F477754

General Info

Members Datasets Scaffolds Average Seq Length
727 304 717 253

Family's Representative Sequence

Representative Sequence 3300031730|Ga0307516_10005007|Ga0307516_100050071
Length 285
Sequence MTTPRSPSTSIDPPRGSRPAWGGPALGREAMSDTVLETRGLLKRFGGITPTNDVSIQVEKGARCALIGPNGAGKTTLINLLTGVIEPTAGSIWLDGADITQLTPHQRVRRGVVRTFQINQLFGELTPLQSLALSVSAQFGISAQWWKRLGTDARVAPRCDTLLKQFHLDDVADQQVKHLAYGKRRLLEIATALACEPRVLLLDEPVAGVPEGERQEIFDIINALPPEVSVLLIEHDMDLVFNFAKSVTVLVNGAVFAEGDVQTISNDPRVKAVYLGESAEGHAHG

Samples

Sample ID Description Type Environment
1 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
2 2585428058 Methylibium sp. CF468 Isolate Rhizosphere
3 2585428062 Methylibium sp. CF059 Isolate Rhizosphere
4 2588253510 Rhizobacter sp. OV335 Isolate Rhizosphere
5 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
6 2643221625 Rhizobacter sp. Root29 Isolate Unclassified
7 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
8 2643221648 Rhizobacter sp. Root1238 Isolate Unclassified
9 2643221654 Rhizobacter sp. Root404 Isolate Unclassified
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
12 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
13 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
14 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
19 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
20 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
25 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
40 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
41 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
42 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
47 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
48 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
51 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
58 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
59 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
60 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
69 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
70 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
78 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
82 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
83 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
84 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
85 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
86 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
87 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
88 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
89 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
90 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
91 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
92 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
93 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
94 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
95 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
96 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
97 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
98 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
99 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
100 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
101 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
102 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
103 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
104 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
105 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
106 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
107 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
108 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
109 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
110 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
111 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
112 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
113 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
114 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
170 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
171 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
175 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
176 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
177 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
178 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
179 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
180 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
181 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
182 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
183 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
184 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
185 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
186 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
187 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
188 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
189 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
190 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
191 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
192 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
193 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
194 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
195 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
196 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
197 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
200 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
201 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
202 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
203 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
204 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
205 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
206 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
207 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
208 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
209 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
210 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
211 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
212 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
213 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
214 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
215 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
216 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
217 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
218 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
219 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
220 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
221 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
222 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
223 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
224 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
225 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
226 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
227 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
228 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
229 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
230 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
231 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
232 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
233 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
234 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
235 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
236 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
237 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
238 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
239 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
240 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
241 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
242 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
243 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
244 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
245 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
246 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
247 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
248 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
249 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
250 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
251 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
252 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
253 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
254 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
255 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
256 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
257 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
258 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
259 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
260 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
261 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
262 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
263 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
264 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
265 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
266 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
267 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
268 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
271 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
272 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
273 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
274 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
275 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
276 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
277 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
278 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
279 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
280 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
281 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
282 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
283 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
284 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
285 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
286 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
287 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
288 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
289 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
290 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
291 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
292 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
293 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
294 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
295 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
296 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
297 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
298 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
299 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
300 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
301 3300053726 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 endosphere Metagenome Endosphere
302 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
303 3300053739 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 endosphere Metagenome Endosphere
304 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.62
Metatranscriptomes 0
Isolates 1.38

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.07
Nodule 0
Rhizoplane 3.03
Rhizosphere 75.79
Stem 0
Stem Tuber 0
Unclassified 8.12

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25406J46586_10048047 3300003203 Bacteria 1450
2 JGI25153J46596_10004971 3300003215 Bacteria 7062
3 rootH1_10004635 3300003323 Bacteria 23785
4 Ga0055526_1001524 3300003771 Bacteria 16387
5 Ga0055530_10009684 3300003791 Bacteria 3665
6 Ga0065165_1004067 3300005262 Bacteria 9489
7 Ga0070676_10056499 3300005328 Bacteria 2319
8 Ga0070676_10068675 3300005328 Bacteria 2122
9 Ga0070676_10133099 3300005328 Bacteria 1574
10 Ga0070683_100135892 3300005329 Bacteria 2328
11 Ga0070690_100009364 3300005330 Bacteria 5673
12 Ga0070690_100251716 3300005330 Bacteria 1250
13 Ga0070670_100011095 3300005331 Bacteria 7698
14 Ga0070670_100091187 3300005331 Bacteria 2619
15 Ga0070670_100091478 3300005331 Bacteria 2616
16 Ga0070670_100359275 3300005331 Bacteria 1280
17 Ga0070677_10013542 3300005333 Bacteria 2855
18 Ga0070677_10037192 3300005333 Bacteria 1898
19 Ga0070677_10121109 3300005333 Bacteria 1182
20 Ga0068869_100003047 3300005334 Bacteria 10192
21 Ga0068869_100027130 3300005334 Bacteria 3991
22 Ga0068869_100077017 3300005334 Bacteria 2480
23 Ga0068869_100630889 3300005334 Bacteria 908
24 Ga0070666_10024991 3300005335 Bacteria 3893
25 Ga0070666_10133252 3300005335 Bacteria 1728
26 Ga0070680_100008447 3300005336 Bacteria 7884
27 Ga0068868_100004842 3300005338 Bacteria 9451
28 Ga0068868_100009130 3300005338 Bacteria 7119
29 Ga0068868_100010695 3300005338 Bacteria 6651
30 Ga0068868_100040286 3300005338 Bacteria 3635
31 Ga0068868_100261141 3300005338 Bacteria 1460
32 Ga0068868_100510933 3300005338 Bacteria 1054
33 Ga0070660_100027643 3300005339 Bacteria 4235
34 Ga0070660_100075481 3300005339 Bacteria 2639
35 Ga0070660_100359103 3300005339 Bacteria 1200
36 Ga0070661_100057990 3300005344 Bacteria 2837
37 Ga0070661_100374109 3300005344 Bacteria 1122
38 Ga0070661_100384755 3300005344 Bacteria 1107
39 Ga0070668_100003082 3300005347 Bacteria 12319
40 Ga0070668_100010749 3300005347 Bacteria 6805
41 Ga0070669_100009023 3300005353 Bacteria 7111
42 Ga0070669_100026311 3300005353 Bacteria 4185
43 Ga0070669_100028366 3300005353 Bacteria 4031
44 Ga0070669_100177676 3300005353 Bacteria 1663
45 Ga0070669_100224028 3300005353 Bacteria 1488
46 Ga0070675_100000249 3300005354 Bacteria 35004
47 Ga0070675_100010591 3300005354 Bacteria 7208
48 Ga0070675_100020503 3300005354 Bacteria 5274
49 Ga0070675_100056889 3300005354 Bacteria 3224
50 Ga0070675_100068183 3300005354 Bacteria 2945
51 Ga0070675_100305064 3300005354 Bacteria 1403
52 Ga0070675_100314782 3300005354 Bacteria 1382
53 Ga0070671_100000628 3300005355 Bacteria 25190
54 Ga0070671_100012361 3300005355 Bacteria 6875
55 Ga0070671_100029117 3300005355 Bacteria 4553
56 Ga0070671_100056122 3300005355 Bacteria 3276
57 Ga0070671_100065378 3300005355 Bacteria 3029
58 Ga0070671_100145202 3300005355 Bacteria 2002
59 Ga0070671_100386465 3300005355 Bacteria 1196
60 Ga0070674_100004463 3300005356 Bacteria 7980
61 Ga0070674_100006826 3300005356 Bacteria 6689
62 Ga0070674_100034985 3300005356 Bacteria 3360
63 Ga0070674_100063730 3300005356 Bacteria 2581
64 Ga0070674_100354621 3300005356 Bacteria 1186
65 Ga0070673_100002947 3300005364 Bacteria 10491
66 Ga0070673_100022385 3300005364 Bacteria 4598
67 Ga0070673_100028531 3300005364 Bacteria 4152
68 Ga0070673_100107848 3300005364 Bacteria 2304
69 Ga0070688_100062634 3300005365 Bacteria 2355
70 Ga0070659_100019462 3300005366 Bacteria 5145
71 Ga0070659_100512291 3300005366 Bacteria 1024
72 Ga0070667_100009011 3300005367 Bacteria 8258
73 Ga0070667_100051335 3300005367 Bacteria 3477
74 Ga0070667_100316176 3300005367 Bacteria 1408
75 Ga0070667_100623018 3300005367 Bacteria 995
76 Ga0070701_10032610 3300005438 Bacteria 2596
77 Ga0070708_100026951 3300005445 Bacteria 4925
78 Ga0070708_100037495 3300005445 Bacteria 4230
79 Ga0070663_100180143 3300005455 Bacteria 1638
80 Ga0070678_100012118 3300005456 Bacteria 5345
81 Ga0070678_100039515 3300005456 Bacteria 3330
82 Ga0070678_100083966 3300005456 Bacteria 2422
83 Ga0070678_100270210 3300005456 Bacteria 1433
84 Ga0070662_100005664 3300005457 Bacteria 7993
85 Ga0070662_100089285 3300005457 Bacteria 2312
86 Ga0070662_100097010 3300005457 Bacteria 2224
87 Ga0070662_100175827 3300005457 Bacteria 1684
88 Ga0070662_100583782 3300005457 Bacteria 939
89 Ga0070681_10643798 3300005458 Bacteria 975
90 Ga0068867_100000054 3300005459 Bacteria 69032
91 Ga0068867_100013078 3300005459 Bacteria 5874
92 Ga0068867_100017469 3300005459 Bacteria 5096
93 Ga0068867_100061634 3300005459 Bacteria 2785
94 Ga0068867_100074187 3300005459 Bacteria 2549
95 Ga0068867_100139198 3300005459 Bacteria 1895
96 Ga0068867_100175340 3300005459 Bacteria 1701
97 Ga0068867_100247824 3300005459 Bacteria 1447
98 Ga0070706_100008790 3300005467 Bacteria 9412
99 Ga0070707_100020166 3300005468 Bacteria 6285
100 Ga0070698_100001400 3300005471 Bacteria 26710
101 Ga0070698_100033168 3300005471 Bacteria 5348
102 Ga0070679_100006933 3300005530 Bacteria 10571
103 Ga0070684_100256631 3300005535 Bacteria 1598
104 Ga0070684_100459104 3300005535 Bacteria 1178
105 Ga0068853_100199965 3300005539 Bacteria 1818
106 Ga0068853_100213524 3300005539 Bacteria 1759
107 Ga0068853_100304671 3300005539 Bacteria 1473
108 Ga0070672_100002237 3300005543 Bacteria 12196
109 Ga0070672_100003401 3300005543 Bacteria 10316
110 Ga0070672_100004578 3300005543 Bacteria 9055
111 Ga0070672_100011963 3300005543 Bacteria 6068
112 Ga0070672_100021611 3300005543 Bacteria 4712
113 Ga0070672_100023520 3300005543 Bacteria 4543
114 Ga0070672_100040316 3300005543 Bacteria 3582
115 Ga0070672_100092452 3300005543 Bacteria 2442
116 Ga0070672_100128392 3300005543 Bacteria 2081
117 Ga0070672_100155383 3300005543 Bacteria 1894
118 Ga0070672_100293307 3300005543 Bacteria 1377
119 Ga0070672_100302128 3300005543 Bacteria 1357
120 Ga0070693_100061204 3300005547 Bacteria 2188
121 Ga0070665_100038031 3300005548 Bacteria 4837
122 Ga0070665_100438923 3300005548 Bacteria 1315
123 Ga0070665_100582737 3300005548 Bacteria 1131
124 Ga0070665_100634276 3300005548 Bacteria 1082
125 Ga0068855_100161204 3300005563 Bacteria 2545
126 Ga0070664_100002952 3300005564 Bacteria 13754
127 Ga0070664_100253203 3300005564 Bacteria 1583
128 Ga0070664_100645611 3300005564 Bacteria 983
129 Ga0068857_100175120 3300005577 Bacteria 1951
130 Ga0068857_100271455 3300005577 Bacteria 1559
131 Ga0068854_100108970 3300005578 Bacteria 2086
132 Ga0068854_100477116 3300005578 Bacteria 1046
133 Ga0068856_100032045 3300005614 Bacteria 5144
134 Ga0068856_100142022 3300005614 Bacteria 2408
135 Ga0068856_100303839 3300005614 Bacteria 1613
136 Ga0068852_100011556 3300005616 Bacteria 6655
137 Ga0068852_100065358 3300005616 Bacteria 3173
138 Ga0068852_100077781 3300005616 Bacteria 2933
139 Ga0068852_100136227 3300005616 Bacteria 2267
140 Ga0068852_100169633 3300005616 Bacteria 2044
141 Ga0068852_100180959 3300005616 Bacteria 1982
142 Ga0068852_100227482 3300005616 Bacteria 1777
143 Ga0068852_100416451 3300005616 Bacteria 1324
144 Ga0068852_100526912 3300005616 Bacteria 1179
145 Ga0068852_100749468 3300005616 Bacteria 989
146 Ga0068859_100010521 3300005617 Bacteria 9310
147 Ga0068859_100076039 3300005617 Bacteria 3399
148 Ga0068859_100656874 3300005617 Bacteria 1140
149 Ga0068864_100001865 3300005618 Bacteria 17299
150 Ga0068864_100003674 3300005618 Bacteria 12677
151 Ga0068864_100014639 3300005618 Bacteria 6516
152 Ga0068864_100103122 3300005618 Bacteria 2532
153 Ga0068864_100277743 3300005618 Bacteria 1562
154 Ga0068864_100284407 3300005618 Bacteria 1544
155 Ga0068864_100392548 3300005618 Bacteria 1317
156 Ga0068866_10003009 3300005718 Bacteria 6961
157 Ga0068866_10078229 3300005718 Bacteria 1769
158 Ga0068866_10103754 3300005718 Bacteria 1573
159 Ga0068861_100018459 3300005719 Bacteria 4970
160 Ga0068861_100044597 3300005719 Bacteria 3335
161 Ga0068861_100048758 3300005719 Bacteria 3203
162 Ga0068851_10033053 3300005834 Bacteria 2576
163 Ga0068851_10033318 3300005834 Bacteria 2567
164 Ga0068851_10033722 3300005834 Bacteria 2553
165 Ga0068851_10125101 3300005834 Bacteria 1385
166 Ga0068870_10088594 3300005840 Bacteria 1726
167 Ga0068863_100002188 3300005841 Bacteria 19393
168 Ga0068863_100015545 3300005841 Bacteria 7311
169 Ga0068863_100034885 3300005841 Bacteria 4792
170 Ga0068863_100152686 3300005841 Bacteria 2210
171 Ga0068863_100277051 3300005841 Bacteria 1624
172 Ga0068858_100006780 3300005842 Bacteria 11140
173 Ga0068858_100009570 3300005842 Bacteria 9245
174 Ga0068858_100026038 3300005842 Bacteria 5439
175 Ga0068858_100106510 3300005842 Bacteria 2617
176 Ga0068860_100074770 3300005843 Bacteria 3222
177 Ga0068860_100124430 3300005843 Bacteria 2471
178 Ga0068860_100365033 3300005843 Bacteria 1423
179 Ga0068862_100066838 3300005844 Bacteria 3098
180 Ga0068862_100080500 3300005844 Bacteria 2824
181 Ga0081539_10006995 3300005985 Bacteria 10470
182 Ga0075365_10021734 3300006038 Bacteria 4008
183 Ga0075368_10029292 3300006042 Bacteria 2128
184 Ga0075363_100038490 3300006048 Bacteria 2515
185 Ga0075362_10004317 3300006177 Bacteria 5088
186 Ga0075362_10004366 3300006177 Bacteria 5070
187 Ga0075362_10018675 3300006177 Bacteria 2872
188 Ga0075367_10029814 3300006178 Bacteria 3124
189 Ga0075367_10038321 3300006178 Bacteria 2790
190 Ga0075367_10109982 3300006178 Bacteria 1691
191 Ga0075369_10000085 3300006186 Bacteria 24796
192 Ga0075369_10048661 3300006186 Bacteria 1830
193 Ga0075369_10075604 3300006186 Bacteria 1488
194 Ga0075366_10003063 3300006195 Bacteria 8731
195 Ga0075366_10035028 3300006195 Bacteria 2959
196 Ga0075366_10068020 3300006195 Bacteria 2120
197 Ga0075366_10079226 3300006195 Bacteria 1961
198 Ga0075366_10079352 3300006195 Bacteria 1959
199 Ga0075366_10121040 3300006195 Bacteria 1577
200 Ga0075366_10139123 3300006195 Bacteria 1467
201 Ga0075366_10317915 3300006195 Bacteria 953
202 Ga0097621_100025701 3300006237 Bacteria 4609
203 Ga0097621_100049541 3300006237 Bacteria 3413
204 Ga0097621_100075809 3300006237 Bacteria 2788
205 Ga0097621_100199701 3300006237 Bacteria 1735
206 Ga0097621_100286768 3300006237 Bacteria 1450
207 Ga0097621_100595616 3300006237 Bacteria 1010
208 Ga0075370_10002925 3300006353 Bacteria 8026
209 Ga0075370_10017191 3300006353 Bacteria 3904
210 Ga0075370_10021997 3300006353 Bacteria 3497
211 Ga0075370_10048720 3300006353 Bacteria 2401
212 Ga0075370_10058506 3300006353 Bacteria 2192
213 Ga0075370_10084214 3300006353 Bacteria 1830
214 Ga0075370_10100631 3300006353 Bacteria 1672
215 Ga0075370_10200673 3300006353 Bacteria 1176
216 Ga0068871_100016932 3300006358 Bacteria 5503
217 Ga0068871_100053607 3300006358 Bacteria 3269
218 Ga0068871_100092690 3300006358 Bacteria 2520
219 Ga0068871_100166655 3300006358 Bacteria 1886
220 Ga0068871_100505753 3300006358 Bacteria 1090
221 Ga0068871_100656889 3300006358 Bacteria 958
222 Ga0075434_100085072 3300006871 Bacteria 3162
223 Ga0068865_100003515 3300006881 Bacteria 9390
224 Ga0097620_100010521 3300006931 Bacteria 9310
225 Ga0097620_100076044 3300006931 Bacteria 3399
226 Ga0097620_100656825 3300006931 Bacteria 1140
227 Ga0105240_10349065 3300009093 Bacteria 1679
228 Ga0105240_10776773 3300009093 Bacteria 1039
229 Ga0111539_10619043 3300009094 Bacteria 1261
230 Ga0105245_10012609 3300009098 Bacteria 7360
231 Ga0105245_10122546 3300009098 Bacteria 2430
232 Ga0105245_10247549 3300009098 Bacteria 1730
233 Ga0105245_10365998 3300009098 Bacteria 1432
234 Ga0105245_10395783 3300009098 Bacteria 1379
235 Ga0105245_10654783 3300009098 Bacteria 1081
236 Ga0105243_10001958 3300009148 Bacteria 17540
237 Ga0105243_10004681 3300009148 Bacteria 10771
238 Ga0105243_10028668 3300009148 Bacteria 4275
239 Ga0105243_10201008 3300009148 Bacteria 1747
240 Ga0105242_10145657 3300009176 Bacteria 2060
241 Ga0105242_10528934 3300009176 Bacteria 1126
242 Ga0105248_10013962 3300009177 Bacteria 8838
243 Ga0105248_10147698 3300009177 Bacteria 2653
244 Ga0105248_10162648 3300009177 Bacteria 2517
245 Ga0105248_10223089 3300009177 Bacteria 2122
246 Ga0105248_10255495 3300009177 Bacteria 1973
247 Ga0105248_10541175 3300009177 Bacteria 1314
248 Ga0105237_10195060 3300009545 Bacteria 2025
249 Ga0105237_10204649 3300009545 Bacteria 1974
250 Ga0105237_10633006 3300009545 Bacteria 1076
251 Ga0105238_10414647 3300009551 Bacteria 1341
252 Ga0105238_10456281 3300009551 Bacteria 1275
253 Ga0105249_10082666 3300009553 Bacteria 2988
254 Ga0105249_10307854 3300009553 Bacteria 1591
255 Ga0105249_10515295 3300009553 Bacteria 1243
256 Ga0099796_10005772 3300010159 Bacteria 3115
257 Ga0105239_10058034 3300010375 Bacteria 4246
258 Ga0105239_10186248 3300010375 Bacteria 2323
259 Ga0157373_10084121 3300013100 Bacteria 2243
260 Ga0157371_10055892 3300013102 Bacteria 2800
261 Ga0157369_10267110 3300013105 Bacteria 1784
262 Ga0157369_10593365 3300013105 Bacteria 1144
263 Ga0157374_10014591 3300013296 Bacteria 6877
264 Ga0157374_10221924 3300013296 Bacteria 1855
265 Ga0157374_10300457 3300013296 Bacteria 1588
266 Ga0157374_10409525 3300013296 Bacteria 1353
267 Ga0157378_10077771 3300013297 Bacteria 2991
268 Ga0157378_10254140 3300013297 Bacteria 1683
269 Ga0157378_10402457 3300013297 Bacteria 1349
270 Ga0157378_10546239 3300013297 Bacteria 1163
271 Ga0163162_10001899 3300013306 Bacteria 19688
272 Ga0163162_10039484 3300013306 Bacteria 4717
273 Ga0163162_10202405 3300013306 Bacteria 2114
274 Ga0163162_10578962 3300013306 Bacteria 1250
275 Ga0163162_10819503 3300013306 Bacteria 1047
276 Ga0163162_10849289 3300013306 Bacteria 1028
277 Ga0157372_10013839 3300013307 Bacteria 8615
278 Ga0157372_10277966 3300013307 Bacteria 1947
279 Ga0157375_10003962 3300013308 Bacteria 12842
280 Ga0157375_10007962 3300013308 Bacteria 9277
281 Ga0157375_10120373 3300013308 Bacteria 2734
282 Ga0157375_10161085 3300013308 Bacteria 2385
283 Ga0157375_10205825 3300013308 Bacteria 2124
284 Ga0157375_10507543 3300013308 Bacteria 1370
285 Ga0163163_10005652 3300014325 Bacteria 10842
286 Ga0163163_10061752 3300014325 Bacteria 3713
287 Ga0163163_10553258 3300014325 Bacteria 1213
288 Ga0157380_10015912 3300014326 Bacteria 5535
289 Ga0157380_10215482 3300014326 Bacteria 1714
290 Ga0157377_10000006 3300014745 Bacteria 419853
291 Ga0157377_10052154 3300014745 Bacteria 2309
292 Ga0157377_10188544 3300014745 Bacteria 1302
293 Ga0157379_10001468 3300014968 Bacteria 19438
294 Ga0157379_10002316 3300014968 Bacteria 15874
295 Ga0157379_10025561 3300014968 Bacteria 5247
296 Ga0157379_10072598 3300014968 Bacteria 3079
297 Ga0157379_10300247 3300014968 Bacteria 1463
298 Ga0157379_10352645 3300014968 Bacteria 1347
299 Ga0157376_10063532 3300014969 Bacteria 3111
300 Ga0157376_10075227 3300014969 Bacteria 2881
301 Ga0163161_10031949 3300017792 Bacteria 3755
302 Ga0163161_10036806 3300017792 Bacteria 3506
303 Ga0163161_10348979 3300017792 Bacteria 1176
304 Ga0213876_10060172 3300021384 Bacteria 2004
305 Ga0213876_10115123 3300021384 Bacteria 1427
306 Ga0207425_1000302 3300025245 Bacteria 35962
307 Ga0209129_1000158 3300025258 Bacteria 103711
308 Ga0209673_1033276 3300025273 Bacteria 1575
309 Ga0209564_1000282 3300025295 Bacteria 103837
310 Ga0209758_1000500 3300025297 Bacteria 63618
311 Ga0209758_1000630 3300025297 Bacteria 54005
312 Ga0209050_1000223 3300025298 Bacteria 125465
313 Ga0207697_10016870 3300025315 Bacteria 3005
314 Ga0207697_10071341 3300025315 Bacteria 1455
315 Ga0207656_10022904 3300025321 Bacteria 2510
316 Ga0207682_10042590 3300025893 Bacteria 1855
317 Ga0207682_10080051 3300025893 Bacteria 1399
318 Ga0207642_10046230 3300025899 Bacteria 1938
319 Ga0207642_10046513 3300025899 Bacteria 1934
320 Ga0207710_10130760 3300025900 Bacteria 1205
321 Ga0207688_10060401 3300025901 Bacteria 2135
322 Ga0207688_10190790 3300025901 Bacteria 1225
323 Ga0207680_10025936 3300025903 Bacteria 3240
324 Ga0207680_10256189 3300025903 Bacteria 1210
325 Ga0207645_10046365 3300025907 Bacteria 2777
326 Ga0207645_10049550 3300025907 Bacteria 2682
327 Ga0207645_10128492 3300025907 Bacteria 1648
328 Ga0207643_10022089 3300025908 Bacteria 3501
329 Ga0207643_10060815 3300025908 Bacteria 2157
330 Ga0207705_10234014 3300025909 Bacteria 1398
331 Ga0207684_10002610 3300025910 Bacteria 18019
332 Ga0207684_10298425 3300025910 Bacteria 1389
333 Ga0207654_10237821 3300025911 Bacteria 1216
334 Ga0207707_10524278 3300025912 Bacteria 1009
335 Ga0207695_10201497 3300025913 Bacteria 1904
336 Ga0207671_10093340 3300025914 Bacteria 2270
337 Ga0207671_10163429 3300025914 Bacteria 1725
338 Ga0207660_10007163 3300025917 Bacteria 7222
339 Ga0207657_10030102 3300025919 Bacteria 4932
340 Ga0207657_10094413 3300025919 Bacteria 2491
341 Ga0207649_10005844 3300025920 Bacteria 6665
342 Ga0207652_10042834 3300025921 Bacteria 3854
343 Ga0207646_10110916 3300025922 Bacteria 2462
344 Ga0207681_10000162 3300025923 Bacteria 55291
345 Ga0207681_10014276 3300025923 Bacteria 4932
346 Ga0207681_10032620 3300025923 Bacteria 3411
347 Ga0207681_10033129 3300025923 Bacteria 3386
348 Ga0207681_10065120 3300025923 Bacteria 2518
349 Ga0207681_10224028 3300025923 Bacteria 1456
350 Ga0207694_10093653 3300025924 Bacteria 2373
351 Ga0207650_10000382 3300025925 Bacteria 41562
352 Ga0207650_10000754 3300025925 Bacteria 24910
353 Ga0207650_10093215 3300025925 Bacteria 2305
354 Ga0207659_10000204 3300025926 Bacteria 35509
355 Ga0207659_10003968 3300025926 Bacteria 8929
356 Ga0207659_10006399 3300025926 Bacteria 7212
357 Ga0207659_10009378 3300025926 Bacteria 6112
358 Ga0207659_10031152 3300025926 Bacteria 3648
359 Ga0207659_10046267 3300025926 Bacteria 3071
360 Ga0207659_10068395 3300025926 Bacteria 2583
361 Ga0207659_10083175 3300025926 Bacteria 2372
362 Ga0207687_10021190 3300025927 Bacteria 4316
363 Ga0207687_10299085 3300025927 Bacteria 1296
364 Ga0207687_10328336 3300025927 Bacteria 1240
365 Ga0207687_10372891 3300025927 Bacteria 1167
366 Ga0207644_10000236 3300025931 Bacteria 37953
367 Ga0207644_10004066 3300025931 Bacteria 9485
368 Ga0207644_10028206 3300025931 Bacteria 3884
369 Ga0207644_10036202 3300025931 Bacteria 3463
370 Ga0207644_10044009 3300025931 Bacteria 3170
371 Ga0207644_10076148 3300025931 Bacteria 2468
372 Ga0207690_10273473 3300025932 Bacteria 1313
373 Ga0207706_10007280 3300025933 Bacteria 10230
374 Ga0207706_10037126 3300025933 Bacteria 4327
375 Ga0207706_10067468 3300025933 Bacteria 3147
376 Ga0207706_10096910 3300025933 Bacteria 2594
377 Ga0207686_10096350 3300025934 Bacteria 1966
378 Ga0207686_10148715 3300025934 Bacteria 1628
379 Ga0207686_10167968 3300025934 Bacteria 1544
380 Ga0207709_10007856 3300025935 Bacteria 5914
381 Ga0207709_10010271 3300025935 Bacteria 5157
382 Ga0207709_10049010 3300025935 Bacteria 2576
383 Ga0207709_10136119 3300025935 Bacteria 1682
384 Ga0207669_10023239 3300025937 Bacteria 3308
385 Ga0207669_10077110 3300025937 Bacteria 2118
386 Ga0207669_10195918 3300025937 Bacteria 1462
387 Ga0207704_10004815 3300025938 Bacteria 6193
388 Ga0207691_10008820 3300025940 Bacteria 9674
389 Ga0207691_10010845 3300025940 Bacteria 8746
390 Ga0207691_10022374 3300025940 Bacteria 5962
391 Ga0207691_10065023 3300025940 Bacteria 3303
392 Ga0207691_10067702 3300025940 Bacteria 3228
393 Ga0207691_10185830 3300025940 Bacteria 1814
394 Ga0207691_10214838 3300025940 Bacteria 1669
395 Ga0207691_10217763 3300025940 Bacteria 1656
396 Ga0207691_10313507 3300025940 Bacteria 1346
397 Ga0207691_10354666 3300025940 Bacteria 1255
398 Ga0207711_10019439 3300025941 Bacteria 5655
399 Ga0207711_10055718 3300025941 Bacteria 3394
400 Ga0207711_10119531 3300025941 Bacteria 2351
401 Ga0207711_10428204 3300025941 Bacteria 1231
402 Ga0207711_10444042 3300025941 Bacteria 1207
403 Ga0207689_10000996 3300025942 Bacteria 27158
404 Ga0207689_10039049 3300025942 Bacteria 3930
405 Ga0207689_10083161 3300025942 Bacteria 2632
406 Ga0207689_10593914 3300025942 Bacteria 931
407 Ga0207661_10197145 3300025944 Bacteria 1768
408 Ga0207679_10016215 3300025945 Bacteria 4943
409 Ga0207679_10509009 3300025945 Bacteria 1075
410 Ga0207679_10630811 3300025945 Bacteria 968
411 Ga0207679_10678524 3300025945 Bacteria 934
412 Ga0207651_10000175 3300025960 Bacteria 27877
413 Ga0207651_10001535 3300025960 Bacteria 10540
414 Ga0207651_10009344 3300025960 Bacteria 5360
415 Ga0207651_10042464 3300025960 Bacteria 3026
416 Ga0207651_10138750 3300025960 Bacteria 1874
417 Ga0207651_10299112 3300025960 Bacteria 1337
418 Ga0207651_10305691 3300025960 Bacteria 1324
419 Ga0207712_10022242 3300025961 Bacteria 4172
420 Ga0207668_10007819 3300025972 Bacteria 6361
421 Ga0207668_10023396 3300025972 Bacteria 3969
422 Ga0207668_10088303 3300025972 Bacteria 2270
423 Ga0207668_10597638 3300025972 Bacteria 961
424 Ga0207640_10180524 3300025981 Bacteria 1582
425 Ga0207658_10000181 3300025986 Bacteria 67700
426 Ga0207658_10005878 3300025986 Bacteria 8390
427 Ga0207658_10169038 3300025986 Bacteria 1799
428 Ga0207658_10245744 3300025986 Bacteria 1518
429 Ga0207677_10005136 3300026023 Bacteria 7084
430 Ga0207677_10015401 3300026023 Bacteria 4497
431 Ga0207677_10113321 3300026023 Bacteria 2024
432 Ga0207677_10153693 3300026023 Bacteria 1779
433 Ga0207703_10001940 3300026035 Bacteria 18305
434 Ga0207703_10003292 3300026035 Bacteria 13554
435 Ga0207703_10004491 3300026035 Bacteria 11456
436 Ga0207703_10063519 3300026035 Bacteria 3028
437 Ga0207703_10224404 3300026035 Bacteria 1682
438 Ga0207639_10107951 3300026041 Bacteria 2262
439 Ga0207639_10272739 3300026041 Bacteria 1485
440 Ga0207639_10368718 3300026041 Bacteria 1287
441 Ga0207678_10032683 3300026067 Bacteria 4535
442 Ga0207678_10043973 3300026067 Bacteria 3865
443 Ga0207678_10135866 3300026067 Bacteria 2098
444 Ga0207678_10245976 3300026067 Bacteria 1532
445 Ga0207708_10104594 3300026075 Bacteria 2194
446 Ga0207702_10012210 3300026078 Bacteria 7148
447 Ga0207702_10179161 3300026078 Bacteria 1950
448 Ga0207641_10001945 3300026088 Bacteria 19820
449 Ga0207641_10008762 3300026088 Bacteria 8356
450 Ga0207641_10171371 3300026088 Bacteria 1981
451 Ga0207641_10410810 3300026088 Bacteria 1301
452 Ga0207648_10000254 3300026089 Bacteria 57696
453 Ga0207648_10006063 3300026089 Bacteria 12052
454 Ga0207648_10011724 3300026089 Bacteria 8243
455 Ga0207648_10017985 3300026089 Bacteria 6409
456 Ga0207648_10025241 3300026089 Bacteria 5295
457 Ga0207648_10037669 3300026089 Bacteria 4260
458 Ga0207648_10044748 3300026089 Bacteria 3884
459 Ga0207648_10442264 3300026089 Bacteria 1183
460 Ga0207676_10000459 3300026095 Bacteria 34117
461 Ga0207676_10004639 3300026095 Bacteria 9727
462 Ga0207676_10092427 3300026095 Bacteria 2488
463 Ga0207674_10007474 3300026116 Bacteria 12734
464 Ga0207674_10200584 3300026116 Bacteria 1944
465 Ga0207674_10213474 3300026116 Bacteria 1878
466 Ga0207674_10244585 3300026116 Bacteria 1741
467 Ga0207674_10297656 3300026116 Bacteria 1562
468 Ga0207675_100004099 3300026118 Bacteria 14104
469 Ga0207675_100008352 3300026118 Bacteria 9756
470 Ga0207675_100034268 3300026118 Bacteria 4733
471 Ga0207675_100451451 3300026118 Bacteria 1274
472 Ga0207683_10001583 3300026121 Bacteria 20527
473 Ga0207683_10003340 3300026121 Bacteria 13988
474 Ga0207683_10187716 3300026121 Bacteria 1876
475 Ga0207683_10292796 3300026121 Bacteria 1489
476 Ga0207683_10316733 3300026121 Bacteria 1428
477 Ga0207698_10012242 3300026142 Bacteria 5604
478 Ga0207698_10044685 3300026142 Bacteria 3331
479 Ga0207698_10152355 3300026142 Bacteria 2009
480 Ga0207698_10161229 3300026142 Bacteria 1961
481 Ga0207698_10368196 3300026142 Bacteria 1363
482 Ga0209813_10079002 3300027866 Bacteria 1084
483 Ga0209974_10000572 3300027876 Bacteria 12285
484 Ga0268266_10168039 3300028379 Bacteria 1989
485 Ga0268266_10313015 3300028379 Bacteria 1467
486 Ga0268266_10340147 3300028379 Bacteria 1408
487 Ga0268266_10496754 3300028379 Bacteria 1164
488 Ga0268265_10015703 3300028380 Bacteria 5187
489 Ga0268265_10069832 3300028380 Bacteria 2729
490 Ga0268264_10001738 3300028381 Bacteria 20024
491 Ga0268264_10083069 3300028381 Bacteria 2743
492 Ga0268264_10155269 3300028381 Bacteria 2056
493 Ga0268264_10328773 3300028381 Bacteria 1448
494 Ga0307517_10004361 3300028786 Bacteria 21778
495 Ga0307517_10160963 3300028786 Bacteria 1507
496 Ga0307515_10000911 3300028794 Bacteria 68106
497 Ga0307515_10002263 3300028794 Bacteria 42131
498 Ga0307515_10002980 3300028794 Bacteria 35948
499 Ga0307515_10007802 3300028794 Bacteria 21061
500 Ga0307515_10034317 3300028794 Bacteria 8313
501 Ga0307515_10093328 3300028794 Bacteria 3733
502 Ga0307515_10125748 3300028794 Bacteria 2865
503 Ga0307515_10319198 3300028794 Bacteria 1221
504 Ga0307512_10008490 3300030522 Bacteria 10003
505 Ga0307512_10015306 3300030522 Bacteria 7117
506 Ga0307512_10043701 3300030522 Bacteria 3692
507 Ga0307512_10076911 3300030522 Bacteria 2429
508 Ga0307512_10172472 3300030522 Bacteria 1236
509 Ga0307512_10197122 3300030522 Bacteria 1098
510 Ga0265327_10027464 3300031251 Bacteria 3275
511 Ga0307513_10013217 3300031456 Bacteria 10135
512 Ga0307513_10041281 3300031456 Bacteria 5094
513 Ga0307509_10001647 3300031507 Bacteria 37422
514 Ga0307509_10010682 3300031507 Bacteria 11203
515 Ga0307509_10012990 3300031507 Bacteria 9893
516 Ga0307509_10028187 3300031507 Bacteria 6246
517 Ga0307509_10058927 3300031507 Bacteria 4064
518 Ga0307509_10076354 3300031507 Bacteria 3477
519 Ga0307509_10146968 3300031507 Bacteria 2281
520 Ga0307408_100377317 3300031548 Bacteria 1211
521 Ga0307508_10000101 3300031616 Bacteria 100858
522 Ga0307508_10041346 3300031616 Bacteria 4137
523 Ga0307508_10043133 3300031616 Bacteria 4042
524 Ga0307508_10095632 3300031616 Bacteria 2561
525 Ga0307514_10009380 3300031649 Bacteria 8236
526 Ga0307514_10015754 3300031649 Bacteria 6233
527 Ga0307514_10027344 3300031649 Bacteria 4608
528 Ga0307514_10095565 3300031649 Bacteria 2149
529 Ga0307516_10000394 3300031730 Bacteria 57048
530 Ga0307516_10004894 3300031730 Bacteria 16300
531 Ga0307516_10005007 3300031730 Bacteria 16073
532 Ga0307516_10080188 3300031730 Bacteria 3108
533 Ga0307516_10115443 3300031730 Bacteria 2481
534 Ga0307516_10127244 3300031730 Bacteria 2331
535 Ga0307516_10278211 3300031730 Bacteria 1356
536 Ga0307516_10347117 3300031730 Bacteria 1150
537 Ga0307405_10002583 3300031731 Bacteria 8033
538 Ga0307413_10606873 3300031824 Bacteria 896
539 Ga0307518_10061365 3300031838 Bacteria 2730
540 Ga0307410_10034667 3300031852 Bacteria 3271
541 Ga0307407_10189634 3300031903 Bacteria 1369
542 Ga0307412_10001564 3300031911 Bacteria 12595
543 Ga0307412_10482582 3300031911 Bacteria 1028
544 Ga0307409_100215767 3300031995 Bacteria 1728
545 Ga0307416_100343687 3300032002 Bacteria 1506
546 Ga0307414_10040943 3300032004 Bacteria 3133
547 Ga0307411_10002722 3300032005 Bacteria 7930
548 Ga0307411_10055879 3300032005 Bacteria 2599
549 Ga0307411_10385444 3300032005 Bacteria 1154
550 Ga0307415_100173641 3300032126 Bacteria 1683
551 Ga0307507_10064419 3300033179 Bacteria 3383
552 Ga0307507_10084296 3300033179 Bacteria 2771
553 Ga0307510_10018239 3300033180 Bacteria 8262
554 Ga0307510_10038889 3300033180 Bacteria 5251
555 Ga0307510_10043177 3300033180 Bacteria 4903
556 Ga0307510_10054969 3300033180 Bacteria 4162
557 Ga0373940_0060066 3300035088 Bacteria 1086
558 Ga0373953_0021688 3300035117 Bacteria 2414
559 Ga0373946_0079609 3300035171 Bacteria 1432
560 Ga0373931_0003906 3300035691 Bacteria 6739
561 Ga0373931_0004827 3300035691 Bacteria 6191
562 Ga0373931_0462038 3300035691 Bacteria 813
563 Ga0373937_0018749 3300036401 Bacteria 6185
564 Ga0373937_0058153 3300036401 Bacteria 3552
565 Ga0373937_0329761 3300036401 Bacteria 1444
566 Ga0373937_0536810 3300036401 Bacteria 1111
567 Ga0395905_0063276 3300037471 Bacteria 3461
568 Ga0436365_0359116 3300039437 Bacteria 4582
569 Ga0436361_0493106 3300039447 Bacteria 1951
570 Ga0436363_0700246 3300039450 Bacteria 3126
571 Ga0451795_0627575 3300041456 Bacteria 1362
572 Ga0451802_1369130 3300041460 Bacteria 1133
573 Ga0450918_000126 3300042531 Bacteria 16451
574 Ga0466969_0022247 3300044656 Bacteria 3273
575 Ga0466961_0061111 3300044693 Bacteria 2394
576 Ga0453684_0226562 3300044712 Bacteria 2161
577 Ga0466971_0043006 3300044719 Bacteria 2030
578 Ga0466970_0153506 3300044765 Bacteria 1272
579 Ga0466957_0044543 3300044842 Bacteria 2689
580 Ga0466960_0074485 3300044901 Bacteria 1696
581 Ga0451576_0213295 3300045051 Bacteria 2016
582 Ga0451576_0463418 3300045051 Bacteria 1331
583 Ga0495592_0038461 3300046454 Bacteria 3600
584 Ga0495590_0001361 3300046457 Bacteria 10613
585 Ga0495638_0045454 3300046460 Bacteria 2762
586 Ga0495641_0133279 3300046461 Bacteria 1109
587 Ga0495582_0193012 3300046473 Bacteria 1162
588 Ga0495606_0168850 3300046507 Bacteria 1271
589 Ga0495606_0324451 3300046507 Bacteria 826
590 Ga0495610_0040317 3300046512 Bacteria 2355
591 Ga0495620_0038992 3300046515 Bacteria 2104
592 Ga0495632_0052575 3300046519 Bacteria 2002
593 Ga0495632_0061943 3300046519 Bacteria 1814
594 Ga0495632_0120333 3300046519 Bacteria 1227
595 Ga0495643_0028131 3300046522 Bacteria 3155
596 Ga0495648_0059864 3300046524 Bacteria 2269
597 Ga0495666_0009201 3300046526 Bacteria 4939
598 Ga0495609_0113743 3300046538 Bacteria 1167
599 Ga0495621_0050964 3300046539 Bacteria 1480
600 Ga0495621_0084366 3300046539 Bacteria 1189
601 Ga0495621_0097672 3300046539 Bacteria 1114
602 Ga0495597_0017952 3300046542 Bacteria 3323
603 Ga0495597_0064827 3300046542 Bacteria 1586
604 Ga0495645_0096454 3300046543 Bacteria 2107
605 Ga0495668_0093447 3300046616 Bacteria 1647
606 Ga0495625_0002419 3300046660 Bacteria 20222
607 Ga0495625_0018284 3300046660 Bacteria 5475
608 Ga0495635_0133585 3300046663 Bacteria 1692
609 Ga0495657_0380110 3300046675 Bacteria 833
610 Ga0495647_0178235 3300046681 Bacteria 923
611 Ga0495658_0004477 3300046683 Bacteria 6874
612 Ga0495658_0197604 3300046683 Bacteria 1252
613 Ga0495658_0199547 3300046683 Bacteria 1246
614 Ga0495658_0212033 3300046683 Bacteria 1210
615 Ga0495613_0097650 3300046689 Bacteria 2123
616 Ga0495624_0022385 3300046690 Bacteria 4177
617 Ga0495649_0004222 3300046694 Bacteria 9424
618 Ga0495660_0070270 3300046810 Bacteria 1859
619 Ga0495674_0298307 3300047319 Bacteria 1317
620 Ga0495676_0097621 3300047321 Bacteria 2182
621 Ga0495687_000761 3300047443 Bacteria 34838
622 Ga0495687_003669 3300047443 Bacteria 10931
623 Ga0495687_010060 3300047443 Bacteria 5219
624 Ga0495687_026673 3300047443 Bacteria 2715
625 Ga0495675_0181189 3300047444 Bacteria 1290
626 Ga0495677_0100876 3300047445 Bacteria 1093
627 Ga0495686_0003001 3300047472 Bacteria 14998
628 Ga0495593_0027579 3300047673 Bacteria 3125
629 Ga0495602_0235640 3300048088 Bacteria 1372
630 Ga0496100_0663588 3300048903 Bacteria 812
631 Ga0496101_0184606 3300048904 Bacteria 1607
632 Ga0496101_0243385 3300048904 Bacteria 1400
633 Ga0496102_0006650 3300048905 Bacteria 9882
634 Ga0496104_0050692 3300048907 Bacteria 3917
635 Ga0496104_0235830 3300048907 Bacteria 1741
636 Ga0496105_0156926 3300048908 Bacteria 1869
637 Ga0496106_0007661 3300048909 Bacteria 7986
638 Ga0496106_0197714 3300048909 Bacteria 1600
639 Ga0496106_0273000 3300048909 Bacteria 1354
640 Ga0496107_0105164 3300048910 Bacteria 2072
641 Ga0496108_0056965 3300048911 Bacteria 3284
642 Ga0496108_0130532 3300048911 Bacteria 2160
643 Ga0496109_0118533 3300048912 Bacteria 2464
644 Ga0496110_0034706 3300048913 Bacteria 4372
645 Ga0496111_0257705 3300048914 Bacteria 1294
646 Ga0496112_0206036 3300048915 Bacteria 1925
647 Ga0496113_0498914 3300048916 Bacteria 977
648 Ga0496114_0119780 3300048917 Bacteria 2263
649 Ga0496115_0094142 3300048918 Bacteria 2451
650 Ga0496121_0029040 3300048924 Bacteria 5128
651 Ga0501298_029343 3300049521 Bacteria 1072
652 Ga0501042_0154730 3300049578 Bacteria 1654
653 Ga0501043_0005821 3300049579 Bacteria 9914
654 Ga0501046_0007722 3300049580 Bacteria 9430
655 Ga0501047_0008175 3300049581 Bacteria 9880
656 Ga0501048_0005642 3300049582 Bacteria 9519
657 Ga0501044_0412661 3300049823 Bacteria 1261
658 Ga0501045_0004845 3300049824 Bacteria 9310
659 nmdc:mga03683_19828_c1 3300050489 Bacteria 2572
660 nmdc:mga03683_8328_c1 3300050489 Bacteria 3641
661 nmdc:mga0yw44_20132_c1 3300050492 Bacteria 3697
662 nmdc:mga0k408_100661_c1 3300050493 Bacteria 1704
663 nmdc:mga0k408_100737_c2 3300050493 Bacteria 1001
664 nmdc:mga0k408_119654_c1 3300050493 Bacteria 1559
665 nmdc:mga0k408_17713_c1 3300050493 Bacteria 2978
666 nmdc:mga0k408_2426_c1 3300050493 Bacteria 9910
667 nmdc:mga0k408_295893_c1 3300050493 Bacteria 966
668 nmdc:mga0k408_3909_c1 3300050493 Bacteria 7898
669 nmdc:mga0k408_4594_c1 3300050493 Bacteria 7324
670 nmdc:mga0k408_65134_c1 3300050493 Bacteria 2121
671 nmdc:mga0k408_6858_c1 3300050493 Bacteria 6075
672 nmdc:mga0k408_68982_c1 3300050493 Bacteria 2063
673 nmdc:mga0k408_93143_c1 3300050493 Bacteria 1772
674 nmdc:mga06z11_16131_c1 3300050494 Bacteria 3356
675 nmdc:mga06z11_18417_c1 3300050494 Bacteria 3189
676 nmdc:mga06z11_20069_c1 3300050494 Bacteria 3084
677 nmdc:mga06z11_38707_c1 3300050494 Bacteria 2369
678 nmdc:mga04h51_93877_c1 3300050495 Bacteria 1084
679 nmdc:mga07m45_103442_c1 3300050496 Bacteria 1637
680 nmdc:mga07m45_1192_c1 3300050496 Bacteria 11727
681 nmdc:mga07m45_13851_c1 3300050496 Bacteria 4285
682 nmdc:mga07m45_26288_c1 3300050496 Bacteria 3199
683 nmdc:mga07m45_31891_c1 3300050496 Bacteria 2921
684 nmdc:mga07m45_7812_c1 3300050496 Bacteria 5473
685 nmdc:mga07m45_90112_c1 3300050496 Bacteria 1757
686 nmdc:mga0n895_146326_c1 3300050512 Bacteria 2392
687 nmdc:mga0rr50_143765_c1 3300050513 Bacteria 1921
688 nmdc:mga0sz30_1958_c1 3300050516 Bacteria 7364
689 nmdc:mga0sz30_20041_c1 3300050516 Bacteria 2452
690 nmdc:mga0sz30_78691_c1 3300050516 Bacteria 1425
691 Ga0495601_0010509 3300053077 Bacteria 5512
692 Ga0500578_0000549 3300053086 Bacteria 45594
693 Ga0500578_0041292 3300053086 Bacteria 2963
694 Ga0500644_0008317 3300053088 Bacteria 2736
695 Ga0500651_0037943 3300053093 Bacteria 3036
696 Ga0500651_0178242 3300053093 Bacteria 1263
697 Ga0500651_0180826 3300053093 Bacteria 1252
698 Ga0500594_0053420 3300053118 Bacteria 1144
699 Ga0500621_042430 3300053126 Bacteria 1837
700 Ga0500642_0073538 3300053130 Bacteria 1558
701 Ga0500652_001324 3300053131 Bacteria 7788
702 Ga0500655_011390 3300053133 Bacteria 1611
703 Ga0500658_0095036 3300053134 Bacteria 1294
704 Ga0500559_0000116 3300053136 Bacteria 63080
705 Ga0500577_0031584 3300053142 Bacteria 1854
706 Ga0500590_013660 3300053148 Bacteria 4171
707 Ga0500616_0139944 3300053153 Bacteria 1133
708 Ga0500619_002889 3300053154 Bacteria 3405
709 Ga0500622_0000146 3300053156 Bacteria 74615
710 Ga0500622_0005791 3300053156 Bacteria 7328
711 Ga0500622_0052347 3300053156 Bacteria 2099
712 Ga0500570_088615 3300053724 Bacteria 1358
713 Ga0500584_134309 3300053726 Bacteria 956
714 Ga0500645_006914 3300053730 Bacteria 4003
715 Ga0500587_006386 3300053739 Bacteria 1562
716 Ga0500587_008574 3300053739 Bacteria 1314
717 Ga0466962_0103830 3300061719 Bacteria 1365

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300035691 Ga0373931_0462038 Ga0373931_0462038_44_688 205
2 3300048915 Ga0496112_0206036 Ga0496112_0206036_707_1465 231
3 3300048916 Ga0496113_0498914 Ga0496113_0498914_166_936 231
4 3300028794 Ga0307515_10093328 Ga0307515_100933282 234
5 3300033180 Ga0307510_10054969 Ga0307510_100549694 239
6 3300048907 Ga0496104_0050692 Ga0496104_0050692_377_1099 240
7 3300048909 Ga0496106_0273000 Ga0496106_0273000_97_819 240
8 3300005367 Ga0070667_100623018 Ga0070667_1006230181 245
9 iso_pu_bacteria 2643221644 2644244594 245
10 3300005459 Ga0068867_100000054 Ga0068867_10000005422 246
11 3300005616 Ga0068852_100011556 Ga0068852_1000115563 246
12 3300005616 Ga0068852_100749468 Ga0068852_1007494682 246
13 3300006353 Ga0075370_10021997 Ga0075370_100219973 246
14 3300009148 Ga0105243_10004681 Ga0105243_100046812 246
15 3300014745 Ga0157377_10000006 Ga0157377_10000006354 246
16 3300025935 Ga0207709_10007856 Ga0207709_100078566 246
17 3300026089 Ga0207648_10000254 Ga0207648_100002542 246
18 3300026142 Ga0207698_10012242 Ga0207698_100122424 246
19 3300030522 Ga0307512_10172472 Ga0307512_101724722 246
20 3300044765 Ga0466970_0153506 Ga0466970_0153506_307_1089 246
21 3300044901 Ga0466960_0074485 Ga0466960_0074485_348_1154 246
22 3300048910 Ga0496107_0105164 Ga0496107_0105164_1067_1807 246
23 3300048913 Ga0496110_0034706 Ga0496110_0034706_2118_2858 246
24 3300050496 nmdc:mga07m45_13851_c1 nmdc:mga07m45_13851_c1_428_1180 246
25 iso_pu_bacteria 2585428057 2587725871 246
26 iso_pu_bacteria 2585428058 2587736162 246
27 iso_pu_bacteria 2588253510 2588292918 246
28 iso_pu_bacteria 2643221592 2643968025 246
29 iso_pu_bacteria 2643221625 2644143051 246
30 iso_pu_bacteria 2643221648 2644271861 246
31 3300005338 Ga0068868_100261141 Ga0068868_1002611412 247
32 3300005354 Ga0070675_100314782 Ga0070675_1003147822 247
33 3300005355 Ga0070671_100145202 Ga0070671_1001452022 247
34 3300005367 Ga0070667_100009011 Ga0070667_1000090116 247
35 3300005457 Ga0070662_100583782 Ga0070662_1005837821 247
36 3300005548 Ga0070665_100038031 Ga0070665_1000380313 247
37 3300005548 Ga0070665_100438923 Ga0070665_1004389232 247
38 3300005548 Ga0070665_100582737 Ga0070665_1005827372 247
39 3300005617 Ga0068859_100656874 Ga0068859_1006568742 247
40 3300005841 Ga0068863_100015545 Ga0068863_1000155451 247
41 3300006195 Ga0075366_10317915 Ga0075366_103179151 247
42 3300006931 Ga0097620_100656825 Ga0097620_1006568252 247
43 3300009098 Ga0105245_10122546 Ga0105245_101225462 247
44 3300009098 Ga0105245_10395783 Ga0105245_103957832 247
45 3300009545 Ga0105237_10633006 Ga0105237_106330061 247
46 3300013296 Ga0157374_10409525 Ga0157374_104095252 247
47 3300013306 Ga0163162_10849289 Ga0163162_108492891 247
48 3300013308 Ga0157375_10161085 Ga0157375_101610852 247
49 3300014325 Ga0163163_10553258 Ga0163163_105532582 247
50 3300014968 Ga0157379_10300247 Ga0157379_103002472 247
51 3300025900 Ga0207710_10130760 Ga0207710_101307602 247
52 3300025927 Ga0207687_10328336 Ga0207687_103283362 247
53 3300025941 Ga0207711_10444042 Ga0207711_104440422 247
54 3300025986 Ga0207658_10005878 Ga0207658_100058786 247
55 3300026023 Ga0207677_10153693 Ga0207677_101536932 247
56 3300028379 Ga0268266_10313015 Ga0268266_103130152 247
57 3300028379 Ga0268266_10340147 Ga0268266_103401472 247
58 3300028794 Ga0307515_10007802 Ga0307515_100078027 247
59 3300030522 Ga0307512_10076911 Ga0307512_100769113 247
60 3300031649 Ga0307514_10027344 Ga0307514_100273445 247
61 3300031649 Ga0307514_10095565 Ga0307514_100955652 247
62 3300031730 Ga0307516_10127244 Ga0307516_101272442 247
63 3300039447 Ga0436361_0493106 Ga0436361_0493106_746_1489 247
64 3300046461 Ga0495641_0133279 Ga0495641_0133279_186_941 247
65 3300046616 Ga0495668_0093447 Ga0495668_0093447_497_1249 247
66 3300046690 Ga0495624_0022385 Ga0495624_0022385_924_1694 247
67 3300047321 Ga0495676_0097621 Ga0495676_0097621_289_1059 247
68 3300047444 Ga0495675_0181189 Ga0495675_0181189_208_981 247
69 3300047673 Ga0495593_0027579 Ga0495593_0027579_856_1626 247
70 3300048088 Ga0495602_0235640 Ga0495602_0235640_396_1169 247
71 iso_pu_bacteria 2585428062 2587754294 247
72 iso_pu_bacteria 2643221654 2644303548 247
73 3300005330 Ga0070690_100251716 Ga0070690_1002517162 248
74 3300005331 Ga0070670_100091187 Ga0070670_1000911873 248
75 3300005334 Ga0068869_100630889 Ga0068869_1006308891 248
76 3300005355 Ga0070671_100000628 Ga0070671_1000006284 248
77 3300005539 Ga0068853_100199965 Ga0068853_1001999651 248
78 3300005543 Ga0070672_100040316 Ga0070672_1000403164 248
79 3300005616 Ga0068852_100169633 Ga0068852_1001696331 248
80 3300005617 Ga0068859_100076039 Ga0068859_1000760392 248
81 3300005842 Ga0068858_100026038 Ga0068858_1000260385 248
82 3300006195 Ga0075366_10139123 Ga0075366_101391232 248
83 3300006358 Ga0068871_100053607 Ga0068871_1000536072 248
84 3300006931 Ga0097620_100076044 Ga0097620_1000760442 248
85 3300009177 Ga0105248_10255495 Ga0105248_102554952 248
86 3300009177 Ga0105248_10541175 Ga0105248_105411752 248
87 3300014326 Ga0157380_10215482 Ga0157380_102154822 248
88 3300014968 Ga0157379_10002316 Ga0157379_1000231612 248
89 3300021384 Ga0213876_10060172 Ga0213876_100601722 248
90 3300025925 Ga0207650_10093215 Ga0207650_100932152 248
91 3300025931 Ga0207644_10000236 Ga0207644_1000023626 248
92 3300025940 Ga0207691_10010845 Ga0207691_100108453 248
93 3300025942 Ga0207689_10593914 Ga0207689_105939141 248
94 3300025986 Ga0207658_10245744 Ga0207658_102457442 248
95 3300026035 Ga0207703_10003292 Ga0207703_100032928 248
96 3300026041 Ga0207639_10272739 Ga0207639_102727392 248
97 3300028794 Ga0307515_10002980 Ga0307515_1000298010 248
98 3300031730 Ga0307516_10004894 Ga0307516_100048946 248
99 3300032005 Ga0307411_10055879 Ga0307411_100558793 248
100 3300039437 Ga0436365_0359116 Ga0436365_0359116_925_1707 248
101 3300041456 Ga0451795_0627575 Ga0451795_0627575_362_1123 248
102 3300045051 Ga0451576_0463418 Ga0451576_0463418_338_1087 248
103 3300046515 Ga0495620_0038992 Ga0495620_0038992_192_953 248
104 3300046519 Ga0495632_0120333 Ga0495632_0120333_324_1085 248
105 3300046522 Ga0495643_0028131 Ga0495643_0028131_138_914 248
106 3300046660 Ga0495625_0002419 Ga0495625_0002419_16731_17507 248
107 3300048905 Ga0496102_0006650 Ga0496102_0006650_4799_5560 248
108 3300049578 Ga0501042_0154730 Ga0501042_0154730_18_794 248
109 3300049579 Ga0501043_0005821 Ga0501043_0005821_1216_1992 248
110 3300049580 Ga0501046_0007722 Ga0501046_0007722_7572_8348 248
111 3300049581 Ga0501047_0008175 Ga0501047_0008175_1083_1859 248
112 3300049582 Ga0501048_0005642 Ga0501048_0005642_1170_1946 248
113 3300049823 Ga0501044_0412661 Ga0501044_0412661_388_1164 248
114 3300049824 Ga0501045_0004845 Ga0501045_0004845_890_1666 248
115 3300053724 Ga0500570_088615 Ga0500570_088615_547_1323 248
116 iso_pu_bacteria 2585428062 2587757078 248
117 3300003215 JGI25153J46596_10004971 JGI25153J46596_100049718 249
118 3300003323 rootH1_10004635 rootH1_1000463514 249
119 3300003771 Ga0055526_1001524 Ga0055526_10015241 249
120 3300005328 Ga0070676_10056499 Ga0070676_100564993 249
121 3300005328 Ga0070676_10068675 Ga0070676_100686753 249
122 3300005328 Ga0070676_10133099 Ga0070676_101330992 249
123 3300005329 Ga0070683_100135892 Ga0070683_1001358923 249
124 3300005330 Ga0070690_100009364 Ga0070690_1000093644 249
125 3300005331 Ga0070670_100091478 Ga0070670_1000914782 249
126 3300005333 Ga0070677_10013542 Ga0070677_100135422 249
127 3300005333 Ga0070677_10037192 Ga0070677_100371922 249
128 3300005333 Ga0070677_10121109 Ga0070677_101211092 249
129 3300005334 Ga0068869_100027130 Ga0068869_1000271302 249
130 3300005334 Ga0068869_100077017 Ga0068869_1000770173 249
131 3300005335 Ga0070666_10133252 Ga0070666_101332521 249
132 3300005336 Ga0070680_100008447 Ga0070680_1000084475 249
133 3300005338 Ga0068868_100004842 Ga0068868_1000048427 249
134 3300005338 Ga0068868_100009130 Ga0068868_1000091305 249
135 3300005338 Ga0068868_100010695 Ga0068868_1000106953 249
136 3300005338 Ga0068868_100510933 Ga0068868_1005109332 249
137 3300005339 Ga0070660_100027643 Ga0070660_1000276432 249
138 3300005339 Ga0070660_100075481 Ga0070660_1000754814 249
139 3300005344 Ga0070661_100057990 Ga0070661_1000579902 249
140 3300005344 Ga0070661_100374109 Ga0070661_1003741091 249
141 3300005347 Ga0070668_100010749 Ga0070668_1000107494 249
142 3300005353 Ga0070669_100026311 Ga0070669_1000263114 249
143 3300005353 Ga0070669_100028366 Ga0070669_1000283663 249
144 3300005353 Ga0070669_100224028 Ga0070669_1002240282 249
145 3300005354 Ga0070675_100000249 Ga0070675_10000024924 249
146 3300005354 Ga0070675_100010591 Ga0070675_1000105915 249
147 3300005354 Ga0070675_100020503 Ga0070675_1000205034 249
148 3300005354 Ga0070675_100056889 Ga0070675_1000568893 249
149 3300005355 Ga0070671_100012361 Ga0070671_1000123616 249
150 3300005355 Ga0070671_100029117 Ga0070671_1000291173 249
151 3300005355 Ga0070671_100056122 Ga0070671_1000561223 249
152 3300005355 Ga0070671_100065378 Ga0070671_1000653783 249
153 3300005356 Ga0070674_100006826 Ga0070674_1000068265 249
154 3300005356 Ga0070674_100034985 Ga0070674_1000349853 249
155 3300005356 Ga0070674_100063730 Ga0070674_1000637302 249
156 3300005356 Ga0070674_100354621 Ga0070674_1003546211 249
157 3300005364 Ga0070673_100002947 Ga0070673_10000294711 249
158 3300005364 Ga0070673_100022385 Ga0070673_1000223854 249
159 3300005364 Ga0070673_100028531 Ga0070673_1000285314 249
160 3300005365 Ga0070688_100062634 Ga0070688_1000626343 249
161 3300005366 Ga0070659_100019462 Ga0070659_1000194627 249
162 3300005367 Ga0070667_100051335 Ga0070667_1000513352 249
163 3300005456 Ga0070678_100012118 Ga0070678_1000121183 249
164 3300005456 Ga0070678_100039515 Ga0070678_1000395154 249
165 3300005456 Ga0070678_100083966 Ga0070678_1000839662 249
166 3300005457 Ga0070662_100175827 Ga0070662_1001758271 249
167 3300005458 Ga0070681_10643798 Ga0070681_106437981 249
168 3300005459 Ga0068867_100017469 Ga0068867_1000174695 249
169 3300005459 Ga0068867_100061634 Ga0068867_1000616342 249
170 3300005459 Ga0068867_100139198 Ga0068867_1001391982 249
171 3300005459 Ga0068867_100175340 Ga0068867_1001753402 249
172 3300005459 Ga0068867_100247824 Ga0068867_1002478242 249
173 3300005530 Ga0070679_100006933 Ga0070679_10000693311 249
174 3300005535 Ga0070684_100256631 Ga0070684_1002566311 249
175 3300005539 Ga0068853_100213524 Ga0068853_1002135242 249
176 3300005543 Ga0070672_100002237 Ga0070672_1000022375 249
177 3300005543 Ga0070672_100003401 Ga0070672_10000340113 249
178 3300005543 Ga0070672_100011963 Ga0070672_1000119634 249
179 3300005543 Ga0070672_100023520 Ga0070672_1000235205 249
180 3300005543 Ga0070672_100302128 Ga0070672_1003021282 249
181 3300005547 Ga0070693_100061204 Ga0070693_1000612042 249
182 3300005548 Ga0070665_100634276 Ga0070665_1006342762 249
183 3300005563 Ga0068855_100161204 Ga0068855_1001612044 249
184 3300005564 Ga0070664_100002952 Ga0070664_1000029529 249
185 3300005564 Ga0070664_100645611 Ga0070664_1006456112 249
186 3300005577 Ga0068857_100271455 Ga0068857_1002714552 249
187 3300005578 Ga0068854_100108970 Ga0068854_1001089702 249
188 3300005578 Ga0068854_100477116 Ga0068854_1004771162 249
189 3300005614 Ga0068856_100142022 Ga0068856_1001420223 249
190 3300005614 Ga0068856_100303839 Ga0068856_1003038392 249
191 3300005616 Ga0068852_100227482 Ga0068852_1002274822 249
192 3300005616 Ga0068852_100416451 Ga0068852_1004164512 249
193 3300005616 Ga0068852_100526912 Ga0068852_1005269122 249
194 3300005617 Ga0068859_100010521 Ga0068859_1000105213 249
195 3300005618 Ga0068864_100001865 Ga0068864_10000186515 249
196 3300005618 Ga0068864_100003674 Ga0068864_1000036747 249
197 3300005618 Ga0068864_100014639 Ga0068864_1000146392 249
198 3300005618 Ga0068864_100103122 Ga0068864_1001031224 249
199 3300005618 Ga0068864_100277743 Ga0068864_1002777432 249
200 3300005718 Ga0068866_10078229 Ga0068866_100782292 249
201 3300005719 Ga0068861_100044597 Ga0068861_1000445974 249
202 3300005719 Ga0068861_100048758 Ga0068861_1000487584 249
203 3300005834 Ga0068851_10033053 Ga0068851_100330532 249
204 3300005834 Ga0068851_10033318 Ga0068851_100333182 249
205 3300005834 Ga0068851_10033722 Ga0068851_100337223 249
206 3300005834 Ga0068851_10125101 Ga0068851_101251012 249
207 3300005840 Ga0068870_10088594 Ga0068870_100885942 249
208 3300005841 Ga0068863_100002188 Ga0068863_1000021889 249
209 3300005841 Ga0068863_100152686 Ga0068863_1001526862 249
210 3300005842 Ga0068858_100006780 Ga0068858_1000067805 249
211 3300005842 Ga0068858_100106510 Ga0068858_1001065103 249
212 3300005843 Ga0068860_100124430 Ga0068860_1001244303 249
213 3300005843 Ga0068860_100365033 Ga0068860_1003650332 249
214 3300005844 Ga0068862_100066838 Ga0068862_1000668381 249
215 3300006048 Ga0075363_100038490 Ga0075363_1000384903 249
216 3300006177 Ga0075362_10004366 Ga0075362_100043663 249
217 3300006178 Ga0075367_10038321 Ga0075367_100383213 249
218 3300006186 Ga0075369_10048661 Ga0075369_100486612 249
219 3300006195 Ga0075366_10035028 Ga0075366_100350282 249
220 3300006237 Ga0097621_100025701 Ga0097621_1000257014 249
221 3300006237 Ga0097621_100049541 Ga0097621_1000495413 249
222 3300006237 Ga0097621_100199701 Ga0097621_1001997012 249
223 3300006237 Ga0097621_100286768 Ga0097621_1002867682 249
224 3300006237 Ga0097621_100595616 Ga0097621_1005956162 249
225 3300006353 Ga0075370_10017191 Ga0075370_100171912 249
226 3300006353 Ga0075370_10058506 Ga0075370_100585062 249
227 3300006353 Ga0075370_10200673 Ga0075370_102006732 249
228 3300006358 Ga0068871_100016932 Ga0068871_1000169326 249
229 3300006358 Ga0068871_100092690 Ga0068871_1000926903 249
230 3300006358 Ga0068871_100166655 Ga0068871_1001666553 249
231 3300006358 Ga0068871_100505753 Ga0068871_1005057532 249
232 3300006358 Ga0068871_100656889 Ga0068871_1006568891 249
233 3300006871 Ga0075434_100085072 Ga0075434_1000850722 249
234 3300006931 Ga0097620_100010521 Ga0097620_1000105217 249
235 3300009093 Ga0105240_10349065 Ga0105240_103490652 249
236 3300009094 Ga0111539_10619043 Ga0111539_106190432 249
237 3300009098 Ga0105245_10012609 Ga0105245_100126092 249
238 3300009098 Ga0105245_10247549 Ga0105245_102475492 249
239 3300009098 Ga0105245_10654783 Ga0105245_106547832 249
240 3300009148 Ga0105243_10028668 Ga0105243_100286683 249
241 3300009176 Ga0105242_10528934 Ga0105242_105289341 249
242 3300009177 Ga0105248_10013962 Ga0105248_100139626 249
243 3300009177 Ga0105248_10162648 Ga0105248_101626482 249
244 3300009545 Ga0105237_10195060 Ga0105237_101950602 249
245 3300009545 Ga0105237_10204649 Ga0105237_102046492 249
246 3300009551 Ga0105238_10414647 Ga0105238_104146472 249
247 3300009551 Ga0105238_10456281 Ga0105238_104562812 249
248 3300009553 Ga0105249_10082666 Ga0105249_100826663 249
249 3300010375 Ga0105239_10058034 Ga0105239_100580344 249
250 3300013100 Ga0157373_10084121 Ga0157373_100841212 249
251 3300013105 Ga0157369_10267110 Ga0157369_102671102 249
252 3300013296 Ga0157374_10014591 Ga0157374_100145915 249
253 3300013296 Ga0157374_10221924 Ga0157374_102219242 249
254 3300013296 Ga0157374_10300457 Ga0157374_103004571 249
255 3300013297 Ga0157378_10546239 Ga0157378_105462391 249
256 3300013306 Ga0163162_10001899 Ga0163162_100018994 249
257 3300013306 Ga0163162_10039484 Ga0163162_100394844 249
258 3300013306 Ga0163162_10202405 Ga0163162_102024052 249
259 3300013306 Ga0163162_10578962 Ga0163162_105789622 249
260 3300013306 Ga0163162_10819503 Ga0163162_108195032 249
261 3300013307 Ga0157372_10013839 Ga0157372_1001383911 249
262 3300013307 Ga0157372_10277966 Ga0157372_102779663 249
263 3300013308 Ga0157375_10007962 Ga0157375_100079627 249
264 3300013308 Ga0157375_10120373 Ga0157375_101203734 249
265 3300013308 Ga0157375_10205825 Ga0157375_102058253 249
266 3300013308 Ga0157375_10507543 Ga0157375_105075432 249
267 3300014325 Ga0163163_10005652 Ga0163163_100056525 249
268 3300014326 Ga0157380_10015912 Ga0157380_100159124 249
269 3300014745 Ga0157377_10052154 Ga0157377_100521543 249
270 3300014745 Ga0157377_10188544 Ga0157377_101885441 249
271 3300014968 Ga0157379_10001468 Ga0157379_1000146814 249
272 3300014968 Ga0157379_10072598 Ga0157379_100725982 249
273 3300014969 Ga0157376_10063532 Ga0157376_100635322 249
274 3300014969 Ga0157376_10075227 Ga0157376_100752273 249
275 3300017792 Ga0163161_10031949 Ga0163161_100319493 249
276 3300017792 Ga0163161_10348979 Ga0163161_103489792 249
277 3300025245 Ga0207425_1000302 Ga0207425_100030214 249
278 3300025258 Ga0209129_1000158 Ga0209129_100015894 249
279 3300025273 Ga0209673_1033276 Ga0209673_10332762 249
280 3300025295 Ga0209564_1000282 Ga0209564_100028294 249
281 3300025297 Ga0209758_1000630 Ga0209758_100063040 249
282 3300025315 Ga0207697_10016870 Ga0207697_100168702 249
283 3300025321 Ga0207656_10022904 Ga0207656_100229043 249
284 3300025893 Ga0207682_10042590 Ga0207682_100425902 249
285 3300025899 Ga0207642_10046230 Ga0207642_100462302 249
286 3300025901 Ga0207688_10060401 Ga0207688_100604012 249
287 3300025903 Ga0207680_10025936 Ga0207680_100259363 249
288 3300025903 Ga0207680_10256189 Ga0207680_102561892 249
289 3300025907 Ga0207645_10046365 Ga0207645_100463653 249
290 3300025907 Ga0207645_10049550 Ga0207645_100495504 249
291 3300025907 Ga0207645_10128492 Ga0207645_101284922 249
292 3300025908 Ga0207643_10022089 Ga0207643_100220894 249
293 3300025909 Ga0207705_10234014 Ga0207705_102340142 249
294 3300025911 Ga0207654_10237821 Ga0207654_102378212 249
295 3300025912 Ga0207707_10524278 Ga0207707_105242782 249
296 3300025913 Ga0207695_10201497 Ga0207695_102014973 249
297 3300025914 Ga0207671_10093340 Ga0207671_100933402 249
298 3300025914 Ga0207671_10163429 Ga0207671_101634292 249
299 3300025917 Ga0207660_10007163 Ga0207660_100071635 249
300 3300025919 Ga0207657_10030102 Ga0207657_100301026 249
301 3300025919 Ga0207657_10094413 Ga0207657_100944132 249
302 3300025920 Ga0207649_10005844 Ga0207649_100058448 249
303 3300025921 Ga0207652_10042834 Ga0207652_100428342 249
304 3300025923 Ga0207681_10014276 Ga0207681_100142766 249
305 3300025923 Ga0207681_10032620 Ga0207681_100326202 249
306 3300025923 Ga0207681_10033129 Ga0207681_100331292 249
307 3300025923 Ga0207681_10065120 Ga0207681_100651202 249
308 3300025923 Ga0207681_10224028 Ga0207681_102240282 249
309 3300025924 Ga0207694_10093653 Ga0207694_100936532 249
310 3300025925 Ga0207650_10000754 Ga0207650_100007545 249
311 3300025926 Ga0207659_10000204 Ga0207659_1000020413 249
312 3300025926 Ga0207659_10003968 Ga0207659_100039686 249
313 3300025926 Ga0207659_10006399 Ga0207659_100063995 249
314 3300025926 Ga0207659_10046267 Ga0207659_100462672 249
315 3300025926 Ga0207659_10068395 Ga0207659_100683952 249
316 3300025926 Ga0207659_10083175 Ga0207659_100831752 249
317 3300025927 Ga0207687_10299085 Ga0207687_102990852 249
318 3300025931 Ga0207644_10004066 Ga0207644_100040662 249
319 3300025931 Ga0207644_10028206 Ga0207644_100282065 249
320 3300025931 Ga0207644_10036202 Ga0207644_100362022 249
321 3300025931 Ga0207644_10044009 Ga0207644_100440093 249
322 3300025931 Ga0207644_10076148 Ga0207644_100761483 249
323 3300025932 Ga0207690_10273473 Ga0207690_102734732 249
324 3300025933 Ga0207706_10037126 Ga0207706_100371262 249
325 3300025933 Ga0207706_10067468 Ga0207706_100674684 249
326 3300025934 Ga0207686_10148715 Ga0207686_101487152 249
327 3300025935 Ga0207709_10049010 Ga0207709_100490102 249
328 3300025935 Ga0207709_10136119 Ga0207709_101361192 249
329 3300025937 Ga0207669_10023239 Ga0207669_100232393 249
330 3300025937 Ga0207669_10077110 Ga0207669_100771102 249
331 3300025937 Ga0207669_10195918 Ga0207669_101959182 249
332 3300025940 Ga0207691_10008820 Ga0207691_100088208 249
333 3300025940 Ga0207691_10022374 Ga0207691_100223742 249
334 3300025940 Ga0207691_10065023 Ga0207691_100650232 249
335 3300025940 Ga0207691_10217763 Ga0207691_102177631 249
336 3300025940 Ga0207691_10313507 Ga0207691_103135072 249
337 3300025941 Ga0207711_10019439 Ga0207711_100194392 249
338 3300025942 Ga0207689_10000996 Ga0207689_1000099628 249
339 3300025942 Ga0207689_10039049 Ga0207689_100390492 249
340 3300025942 Ga0207689_10083161 Ga0207689_100831613 249
341 3300025944 Ga0207661_10197145 Ga0207661_101971452 249
342 3300025945 Ga0207679_10016215 Ga0207679_100162153 249
343 3300025945 Ga0207679_10509009 Ga0207679_105090092 249
344 3300025945 Ga0207679_10630811 Ga0207679_106308111 249
345 3300025945 Ga0207679_10678524 Ga0207679_106785242 249
346 3300025960 Ga0207651_10000175 Ga0207651_1000017516 249
347 3300025960 Ga0207651_10001535 Ga0207651_100015359 249
348 3300025960 Ga0207651_10009344 Ga0207651_100093445 249
349 3300025960 Ga0207651_10042464 Ga0207651_100424642 249
350 3300025960 Ga0207651_10138750 Ga0207651_101387502 249
351 3300025960 Ga0207651_10305691 Ga0207651_103056912 249
352 3300025961 Ga0207712_10022242 Ga0207712_100222424 249
353 3300025972 Ga0207668_10023396 Ga0207668_100233963 249
354 3300025972 Ga0207668_10088303 Ga0207668_100883033 249
355 3300025972 Ga0207668_10597638 Ga0207668_105976382 249
356 3300025981 Ga0207640_10180524 Ga0207640_101805242 249
357 3300025986 Ga0207658_10169038 Ga0207658_101690382 249
358 3300026023 Ga0207677_10005136 Ga0207677_100051365 249
359 3300026023 Ga0207677_10113321 Ga0207677_101133212 249
360 3300026035 Ga0207703_10001940 Ga0207703_1000194012 249
361 3300026035 Ga0207703_10063519 Ga0207703_100635194 249
362 3300026035 Ga0207703_10224404 Ga0207703_102244043 249
363 3300026041 Ga0207639_10368718 Ga0207639_103687182 249
364 3300026067 Ga0207678_10043973 Ga0207678_100439734 249
365 3300026078 Ga0207702_10012210 Ga0207702_100122103 249
366 3300026078 Ga0207702_10179161 Ga0207702_101791613 249
367 3300026088 Ga0207641_10008762 Ga0207641_100087623 249
368 3300026088 Ga0207641_10410810 Ga0207641_104108102 249
369 3300026089 Ga0207648_10006063 Ga0207648_100060637 249
370 3300026089 Ga0207648_10011724 Ga0207648_100117248 249
371 3300026089 Ga0207648_10037669 Ga0207648_100376693 249
372 3300026089 Ga0207648_10044748 Ga0207648_100447484 249
373 3300026089 Ga0207648_10442264 Ga0207648_104422642 249
374 3300026095 Ga0207676_10000459 Ga0207676_100004599 249
375 3300026095 Ga0207676_10004639 Ga0207676_100046395 249
376 3300026095 Ga0207676_10092427 Ga0207676_100924273 249
377 3300026116 Ga0207674_10007474 Ga0207674_1000747412 249
378 3300026116 Ga0207674_10213474 Ga0207674_102134742 249
379 3300026116 Ga0207674_10297656 Ga0207674_102976562 249
380 3300026118 Ga0207675_100008352 Ga0207675_1000083524 249
381 3300026118 Ga0207675_100034268 Ga0207675_1000342684 249
382 3300026118 Ga0207675_100451451 Ga0207675_1004514512 249
383 3300026121 Ga0207683_10001583 Ga0207683_100015832 249
384 3300026121 Ga0207683_10003340 Ga0207683_100033405 249
385 3300026121 Ga0207683_10187716 Ga0207683_101877162 249
386 3300026121 Ga0207683_10292796 Ga0207683_102927962 249
387 3300026142 Ga0207698_10044685 Ga0207698_100446853 249
388 3300026142 Ga0207698_10161229 Ga0207698_101612292 249
389 3300027876 Ga0209974_10000572 Ga0209974_100005729 249
390 3300028379 Ga0268266_10496754 Ga0268266_104967542 249
391 3300028380 Ga0268265_10015703 Ga0268265_100157036 249
392 3300028381 Ga0268264_10083069 Ga0268264_100830692 249
393 3300028381 Ga0268264_10155269 Ga0268264_101552693 249
394 3300028381 Ga0268264_10328773 Ga0268264_103287732 249
395 3300028786 Ga0307517_10004361 Ga0307517_100043612 249
396 3300028794 Ga0307515_10000911 Ga0307515_1000091148 249
397 3300028794 Ga0307515_10002263 Ga0307515_1000226320 249
398 3300028794 Ga0307515_10125748 Ga0307515_101257482 249
399 3300028794 Ga0307515_10319198 Ga0307515_103191982 249
400 3300030522 Ga0307512_10008490 Ga0307512_100084905 249
401 3300030522 Ga0307512_10015306 Ga0307512_100153067 249
402 3300030522 Ga0307512_10043701 Ga0307512_100437012 249
403 3300030522 Ga0307512_10197122 Ga0307512_101971222 249
404 3300031251 Ga0265327_10027464 Ga0265327_100274643 249
405 3300031456 Ga0307513_10013217 Ga0307513_100132176 249
406 3300031456 Ga0307513_10041281 Ga0307513_100412815 249
407 3300031507 Ga0307509_10001647 Ga0307509_100016474 249
408 3300031507 Ga0307509_10010682 Ga0307509_100106828 249
409 3300031507 Ga0307509_10012990 Ga0307509_100129905 249
410 3300031507 Ga0307509_10028187 Ga0307509_100281872 249
411 3300031507 Ga0307509_10058927 Ga0307509_100589273 249
412 3300031507 Ga0307509_10146968 Ga0307509_101469683 249
413 3300031616 Ga0307508_10000101 Ga0307508_1000010151 249
414 3300031616 Ga0307508_10041346 Ga0307508_100413463 249
415 3300031616 Ga0307508_10043133 Ga0307508_100431333 249
416 3300031616 Ga0307508_10095632 Ga0307508_100956324 249
417 3300031649 Ga0307514_10009380 Ga0307514_100093803 249
418 3300031649 Ga0307514_10015754 Ga0307514_100157545 249
419 3300031730 Ga0307516_10000394 Ga0307516_100003948 249
420 3300031730 Ga0307516_10080188 Ga0307516_100801882 249
421 3300031730 Ga0307516_10115443 Ga0307516_101154433 249
422 3300031730 Ga0307516_10278211 Ga0307516_102782112 249
423 3300031731 Ga0307405_10002583 Ga0307405_100025833 249
424 3300031824 Ga0307413_10606873 Ga0307413_106068731 249
425 3300031838 Ga0307518_10061365 Ga0307518_100613652 249
426 3300031852 Ga0307410_10034667 Ga0307410_100346673 249
427 3300031903 Ga0307407_10189634 Ga0307407_101896341 249
428 3300031911 Ga0307412_10001564 Ga0307412_100015642 249
429 3300032002 Ga0307416_100343687 Ga0307416_1003436872 249
430 3300032004 Ga0307414_10040943 Ga0307414_100409433 249
431 3300032005 Ga0307411_10002722 Ga0307411_100027223 249
432 3300032126 Ga0307415_100173641 Ga0307415_1001736412 249
433 3300033179 Ga0307507_10064419 Ga0307507_100644192 249
434 3300033179 Ga0307507_10084296 Ga0307507_100842963 249
435 3300033180 Ga0307510_10018239 Ga0307510_100182398 249
436 3300033180 Ga0307510_10043177 Ga0307510_100431774 249
437 3300035088 Ga0373940_0060066 Ga0373940_0060066_93_869 249
438 3300035691 Ga0373931_0003906 Ga0373931_0003906_2370_3122 249
439 3300035691 Ga0373931_0004827 Ga0373931_0004827_845_1621 249
440 3300036401 Ga0373937_0329761 Ga0373937_0329761_466_1224 249
441 3300037471 Ga0395905_0063276 Ga0395905_0063276_2084_2863 249
442 3300039450 Ga0436363_0700246 Ga0436363_0700246_1939_2691 249
443 3300042531 Ga0450918_000126 Ga0450918_000126_15626_16393 249
444 3300044656 Ga0466969_0022247 Ga0466969_0022247_694_1443 249
445 3300044693 Ga0466961_0061111 Ga0466961_0061111_1634_2383 249
446 3300044719 Ga0466971_0043006 Ga0466971_0043006_801_1568 249
447 3300044842 Ga0466957_0044543 Ga0466957_0044543_257_1024 249
448 3300045051 Ga0451576_0213295 Ga0451576_0213295_1154_1906 249
449 3300046454 Ga0495592_0038461 Ga0495592_0038461_2524_3285 249
450 3300046457 Ga0495590_0001361 Ga0495590_0001361_3579_4340 249
451 3300046473 Ga0495582_0193012 Ga0495582_0193012_275_1051 249
452 3300046507 Ga0495606_0324451 Ga0495606_0324451_43_804 249
453 3300046519 Ga0495632_0061943 Ga0495632_0061943_951_1727 249
454 3300046524 Ga0495648_0059864 Ga0495648_0059864_1288_2052 249
455 3300046526 Ga0495666_0009201 Ga0495666_0009201_177_938 249
456 3300046539 Ga0495621_0050964 Ga0495621_0050964_289_1062 249
457 3300046539 Ga0495621_0084366 Ga0495621_0084366_227_985 249
458 3300046542 Ga0495597_0017952 Ga0495597_0017952_617_1378 249
459 3300046543 Ga0495645_0096454 Ga0495645_0096454_240_1022 249
460 3300046681 Ga0495647_0178235 Ga0495647_0178235_103_876 249
461 3300046683 Ga0495658_0199547 Ga0495658_0199547_282_1043 249
462 3300047443 Ga0495687_000761 Ga0495687_000761_5581_6342 249
463 3300047445 Ga0495677_0100876 Ga0495677_0100876_212_979 249
464 3300047472 Ga0495686_0003001 Ga0495686_0003001_11351_12112 249
465 3300048903 Ga0496100_0663588 Ga0496100_0663588_19_771 249
466 3300048904 Ga0496101_0184606 Ga0496101_0184606_680_1432 249
467 3300048904 Ga0496101_0243385 Ga0496101_0243385_47_820 249
468 3300048907 Ga0496104_0235830 Ga0496104_0235830_683_1435 249
469 3300048909 Ga0496106_0007661 Ga0496106_0007661_2844_3605 249
470 3300048909 Ga0496106_0197714 Ga0496106_0197714_648_1433 249
471 3300048911 Ga0496108_0056965 Ga0496108_0056965_826_1578 249
472 3300048912 Ga0496109_0118533 Ga0496109_0118533_1183_1935 249
473 3300048914 Ga0496111_0257705 Ga0496111_0257705_133_885 249
474 3300048917 Ga0496114_0119780 Ga0496114_0119780_936_1688 249
475 3300048918 Ga0496115_0094142 Ga0496115_0094142_162_914 249
476 3300048924 Ga0496121_0029040 Ga0496121_0029040_3705_4454 249
477 3300049521 Ga0501298_029343 Ga0501298_029343_217_975 249
478 3300050493 nmdc:mga0k408_119654_c1 nmdc:mga0k408_119654_c1_460_1233 249
479 3300050493 nmdc:mga0k408_2426_c1 nmdc:mga0k408_2426_c1_1102_1881 249
480 3300050493 nmdc:mga0k408_295893_c1 nmdc:mga0k408_295893_c1_104_871 249
481 3300050493 nmdc:mga0k408_3909_c1 nmdc:mga0k408_3909_c1_129_881 249
482 3300050493 nmdc:mga0k408_4594_c1 nmdc:mga0k408_4594_c1_1804_2556 249
483 3300050493 nmdc:mga0k408_93143_c1 nmdc:mga0k408_93143_c1_782_1549 249
484 3300050494 nmdc:mga06z11_16131_c1 nmdc:mga06z11_16131_c1_1286_2053 249
485 3300050496 nmdc:mga07m45_26288_c1 nmdc:mga07m45_26288_c1_1469_2236 249
486 3300050496 nmdc:mga07m45_7812_c1 nmdc:mga07m45_7812_c1_2974_3732 249
487 3300050512 nmdc:mga0n895_146326_c1 nmdc:mga0n895_146326_c1_1630_2382 249
488 3300050516 nmdc:mga0sz30_20041_c1 nmdc:mga0sz30_20041_c1_129_896 249
489 3300053086 Ga0500578_0041292 Ga0500578_0041292_97_858 249
490 3300053093 Ga0500651_0178242 Ga0500651_0178242_162_929 249
491 3300053148 Ga0500590_013660 Ga0500590_013660_917_1669 249
492 3300053154 Ga0500619_002889 Ga0500619_002889_1193_1954 249
493 3300053730 Ga0500645_006914 Ga0500645_006914_42_803 249
494 3300053739 Ga0500587_006386 Ga0500587_006386_771_1532 249
495 3300061719 Ga0466962_0103830 Ga0466962_0103830_517_1266 249
496 3300003203 JGI25406J46586_10048047 JGI25406J46586_100480472 250
497 3300003791 Ga0055530_10009684 Ga0055530_100096844 250
498 3300005262 Ga0065165_1004067 Ga0065165_100406711 250
499 3300005331 Ga0070670_100011095 Ga0070670_1000110952 250
500 3300005331 Ga0070670_100359275 Ga0070670_1003592752 250
501 3300005334 Ga0068869_100003047 Ga0068869_1000030472 250
502 3300005335 Ga0070666_10024991 Ga0070666_100249914 250
503 3300005338 Ga0068868_100040286 Ga0068868_1000402864 250
504 3300005339 Ga0070660_100359103 Ga0070660_1003591032 250
505 3300005344 Ga0070661_100384755 Ga0070661_1003847552 250
506 3300005347 Ga0070668_100003082 Ga0070668_1000030829 250
507 3300005353 Ga0070669_100009023 Ga0070669_1000090236 250
508 3300005353 Ga0070669_100177676 Ga0070669_1001776762 250
509 3300005354 Ga0070675_100068183 Ga0070675_1000681834 250
510 3300005354 Ga0070675_100305064 Ga0070675_1003050642 250
511 3300005355 Ga0070671_100386465 Ga0070671_1003864652 250
512 3300005356 Ga0070674_100004463 Ga0070674_1000044632 250
513 3300005364 Ga0070673_100107848 Ga0070673_1001078483 250
514 3300005366 Ga0070659_100512291 Ga0070659_1005122911 250
515 3300005367 Ga0070667_100316176 Ga0070667_1003161762 250
516 3300005438 Ga0070701_10032610 Ga0070701_100326102 250
517 3300005445 Ga0070708_100026951 Ga0070708_1000269515 250
518 3300005445 Ga0070708_100037495 Ga0070708_1000374954 250
519 3300005455 Ga0070663_100180143 Ga0070663_1001801432 250
520 3300005456 Ga0070678_100270210 Ga0070678_1002702102 250
521 3300005457 Ga0070662_100005664 Ga0070662_1000056647 250
522 3300005457 Ga0070662_100089285 Ga0070662_1000892852 250
523 3300005457 Ga0070662_100097010 Ga0070662_1000970103 250
524 3300005459 Ga0068867_100013078 Ga0068867_1000130784 250
525 3300005459 Ga0068867_100074187 Ga0068867_1000741872 250
526 3300005467 Ga0070706_100008790 Ga0070706_1000087904 250
527 3300005468 Ga0070707_100020166 Ga0070707_1000201666 250
528 3300005471 Ga0070698_100001400 Ga0070698_10000140026 250
529 3300005471 Ga0070698_100033168 Ga0070698_1000331684 250
530 3300005535 Ga0070684_100459104 Ga0070684_1004591042 250
531 3300005539 Ga0068853_100304671 Ga0068853_1003046712 250
532 3300005543 Ga0070672_100004578 Ga0070672_1000045787 250
533 3300005543 Ga0070672_100021611 Ga0070672_1000216114 250
534 3300005543 Ga0070672_100092452 Ga0070672_1000924524 250
535 3300005543 Ga0070672_100128392 Ga0070672_1001283922 250
536 3300005543 Ga0070672_100155383 Ga0070672_1001553832 250
537 3300005543 Ga0070672_100293307 Ga0070672_1002933072 250
538 3300005564 Ga0070664_100253203 Ga0070664_1002532032 250
539 3300005577 Ga0068857_100175120 Ga0068857_1001751202 250
540 3300005614 Ga0068856_100032045 Ga0068856_1000320456 250
541 3300005616 Ga0068852_100065358 Ga0068852_1000653584 250
542 3300005616 Ga0068852_100077781 Ga0068852_1000777814 250
543 3300005616 Ga0068852_100136227 Ga0068852_1001362274 250
544 3300005616 Ga0068852_100180959 Ga0068852_1001809592 250
545 3300005618 Ga0068864_100284407 Ga0068864_1002844072 250
546 3300005618 Ga0068864_100392548 Ga0068864_1003925482 250
547 3300005718 Ga0068866_10003009 Ga0068866_100030092 250
548 3300005718 Ga0068866_10103754 Ga0068866_101037542 250
549 3300005719 Ga0068861_100018459 Ga0068861_1000184594 250
550 3300005841 Ga0068863_100034885 Ga0068863_1000348854 250
551 3300005841 Ga0068863_100277051 Ga0068863_1002770512 250
552 3300005842 Ga0068858_100009570 Ga0068858_1000095702 250
553 3300005843 Ga0068860_100074770 Ga0068860_1000747702 250
554 3300005844 Ga0068862_100080500 Ga0068862_1000805002 250
555 3300005985 Ga0081539_10006995 Ga0081539_1000699512 250
556 3300006038 Ga0075365_10021734 Ga0075365_100217343 250
557 3300006042 Ga0075368_10029292 Ga0075368_100292922 250
558 3300006177 Ga0075362_10004317 Ga0075362_100043173 250
559 3300006177 Ga0075362_10018675 Ga0075362_100186753 250
560 3300006178 Ga0075367_10029814 Ga0075367_100298142 250
561 3300006178 Ga0075367_10109982 Ga0075367_101099822 250
562 3300006186 Ga0075369_10000085 Ga0075369_1000008510 250
563 3300006186 Ga0075369_10075604 Ga0075369_100756042 250
564 3300006195 Ga0075366_10003063 Ga0075366_100030639 250
565 3300006195 Ga0075366_10068020 Ga0075366_100680202 250
566 3300006195 Ga0075366_10079226 Ga0075366_100792262 250
567 3300006195 Ga0075366_10079352 Ga0075366_100793524 250
568 3300006195 Ga0075366_10121040 Ga0075366_101210402 250
569 3300006237 Ga0097621_100075809 Ga0097621_1000758094 250
570 3300006353 Ga0075370_10002925 Ga0075370_100029252 250
571 3300006353 Ga0075370_10048720 Ga0075370_100487202 250
572 3300006353 Ga0075370_10084214 Ga0075370_100842142 250
573 3300006353 Ga0075370_10100631 Ga0075370_101006312 250
574 3300006881 Ga0068865_100003515 Ga0068865_1000035157 250
575 3300009093 Ga0105240_10776773 Ga0105240_107767732 250
576 3300009098 Ga0105245_10365998 Ga0105245_103659982 250
577 3300009148 Ga0105243_10001958 Ga0105243_100019588 250
578 3300009148 Ga0105243_10201008 Ga0105243_102010082 250
579 3300009176 Ga0105242_10145657 Ga0105242_101456572 250
580 3300009177 Ga0105248_10147698 Ga0105248_101476984 250
581 3300009177 Ga0105248_10223089 Ga0105248_102230892 250
582 3300009553 Ga0105249_10307854 Ga0105249_103078542 250
583 3300009553 Ga0105249_10515295 Ga0105249_105152952 250
584 3300010159 Ga0099796_10005772 Ga0099796_100057723 250
585 3300010375 Ga0105239_10186248 Ga0105239_101862482 250
586 3300013102 Ga0157371_10055892 Ga0157371_100558923 250
587 3300013105 Ga0157369_10593365 Ga0157369_105933652 250
588 3300013297 Ga0157378_10077771 Ga0157378_100777712 250
589 3300013297 Ga0157378_10254140 Ga0157378_102541402 250
590 3300013297 Ga0157378_10402457 Ga0157378_104024572 250
591 3300013308 Ga0157375_10003962 Ga0157375_100039624 250
592 3300014325 Ga0163163_10061752 Ga0163163_100617522 250
593 3300014968 Ga0157379_10025561 Ga0157379_100255614 250
594 3300014968 Ga0157379_10352645 Ga0157379_103526451 250
595 3300017792 Ga0163161_10036806 Ga0163161_100368064 250
596 3300021384 Ga0213876_10115123 Ga0213876_101151232 250
597 3300025297 Ga0209758_1000500 Ga0209758_100050053 250
598 3300025298 Ga0209050_1000223 Ga0209050_1000223121 250
599 3300025315 Ga0207697_10071341 Ga0207697_100713412 250
600 3300025893 Ga0207682_10080051 Ga0207682_100800512 250
601 3300025899 Ga0207642_10046513 Ga0207642_100465132 250
602 3300025901 Ga0207688_10190790 Ga0207688_101907902 250
603 3300025908 Ga0207643_10060815 Ga0207643_100608152 250
604 3300025910 Ga0207684_10002610 Ga0207684_1000261015 250
605 3300025910 Ga0207684_10298425 Ga0207684_102984252 250
606 3300025922 Ga0207646_10110916 Ga0207646_101109163 250
607 3300025923 Ga0207681_10000162 Ga0207681_100001622 250
608 3300025925 Ga0207650_10000382 Ga0207650_1000038220 250
609 3300025926 Ga0207659_10009378 Ga0207659_100093782 250
610 3300025926 Ga0207659_10031152 Ga0207659_100311525 250
611 3300025927 Ga0207687_10021190 Ga0207687_100211902 250
612 3300025927 Ga0207687_10372891 Ga0207687_103728912 250
613 3300025933 Ga0207706_10007280 Ga0207706_100072807 250
614 3300025933 Ga0207706_10096910 Ga0207706_100969102 250
615 3300025934 Ga0207686_10096350 Ga0207686_100963502 250
616 3300025934 Ga0207686_10167968 Ga0207686_101679682 250
617 3300025935 Ga0207709_10010271 Ga0207709_100102714 250
618 3300025938 Ga0207704_10004815 Ga0207704_100048156 250
619 3300025940 Ga0207691_10067702 Ga0207691_100677022 250
620 3300025940 Ga0207691_10185830 Ga0207691_101858302 250
621 3300025940 Ga0207691_10214838 Ga0207691_102148382 250
622 3300025940 Ga0207691_10354666 Ga0207691_103546662 250
623 3300025941 Ga0207711_10055718 Ga0207711_100557184 250
624 3300025941 Ga0207711_10119531 Ga0207711_101195312 250
625 3300025941 Ga0207711_10428204 Ga0207711_104282042 250
626 3300025960 Ga0207651_10299112 Ga0207651_102991121 250
627 3300025972 Ga0207668_10007819 Ga0207668_100078196 250
628 3300025986 Ga0207658_10000181 Ga0207658_1000018146 250
629 3300026023 Ga0207677_10015401 Ga0207677_100154013 250
630 3300026035 Ga0207703_10004491 Ga0207703_100044917 250
631 3300026041 Ga0207639_10107951 Ga0207639_101079512 250
632 3300026067 Ga0207678_10032683 Ga0207678_100326836 250
633 3300026067 Ga0207678_10135866 Ga0207678_101358663 250
634 3300026067 Ga0207678_10245976 Ga0207678_102459762 250
635 3300026075 Ga0207708_10104594 Ga0207708_101045943 250
636 3300026088 Ga0207641_10001945 Ga0207641_1000194510 250
637 3300026088 Ga0207641_10171371 Ga0207641_101713712 250
638 3300026089 Ga0207648_10017985 Ga0207648_100179854 250
639 3300026089 Ga0207648_10025241 Ga0207648_100252414 250
640 3300026116 Ga0207674_10200584 Ga0207674_102005842 250
641 3300026116 Ga0207674_10244585 Ga0207674_102445852 250
642 3300026118 Ga0207675_100004099 Ga0207675_1000040994 250
643 3300026121 Ga0207683_10316733 Ga0207683_103167332 250
644 3300026142 Ga0207698_10152355 Ga0207698_101523553 250
645 3300026142 Ga0207698_10368196 Ga0207698_103681962 250
646 3300027866 Ga0209813_10079002 Ga0209813_100790022 250
647 3300028379 Ga0268266_10168039 Ga0268266_101680392 250
648 3300028380 Ga0268265_10069832 Ga0268265_100698323 250
649 3300028381 Ga0268264_10001738 Ga0268264_100017384 250
650 3300028786 Ga0307517_10160963 Ga0307517_101609632 250
651 3300028794 Ga0307515_10034317 Ga0307515_100343176 250
652 3300031507 Ga0307509_10076354 Ga0307509_100763542 250
653 3300031548 Ga0307408_100377317 Ga0307408_1003773171 250
654 3300031730 Ga0307516_10005007 Ga0307516_100050071 250
655 3300031730 Ga0307516_10347117 Ga0307516_103471172 250
656 3300031911 Ga0307412_10482582 Ga0307412_104825821 250
657 3300031995 Ga0307409_100215767 Ga0307409_1002157672 250
658 3300032005 Ga0307411_10385444 Ga0307411_103854441 250
659 3300033180 Ga0307510_10038889 Ga0307510_100388893 250
660 3300035117 Ga0373953_0021688 Ga0373953_0021688_1416_2171 250
661 3300035171 Ga0373946_0079609 Ga0373946_0079609_283_1038 250
662 3300036401 Ga0373937_0018749 Ga0373937_0018749_3032_3811 250
663 3300036401 Ga0373937_0058153 Ga0373937_0058153_155_910 250
664 3300036401 Ga0373937_0536810 Ga0373937_0536810_162_944 250
665 3300041460 Ga0451802_1369130 Ga0451802_1369130_263_1060 250
666 3300044712 Ga0453684_0226562 Ga0453684_0226562_329_1084 250
667 3300046460 Ga0495638_0045454 Ga0495638_0045454_1220_1978 250
668 3300046507 Ga0495606_0168850 Ga0495606_0168850_148_930 250
669 3300046512 Ga0495610_0040317 Ga0495610_0040317_311_1108 250
670 3300046519 Ga0495632_0052575 Ga0495632_0052575_985_1743 250
671 3300046538 Ga0495609_0113743 Ga0495609_0113743_322_1098 250
672 3300046539 Ga0495621_0097672 Ga0495621_0097672_241_996 250
673 3300046542 Ga0495597_0064827 Ga0495597_0064827_616_1380 250
674 3300046660 Ga0495625_0018284 Ga0495625_0018284_2621_3400 250
675 3300046663 Ga0495635_0133585 Ga0495635_0133585_355_1140 250
676 3300046675 Ga0495657_0380110 Ga0495657_0380110_27_806 250
677 3300046683 Ga0495658_0004477 Ga0495658_0004477_2753_3532 250
678 3300046683 Ga0495658_0197604 Ga0495658_0197604_383_1147 250
679 3300046683 Ga0495658_0212033 Ga0495658_0212033_68_847 250
680 3300046689 Ga0495613_0097650 Ga0495613_0097650_1094_1849 250
681 3300046694 Ga0495649_0004222 Ga0495649_0004222_1206_1985 250
682 3300046810 Ga0495660_0070270 Ga0495660_0070270_750_1529 250
683 3300047319 Ga0495674_0298307 Ga0495674_0298307_137_892 250
684 3300047443 Ga0495687_003669 Ga0495687_003669_7268_8047 250
685 3300047443 Ga0495687_010060 Ga0495687_010060_1431_2207 250
686 3300047443 Ga0495687_026673 Ga0495687_026673_1180_1959 250
687 3300048908 Ga0496105_0156926 Ga0496105_0156926_398_1153 250
688 3300048911 Ga0496108_0130532 Ga0496108_0130532_573_1328 250
689 3300050489 nmdc:mga03683_19828_c1 nmdc:mga03683_19828_c1_1718_2500 250
690 3300050489 nmdc:mga03683_8328_c1 nmdc:mga03683_8328_c1_2679_3446 250
691 3300050492 nmdc:mga0yw44_20132_c1 nmdc:mga0yw44_20132_c1_1102_1884 250
692 3300050493 nmdc:mga0k408_100661_c1 nmdc:mga0k408_100661_c1_307_1062 250
693 3300050493 nmdc:mga0k408_100737_c2 nmdc:mga0k408_100737_c2_139_918 250
694 3300050493 nmdc:mga0k408_17713_c1 nmdc:mga0k408_17713_c1_803_1561 250
695 3300050493 nmdc:mga0k408_65134_c1 nmdc:mga0k408_65134_c1_628_1419 250
696 3300050493 nmdc:mga0k408_6858_c1 nmdc:mga0k408_6858_c1_549_1343 250
697 3300050493 nmdc:mga0k408_68982_c1 nmdc:mga0k408_68982_c1_681_1448 250
698 3300050494 nmdc:mga06z11_18417_c1 nmdc:mga06z11_18417_c1_801_1583 250
699 3300050494 nmdc:mga06z11_20069_c1 nmdc:mga06z11_20069_c1_629_1423 250
700 3300050494 nmdc:mga06z11_38707_c1 nmdc:mga06z11_38707_c1_151_942 250
701 3300050495 nmdc:mga04h51_93877_c1 nmdc:mga04h51_93877_c1_133_927 250
702 3300050496 nmdc:mga07m45_103442_c1 nmdc:mga07m45_103442_c1_617_1411 250
703 3300050496 nmdc:mga07m45_1192_c1 nmdc:mga07m45_1192_c1_6343_7134 250
704 3300050496 nmdc:mga07m45_31891_c1 nmdc:mga07m45_31891_c1_1340_2122 250
705 3300050496 nmdc:mga07m45_90112_c1 nmdc:mga07m45_90112_c1_98_865 250
706 3300050513 nmdc:mga0rr50_143765_c1 nmdc:mga0rr50_143765_c1_254_1048 250
707 3300050516 nmdc:mga0sz30_1958_c1 nmdc:mga0sz30_1958_c1_2915_3697 250
708 3300050516 nmdc:mga0sz30_78691_c1 nmdc:mga0sz30_78691_c1_106_873 250
709 3300053077 Ga0495601_0010509 Ga0495601_0010509_3152_3931 250
710 3300053086 Ga0500578_0000549 Ga0500578_0000549_28875_29645 250
711 3300053088 Ga0500644_0008317 Ga0500644_0008317_1795_2571 250
712 3300053093 Ga0500651_0037943 Ga0500651_0037943_364_1146 250
713 3300053093 Ga0500651_0180826 Ga0500651_0180826_421_1179 250
714 3300053118 Ga0500594_0053420 Ga0500594_0053420_343_1119 250
715 3300053126 Ga0500621_042430 Ga0500621_042430_586_1362 250
716 3300053130 Ga0500642_0073538 Ga0500642_0073538_559_1317 250
717 3300053131 Ga0500652_001324 Ga0500652_001324_4292_5050 250
718 3300053133 Ga0500655_011390 Ga0500655_011390_53_811 250
719 3300053134 Ga0500658_0095036 Ga0500658_0095036_316_1080 250
720 3300053136 Ga0500559_0000116 Ga0500559_0000116_59494_60270 250
721 3300053142 Ga0500577_0031584 Ga0500577_0031584_202_960 250
722 3300053153 Ga0500616_0139944 Ga0500616_0139944_236_1012 250
723 3300053156 Ga0500622_0000146 Ga0500622_0000146_8252_9010 250
724 3300053156 Ga0500622_0005791 Ga0500622_0005791_4551_5327 250
725 3300053156 Ga0500622_0052347 Ga0500622_0052347_1106_1888 250
726 3300053726 Ga0500584_134309 Ga0500584_134309_59_841 250
727 3300053739 Ga0500587_008574 Ga0500587_008574_392_1168 250

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

51

207

0.94

PF12399

BCA_ABC_TP_C

Branched-chain amino acid ATP-binding cassette transporter

254

280

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.938 4 243
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9264 4 243
7x0q-assembly1.cif.gz_A crystal structure of atpase clo1313_2554 from clostridium thermocellum 0.9133 5 233
7efo-assembly1.cif.gz_A lptb2fg-lps from klebsiella pneumoniae in nanodiscs 0.9126 4 245
4yer-assembly1.cif.gz_A crystal structure of an abc transporter atp-binding protein (tm_1403) from thermotoga maritima msb8 at 2.35 a resolution 0.9107 1 233
ID Description Score Start End Superfamily
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9545 4 245 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9212 4 245 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.919 1 229 3.40.50.300
af_A4HRM7_2286_2560_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.918 3 237 3.40.50.300
af_Q58762_1_229_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9161 5 242 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A538JJF5-F1-model_v4 ABC transporter ATP-binding protein 0.9434 4 250 GO:0005524
GO:0005886
GO:0016887
AF-A0A7Y0LYI9-F1-model_v4 ABC transporter ATP-binding protein 0.9424 2 250 GO:0005524
GO:0005886
GO:0016887
AF-A0A3N6MLS5-F1-model_v4 ABC transporter ATP-binding protein 0.942 3 248 GO:0005524
GO:0005886
GO:0016887
AF-A0A239NU23-F1-model_v4 Branched-chain amino acid transport system ATP-binding protein 0.9404 3 247 GO:0005304
GO:0005524
GO:0005886
GO:0015188
GO:0015192
GO:0015808
GO:0016887
GO:0042941
GO:1903805
GO:1903806
AF-A0A0F2NA46-F1-model_v4 ABC transporter 0.9362 3 247 GO:0005524
GO:0005886
GO:0016887

Feature Viewer

pLDDT pTM Quality
90.35 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map