 2644303548 | 247 |
| 73 | 3300005330 | Ga0070690_100251716 | Ga0070690_1002517162 | 248 |
| 74 | 3300005331 | Ga0070670_100091187 | Ga0070670_1000911873 | 248 |
| 75 | 3300005334 | Ga0068869_100630889 | Ga0068869_1006308891 | 248 |
| 76 | 3300005355 | Ga0070671_100000628 | Ga0070671_1000006284 | 248 |
| 77 | 3300005539 | Ga0068853_100199965 | Ga0068853_1001999651 | 248 |
| 78 | 3300005543 | Ga0070672_100040316 | Ga0070672_1000403164 | 248 |
| 79 | 3300005616 | Ga0068852_100169633 | Ga0068852_1001696331 | 248 |
| 80 | 3300005617 | Ga0068859_100076039 | Ga0068859_1000760392 | 248 |
| 81 | 3300005842 | Ga0068858_100026038 | Ga0068858_1000260385 | 248 |
| 82 | 3300006195 | Ga0075366_10139123 | Ga0075366_101391232 | 248 |
| 83 | 3300006358 | Ga0068871_100053607 | Ga0068871_1000536072 | 248 |
| 84 | 3300006931 | Ga0097620_100076044 | Ga0097620_1000760442 | 248 |
| 85 | 3300009177 | Ga0105248_10255495 | Ga0105248_102554952 | 248 |
| 86 | 3300009177 | Ga0105248_10541175 | Ga0105248_105411752 | 248 |
| 87 | 3300014326 | Ga0157380_10215482 | Ga0157380_102154822 | 248 |
| 88 | 3300014968 | Ga0157379_10002316 | Ga0157379_1000231612 | 248 |
| 89 | 3300021384 | Ga0213876_10060172 | Ga0213876_100601722 | 248 |
| 90 | 3300025925 | Ga0207650_10093215 | Ga0207650_100932152 | 248 |
| 91 | 3300025931 | Ga0207644_10000236 | Ga0207644_1000023626 | 248 |
| 92 | 3300025940 | Ga0207691_10010845 | Ga0207691_100108453 | 248 |
| 93 | 3300025942 | Ga0207689_10593914 | Ga0207689_105939141 | 248 |
| 94 | 3300025986 | Ga0207658_10245744 | Ga0207658_102457442 | 248 |
| 95 | 3300026035 | Ga0207703_10003292 | Ga0207703_100032928 | 248 |
| 96 | 3300026041 | Ga0207639_10272739 | Ga0207639_102727392 | 248 |
| 97 | 3300028794 | Ga0307515_10002980 | Ga0307515_1000298010 | 248 |
| 98 | 3300031730 | Ga0307516_10004894 | Ga0307516_100048946 | 248 |
| 99 | 3300032005 | Ga0307411_10055879 | Ga0307411_100558793 | 248 |
| 100 | 3300039437 | Ga0436365_0359116 | Ga0436365_0359116_925_1707 | 248 |
| 101 | 3300041456 | Ga0451795_0627575 | Ga0451795_0627575_362_1123 | 248 |
| 102 | 3300045051 | Ga0451576_0463418 | Ga0451576_0463418_338_1087 | 248 |
| 103 | 3300046515 | Ga0495620_0038992 | Ga0495620_0038992_192_953 | 248 |
| 104 | 3300046519 | Ga0495632_0120333 | Ga0495632_0120333_324_1085 | 248 |
| 105 | 3300046522 | Ga0495643_0028131 | Ga0495643_0028131_138_914 | 248 |
| 106 | 3300046660 | Ga0495625_0002419 | Ga0495625_0002419_16731_17507 | 248 |
| 107 | 3300048905 | Ga0496102_0006650 | Ga0496102_0006650_4799_5560 | 248 |
| 108 | 3300049578 | Ga0501042_0154730 | Ga0501042_0154730_18_794 | 248 |
| 109 | 3300049579 | Ga0501043_0005821 | Ga0501043_0005821_1216_1992 | 248 |
| 110 | 3300049580 | Ga0501046_0007722 | Ga0501046_0007722_7572_8348 | 248 |
| 111 | 3300049581 | Ga0501047_0008175 | Ga0501047_0008175_1083_1859 | 248 |
| 112 | 3300049582 | Ga0501048_0005642 | Ga0501048_0005642_1170_1946 | 248 |
| 113 | 3300049823 | Ga0501044_0412661 | Ga0501044_0412661_388_1164 | 248 |
| 114 | 3300049824 | Ga0501045_0004845 | Ga0501045_0004845_890_1666 | 248 |
| 115 | 3300053724 | Ga0500570_088615 | Ga0500570_088615_547_1323 | 248 |
| 116 | iso_pu_bacteria | 2585428062 | 2587757078 | 248 |
| 117 | 3300003215 | JGI25153J46596_10004971 | JGI25153J46596_100049718 | 249 |
| 118 | 3300003323 | rootH1_10004635 | rootH1_1000463514 | 249 |
| 119 | 3300003771 | Ga0055526_1001524 | Ga0055526_10015241 | 249 |
| 120 | 3300005328 | Ga0070676_10056499 | Ga0070676_100564993 | 249 |
| 121 | 3300005328 | Ga0070676_10068675 | Ga0070676_100686753 | 249 |
| 122 | 3300005328 | Ga0070676_10133099 | Ga0070676_101330992 | 249 |
| 123 | 3300005329 | Ga0070683_100135892 | Ga0070683_1001358923 | 249 |
| 124 | 3300005330 | Ga0070690_100009364 | Ga0070690_1000093644 | 249 |
| 125 | 3300005331 | Ga0070670_100091478 | Ga0070670_1000914782 | 249 |
| 126 | 3300005333 | Ga0070677_10013542 | Ga0070677_100135422 | 249 |
| 127 | 3300005333 | Ga0070677_10037192 | Ga0070677_100371922 | 249 |
| 128 | 3300005333 | Ga0070677_10121109 | Ga0070677_101211092 | 249 |
| 129 | 3300005334 | Ga0068869_100027130 | Ga0068869_1000271302 | 249 |
| 130 | 3300005334 | Ga0068869_100077017 | Ga0068869_1000770173 | 249 |
| 131 | 3300005335 | Ga0070666_10133252 | Ga0070666_101332521 | 249 |
| 132 | 3300005336 | Ga0070680_100008447 | Ga0070680_1000084475 | 249 |
| 133 | 3300005338 | Ga0068868_100004842 | Ga0068868_1000048427 | 249 |
| 134 | 3300005338 | Ga0068868_100009130 | Ga0068868_1000091305 | 249 |
| 135 | 3300005338 | Ga0068868_100010695 | Ga0068868_1000106953 | 249 |
| 136 | 3300005338 | Ga0068868_100510933 | Ga0068868_1005109332 | 249 |
| 137 | 3300005339 | Ga0070660_100027643 | Ga0070660_1000276432 | 249 |
| 138 | 3300005339 | Ga0070660_100075481 | Ga0070660_1000754814 | 249 |
| 139 | 3300005344 | Ga0070661_100057990 | Ga0070661_1000579902 | 249 |
| 140 | 3300005344 | Ga0070661_100374109 | Ga0070661_1003741091 | 249 |
| 141 | 3300005347 | Ga0070668_100010749 | Ga0070668_1000107494 | 249 |
| 142 | 3300005353 | Ga0070669_100026311 | Ga0070669_1000263114 | 249 |
| 143 | 3300005353 | Ga0070669_100028366 | Ga0070669_1000283663 | 249 |
| 144 | 3300005353 | Ga0070669_100224028 | Ga0070669_1002240282 | 249 |
| 145 | 3300005354 | Ga0070675_100000249 | Ga0070675_10000024924 | 249 |
| 146 | 3300005354 | Ga0070675_100010591 | Ga0070675_1000105915 | 249 |
| 147 | 3300005354 | Ga0070675_100020503 | Ga0070675_1000205034 | 249 |
| 148 | 3300005354 | Ga0070675_100056889 | Ga0070675_1000568893 | 249 |
| 149 | 3300005355 | Ga0070671_100012361 | Ga0070671_1000123616 | 249 |
| 150 | 3300005355 | Ga0070671_100029117 | Ga0070671_1000291173 | 249 |
| 151 | 3300005355 | Ga0070671_100056122 | Ga0070671_1000561223 | 249 |
| 152 | 3300005355 | Ga0070671_100065378 | Ga0070671_1000653783 | 249 |
| 153 | 3300005356 | Ga0070674_100006826 | Ga0070674_1000068265 | 249 |
| 154 | 3300005356 | Ga0070674_100034985 | Ga0070674_1000349853 | 249 |
| 155 | 3300005356 | Ga0070674_100063730 | Ga0070674_1000637302 | 249 |
| 156 | 3300005356 | Ga0070674_100354621 | Ga0070674_1003546211 | 249 |
| 157 | 3300005364 | Ga0070673_100002947 | Ga0070673_10000294711 | 249 |
| 158 | 3300005364 | Ga0070673_100022385 | Ga0070673_1000223854 | 249 |
| 159 | 3300005364 | Ga0070673_100028531 | Ga0070673_1000285314 | 249 |
| 160 | 3300005365 | Ga0070688_100062634 | Ga0070688_1000626343 | 249 |
| 161 | 3300005366 | Ga0070659_100019462 | Ga0070659_1000194627 | 249 |
| 162 | 3300005367 | Ga0070667_100051335 | Ga0070667_1000513352 | 249 |
| 163 | 3300005456 | Ga0070678_100012118 | Ga0070678_1000121183 | 249 |
| 164 | 3300005456 | Ga0070678_100039515 | Ga0070678_1000395154 | 249 |
| 165 | 3300005456 | Ga0070678_100083966 | Ga0070678_1000839662 | 249 |
| 166 | 3300005457 | Ga0070662_100175827 | Ga0070662_1001758271 | 249 |
| 167 | 3300005458 | Ga0070681_10643798 | Ga0070681_106437981 | 249 |
| 168 | 3300005459 | Ga0068867_100017469 | Ga0068867_1000174695 | 249 |
| 169 | 3300005459 | Ga0068867_100061634 | Ga0068867_1000616342 | 249 |
| 170 | 3300005459 | Ga0068867_100139198 | Ga0068867_1001391982 | 249 |
| 171 | 3300005459 | Ga0068867_100175340 | Ga0068867_1001753402 | 249 |
| 172 | 3300005459 | Ga0068867_100247824 | Ga0068867_1002478242 | 249 |
| 173 | 3300005530 | Ga0070679_100006933 | Ga0070679_10000693311 | 249 |
| 174 | 3300005535 | Ga0070684_100256631 | Ga0070684_1002566311 | 249 |
| 175 | 3300005539 | Ga0068853_100213524 | Ga0068853_1002135242 | 249 |
| 176 | 3300005543 | Ga0070672_100002237 | Ga0070672_1000022375 | 249 |
| 177 | 3300005543 | Ga0070672_100003401 | Ga0070672_10000340113 | 249 |
| 178 | 3300005543 | Ga0070672_100011963 | Ga0070672_1000119634 | 249 |
| 179 | 3300005543 | Ga0070672_100023520 | Ga0070672_1000235205 | 249 |
| 180 | 3300005543 | Ga0070672_100302128 | Ga0070672_1003021282 | 249 |
| 181 | 3300005547 | Ga0070693_100061204 | Ga0070693_1000612042 | 249 |
| 182 | 3300005548 | Ga0070665_100634276 | Ga0070665_1006342762 | 249 |
| 183 | 3300005563 | Ga0068855_100161204 | Ga0068855_1001612044 | 249 |
| 184 | 3300005564 | Ga0070664_100002952 | Ga0070664_1000029529 | 249 |
| 185 | 3300005564 | Ga0070664_100645611 | Ga0070664_1006456112 | 249 |
| 186 | 3300005577 | Ga0068857_100271455 | Ga0068857_1002714552 | 249 |
| 187 | 3300005578 | Ga0068854_100108970 | Ga0068854_1001089702 | 249 |
| 188 | 3300005578 | Ga0068854_100477116 | Ga0068854_1004771162 | 249 |
| 189 | 3300005614 | Ga0068856_100142022 | Ga0068856_1001420223 | 249 |
| 190 | 3300005614 | Ga0068856_100303839 | Ga0068856_1003038392 | 249 |
| 191 | 3300005616 | Ga0068852_100227482 | Ga0068852_1002274822 | 249 |
| 192 | 3300005616 | Ga0068852_100416451 | Ga0068852_1004164512 | 249 |
| 193 | 3300005616 | Ga0068852_100526912 | Ga0068852_1005269122 | 249 |
| 194 | 3300005617 | Ga0068859_100010521 | Ga0068859_1000105213 | 249 |
| 195 | 3300005618 | Ga0068864_100001865 | Ga0068864_10000186515 | 249 |
| 196 | 3300005618 | Ga0068864_100003674 | Ga0068864_1000036747 | 249 |
| 197 | 3300005618 | Ga0068864_100014639 | Ga0068864_1000146392 | 249 |
| 198 | 3300005618 | Ga0068864_100103122 | Ga0068864_1001031224 | 249 |
| 199 | 3300005618 | Ga0068864_100277743 | Ga0068864_1002777432 | 249 |
| 200 | 3300005718 | Ga0068866_10078229 | Ga0068866_100782292 | 249 |
| 201 | 3300005719 | Ga0068861_100044597 | Ga0068861_1000445974 | 249 |
| 202 | 3300005719 | Ga0068861_100048758 | Ga0068861_1000487584 | 249 |
| 203 | 3300005834 | Ga0068851_10033053 | Ga0068851_100330532 | 249 |
| 204 | 3300005834 | Ga0068851_10033318 | Ga0068851_100333182 | 249 |
| 205 | 3300005834 | Ga0068851_10033722 | Ga0068851_100337223 | 249 |
| 206 | 3300005834 | Ga0068851_10125101 | Ga0068851_101251012 | 249 |
| 207 | 3300005840 | Ga0068870_10088594 | Ga0068870_100885942 | 249 |
| 208 | 3300005841 | Ga0068863_100002188 | Ga0068863_1000021889 | 249 |
| 209 | 3300005841 | Ga0068863_100152686 | Ga0068863_1001526862 | 249 |
| 210 | 3300005842 | Ga0068858_100006780 | Ga0068858_1000067805 | 249 |
| 211 | 3300005842 | Ga0068858_100106510 | Ga0068858_1001065103 | 249 |
| 212 | 3300005843 | Ga0068860_100124430 | Ga0068860_1001244303 | 249 |
| 213 | 3300005843 | Ga0068860_100365033 | Ga0068860_1003650332 | 249 |
| 214 | 3300005844 | Ga0068862_100066838 | Ga0068862_1000668381 | 249 |
| 215 | 3300006048 | Ga0075363_100038490 | Ga0075363_1000384903 | 249 |
| 216 | 3300006177 | Ga0075362_10004366 | Ga0075362_100043663 | 249 |
| 217 | 3300006178 | Ga0075367_10038321 | Ga0075367_100383213 | 249 |
| 218 | 3300006186 | Ga0075369_10048661 | Ga0075369_100486612 | 249 |
| 219 | 3300006195 | Ga0075366_10035028 | Ga0075366_100350282 | 249 |
| 220 | 3300006237 | Ga0097621_100025701 | Ga0097621_1000257014 | 249 |
| 221 | 3300006237 | Ga0097621_100049541 | Ga0097621_1000495413 | 249 |
| 222 | 3300006237 | Ga0097621_100199701 | Ga0097621_1001997012 | 249 |
| 223 | 3300006237 | Ga0097621_100286768 | Ga0097621_1002867682 | 249 |
| 224 | 3300006237 | Ga0097621_100595616 | Ga0097621_1005956162 | 249 |
| 225 | 3300006353 | Ga0075370_10017191 | Ga0075370_100171912 | 249 |
| 226 | 3300006353 | Ga0075370_10058506 | Ga0075370_100585062 | 249 |
| 227 | 3300006353 | Ga0075370_10200673 | Ga0075370_102006732 | 249 |
| 228 | 3300006358 | Ga0068871_100016932 | Ga0068871_1000169326 | 249 |
| 229 | 3300006358 | Ga0068871_100092690 | Ga0068871_1000926903 | 249 |
| 230 | 3300006358 | Ga0068871_100166655 | Ga0068871_1001666553 | 249 |
| 231 | 3300006358 | Ga0068871_100505753 | Ga0068871_1005057532 | 249 |
| 232 | 3300006358 | Ga0068871_100656889 | Ga0068871_1006568891 | 249 |
| 233 | 3300006871 | Ga0075434_100085072 | Ga0075434_1000850722 | 249 |
| 234 | 3300006931 | Ga0097620_100010521 | Ga0097620_1000105217 | 249 |
| 235 | 3300009093 | Ga0105240_10349065 | Ga0105240_103490652 | 249 |
| 236 | 3300009094 | Ga0111539_10619043 | Ga0111539_106190432 | 249 |
| 237 | 3300009098 | Ga0105245_10012609 | Ga0105245_100126092 | 249 |
| 238 | 3300009098 | Ga0105245_10247549 | Ga0105245_102475492 | 249 |
| 239 | 3300009098 | Ga0105245_10654783 | Ga0105245_106547832 | 249 |
| 240 | 3300009148 | Ga0105243_10028668 | Ga0105243_100286683 | 249 |
| 241 | 3300009176 | Ga0105242_10528934 | Ga0105242_105289341 | 249 |
| 242 | 3300009177 | Ga0105248_10013962 | Ga0105248_100139626 | 249 |
| 243 | 3300009177 | Ga0105248_10162648 | Ga0105248_101626482 | 249 |
| 244 | 3300009545 | Ga0105237_10195060 | Ga0105237_101950602 | 249 |
| 245 | 3300009545 | Ga0105237_10204649 | Ga0105237_102046492 | 249 |
| 246 | 3300009551 | Ga0105238_10414647 | Ga0105238_104146472 | 249 |
| 247 | 3300009551 | Ga0105238_10456281 | Ga0105238_104562812 | 249 |
| 248 | 3300009553 | Ga0105249_10082666 | Ga0105249_100826663 | 249 |
| 249 | 3300010375 | Ga0105239_10058034 | Ga0105239_100580344 | 249 |
| 250 | 3300013100 | Ga0157373_10084121 | Ga0157373_100841212 | 249 |
| 251 | 3300013105 | Ga0157369_10267110 | Ga0157369_102671102 | 249 |
| 252 | 3300013296 | Ga0157374_10014591 | Ga0157374_100145915 | 249 |
| 253 | 3300013296 | Ga0157374_10221924 | Ga0157374_102219242 | 249 |
| 254 | 3300013296 | Ga0157374_10300457 | Ga0157374_103004571 | 249 |
| 255 | 3300013297 | Ga0157378_10546239 | Ga0157378_105462391 | 249 |
| 256 | 3300013306 | Ga0163162_10001899 | Ga0163162_100018994 | 249 |
| 257 | 3300013306 | Ga0163162_10039484 | Ga0163162_100394844 | 249 |
| 258 | 3300013306 | Ga0163162_10202405 | Ga0163162_102024052 | 249 |
| 259 | 3300013306 | Ga0163162_10578962 | Ga0163162_105789622 | 249 |
| 260 | 3300013306 | Ga0163162_10819503 | Ga0163162_108195032 | 249 |
| 261 | 3300013307 | Ga0157372_10013839 | Ga0157372_1001383911 | 249 |
| 262 | 3300013307 | Ga0157372_10277966 | Ga0157372_102779663 | 249 |
| 263 | 3300013308 | Ga0157375_10007962 | Ga0157375_100079627 | 249 |
| 264 | 3300013308 | Ga0157375_10120373 | Ga0157375_101203734 | 249 |
| 265 | 3300013308 | Ga0157375_10205825 | Ga0157375_102058253 | 249 |
| 266 | 3300013308 | Ga0157375_10507543 | Ga0157375_105075432 | 249 |
| 267 | 3300014325 | Ga0163163_10005652 | Ga0163163_100056525 | 249 |
| 268 | 3300014326 | Ga0157380_10015912 | Ga0157380_100159124 | 249 |
| 269 | 3300014745 | Ga0157377_10052154 | Ga0157377_100521543 | 249 |
| 270 | 3300014745 | Ga0157377_10188544 | Ga0157377_101885441 | 249 |
| 271 | 3300014968 | Ga0157379_10001468 | Ga0157379_1000146814 | 249 |
| 272 | 3300014968 | Ga0157379_10072598 | Ga0157379_100725982 | 249 |
| 273 | 3300014969 | Ga0157376_10063532 | Ga0157376_100635322 | 249 |
| 274 | 3300014969 | Ga0157376_10075227 | Ga0157376_100752273 | 249 |
| 275 | 3300017792 | Ga0163161_10031949 | Ga0163161_100319493 | 249 |
| 276 | 3300017792 | Ga0163161_10348979 | Ga0163161_103489792 | 249 |
| 277 | 3300025245 | Ga0207425_1000302 | Ga0207425_100030214 | 249 |
| 278 | 3300025258 | Ga0209129_1000158 | Ga0209129_100015894 | 249 |
| 279 | 3300025273 | Ga0209673_1033276 | Ga0209673_10332762 | 249 |
| 280 | 3300025295 | Ga0209564_1000282 | Ga0209564_100028294 | 249 |
| 281 | 3300025297 | Ga0209758_1000630 | Ga0209758_100063040 | 249 |
| 282 | 3300025315 | Ga0207697_10016870 | Ga0207697_100168702 | 249 |
| 283 | 3300025321 | Ga0207656_10022904 | Ga0207656_100229043 | 249 |
| 284 | 3300025893 | Ga0207682_10042590 | Ga0207682_100425902 | 249 |
| 285 | 3300025899 | Ga0207642_10046230 | Ga0207642_100462302 | 249 |
| 286 | 3300025901 | Ga0207688_10060401 | Ga0207688_100604012 | 249 |
| 287 | 3300025903 | Ga0207680_10025936 | Ga0207680_100259363 | 249 |
| 288 | 3300025903 | Ga0207680_10256189 | Ga0207680_102561892 | 249 |
| 289 | 3300025907 | Ga0207645_10046365 | Ga0207645_100463653 | 249 |
| 290 | 3300025907 | Ga0207645_10049550 | Ga0207645_100495504 | 249 |
| 291 | 3300025907 | Ga0207645_10128492 | Ga0207645_101284922 | 249 |
| 292 | 3300025908 | Ga0207643_10022089 | Ga0207643_100220894 | 249 |
| 293 | 3300025909 | Ga0207705_10234014 | Ga0207705_102340142 | 249 |
| 294 | 3300025911 | Ga0207654_10237821 | Ga0207654_102378212 | 249 |
| 295 | 3300025912 | Ga0207707_10524278 | Ga0207707_105242782 | 249 |
| 296 | 3300025913 | Ga0207695_10201497 | Ga0207695_102014973 | 249 |
| 297 | 3300025914 | Ga0207671_10093340 | Ga0207671_100933402 | 249 |
| 298 | 3300025914 | Ga0207671_10163429 | Ga0207671_101634292 | 249 |
| 299 | 3300025917 | Ga0207660_10007163 | Ga0207660_100071635 | 249 |
| 300 | 3300025919 | Ga0207657_10030102 | Ga0207657_100301026 | 249 |
| 301 | 3300025919 | Ga0207657_10094413 | Ga0207657_100944132 | 249 |
| 302 | 3300025920 | Ga0207649_10005844 | Ga0207649_100058448 | 249 |
| 303 | 3300025921 | Ga0207652_10042834 | Ga0207652_100428342 | 249 |
| 304 | 3300025923 | Ga0207681_10014276 | Ga0207681_100142766 | 249 |
| 305 | 3300025923 | Ga0207681_10032620 | Ga0207681_100326202 | 249 |
| 306 | 3300025923 | Ga0207681_10033129 | Ga0207681_100331292 | 249 |
| 307 | 3300025923 | Ga0207681_10065120 | Ga0207681_100651202 | 249 |
| 308 | 3300025923 | Ga0207681_10224028 | Ga0207681_102240282 | 249 |
| 309 | 3300025924 | Ga0207694_10093653 | Ga0207694_100936532 | 249 |
| 310 | 3300025925 | Ga0207650_10000754 | Ga0207650_100007545 | 249 |
| 311 | 3300025926 | Ga0207659_10000204 | Ga0207659_1000020413 | 249 |
| 312 | 3300025926 | Ga0207659_10003968 | Ga0207659_100039686 | 249 |
| 313 | 3300025926 | Ga0207659_10006399 | Ga0207659_100063995 | 249 |
| 314 | 3300025926 | Ga0207659_10046267 | Ga0207659_100462672 | 249 |
| 315 | 3300025926 | Ga0207659_10068395 | Ga0207659_100683952 | 249 |
| 316 | 3300025926 | Ga0207659_10083175 | Ga0207659_100831752 | 249 |
| 317 | 3300025927 | Ga0207687_10299085 | Ga0207687_102990852 | 249 |
| 318 | 3300025931 | Ga0207644_10004066 | Ga0207644_100040662 | 249 |
| 319 | 3300025931 | Ga0207644_10028206 | Ga0207644_100282065 | 249 |
| 320 | 3300025931 | Ga0207644_10036202 | Ga0207644_100362022 | 249 |
| 321 | 3300025931 | Ga0207644_10044009 | Ga0207644_100440093 | 249 |
| 322 | 3300025931 | Ga0207644_10076148 | Ga0207644_100761483 | 249 |
| 323 | 3300025932 | Ga0207690_10273473 | Ga0207690_102734732 | 249 |
| 324 | 3300025933 | Ga0207706_10037126 | Ga0207706_100371262 | 249 |
| 325 | 3300025933 | Ga0207706_10067468 | Ga0207706_100674684 | 249 |
| 326 | 3300025934 | Ga0207686_10148715 | Ga0207686_101487152 | 249 |
| 327 | 3300025935 | Ga0207709_10049010 | Ga0207709_100490102 | 249 |
| 328 | 3300025935 | Ga0207709_10136119 | Ga0207709_101361192 | 249 |
| 329 | 3300025937 | Ga0207669_10023239 | Ga0207669_100232393 | 249 |
| 330 | 3300025937 | Ga0207669_10077110 | Ga0207669_100771102 | 249 |
| 331 | 3300025937 | Ga0207669_10195918 | Ga0207669_101959182 | 249 |
| 332 | 3300025940 | Ga0207691_10008820 | Ga0207691_100088208 | 249 |
| 333 | 3300025940 | Ga0207691_10022374 | Ga0207691_100223742 | 249 |
| 334 | 3300025940 | Ga0207691_10065023 | Ga0207691_100650232 | 249 |
| 335 | 3300025940 | Ga0207691_10217763 | Ga0207691_102177631 | 249 |
| 336 | 3300025940 | Ga0207691_10313507 | Ga0207691_103135072 | 249 |
| 337 | 3300025941 | Ga0207711_10019439 | Ga0207711_100194392 | 249 |
| 338 | 3300025942 | Ga0207689_10000996 | Ga0207689_1000099628 | 249 |
| 339 | 3300025942 | Ga0207689_10039049 | Ga0207689_100390492 | 249 |
| 340 | 3300025942 | Ga0207689_10083161 | Ga0207689_100831613 | 249 |
| 341 | 3300025944 | Ga0207661_10197145 | Ga0207661_101971452 | 249 |
| 342 | 3300025945 | Ga0207679_10016215 | Ga0207679_100162153 | 249 |
| 343 | 3300025945 | Ga0207679_10509009 | Ga0207679_105090092 | 249 |
| 344 | 3300025945 | Ga0207679_10630811 | Ga0207679_106308111 | 249 |
| 345 | 3300025945 | Ga0207679_10678524 | Ga0207679_106785242 | 249 |
| 346 | 3300025960 | Ga0207651_10000175 | Ga0207651_1000017516 | 249 |
| 347 | 3300025960 | Ga0207651_10001535 | Ga0207651_100015359 | 249 |
| 348 | 3300025960 | Ga0207651_10009344 | Ga0207651_100093445 | 249 |
| 349 | 3300025960 | Ga0207651_10042464 | Ga0207651_100424642 | 249 |
| 350 | 3300025960 | Ga0207651_10138750 | Ga0207651_101387502 | 249 |
| 351 | 3300025960 | Ga0207651_10305691 | Ga0207651_103056912 | 249 |
| 352 | 3300025961 | Ga0207712_10022242 | Ga0207712_100222424 | 249 |
| 353 | 3300025972 | Ga0207668_10023396 | Ga0207668_100233963 | 249 |
| 354 | 3300025972 | Ga0207668_10088303 | Ga0207668_100883033 | 249 |
| 355 | 3300025972 | Ga0207668_10597638 | Ga0207668_105976382 | 249 |
| 356 | 3300025981 | Ga0207640_10180524 | Ga0207640_101805242 | 249 |
| 357 | 3300025986 | Ga0207658_10169038 | Ga0207658_101690382 | 249 |
| 358 | 3300026023 | Ga0207677_10005136 | Ga0207677_100051365 | 249 |
| 359 | 3300026023 | Ga0207677_10113321 | Ga0207677_101133212 | 249 |
| 360 | 3300026035 | Ga0207703_10001940 | Ga0207703_1000194012 | 249 |
| 361 | 3300026035 | Ga0207703_10063519 | Ga0207703_100635194 | 249 |
| 362 | 3300026035 | Ga0207703_10224404 | Ga0207703_102244043 | 249 |
| 363 | 3300026041 | Ga0207639_10368718 | Ga0207639_103687182 | 249 |
| 364 | 3300026067 | Ga0207678_10043973 | Ga0207678_100439734 | 249 |
| 365 | 3300026078 | Ga0207702_10012210 | Ga0207702_100122103 | 249 |
| 366 | 3300026078 | Ga0207702_10179161 | Ga0207702_101791613 | 249 |
| 367 | 3300026088 | Ga0207641_10008762 | Ga0207641_100087623 | 249 |
| 368 | 3300026088 | Ga0207641_10410810 | Ga0207641_104108102 | 249 |
| 369 | 3300026089 | Ga0207648_10006063 | Ga0207648_100060637 | 249 |
| 370 | 3300026089 | Ga0207648_10011724 | Ga0207648_100117248 | 249 |
| 371 | 3300026089 | Ga0207648_10037669 | Ga0207648_100376693 | 249 |
| 372 | 3300026089 | Ga0207648_10044748 | Ga0207648_100447484 | 249 |
| 373 | 3300026089 | Ga0207648_10442264 | Ga0207648_104422642 | 249 |
| 374 | 3300026095 | Ga0207676_10000459 | Ga0207676_100004599 | 249 |
| 375 | 3300026095 | Ga0207676_10004639 | Ga0207676_100046395 | 249 |
| 376 | 3300026095 | Ga0207676_10092427 | Ga0207676_100924273 | 249 |
| 377 | 3300026116 | Ga0207674_10007474 | Ga0207674_1000747412 | 249 |
| 378 | 3300026116 | Ga0207674_10213474 | Ga0207674_102134742 | 249 |
| 379 | 3300026116 | Ga0207674_10297656 | Ga0207674_102976562 | 249 |
| 380 | 3300026118 | Ga0207675_100008352 | Ga0207675_1000083524 | 249 |
| 381 | 3300026118 | Ga0207675_100034268 | Ga0207675_1000342684 | 249 |
| 382 | 3300026118 | Ga0207675_100451451 | Ga0207675_1004514512 | 249 |
| 383 | 3300026121 | Ga0207683_10001583 | Ga0207683_100015832 | 249 |
| 384 | 3300026121 | Ga0207683_10003340 | Ga0207683_100033405 | 249 |
| 385 | 3300026121 | Ga0207683_10187716 | Ga0207683_101877162 | 249 |
| 386 | 3300026121 | Ga0207683_10292796 | Ga0207683_102927962 | 249 |
| 387 | 3300026142 | Ga0207698_10044685 | Ga0207698_100446853 | 249 |
| 388 | 3300026142 | Ga0207698_10161229 | Ga0207698_101612292 | 249 |
| 389 | 3300027876 | Ga0209974_10000572 | Ga0209974_100005729 | 249 |
| 390 | 3300028379 | Ga0268266_10496754 | Ga0268266_104967542 | 249 |
| 391 | 3300028380 | Ga0268265_10015703 | Ga0268265_100157036 | 249 |
| 392 | 3300028381 | Ga0268264_10083069 | Ga0268264_100830692 | 249 |
| 393 | 3300028381 | Ga0268264_10155269 | Ga0268264_101552693 | 249 |
| 394 | 3300028381 | Ga0268264_10328773 | Ga0268264_103287732 | 249 |
| 395 | 3300028786 | Ga0307517_10004361 | Ga0307517_100043612 | 249 |
| 396 | 3300028794 | Ga0307515_10000911 | Ga0307515_1000091148 | 249 |
| 397 | 3300028794 | Ga0307515_10002263 | Ga0307515_1000226320 | 249 |
| 398 | 3300028794 | Ga0307515_10125748 | Ga0307515_101257482 | 249 |
| 399 | 3300028794 | Ga0307515_10319198 | Ga0307515_103191982 | 249 |
| 400 | 3300030522 | Ga0307512_10008490 | Ga0307512_100084905 | 249 |
| 401 | 3300030522 | Ga0307512_10015306 | Ga0307512_100153067 | 249 |
| 402 | 3300030522 | Ga0307512_10043701 | Ga0307512_100437012 | 249 |
| 403 | 3300030522 | Ga0307512_10197122 | Ga0307512_101971222 | 249 |
| 404 | 3300031251 | Ga0265327_10027464 | Ga0265327_100274643 | 249 |
| 405 | 3300031456 | Ga0307513_10013217 | Ga0307513_100132176 | 249 |
| 406 | 3300031456 | Ga0307513_10041281 | Ga0307513_100412815 | 249 |
| 407 | 3300031507 | Ga0307509_10001647 | Ga0307509_100016474 | 249 |
| 408 | 3300031507 | Ga0307509_10010682 | Ga0307509_100106828 | 249 |
| 409 | 3300031507 | Ga0307509_10012990 | Ga0307509_100129905 | 249 |
| 410 | 3300031507 | Ga0307509_10028187 | Ga0307509_100281872 | 249 |
| 411 | 3300031507 | Ga0307509_10058927 | Ga0307509_100589273 | 249 |
| 412 | 3300031507 | Ga0307509_10146968 | Ga0307509_101469683 | 249 |
| 413 | 3300031616 | Ga0307508_10000101 | Ga0307508_1000010151 | 249 |
| 414 | 3300031616 | Ga0307508_10041346 | Ga0307508_100413463 | 249 |
| 415 | 3300031616 | Ga0307508_10043133 | Ga0307508_100431333 | 249 |
| 416 | 3300031616 | Ga0307508_10095632 | Ga0307508_100956324 | 249 |
| 417 | 3300031649 | Ga0307514_10009380 | Ga0307514_100093803 | 249 |
| 418 | 3300031649 | Ga0307514_10015754 | Ga0307514_100157545 | 249 |
| 419 | 3300031730 | Ga0307516_10000394 | Ga0307516_100003948 | 249 |
| 420 | 3300031730 | Ga0307516_10080188 | Ga0307516_100801882 | 249 |
| 421 | 3300031730 | Ga0307516_10115443 | Ga0307516_101154433 | 249 |
| 422 | 3300031730 | Ga0307516_10278211 | Ga0307516_102782112 | 249 |
| 423 | 3300031731 | Ga0307405_10002583 | Ga0307405_100025833 | 249 |
| 424 | 3300031824 | Ga0307413_10606873 | Ga0307413_106068731 | 249 |
| 425 | 3300031838 | Ga0307518_10061365 | Ga0307518_100613652 | 249 |
| 426 | 3300031852 | Ga0307410_10034667 | Ga0307410_100346673 | 249 |
| 427 | 3300031903 | Ga0307407_10189634 | Ga0307407_101896341 | 249 |
| 428 | 3300031911 | Ga0307412_10001564 | Ga0307412_100015642 | 249 |
| 429 | 3300032002 | Ga0307416_100343687 | Ga0307416_1003436872 | 249 |
| 430 | 3300032004 | Ga0307414_10040943 | Ga0307414_100409433 | 249 |
| 431 | 3300032005 | Ga0307411_10002722 | Ga0307411_100027223 | 249 |
| 432 | 3300032126 | Ga0307415_100173641 | Ga0307415_1001736412 | 249 |
| 433 | 3300033179 | Ga0307507_10064419 | Ga0307507_100644192 | 249 |
| 434 | 3300033179 | Ga0307507_10084296 | Ga0307507_100842963 | 249 |
| 435 | 3300033180 | Ga0307510_10018239 | Ga0307510_100182398 | 249 |
| 436 | 3300033180 | Ga0307510_10043177 | Ga0307510_100431774 | 249 |
| 437 | 3300035088 | Ga0373940_0060066 | Ga0373940_0060066_93_869 | 249 |
| 438 | 3300035691 | Ga0373931_0003906 | Ga0373931_0003906_2370_3122 | 249 |
| 439 | 3300035691 | Ga0373931_0004827 | Ga0373931_0004827_845_1621 | 249 |
| 440 | 3300036401 | Ga0373937_0329761 | Ga0373937_0329761_466_1224 | 249 |
| 441 | 3300037471 | Ga0395905_0063276 | Ga0395905_0063276_2084_2863 | 249 |
| 442 | 3300039450 | Ga0436363_0700246 | Ga0436363_0700246_1939_2691 | 249 |
| 443 | 3300042531 | Ga0450918_000126 | Ga0450918_000126_15626_16393 | 249 |
| 444 | 3300044656 | Ga0466969_0022247 | Ga0466969_0022247_694_1443 | 249 |
| 445 | 3300044693 | Ga0466961_0061111 | Ga0466961_0061111_1634_2383 | 249 |
| 446 | 3300044719 | Ga0466971_0043006 | Ga0466971_0043006_801_1568 | 249 |
| 447 | 3300044842 | Ga0466957_0044543 | Ga0466957_0044543_257_1024 | 249 |
| 448 | 3300045051 | Ga0451576_0213295 | Ga0451576_0213295_1154_1906 | 249 |
| 449 | 3300046454 | Ga0495592_0038461 | Ga0495592_0038461_2524_3285 | 249 |
| 450 | 3300046457 | Ga0495590_0001361 | Ga0495590_0001361_3579_4340 | 249 |
| 451 | 3300046473 | Ga0495582_0193012 | Ga0495582_0193012_275_1051 | 249 |
| 452 | 3300046507 | Ga0495606_0324451 | Ga0495606_0324451_43_804 | 249 |
| 453 | 3300046519 | Ga0495632_0061943 | Ga0495632_0061943_951_1727 | 249 |
| 454 | 3300046524 | Ga0495648_0059864 | Ga0495648_0059864_1288_2052 | 249 |
| 455 | 3300046526 | Ga0495666_0009201 | Ga0495666_0009201_177_938 | 249 |
| 456 | 3300046539 | Ga0495621_0050964 | Ga0495621_0050964_289_1062 | 249 |
| 457 | 3300046539 | Ga0495621_0084366 | Ga0495621_0084366_227_985 | 249 |
| 458 | 3300046542 | Ga0495597_0017952 | Ga0495597_0017952_617_1378 | 249 |
| 459 | 3300046543 | Ga0495645_0096454 | Ga0495645_0096454_240_1022 | 249 |
| 460 | 3300046681 | Ga0495647_0178235 | Ga0495647_0178235_103_876 | 249 |
| 461 | 3300046683 | Ga0495658_0199547 | Ga0495658_0199547_282_1043 | 249 |
| 462 | 3300047443 | Ga0495687_000761 | Ga0495687_000761_5581_6342 | 249 |
| 463 | 3300047445 | Ga0495677_0100876 | Ga0495677_0100876_212_979 | 249 |
| 464 | 3300047472 | Ga0495686_0003001 | Ga0495686_0003001_11351_12112 | 249 |
| 465 | 3300048903 | Ga0496100_0663588 | Ga0496100_0663588_19_771 | 249 |
| 466 | 3300048904 | Ga0496101_0184606 | Ga0496101_0184606_680_1432 | 249 |
| 467 | 3300048904 | Ga0496101_0243385 | Ga0496101_0243385_47_820 | 249 |
| 468 | 3300048907 | Ga0496104_0235830 | Ga0496104_0235830_683_1435 | 249 |
| 469 | 3300048909 | Ga0496106_0007661 | Ga0496106_0007661_2844_3605 | 249 |
| 470 | 3300048909 | Ga0496106_0197714 | Ga0496106_0197714_648_1433 | 249 |
| 471 | 3300048911 | Ga0496108_0056965 | Ga0496108_0056965_826_1578 | 249 |
| 472 | 3300048912 | Ga0496109_0118533 | Ga0496109_0118533_1183_1935 | 249 |
| 473 | 3300048914 | Ga0496111_0257705 | Ga0496111_0257705_133_885 | 249 |
| 474 | 3300048917 | Ga0496114_0119780 | Ga0496114_0119780_936_1688 | 249 |
| 475 | 3300048918 | Ga0496115_0094142 | Ga0496115_0094142_162_914 | 249 |
| 476 | 3300048924 | Ga0496121_0029040 | Ga0496121_0029040_3705_4454 | 249 |
| 477 | 3300049521 | Ga0501298_029343 | Ga0501298_029343_217_975 | 249 |
| 478 | 3300050493 | nmdc:mga0k408_119654_c1 | nmdc:mga0k408_119654_c1_460_1233 | 249 |
| 479 | 3300050493 | nmdc:mga0k408_2426_c1 | nmdc:mga0k408_2426_c1_1102_1881 | 249 |
| 480 | 3300050493 | nmdc:mga0k408_295893_c1 | nmdc:mga0k408_295893_c1_104_871 | 249 |
| 481 | 3300050493 | nmdc:mga0k408_3909_c1 | nmdc:mga0k408_3909_c1_129_881 | 249 |
| 482 | 3300050493 | nmdc:mga0k408_4594_c1 | nmdc:mga0k408_4594_c1_1804_2556 | 249 |
| 483 | 3300050493 | nmdc:mga0k408_93143_c1 | nmdc:mga0k408_93143_c1_782_1549 | 249 |
| 484 | 3300050494 | nmdc:mga06z11_16131_c1 | nmdc:mga06z11_16131_c1_1286_2053 | 249 |
| 485 | 3300050496 | nmdc:mga07m45_26288_c1 | nmdc:mga07m45_26288_c1_1469_2236 | 249 |
| 486 | 3300050496 | nmdc:mga07m45_7812_c1 | nmdc:mga07m45_7812_c1_2974_3732 | 249 |
| 487 | 3300050512 | nmdc:mga0n895_146326_c1 | nmdc:mga0n895_146326_c1_1630_2382 | 249 |
| 488 | 3300050516 | nmdc:mga0sz30_20041_c1 | nmdc:mga0sz30_20041_c1_129_896 | 249 |
| 489 | 3300053086 | Ga0500578_0041292 | Ga0500578_0041292_97_858 | 249 |
| 490 | 3300053093 | Ga0500651_0178242 | Ga0500651_0178242_162_929 | 249 |
| 491 | 3300053148 | Ga0500590_013660 | Ga0500590_013660_917_1669 | 249 |
| 492 | 3300053154 | Ga0500619_002889 | Ga0500619_002889_1193_1954 | 249 |
| 493 | 3300053730 | Ga0500645_006914 | Ga0500645_006914_42_803 | 249 |
| 494 | 3300053739 | Ga0500587_006386 | Ga0500587_006386_771_1532 | 249 |
| 495 | 3300061719 | Ga0466962_0103830 | Ga0466962_0103830_517_1266 | 249 |
| 496 | 3300003203 | JGI25406J46586_10048047 | JGI25406J46586_100480472 | 250 |
| 497 | 3300003791 | Ga0055530_10009684 | Ga0055530_100096844 | 250 |
| 498 | 3300005262 | Ga0065165_1004067 | Ga0065165_100406711 | 250 |
| 499 | 3300005331 | Ga0070670_100011095 | Ga0070670_1000110952 | 250 |
| 500 | 3300005331 | Ga0070670_100359275 | Ga0070670_1003592752 | 250 |
| 501 | 3300005334 | Ga0068869_100003047 | Ga0068869_1000030472 | 250 |
| 502 | 3300005335 | Ga0070666_10024991 | Ga0070666_100249914 | 250 |
| 503 | 3300005338 | Ga0068868_100040286 | Ga0068868_1000402864 | 250 |
| 504 | 3300005339 | Ga0070660_100359103 | Ga0070660_1003591032 | 250 |
| 505 | 3300005344 | Ga0070661_100384755 | Ga0070661_1003847552 | 250 |
| 506 | 3300005347 | Ga0070668_100003082 | Ga0070668_1000030829 | 250 |
| 507 | 3300005353 | Ga0070669_100009023 | Ga0070669_1000090236 | 250 |
| 508 | 3300005353 | Ga0070669_100177676 | Ga0070669_1001776762 | 250 |
| 509 | 3300005354 | Ga0070675_100068183 | Ga0070675_1000681834 | 250 |
| 510 | 3300005354 | Ga0070675_100305064 | Ga0070675_1003050642 | 250 |
| 511 | 3300005355 | Ga0070671_100386465 | Ga0070671_1003864652 | 250 |
| 512 | 3300005356 | Ga0070674_100004463 | Ga0070674_1000044632 | 250 |
| 513 | 3300005364 | Ga0070673_100107848 | Ga0070673_1001078483 | 250 |
| 514 | 3300005366 | Ga0070659_100512291 | Ga0070659_1005122911 | 250 |
| 515 | 3300005367 | Ga0070667_100316176 | Ga0070667_1003161762 | 250 |
| 516 | 3300005438 | Ga0070701_10032610 | Ga0070701_100326102 | 250 |
| 517 | 3300005445 | Ga0070708_100026951 | Ga0070708_1000269515 | 250 |
| 518 | 3300005445 | Ga0070708_100037495 | Ga0070708_1000374954 | 250 |
| 519 | 3300005455 | Ga0070663_100180143 | Ga0070663_1001801432 | 250 |
| 520 | 3300005456 | Ga0070678_100270210 | Ga0070678_1002702102 | 250 |
| 521 | 3300005457 | Ga0070662_100005664 | Ga0070662_1000056647 | 250 |
| 522 | 3300005457 | Ga0070662_100089285 | Ga0070662_1000892852 | 250 |
| 523 | 3300005457 | Ga0070662_100097010 | Ga0070662_1000970103 | 250 |
| 524 | 3300005459 | Ga0068867_100013078 | Ga0068867_1000130784 | 250 |
| 525 | 3300005459 | Ga0068867_100074187 | Ga0068867_1000741872 | 250 |
| 526 | 3300005467 | Ga0070706_100008790 | Ga0070706_1000087904 | 250 |
| 527 | 3300005468 | Ga0070707_100020166 | Ga0070707_1000201666 | 250 |
| 528 | 3300005471 | Ga0070698_100001400 | Ga0070698_10000140026 | 250 |
| 529 | 3300005471 | Ga0070698_100033168 | Ga0070698_1000331684 | 250 |
| 530 | 3300005535 | Ga0070684_100459104 | Ga0070684_1004591042 | 250 |
| 531 | 3300005539 | Ga0068853_100304671 | Ga0068853_1003046712 | 250 |
| 532 | 3300005543 | Ga0070672_100004578 | Ga0070672_1000045787 | 250 |
| 533 | 3300005543 | Ga0070672_100021611 | Ga0070672_1000216114 | 250 |
| 534 | 3300005543 | Ga0070672_100092452 | Ga0070672_1000924524 | 250 |
| 535 | 3300005543 | Ga0070672_100128392 | Ga0070672_1001283922 | 250 |
| 536 | 3300005543 | Ga0070672_100155383 | Ga0070672_1001553832 | 250 |
| 537 | 3300005543 | Ga0070672_100293307 | Ga0070672_1002933072 | 250 |
| 538 | 3300005564 | Ga0070664_100253203 | Ga0070664_1002532032 | 250 |
| 539 | 3300005577 | Ga0068857_100175120 | Ga0068857_1001751202 | 250 |
| 540 | 3300005614 | Ga0068856_100032045 | Ga0068856_1000320456 | 250 |
| 541 | 3300005616 | Ga0068852_100065358 | Ga0068852_1000653584 | 250 |
| 542 | 3300005616 | Ga0068852_100077781 | Ga0068852_1000777814 | 250 |
| 543 | 3300005616 | Ga0068852_100136227 | Ga0068852_1001362274 | 250 |
| 544 | 3300005616 | Ga0068852_100180959 | Ga0068852_1001809592 | 250 |
| 545 | 3300005618 | Ga0068864_100284407 | Ga0068864_1002844072 | 250 |
| 546 | 3300005618 | Ga0068864_100392548 | Ga0068864_1003925482 | 250 |
| 547 | 3300005718 | Ga0068866_10003009 | Ga0068866_100030092 | 250 |
| 548 | 3300005718 | Ga0068866_10103754 | Ga0068866_101037542 | 250 |
| 549 | 3300005719 | Ga0068861_100018459 | Ga0068861_1000184594 | 250 |
| 550 | 3300005841 | Ga0068863_100034885 | Ga0068863_1000348854 | 250 |
| 551 | 3300005841 | Ga0068863_100277051 | Ga0068863_1002770512 | 250 |
| 552 | 3300005842 | Ga0068858_100009570 | Ga0068858_1000095702 | 250 |
| 553 | 3300005843 | Ga0068860_100074770 | Ga0068860_1000747702 | 250 |
| 554 | 3300005844 | Ga0068862_100080500 | Ga0068862_1000805002 | 250 |
| 555 | 3300005985 | Ga0081539_10006995 | Ga0081539_1000699512 | 250 |
| 556 | 3300006038 | Ga0075365_10021734 | Ga0075365_100217343 | 250 |
| 557 | 3300006042 | Ga0075368_10029292 | Ga0075368_100292922 | 250 |
| 558 | 3300006177 | Ga0075362_10004317 | Ga0075362_100043173 | 250 |
| 559 | 3300006177 | Ga0075362_10018675 | Ga0075362_100186753 | 250 |
| 560 | 3300006178 | Ga0075367_10029814 | Ga0075367_100298142 | 250 |
| 561 | 3300006178 | Ga0075367_10109982 | Ga0075367_101099822 | 250 |
| 562 | 3300006186 | Ga0075369_10000085 | Ga0075369_1000008510 | 250 |
| 563 | 3300006186 | Ga0075369_10075604 | Ga0075369_100756042 | 250 |
| 564 | 3300006195 | Ga0075366_10003063 | Ga0075366_100030639 | 250 |
| 565 | 3300006195 | Ga0075366_10068020 | Ga0075366_100680202 | 250 |
| 566 | 3300006195 | Ga0075366_10079226 | Ga0075366_100792262 | 250 |
| 567 | 3300006195 | Ga0075366_10079352 | Ga0075366_100793524 | 250 |
| 568 | 3300006195 | Ga0075366_10121040 | Ga0075366_101210402 | 250 |
| 569 | 3300006237 | Ga0097621_100075809 | Ga0097621_1000758094 | 250 |
| 570 | 3300006353 | Ga0075370_10002925 | Ga0075370_100029252 | 250 |
| 571 | 3300006353 | Ga0075370_10048720 | Ga0075370_100487202 | 250 |
| 572 | 3300006353 | Ga0075370_10084214 | Ga0075370_100842142 | 250 |
| 573 | 3300006353 | Ga0075370_10100631 | Ga0075370_101006312 | 250 |
| 574 | 3300006881 | Ga0068865_100003515 | Ga0068865_1000035157 | 250 |
| 575 | 3300009093 | Ga0105240_10776773 | Ga0105240_107767732 | 250 |
| 576 | 3300009098 | Ga0105245_10365998 | Ga0105245_103659982 | 250 |
| 577 | 3300009148 | Ga0105243_10001958 | Ga0105243_100019588 | 250 |
| 578 | 3300009148 | Ga0105243_10201008 | Ga0105243_102010082 | 250 |
| 579 | 3300009176 | Ga0105242_10145657 | Ga0105242_101456572 | 250 |
| 580 | 3300009177 | Ga0105248_10147698 | Ga0105248_101476984 | 250 |
| 581 | 3300009177 | Ga0105248_10223089 | Ga0105248_102230892 | 250 |
| 582 | 3300009553 | Ga0105249_10307854 | Ga0105249_103078542 | 250 |
| 583 | 3300009553 | Ga0105249_10515295 | Ga0105249_105152952 | 250 |
| 584 | 3300010159 | Ga0099796_10005772 | Ga0099796_100057723 | 250 |
| 585 | 3300010375 | Ga0105239_10186248 | Ga0105239_101862482 | 250 |
| 586 | 3300013102 | Ga0157371_10055892 | Ga0157371_100558923 | 250 |
| 587 | 3300013105 | Ga0157369_10593365 | Ga0157369_105933652 | 250 |
| 588 | 3300013297 | Ga0157378_10077771 | Ga0157378_100777712 | 250 |
| 589 | 3300013297 | Ga0157378_10254140 | Ga0157378_102541402 | 250 |
| 590 | 3300013297 | Ga0157378_10402457 | Ga0157378_104024572 | 250 |
| 591 | 3300013308 | Ga0157375_10003962 | Ga0157375_100039624 | 250 |
| 592 | 3300014325 | Ga0163163_10061752 | Ga0163163_100617522 | 250 |
| 593 | 3300014968 | Ga0157379_10025561 | Ga0157379_100255614 | 250 |
| 594 | 3300014968 | Ga0157379_10352645 | Ga0157379_103526451 | 250 |
| 595 | 3300017792 | Ga0163161_10036806 | Ga0163161_100368064 | 250 |
| 596 | 3300021384 | Ga0213876_10115123 | Ga0213876_101151232 | 250 |
| 597 | 3300025297 | Ga0209758_1000500 | Ga0209758_100050053 | 250 |
| 598 | 3300025298 | Ga0209050_1000223 | Ga0209050_1000223121 | 250 |
| 599 | 3300025315 | Ga0207697_10071341 | Ga0207697_100713412 | 250 |
| 600 | 3300025893 | Ga0207682_10080051 | Ga0207682_100800512 | 250 |
| 601 | 3300025899 | Ga0207642_10046513 | Ga0207642_100465132 | 250 |
| 602 | 3300025901 | Ga0207688_10190790 | Ga0207688_101907902 | 250 |
| 603 | 3300025908 | Ga0207643_10060815 | Ga0207643_100608152 | 250 |
| 604 | 3300025910 | Ga0207684_10002610 | Ga0207684_1000261015 | 250 |
| 605 | 3300025910 | Ga0207684_10298425 | Ga0207684_102984252 | 250 |
| 606 | 3300025922 | Ga0207646_10110916 | Ga0207646_101109163 | 250 |
| 607 | 3300025923 | Ga0207681_10000162 | Ga0207681_100001622 | 250 |
| 608 | 3300025925 | Ga0207650_10000382 | Ga0207650_1000038220 | 250 |
| 609 | 3300025926 | Ga0207659_10009378 | Ga0207659_100093782 | 250 |
| 610 | 3300025926 | Ga0207659_10031152 | Ga0207659_100311525 | 250 |
| 611 | 3300025927 | Ga0207687_10021190 | Ga0207687_100211902 | 250 |
| 612 | 3300025927 | Ga0207687_10372891 | Ga0207687_103728912 | 250 |
| 613 | 3300025933 | Ga0207706_10007280 | Ga0207706_100072807 | 250 |
| 614 | 3300025933 | Ga0207706_10096910 | Ga0207706_100969102 | 250 |
| 615 | 3300025934 | Ga0207686_10096350 | Ga0207686_100963502 | 250 |
| 616 | 3300025934 | Ga0207686_10167968 | Ga0207686_101679682 | 250 |
| 617 | 3300025935 | Ga0207709_10010271 | Ga0207709_100102714 | 250 |
| 618 | 3300025938 | Ga0207704_10004815 | Ga0207704_100048156 | 250 |
| 619 | 3300025940 | Ga0207691_10067702 | Ga0207691_100677022 | 250 |
| 620 | 3300025940 | Ga0207691_10185830 | Ga0207691_101858302 | 250 |
| 621 | 3300025940 | Ga0207691_10214838 | Ga0207691_102148382 | 250 |
| 622 | 3300025940 | Ga0207691_10354666 | Ga0207691_103546662 | 250 |
| 623 | 3300025941 | Ga0207711_10055718 | Ga0207711_100557184 | 250 |
| 624 | 3300025941 | Ga0207711_10119531 | Ga0207711_101195312 | 250 |
| 625 | 3300025941 | Ga0207711_10428204 | Ga0207711_104282042 | 250 |
| 626 | 3300025960 | Ga0207651_10299112 | Ga0207651_102991121 | 250 |
| 627 | 3300025972 | Ga0207668_10007819 | Ga0207668_100078196 | 250 |
| 628 | 3300025986 | Ga0207658_10000181 | Ga0207658_1000018146 | 250 |
| 629 | 3300026023 | Ga0207677_10015401 | Ga0207677_100154013 | 250 |
| 630 | 3300026035 | Ga0207703_10004491 | Ga0207703_100044917 | 250 |
| 631 | 3300026041 | Ga0207639_10107951 | Ga0207639_101079512 | 250 |
| 632 | 3300026067 | Ga0207678_10032683 | Ga0207678_100326836 | 250 |
| 633 | 3300026067 | Ga0207678_10135866 | Ga0207678_101358663 | 250 |
| 634 | 3300026067 | Ga0207678_10245976 | Ga0207678_102459762 | 250 |
| 635 | 3300026075 | Ga0207708_10104594 | Ga0207708_101045943 | 250 |
| 636 | 3300026088 | Ga0207641_10001945 | Ga0207641_1000194510 | 250 |
| 637 | 3300026088 | Ga0207641_10171371 | Ga0207641_101713712 | 250 |
| 638 | 3300026089 | Ga0207648_10017985 | Ga0207648_100179854 | 250 |
| 639 | 3300026089 | Ga0207648_10025241 | Ga0207648_100252414 | 250 |
| 640 | 3300026116 | Ga0207674_10200584 | Ga0207674_102005842 | 250 |
| 641 | 3300026116 | Ga0207674_10244585 | Ga0207674_102445852 | 250 |
| 642 | 3300026118 | Ga0207675_100004099 | Ga0207675_1000040994 | 250 |
| 643 | 3300026121 | Ga0207683_10316733 | Ga0207683_103167332 | 250 |
| 644 | 3300026142 | Ga0207698_10152355 | Ga0207698_101523553 | 250 |
| 645 | 3300026142 | Ga0207698_10368196 | Ga0207698_103681962 | 250 |
| 646 | 3300027866 | Ga0209813_10079002 | Ga0209813_100790022 | 250 |
| 647 | 3300028379 | Ga0268266_10168039 | Ga0268266_101680392 | 250 |
| 648 | 3300028380 | Ga0268265_10069832 | Ga0268265_100698323 | 250 |
| 649 | 3300028381 | Ga0268264_10001738 | Ga0268264_100017384 | 250 |
| 650 | 3300028786 | Ga0307517_10160963 | Ga0307517_101609632 | 250 |
| 651 | 3300028794 | Ga0307515_10034317 | Ga0307515_100343176 | 250 |
| 652 | 3300031507 | Ga0307509_10076354 | Ga0307509_100763542 | 250 |
| 653 | 3300031548 | Ga0307408_100377317 | Ga0307408_1003773171 | 250 |
| 654 | 3300031730 | Ga0307516_10005007 | Ga0307516_100050071 | 250 |
| 655 | 3300031730 | Ga0307516_10347117 | Ga0307516_103471172 | 250 |
| 656 | 3300031911 | Ga0307412_10482582 | Ga0307412_104825821 | 250 |
| 657 | 3300031995 | Ga0307409_100215767 | Ga0307409_1002157672 | 250 |
| 658 | 3300032005 | Ga0307411_10385444 | Ga0307411_103854441 | 250 |
| 659 | 3300033180 | Ga0307510_10038889 | Ga0307510_100388893 | 250 |
| 660 | 3300035117 | Ga0373953_0021688 | Ga0373953_0021688_1416_2171 | 250 |
| 661 | 3300035171 | Ga0373946_0079609 | Ga0373946_0079609_283_1038 | 250 |
| 662 | 3300036401 | Ga0373937_0018749 | Ga0373937_0018749_3032_3811 | 250 |
| 663 | 3300036401 | Ga0373937_0058153 | Ga0373937_0058153_155_910 | 250 |
| 664 | 3300036401 | Ga0373937_0536810 | Ga0373937_0536810_162_944 | 250 |
| 665 | 3300041460 | Ga0451802_1369130 | Ga0451802_1369130_263_1060 | 250 |
| 666 | 3300044712 | Ga0453684_0226562 | Ga0453684_0226562_329_1084 | 250 |
| 667 | 3300046460 | Ga0495638_0045454 | Ga0495638_0045454_1220_1978 | 250 |
| 668 | 3300046507 | Ga0495606_0168850 | Ga0495606_0168850_148_930 | 250 |
| 669 | 3300046512 | Ga0495610_0040317 | Ga0495610_0040317_311_1108 | 250 |
| 670 | 3300046519 | Ga0495632_0052575 | Ga0495632_0052575_985_1743 | 250 |
| 671 | 3300046538 | Ga0495609_0113743 | Ga0495609_0113743_322_1098 | 250 |
| 672 | 3300046539 | Ga0495621_0097672 | Ga0495621_0097672_241_996 | 250 |
| 673 | 3300046542 | Ga0495597_0064827 | Ga0495597_0064827_616_1380 | 250 |
| 674 | 3300046660 | Ga0495625_0018284 | Ga0495625_0018284_2621_3400 | 250 |
| 675 | 3300046663 | Ga0495635_0133585 | Ga0495635_0133585_355_1140 | 250 |
| 676 | 3300046675 | Ga0495657_0380110 | Ga0495657_0380110_27_806 | 250 |
| 677 | 3300046683 | Ga0495658_0004477 | Ga0495658_0004477_2753_3532 | 250 |
| 678 | 3300046683 | Ga0495658_0197604 | Ga0495658_0197604_383_1147 | 250 |
| 679 | 3300046683 | Ga0495658_0212033 | Ga0495658_0212033_68_847 | 250 |
| 680 | 3300046689 | Ga0495613_0097650 | Ga0495613_0097650_1094_1849 | 250 |
| 681 | 3300046694 | Ga0495649_0004222 | Ga0495649_0004222_1206_1985 | 250 |
| 682 | 3300046810 | Ga0495660_0070270 | Ga0495660_0070270_750_1529 | 250 |
| 683 | 3300047319 | Ga0495674_0298307 | Ga0495674_0298307_137_892 | 250 |
| 684 | 3300047443 | Ga0495687_003669 | Ga0495687_003669_7268_8047 | 250 |
| 685 | 3300047443 | Ga0495687_010060 | Ga0495687_010060_1431_2207 | 250 |
| 686 | 3300047443 | Ga0495687_026673 | Ga0495687_026673_1180_1959 | 250 |
| 687 | 3300048908 | Ga0496105_0156926 | Ga0496105_0156926_398_1153 | 250 |
| 688 | 3300048911 | Ga0496108_0130532 | Ga0496108_0130532_573_1328 | 250 |
| 689 | 3300050489 | nmdc:mga03683_19828_c1 | nmdc:mga03683_19828_c1_1718_2500 | 250 |
| 690 | 3300050489 | nmdc:mga03683_8328_c1 | nmdc:mga03683_8328_c1_2679_3446 | 250 |
| 691 | 3300050492 | nmdc:mga0yw44_20132_c1 | nmdc:mga0yw44_20132_c1_1102_1884 | 250 |
| 692 | 3300050493 | nmdc:mga0k408_100661_c1 | nmdc:mga0k408_100661_c1_307_1062 | 250 |
| 693 | 3300050493 | nmdc:mga0k408_100737_c2 | nmdc:mga0k408_100737_c2_139_918 | 250 |
| 694 | 3300050493 | nmdc:mga0k408_17713_c1 | nmdc:mga0k408_17713_c1_803_1561 | 250 |
| 695 | 3300050493 | nmdc:mga0k408_65134_c1 | nmdc:mga0k408_65134_c1_628_1419 | 250 |
| 696 | 3300050493 | nmdc:mga0k408_6858_c1 | nmdc:mga0k408_6858_c1_549_1343 | 250 |
| 697 | 3300050493 | nmdc:mga0k408_68982_c1 | nmdc:mga0k408_68982_c1_681_1448 | 250 |
| 698 | 3300050494 | nmdc:mga06z11_18417_c1 | nmdc:mga06z11_18417_c1_801_1583 | 250 |
| 699 | 3300050494 | nmdc:mga06z11_20069_c1 | nmdc:mga06z11_20069_c1_629_1423 | 250 |
| 700 | 3300050494 | nmdc:mga06z11_38707_c1 | nmdc:mga06z11_38707_c1_151_942 | 250 |
| 701 | 3300050495 | nmdc:mga04h51_93877_c1 | nmdc:mga04h51_93877_c1_133_927 | 250 |
| 702 | 3300050496 | nmdc:mga07m45_103442_c1 | nmdc:mga07m45_103442_c1_617_1411 | 250 |
| 703 | 3300050496 | nmdc:mga07m45_1192_c1 | nmdc:mga07m45_1192_c1_6343_7134 | 250 |
| 704 | 3300050496 | nmdc:mga07m45_31891_c1 | nmdc:mga07m45_31891_c1_1340_2122 | 250 |
| 705 | 3300050496 | nmdc:mga07m45_90112_c1 | nmdc:mga07m45_90112_c1_98_865 | 250 |
| 706 | 3300050513 | nmdc:mga0rr50_143765_c1 | nmdc:mga0rr50_143765_c1_254_1048 | 250 |
| 707 | 3300050516 | nmdc:mga0sz30_1958_c1 | nmdc:mga0sz30_1958_c1_2915_3697 | 250 |
| 708 | 3300050516 | nmdc:mga0sz30_78691_c1 | nmdc:mga0sz30_78691_c1_106_873 | 250 |
| 709 | 3300053077 | Ga0495601_0010509 | Ga0495601_0010509_3152_3931 | 250 |
| 710 | 3300053086 | Ga0500578_0000549 | Ga0500578_0000549_28875_29645 | 250 |
| 711 | 3300053088 | Ga0500644_0008317 | Ga0500644_0008317_1795_2571 | 250 |
| 712 | 3300053093 | Ga0500651_0037943 | Ga0500651_0037943_364_1146 | 250 |
| 713 | 3300053093 | Ga0500651_0180826 | Ga0500651_0180826_421_1179 | 250 |
| 714 | 3300053118 | Ga0500594_0053420 | Ga0500594_0053420_343_1119 | 250 |
| 715 | 3300053126 | Ga0500621_042430 | Ga0500621_042430_586_1362 | 250 |
| 716 | 3300053130 | Ga0500642_0073538 | Ga0500642_0073538_559_1317 | 250 |
| 717 | 3300053131 | Ga0500652_001324 | Ga0500652_001324_4292_5050 | 250 |
| 718 | 3300053133 | Ga0500655_011390 | Ga0500655_011390_53_811 | 250 |
| 719 | 3300053134 | Ga0500658_0095036 | Ga0500658_0095036_316_1080 | 250 |
| 720 | 3300053136 | Ga0500559_0000116 | Ga0500559_0000116_59494_60270 | 250 |
| 721 | 3300053142 | Ga0500577_0031584 | Ga0500577_0031584_202_960 | 250 |
| 722 | 3300053153 | Ga0500616_0139944 | Ga0500616_0139944_236_1012 | 250 |
| 723 | 3300053156 | Ga0500622_0000146 | Ga0500622_0000146_8252_9010 | 250 |
| 724 | 3300053156 | Ga0500622_0005791 | Ga0500622_0005791_4551_5327 | 250 |
| 725 | 3300053156 | Ga0500622_0052347 | Ga0500622_0052347_1106_1888 | 250 |
| 726 | 3300053726 | Ga0500584_134309 | Ga0500584_134309_59_841 | 250 |
| 727 | 3300053739 | Ga0500587_008574 | Ga0500587_008574_392_1168 | 250 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.938 | 4 | 243 |
| 6b89-assembly1.cif.gz_A | e. coli lptb in complex with adp and novobiocin | 0.9264 | 4 | 243 |
| 7x0q-assembly1.cif.gz_A | crystal structure of atpase clo1313_2554 from clostridium thermocellum | 0.9133 | 5 | 233 |
| 7efo-assembly1.cif.gz_A | lptb2fg-lps from klebsiella pneumoniae in nanodiscs | 0.9126 | 4 | 245 |
| 4yer-assembly1.cif.gz_A | crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution | 0.9107 | 1 | 233 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0A9S7_4_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9545 | 4 | 245 | 3.40.50.300 |
| af_P0A9S7_4_254_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9212 | 4 | 245 | 3.40.50.300 |
| af_P77795_1_218_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.919 | 1 | 229 | 3.40.50.300 |
| af_A4HRM7_2286_2560_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.918 | 3 | 237 | 3.40.50.300 |
| af_Q58762_1_229_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9161 | 5 | 242 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538JJF5-F1-model_v4 | ABC transporter ATP-binding protein | 0.9434 | 4 | 250 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A7Y0LYI9-F1-model_v4 | ABC transporter ATP-binding protein | 0.9424 | 2 | 250 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A3N6MLS5-F1-model_v4 | ABC transporter ATP-binding protein | 0.942 | 3 | 248 |
GO:0005524
GO:0005886 GO:0016887 |
| AF-A0A239NU23-F1-model_v4 | Branched-chain amino acid transport system ATP-binding protein | 0.9404 | 3 | 247 |
GO:0005304
GO:0005524 GO:0005886 GO:0015188 GO:0015192 GO:0015808 GO:0016887 GO:0042941 GO:1903805 GO:1903806 |
| AF-A0A0F2NA46-F1-model_v4 | ABC transporter | 0.9362 | 3 | 247 |
GO:0005524
GO:0005886 GO:0016887 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar