F477724

General Info

Members Datasets Scaffolds Average Seq Length
727 305 1454 114

Family's Representative Sequence

Representative Sequence 3300005330|Ga0070690_100100755|Ga0070690_1001007552
Length 131
Sequence VSPLRPPGPPSYGARTAPATIAPDRVTTAMGFDGYRIVQHRGVVRGIVVRSRSVVGTIGASIQTLFGGNITLYTELCERARQDAFDLMLQHGAELGANAIIAMHYDANEVAAGVTEVLAYGTAVVIEPTGR

Samples

Sample ID Description Type Environment
1 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
4 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
5 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
6 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
22 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
34 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
35 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
36 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
40 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
41 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
42 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
43 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
44 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
45 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
46 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
47 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
48 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
49 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
50 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
51 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
52 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
53 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
54 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
55 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
56 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
57 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
58 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
59 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
60 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
61 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
62 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
63 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
64 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
65 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
66 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
67 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
68 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
69 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
70 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
71 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
75 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
76 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
77 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
82 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
83 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
84 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
85 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
86 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
87 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
88 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
89 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
90 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
91 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
92 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
93 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
95 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
96 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
97 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
98 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
99 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
104 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
105 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
106 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
107 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
112 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
163 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
164 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
165 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
166 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
167 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
171 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
172 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
173 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
174 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
175 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
176 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
177 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
178 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
179 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
180 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
181 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
182 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
183 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
184 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
185 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
186 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
187 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
188 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
189 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
190 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
191 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
192 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
193 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
194 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
195 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
196 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
197 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
198 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
199 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
200 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
201 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
202 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
203 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
204 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
205 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
206 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
207 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
208 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
209 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
210 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
211 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
212 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
213 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
214 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
215 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
216 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
217 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
218 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
219 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
220 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
221 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
222 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
223 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
224 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
225 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
226 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
227 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
228 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
229 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
230 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
231 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
232 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
233 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
234 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
235 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
236 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
237 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
238 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
239 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
240 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
241 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
242 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
243 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
244 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
245 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
246 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
247 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
248 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
249 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
250 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
251 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
252 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
253 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
254 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
255 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
256 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
257 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
258 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
259 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
260 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
261 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
262 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
263 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
264 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
265 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
266 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
267 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
268 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
269 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
270 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
272 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
273 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
274 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
275 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
276 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
277 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
278 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
279 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
280 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
281 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
282 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
283 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
284 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
285 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
286 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
287 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
288 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
289 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
290 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
291 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
292 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
293 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
294 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
295 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
296 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
297 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
298 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
299 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
300 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
301 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
302 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
303 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
304 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
305 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.55
Nodule 0
Rhizoplane 3.71
Rhizosphere 95.74
Stem 0
Stem Tuber 0
Unclassified 13.07

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070690_100100755 3300005330 Bacteria 1915
2 ARcpr5oldR_c016755 3300000041 Bacteria 640
3 ARcpr5yngRDRAFT_c010194 3300000043 Bacteria 799
4 JGI24746J21847_1036827 3300001977 Bacteria 677
5 JGI25406J46586_10001685 3300003203 Bacteria 10426
6 JGI25406J46586_10007182 3300003203 Bacteria 5100
7 JGI25406J46586_10084439 3300003203 Unclassified 967
8 Ga0065714_10447631 3300005288 Bacteria 556
9 Ga0065712_10104073 3300005290 Unclassified 1970
10 Ga0065712_10106096 3300005290 Bacteria 1924
11 Ga0065715_10142108 3300005293 Bacteria 1838
12 Ga0065715_10308767 3300005293 Bacteria 1025
13 Ga0065707_10289001 3300005295 Bacteria 1029
14 Ga0065707_10317748 3300005295 Bacteria 972
15 Ga0065707_10475139 3300005295 Unclassified 778
16 Ga0070676_10053591 3300005328 Bacteria 2376
17 Ga0070676_10068470 3300005328 Unclassified 2125
18 Ga0070676_11307221 3300005328 Bacteria 554
19 Ga0070683_100074962 3300005329 Bacteria 3160
20 Ga0070690_100334420 3300005330 Unclassified 1095
21 Ga0070670_100059914 3300005331 Bacteria 3267
22 Ga0070670_100144311 3300005331 Bacteria 2059
23 Ga0070670_100170891 3300005331 Bacteria 1885
24 Ga0070677_10010851 3300005333 Bacteria 3128
25 Ga0068869_100169343 3300005334 Bacteria 1706
26 Ga0068869_100601371 3300005334 Bacteria 929
27 Ga0068869_101363639 3300005334 Bacteria 627
28 Ga0070680_100082279 3300005336 Bacteria 2657
29 Ga0070680_100197679 3300005336 Bacteria 1695
30 Ga0070682_100058507 3300005337 Bacteria 2431
31 Ga0070660_100121243 3300005339 Bacteria 2087
32 Ga0070689_100039851 3300005340 Bacteria 3598
33 Ga0070689_101029407 3300005340 Bacteria 734
34 Ga0070691_10121257 3300005341 Unclassified 1317
35 Ga0070687_100741233 3300005343 Bacteria 690
36 Ga0070661_100021331 3300005344 Bacteria 4625
37 Ga0070692_10207740 3300005345 Bacteria 1150
38 Ga0070692_10813806 3300005345 Bacteria 639
39 Ga0070668_100471032 3300005347 Bacteria 1083
40 Ga0070668_100504840 3300005347 Bacteria 1047
41 Ga0070668_101021293 3300005347 Bacteria 744
42 Ga0070669_100066919 3300005353 Bacteria 2649
43 Ga0070669_100089043 3300005353 Bacteria 2311
44 Ga0070669_100109669 3300005353 Unclassified 2093
45 Ga0070669_100142442 3300005353 Bacteria 1849
46 Ga0070669_101207923 3300005353 Bacteria 653
47 Ga0070675_100027961 3300005354 Bacteria 4535
48 Ga0070675_100211755 3300005354 Bacteria 1685
49 Ga0070675_101932502 3300005354 Bacteria 544
50 Ga0070671_101049544 3300005355 Bacteria 715
51 Ga0070671_101502580 3300005355 Bacteria 596
52 Ga0070674_100010510 3300005356 Bacteria 5600
53 Ga0070674_101646785 3300005356 Unclassified 579
54 Ga0070673_100184464 3300005364 Bacteria 1788
55 Ga0070673_100432627 3300005364 Bacteria 1181
56 Ga0070688_100932791 3300005365 Bacteria 686
57 Ga0070659_100071481 3300005366 Bacteria 2759
58 Ga0070659_101701350 3300005366 Bacteria 564
59 Ga0070667_100057497 3300005367 Bacteria 3288
60 Ga0070667_100598026 3300005367 Bacteria 1016
61 Ga0070703_10244788 3300005406 Bacteria 725
62 Ga0070701_10021433 3300005438 Bacteria 3084
63 Ga0070701_10104261 3300005438 Bacteria 1575
64 Ga0070705_100000037 3300005440 Bacteria 66783
65 Ga0070705_100011227 3300005440 Bacteria 4512
66 Ga0070705_100021237 3300005440 Bacteria 3450
67 Ga0070705_100658578 3300005440 Bacteria 817
68 Ga0070700_100168704 3300005441 Bacteria 1514
69 Ga0070700_100185795 3300005441 Bacteria 1450
70 Ga0070694_100005053 3300005444 Bacteria 7961
71 Ga0070694_100095082 3300005444 Bacteria 2097
72 Ga0070694_100109420 3300005444 Bacteria 1967
73 Ga0070694_100180764 3300005444 Bacteria 1560
74 Ga0070694_100235998 3300005444 Bacteria 1378
75 Ga0070708_100269900 3300005445 Bacteria 1600
76 Ga0070708_100337448 3300005445 Unclassified 1420
77 Ga0070708_100426303 3300005445 Bacteria 1251
78 Ga0070708_100448438 3300005445 Bacteria 1217
79 Ga0070708_101424932 3300005445 Unclassified 646
80 Ga0070663_100058640 3300005455 Bacteria 2765
81 Ga0070663_101347267 3300005455 Bacteria 631
82 Ga0070662_100286816 3300005457 Bacteria 1333
83 Ga0070662_101018058 3300005457 Bacteria 709
84 Ga0070662_101099618 3300005457 Bacteria 682
85 Ga0070681_10011610 3300005458 Bacteria 8721
86 Ga0070681_10044262 3300005458 Bacteria 4455
87 Ga0070681_11280591 3300005458 Bacteria 656
88 Ga0068867_100213924 3300005459 Bacteria 1550
89 Ga0068867_100664276 3300005459 Bacteria 916
90 Ga0070685_10327640 3300005466 Bacteria 1040
91 Ga0070685_10693254 3300005466 Bacteria 742
92 Ga0070706_100071489 3300005467 Bacteria 3209
93 Ga0070707_100220660 3300005468 Bacteria 1846
94 Ga0070707_100347338 3300005468 Bacteria 1441
95 Ga0070707_100845741 3300005468 Bacteria 879
96 Ga0070698_100007050 3300005471 Bacteria 12172
97 Ga0070698_100235713 3300005471 Bacteria 1763
98 Ga0070698_101058591 3300005471 Bacteria 759
99 Ga0070699_100079181 3300005518 Bacteria 2862
100 Ga0070699_100228291 3300005518 Bacteria 1660
101 Ga0070699_101360166 3300005518 Unclassified 651
102 Ga0070679_100072512 3300005530 Bacteria 3435
103 Ga0070684_101538990 3300005535 Bacteria 627
104 Ga0070697_100044046 3300005536 Bacteria 3614
105 Ga0070697_100056194 3300005536 Bacteria 3202
106 Ga0070697_100094038 3300005536 Bacteria 2483
107 Ga0070672_100100472 3300005543 Bacteria 2346
108 Ga0070672_100404958 3300005543 Bacteria 1170
109 Ga0070686_100060614 3300005544 Bacteria 2442
110 Ga0070686_100130150 3300005544 Unclassified 1739
111 Ga0070686_100212608 3300005544 Bacteria 1393
112 Ga0070695_100000076 3300005545 Bacteria 40234
113 Ga0070695_100037025 3300005545 Bacteria 3073
114 Ga0070695_100626948 3300005545 Bacteria 847
115 Ga0070695_100862372 3300005545 Unclassified 729
116 Ga0070696_100009758 3300005546 Bacteria 6424
117 Ga0070696_100013743 3300005546 Bacteria 5437
118 Ga0070696_100037644 3300005546 Unclassified 3337
119 Ga0070696_100081219 3300005546 Bacteria 2296
120 Ga0070696_100307045 3300005546 Bacteria 1217
121 Ga0070696_100770167 3300005546 Unclassified 790
122 Ga0070665_100048599 3300005548 Bacteria 4258
123 Ga0070665_100075321 3300005548 Bacteria 3382
124 Ga0070665_101693797 3300005548 Bacteria 640
125 Ga0070665_102092736 3300005548 Unclassified 571
126 Ga0070704_100021281 3300005549 Bacteria 4202
127 Ga0070704_100059347 3300005549 Bacteria 2729
128 Ga0070704_100293434 3300005549 Bacteria 1352
129 Ga0070704_100813418 3300005549 Bacteria 836
130 Ga0070704_101418948 3300005549 Unclassified 637
131 Ga0068855_100110356 3300005563 Bacteria 3158
132 Ga0068855_101607964 3300005563 Bacteria 665
133 Ga0070664_100020709 3300005564 Bacteria 5417
134 Ga0070664_100044727 3300005564 Bacteria 3738
135 Ga0070664_101228910 3300005564 Bacteria 707
136 Ga0068857_100533565 3300005577 Bacteria 1104
137 Ga0068857_100727635 3300005577 Bacteria 944
138 Ga0068857_101472116 3300005577 Bacteria 663
139 Ga0068854_100171409 3300005578 Bacteria 1689
140 Ga0070702_100044043 3300005615 Bacteria 2518
141 Ga0070702_100237631 3300005615 Bacteria 1228
142 Ga0070702_100262321 3300005615 Bacteria 1177
143 Ga0068852_100915582 3300005616 Bacteria 894
144 Ga0068859_100014683 3300005617 Bacteria 7872
145 Ga0068859_100021645 3300005617 Bacteria 6453
146 Ga0068859_100039242 3300005617 Bacteria 4750
147 Ga0068859_100174446 3300005617 Bacteria 2232
148 Ga0068859_100417000 3300005617 Bacteria 1439
149 Ga0068859_101472743 3300005617 Bacteria 751
150 Ga0068864_100012931 3300005618 Bacteria 6906
151 Ga0068864_100039223 3300005618 Unclassified 4048
152 Ga0068864_100335862 3300005618 Bacteria 1423
153 Ga0068864_102523372 3300005618 Bacteria 520
154 Ga0068866_10160834 3300005718 Bacteria 1309
155 Ga0068866_10250741 3300005718 Bacteria 1083
156 Ga0068866_10697458 3300005718 Bacteria 696
157 Ga0068866_11187115 3300005718 Bacteria 550
158 Ga0068861_100084680 3300005719 Bacteria 2489
159 Ga0068861_100586614 3300005719 Bacteria 1021
160 Ga0068861_100770819 3300005719 Bacteria 900
161 Ga0068861_101117252 3300005719 Bacteria 758
162 Ga0068861_101280025 3300005719 Bacteria 712
163 Ga0068870_10019179 3300005840 Bacteria 3314
164 Ga0068870_10341055 3300005840 Bacteria 958
165 Ga0068863_100040996 3300005841 Bacteria 4402
166 Ga0068863_100559157 3300005841 Bacteria 1130
167 Ga0068863_100641674 3300005841 Bacteria 1053
168 Ga0068858_100921687 3300005842 Unclassified 855
169 Ga0068860_100066929 3300005843 Bacteria 3413
170 Ga0068860_100154486 3300005843 Bacteria 2211
171 Ga0068860_100601362 3300005843 Bacteria 1105
172 Ga0068860_100710508 3300005843 Bacteria 1015
173 Ga0068862_100064541 3300005844 Bacteria 3152
174 Ga0068862_100090196 3300005844 Bacteria 2668
175 Ga0068862_100250456 3300005844 Bacteria 1614
176 Ga0068862_100503154 3300005844 Bacteria 1150
177 Ga0068862_100512582 3300005844 Unclassified 1140
178 Ga0068862_101697236 3300005844 Bacteria 640
179 Ga0081455_10001477 3300005937 Bacteria 29097
180 Ga0081455_10048002 3300005937 Bacteria 3692
181 Ga0081455_10083574 3300005937 Bacteria 2609
182 Ga0081455_10175218 3300005937 Bacteria 1629
183 Ga0081455_10224765 3300005937 Unclassified 1389
184 Ga0081540_1004427 3300005983 Bacteria 10715
185 Ga0081539_10000047 3300005985 Bacteria 275235
186 Ga0081539_10000175 3300005985 Bacteria 150479
187 Ga0081539_10001454 3300005985 Bacteria 40374
188 Ga0075432_10025887 3300006058 Bacteria 2013
189 Ga0075432_10074489 3300006058 Bacteria 1223
190 Ga0070715_10567446 3300006163 Bacteria 660
191 Ga0070712_100469711 3300006175 Bacteria 1050
192 Ga0070712_101716483 3300006175 Bacteria 550
193 Ga0075367_10277845 3300006178 Bacteria 1052
194 Ga0075366_10099188 3300006195 Bacteria 1747
195 Ga0097621_100444859 3300006237 Bacteria 1167
196 Ga0097621_100456169 3300006237 Bacteria 1152
197 Ga0097621_101130324 3300006237 Unclassified 736
198 Ga0097621_101688745 3300006237 Bacteria 603
199 Ga0068871_101809210 3300006358 Bacteria 580
200 Ga0068871_102066656 3300006358 Unclassified 542
201 Ga0075428_100032369 3300006844 Bacteria 5775
202 Ga0075428_100064232 3300006844 Bacteria 4019
203 Ga0075428_100115185 3300006844 Unclassified 2928
204 Ga0075428_100117800 3300006844 Bacteria 2893
205 Ga0075428_100168834 3300006844 Bacteria 2373
206 Ga0075428_100309607 3300006844 Bacteria 1698
207 Ga0075428_100760850 3300006844 Bacteria 1030
208 Ga0075428_100939370 3300006844 Bacteria 917
209 Ga0075428_101089851 3300006844 Bacteria 844
210 Ga0075430_100107648 3300006846 Bacteria 2325
211 Ga0075430_100320360 3300006846 Bacteria 1281
212 Ga0075430_100414699 3300006846 Bacteria 1112
213 Ga0075430_100808781 3300006846 Bacteria 772
214 Ga0075431_100008620 3300006847 Bacteria 10211
215 Ga0075431_100051164 3300006847 Bacteria 4261
216 Ga0075431_101301129 3300006847 Bacteria 688
217 Ga0075433_10001352 3300006852 Bacteria 17979
218 Ga0075433_10019342 3300006852 Bacteria 5673
219 Ga0075433_10063361 3300006852 Bacteria 3239
220 Ga0075433_10071530 3300006852 Bacteria 3049
221 Ga0075433_10240348 3300006852 Bacteria 1608
222 Ga0075433_10252232 3300006852 Bacteria 1565
223 Ga0075433_10354385 3300006852 Bacteria 1297
224 Ga0075433_10453731 3300006852 Bacteria 1130
225 Ga0075433_10489690 3300006852 Bacteria 1083
226 Ga0075433_10772767 3300006852 Bacteria 840
227 Ga0075433_11247041 3300006852 Unclassified 645
228 Ga0075434_100000398 3300006871 Bacteria 31961
229 Ga0075434_100015445 3300006871 Bacteria 7321
230 Ga0075434_100038481 3300006871 Bacteria 4737
231 Ga0075434_100050561 3300006871 Bacteria 4130
232 Ga0075434_100078375 3300006871 Bacteria 3300
233 Ga0075434_100093484 3300006871 Bacteria 3011
234 Ga0075434_100126521 3300006871 Bacteria 2572
235 Ga0075434_100136677 3300006871 Bacteria 2470
236 Ga0075434_100243710 3300006871 Bacteria 1817
237 Ga0075434_100470560 3300006871 Bacteria 1278
238 Ga0075434_101536489 3300006871 Unclassified 675
239 Ga0075434_101791804 3300006871 Bacteria 621
240 Ga0075429_100055097 3300006880 Bacteria 3460
241 Ga0075429_100102930 3300006880 Bacteria 2493
242 Ga0075429_100145960 3300006880 Bacteria 2071
243 Ga0075429_100482195 3300006880 Unclassified 1086
244 Ga0068865_100646319 3300006881 Bacteria 898
245 Ga0075436_100155694 3300006914 Bacteria 1610
246 Ga0097620_100014683 3300006931 Bacteria 7872
247 Ga0097620_100021645 3300006931 Bacteria 6453
248 Ga0097620_100039242 3300006931 Bacteria 4750
249 Ga0097620_100174451 3300006931 Bacteria 2232
250 Ga0097620_100417035 3300006931 Bacteria 1439
251 Ga0097620_101473247 3300006931 Bacteria 751
252 Ga0075435_100014668 3300007076 Bacteria 5870
253 Ga0075435_100041438 3300007076 Bacteria 3681
254 Ga0075435_100069157 3300007076 Bacteria 2878
255 Ga0075435_100070111 3300007076 Bacteria 2861
256 Ga0075435_100149636 3300007076 Bacteria 1962
257 Ga0075435_100776321 3300007076 Bacteria 834
258 Ga0075435_100989692 3300007076 Bacteria 734
259 Ga0075435_101465149 3300007076 Bacteria 598
260 Ga0075435_101569001 3300007076 Bacteria 577
261 Ga0105250_10218505 3300009092 Unclassified 808
262 Ga0105240_10257179 3300009093 Bacteria 2016
263 Ga0111539_10000850 3300009094 Bacteria 39822
264 Ga0111539_10006221 3300009094 Bacteria 15408
265 Ga0111539_10009881 3300009094 Bacteria 12041
266 Ga0111539_10022997 3300009094 Bacteria 7654
267 Ga0111539_10034389 3300009094 Bacteria 6145
268 Ga0111539_10115471 3300009094 Bacteria 3148
269 Ga0111539_10559455 3300009094 Bacteria 1332
270 Ga0111539_10668280 3300009094 Unclassified 1210
271 Ga0111539_10697152 3300009094 Unclassified 1182
272 Ga0111539_11006281 3300009094 Bacteria 969
273 Ga0105247_11432670 3300009101 Viruses 560
274 Ga0114129_10000921 3300009147 Bacteria 38394
275 Ga0114129_10004390 3300009147 Bacteria 19893
276 Ga0114129_10007287 3300009147 Bacteria 15747
277 Ga0114129_10075368 3300009147 Bacteria 4698
278 Ga0114129_10116105 3300009147 Unclassified 3688
279 Ga0114129_10150803 3300009147 Bacteria 3182
280 Ga0114129_10572094 3300009147 Bacteria 1467
281 Ga0114129_10584286 3300009147 Bacteria 1449
282 Ga0114129_10721406 3300009147 Bacteria 1279
283 Ga0114129_10738614 3300009147 Bacteria 1261
284 Ga0114129_11266999 3300009147 Bacteria 915
285 Ga0114129_11298831 3300009147 Bacteria 902
286 Ga0114129_12292597 3300009147 Unclassified 648
287 Ga0105243_11767060 3300009148 Bacteria 649
288 Ga0105243_12070215 3300009148 Bacteria 604
289 Ga0105241_10394388 3300009174 Bacteria 1212
290 Ga0105242_10853977 3300009176 Bacteria 906
291 Ga0105248_10240364 3300009177 Bacteria 2038
292 Ga0105248_12409082 3300009177 Bacteria 600
293 Ga0105249_10079824 3300009553 Bacteria 3038
294 Ga0105249_10169893 3300009553 Bacteria 2114
295 Ga0105249_11396326 3300009553 Bacteria 772
296 Ga0105239_10829723 3300010375 Bacteria 1060
297 Ga0105239_11310069 3300010375 Bacteria 835
298 Ga0105246_10907350 3300011119 Bacteria 791
299 Ga0157338_1026667 3300012515 Bacteria 711
300 Ga0157370_11093057 3300013104 Unclassified 721
301 Ga0157374_10393610 3300013296 Bacteria 1381
302 Ga0157374_12037919 3300013296 Bacteria 600
303 Ga0157378_10096636 3300013297 Bacteria 2692
304 Ga0157378_10144791 3300013297 Bacteria 2209
305 Ga0157378_10264253 3300013297 Bacteria 1652
306 Ga0163162_10041449 3300013306 Bacteria 4607
307 Ga0163162_12234087 3300013306 Unclassified 628
308 Ga0157375_10007885 3300013308 Bacteria 9319
309 Ga0163163_10012339 3300014325 Bacteria 7784
310 Ga0163163_10033227 3300014325 Unclassified 4989
311 Ga0157380_10371675 3300014326 Unclassified 1346
312 Ga0157380_10611861 3300014326 Bacteria 1080
313 Ga0157380_10629006 3300014326 Unclassified 1067
314 Ga0157380_10977670 3300014326 Bacteria 878
315 Ga0163161_10644437 3300017792 Bacteria 877
316 Ga0163161_11142259 3300017792 Bacteria 671
317 Ga0207697_10022760 3300025315 Bacteria 2566
318 Ga0207653_10118312 3300025885 Unclassified 952
319 Ga0207682_10013538 3300025893 Bacteria 3177
320 Ga0207642_10688374 3300025899 Bacteria 643
321 Ga0207710_10632075 3300025900 Viruses 560
322 Ga0207647_10056716 3300025904 Bacteria 2403
323 Ga0207699_10109175 3300025906 Bacteria 1770
324 Ga0207645_10051243 3300025907 Bacteria 2637
325 Ga0207645_10165786 3300025907 Bacteria 1447
326 Ga0207645_10886403 3300025907 Bacteria 606
327 Ga0207643_10003473 3300025908 Bacteria 8481
328 Ga0207684_10210452 3300025910 Unclassified 1677
329 Ga0207684_11653081 3300025910 Bacteria 517
330 Ga0207707_10004115 3300025912 Bacteria 12890
331 Ga0207695_10316128 3300025913 Bacteria 1451
332 Ga0207660_10090084 3300025917 Bacteria 2272
333 Ga0207660_10093455 3300025917 Bacteria 2235
334 Ga0207660_10670146 3300025917 Bacteria 846
335 Ga0207662_10545476 3300025918 Bacteria 802
336 Ga0207657_10095551 3300025919 Bacteria 2473
337 Ga0207652_10330502 3300025921 Bacteria 1376
338 Ga0207646_10326275 3300025922 Bacteria 1387
339 Ga0207646_10347762 3300025922 Bacteria 1340
340 Ga0207646_11191621 3300025922 Bacteria 668
341 Ga0207646_11798843 3300025922 Bacteria 524
342 Ga0207681_10206412 3300025923 Bacteria 1511
343 Ga0207681_10371568 3300025923 Bacteria 1149
344 Ga0207681_10876061 3300025923 Bacteria 751
345 Ga0207694_11689889 3300025924 Bacteria 533
346 Ga0207650_10041763 3300025925 Bacteria 3362
347 Ga0207650_10057008 3300025925 Bacteria 2904
348 Ga0207659_10197584 3300025926 Bacteria 1604
349 Ga0207659_10427817 3300025926 Bacteria 1111
350 Ga0207644_10059303 3300025931 Bacteria 2768
351 Ga0207644_10267399 3300025931 Bacteria 1369
352 Ga0207644_10600146 3300025931 Bacteria 914
353 Ga0207644_11013743 3300025931 Unclassified 697
354 Ga0207644_11250079 3300025931 Bacteria 624
355 Ga0207690_10052173 3300025932 Bacteria 2738
356 Ga0207690_11125486 3300025932 Bacteria 655
357 Ga0207706_10019750 3300025933 Bacteria 6060
358 Ga0207706_10254294 3300025933 Bacteria 1534
359 Ga0207686_10090406 3300025934 Bacteria 2020
360 Ga0207686_11165597 3300025934 Bacteria 630
361 Ga0207709_10390703 3300025935 Bacteria 1061
362 Ga0207670_10054435 3300025936 Bacteria 2700
363 Ga0207669_10938007 3300025937 Bacteria 725
364 Ga0207669_11079712 3300025937 Unclassified 677
365 Ga0207704_10010877 3300025938 Bacteria 4458
366 Ga0207665_10505602 3300025939 Archaea 934
367 Ga0207691_10002008 3300025940 Bacteria 19911
368 Ga0207691_10225173 3300025940 Bacteria 1625
369 Ga0207691_10458489 3300025940 Bacteria 1084
370 Ga0207711_10144924 3300025941 Bacteria 2139
371 Ga0207711_10192095 3300025941 Bacteria 1861
372 Ga0207689_10143420 3300025942 Bacteria 1968
373 Ga0207689_10221320 3300025942 Bacteria 1564
374 Ga0207661_10324679 3300025944 Bacteria 1384
375 Ga0207661_11065788 3300025944 Bacteria 744
376 Ga0207679_10043848 3300025945 Bacteria 3223
377 Ga0207667_11480315 3300025949 Bacteria 650
378 Ga0207651_10362997 3300025960 Bacteria 1223
379 Ga0207651_11344962 3300025960 Bacteria 642
380 Ga0207712_10015294 3300025961 Bacteria 4946
381 Ga0207712_10164018 3300025961 Bacteria 1730
382 Ga0207712_10203329 3300025961 Bacteria 1572
383 Ga0207712_11287853 3300025961 Bacteria 653
384 Ga0207712_11828421 3300025961 Bacteria 544
385 Ga0207668_10454739 3300025972 Bacteria 1093
386 Ga0207668_10925251 3300025972 Bacteria 777
387 Ga0207640_10301792 3300025981 Bacteria 1267
388 Ga0207640_10390386 3300025981 Bacteria 1130
389 Ga0207658_10072306 3300025986 Bacteria 2614
390 Ga0207658_10870870 3300025986 Unclassified 819
391 Ga0207658_11142061 3300025986 Bacteria 712
392 Ga0207677_10244128 3300026023 Bacteria 1455
393 Ga0207703_10447846 3300026035 Unclassified 1206
394 Ga0207703_10769482 3300026035 Unclassified 918
395 Ga0207678_10755639 3300026067 Bacteria 857
396 Ga0207708_10049587 3300026075 Bacteria 3197
397 Ga0207708_10106690 3300026075 Unclassified 2172
398 Ga0207708_10168939 3300026075 Bacteria 1731
399 Ga0207641_10030813 3300026088 Bacteria 4445
400 Ga0207641_10593354 3300026088 Bacteria 1084
401 Ga0207641_11015333 3300026088 Unclassified 826
402 Ga0207648_10079942 3300026089 Bacteria 2852
403 Ga0207648_10097149 3300026089 Bacteria 2578
404 Ga0207648_10384802 3300026089 Bacteria 1269
405 Ga0207676_10018981 3300026095 Bacteria 5009
406 Ga0207674_10063174 3300026116 Archaea 3738
407 Ga0207674_10419985 3300026116 Bacteria 1292
408 Ga0207674_10610902 3300026116 Bacteria 1053
409 Ga0207674_10913688 3300026116 Bacteria 846
410 Ga0207674_11179372 3300026116 Bacteria 735
411 Ga0207675_100010116 3300026118 Bacteria 8841
412 Ga0207675_100045338 3300026118 Bacteria 4108
413 Ga0207675_100464742 3300026118 Unclassified 1256
414 Ga0207675_100651544 3300026118 Bacteria 1059
415 Ga0207675_101022199 3300026118 Bacteria 845
416 Ga0207698_11698897 3300026142 Unclassified 647
417 Ga0209983_1058503 3300027665 Bacteria 849
418 Ga0209966_1014832 3300027695 Bacteria 1459
419 Ga0209974_10317044 3300027876 Bacteria 599
420 Ga0207428_10000870 3300027907 Bacteria 33924
421 Ga0207428_10012848 3300027907 Bacteria 7341
422 Ga0207428_10019280 3300027907 Bacteria 5816
423 Ga0207428_10074854 3300027907 Bacteria 2654
424 Ga0207428_10094069 3300027907 Bacteria 2324
425 Ga0207428_10218271 3300027907 Bacteria 1430
426 Ga0207428_10248190 3300027907 Bacteria 1328
427 Ga0207428_10322235 3300027907 Bacteria 1141
428 Ga0207428_10464666 3300027907 Bacteria 922
429 Ga0207428_10510257 3300027907 Bacteria 873
430 Ga0207428_11262377 3300027907 Bacteria 513
431 Ga0268266_10003524 3300028379 Bacteria 15531
432 Ga0268265_10154940 3300028380 Bacteria 1937
433 Ga0268265_10185597 3300028380 Bacteria 1791
434 Ga0268265_10275784 3300028380 Bacteria 1502
435 Ga0268265_10628339 3300028380 Bacteria 1030
436 Ga0268265_10779607 3300028380 Bacteria 930
437 Ga0268265_10792447 3300028380 Bacteria 923
438 Ga0268265_12432343 3300028380 Bacteria 530
439 Ga0268264_10388586 3300028381 Bacteria 1338
440 Ga0268264_10530304 3300028381 Bacteria 1152
441 Ga0268264_10672443 3300028381 Bacteria 1026
442 Ga0268264_11345965 3300028381 Bacteria 724
443 Ga0268264_11384559 3300028381 Bacteria 714
444 Ga0268264_11487284 3300028381 Bacteria 688
445 Ga0268264_12317091 3300028381 Bacteria 544
446 Ga0265325_10405524 3300031241 Bacteria 597
447 Ga0265327_10039288 3300031251 Bacteria 2572
448 Ga0307408_100663203 3300031548 Bacteria 934
449 Ga0307408_101267508 3300031548 Bacteria 690
450 Ga0307405_10651614 3300031731 Bacteria 866
451 Ga0307416_102033352 3300032002 Bacteria 677
452 Ga0373934_0002188 3300035086 Bacteria 7185
453 Ga0373934_0282756 3300035086 Unclassified 687
454 Ga0373944_0020211 3300035089 Bacteria 1916
455 Ga0373951_0113486 3300035091 Bacteria 731
456 Ga0373923_0705335 3300035111 Bacteria 501
457 Ga0373932_0195768 3300035112 Bacteria 716
458 Ga0373932_0443068 3300035112 Unclassified 509
459 Ga0373936_0021315 3300035113 Bacteria 2520
460 Ga0373939_0066398 3300035114 Bacteria 1163
461 Ga0373939_0109727 3300035114 Bacteria 959
462 Ga0373939_0195606 3300035114 Bacteria 762
463 Ga0373939_0519566 3300035114 Bacteria 511
464 Ga0373945_0317121 3300035116 Bacteria 670
465 Ga0373953_0101989 3300035117 Unclassified 1208
466 Ga0373954_0151838 3300035118 Bacteria 1131
467 Ga0373956_0022659 3300035119 Bacteria 2689
468 Ga0373957_0114261 3300035120 Unclassified 1089
469 Ga0373943_0113039 3300035170 Bacteria 1434
470 Ga0373955_0002206 3300035172 Bacteria 8452
471 Ga0373955_0137319 3300035172 Bacteria 1431
472 Ga0373955_0203943 3300035172 Bacteria 1178
473 Ga0373955_0546566 3300035172 Bacteria 708
474 Ga0373942_0055989 3300035207 Unclassified 1118
475 Ga0373961_0420791 3300035241 Bacteria 516
476 Ga0373962_0075073 3300035242 Unclassified 1017
477 Ga0373962_0098389 3300035242 Bacteria 910
478 Ga0373924_0492097 3300035410 Bacteria 551
479 Ga0373931_0037196 3300035691 Unclassified 2541
480 Ga0373931_0137235 3300035691 Bacteria 1413
481 Ga0373931_0199716 3300035691 Bacteria 1194
482 Ga0373935_0005403 3300035692 Bacteria 7528
483 Ga0373935_0616691 3300035692 Unclassified 794
484 Ga0373935_0684510 3300035692 Bacteria 754
485 Ga0373927_0031574 3300035695 Bacteria 3452
486 Ga0373933_0000282 3300035724 Bacteria 32973
487 Ga0373933_0012495 3300035724 Bacteria 4690
488 Ga0373933_0451148 3300035724 Unclassified 841
489 Ga0373947_0005595 3300035725 Bacteria 7328
490 Ga0373947_0102610 3300035725 Bacteria 1799
491 Ga0373947_0908579 3300035725 Bacteria 601
492 Ga0373937_0000272 3300036401 Bacteria 49656
493 Ga0373937_0037348 3300036401 Bacteria 4426
494 Ga0373937_0098182 3300036401 Bacteria 2716
495 Ga0373937_0303160 3300036401 Unclassified 1510
496 Ga0373937_0513821 3300036401 Unclassified 1138
497 Ga0373937_1617252 3300036401 Bacteria 595
498 Ga0373937_1957693 3300036401 Bacteria 532
499 Ga0373925_0033625 3300037068 Bacteria 3777
500 Ga0373925_0129576 3300037068 Unclassified 1966
501 Ga0373925_0575896 3300037068 Unclassified 927
502 Ga0450923_193360 3300042125 Unclassified 504
503 Ga0439434_0047283 3300042435 Unclassified 1329
504 Ga0439435_0036339 3300042436 Bacteria 1361
505 Ga0439444_0023861 3300042437 Bacteria 1101
506 Ga0451577_0001787 3300042876 Bacteria 27578
507 Ga0453683_0145109 3300044673 Bacteria 1498
508 Ga0453683_0403920 3300044673 Bacteria 881
509 Ga0453684_0000221 3300044712 Bacteria 249908
510 Ga0453684_0218831 3300044712 Bacteria 2207
511 Ga0451576_0021043 3300045051 Bacteria 7096
512 Ga0451576_0027681 3300045051 Bacteria 6085
513 Ga0451576_0060712 3300045051 Bacteria 3943
514 Ga0451576_0082926 3300045051 Bacteria 3335
515 Ga0451576_0111366 3300045051 Bacteria 2849
516 Ga0451576_0178142 3300045051 Bacteria 2219
517 Ga0451576_0371533 3300045051 Bacteria 1498
518 Ga0451576_2710352 3300045051 Unclassified 504
519 Ga0466967_1292066 3300045976 Bacteria 727
520 Ga0495603_0010168 3300046455 Bacteria 5693
521 Ga0495603_0132651 3300046455 Bacteria 1450
522 Ga0495590_0234488 3300046457 Bacteria 680
523 Ga0495629_0247612 3300046459 Bacteria 1227
524 Ga0495651_0125516 3300046462 Bacteria 1880
525 Ga0495580_0059404 3300046472 Bacteria 2687
526 Ga0495639_0220342 3300046475 Bacteria 933
527 Ga0495584_0173569 3300046491 Bacteria 1096
528 Ga0495585_0353238 3300046492 Bacteria 714
529 Ga0495594_0691109 3300046499 Bacteria 577
530 Ga0495583_0269664 3300046506 Bacteria 680
531 Ga0495608_0447783 3300046511 Bacteria 786
532 Ga0495628_0009103 3300046516 Bacteria 8496
533 Ga0495628_0752602 3300046516 Bacteria 685
534 Ga0495630_0141755 3300046517 Bacteria 1828
535 Ga0495644_0224350 3300046523 Bacteria 727
536 Ga0495663_0316513 3300046525 Unclassified 564
537 Ga0495642_0012435 3300046528 Bacteria 3282
538 Ga0495642_0242450 3300046528 Unclassified 788
539 Ga0495586_0286438 3300046535 Bacteria 943
540 Ga0495609_0355838 3300046538 Bacteria 590
541 Ga0495621_0230749 3300046539 Bacteria 752
542 Ga0495597_0168020 3300046542 Bacteria 892
543 Ga0495667_0077646 3300046559 Bacteria 2160
544 Ga0495656_0158292 3300046615 Bacteria 1099
545 Ga0495656_0326568 3300046615 Bacteria 791
546 Ga0495656_0385887 3300046615 Bacteria 731
547 Ga0495659_0024223 3300046664 Bacteria 2068
548 Ga0495659_0032128 3300046664 Bacteria 1835
549 Ga0495659_0115327 3300046664 Bacteria 1053
550 Ga0495659_0247308 3300046664 Bacteria 742
551 Ga0495659_0249078 3300046664 Bacteria 740
552 Ga0495659_0390424 3300046664 Bacteria 599
553 Ga0495661_0630696 3300046665 Bacteria 502
554 Ga0495588_0005306 3300046674 Bacteria 5730
555 Ga0495588_0519191 3300046674 Bacteria 624
556 Ga0495669_0141084 3300046684 Bacteria 1138
557 Ga0495669_0219260 3300046684 Bacteria 912
558 Ga0495670_0263293 3300046691 Bacteria 920
559 Ga0495589_0483062 3300046794 Bacteria 566
560 Ga0495636_0142641 3300047318 Bacteria 1070
561 Ga0495636_0615775 3300047318 Bacteria 531
562 Ga0495674_0586907 3300047319 Bacteria 884
563 Ga0495672_0419614 3300047320 Bacteria 609
564 Ga0495680_0356918 3300047322 Unclassified 1017
565 Ga0495677_0256085 3300047445 Bacteria 685
566 Ga0495677_0325058 3300047445 Unclassified 606
567 Ga0495685_119041 3300047447 Bacteria 867
568 Ga0495685_250075 3300047447 Bacteria 562
569 Ga0496100_0416600 3300048903 Bacteria 1025
570 Ga0496100_1067236 3300048903 Unclassified 636
571 Ga0496100_1488473 3300048903 Bacteria 535
572 Ga0496101_0355754 3300048904 Bacteria 1151
573 Ga0496102_1049419 3300048905 Bacteria 735
574 Ga0496102_1138012 3300048905 Bacteria 700
575 Ga0496104_0156873 3300048907 Bacteria 2184
576 Ga0496104_0279841 3300048907 Bacteria 1581
577 Ga0496104_0501176 3300048907 Bacteria 1125
578 Ga0496104_0974848 3300048907 Bacteria 752
579 Ga0496104_1015821 3300048907 Bacteria 733
580 Ga0496104_1781714 3300048907 Bacteria 518
581 Ga0496105_0512516 3300048908 Bacteria 940
582 Ga0496105_1316829 3300048908 Bacteria 527
583 Ga0496106_0389022 3300048909 Unclassified 1121
584 Ga0496106_1295540 3300048909 Unclassified 566
585 Ga0496107_0371690 3300048910 Bacteria 1063
586 Ga0496107_0847726 3300048910 Bacteria 668
587 Ga0496108_0331186 3300048911 Bacteria 1328
588 Ga0496108_0818483 3300048911 Bacteria 803
589 Ga0496109_0182068 3300048912 Bacteria 1974
590 Ga0496110_0767545 3300048913 Unclassified 868
591 Ga0496112_0160668 3300048915 Bacteria 2213
592 Ga0496112_0255701 3300048915 Unclassified 1702
593 Ga0496113_1158877 3300048916 Bacteria 605
594 Ga0496114_0187574 3300048917 Bacteria 1808
595 Ga0496115_0363062 3300048918 Bacteria 1180
596 Ga0501031_0020428 3300049568 Bacteria 4317
597 Ga0501032_0444543 3300049569 Unclassified 831
598 Ga0501034_0009078 3300049571 Bacteria 10442
599 Ga0501034_0180852 3300049571 Bacteria 2073
600 Ga0501036_0020044 3300049572 Bacteria 5615
601 Ga0501036_0039453 3300049572 Bacteria 3996
602 Ga0501036_1209724 3300049572 Bacteria 616
603 Ga0501037_0183103 3300049573 Bacteria 1486
604 Ga0501037_0270502 3300049573 Unclassified 1186
605 Ga0501038_0006069 3300049574 Bacteria 11178
606 Ga0501038_0064005 3300049574 Bacteria 3137
607 Ga0501039_0524576 3300049575 Bacteria 930
608 Ga0501039_1089116 3300049575 Unclassified 619
609 Ga0501040_0096719 3300049576 Unclassified 2056
610 Ga0501041_0333045 3300049577 Unclassified 958
611 Ga0501042_0024714 3300049578 Bacteria 4215
612 Ga0501043_0109025 3300049579 Bacteria 2174
613 Ga0501043_0673952 3300049579 Bacteria 757
614 Ga0501046_0010580 3300049580 Bacteria 7917
615 Ga0501047_0003391 3300049581 Bacteria 15079
616 Ga0501047_0132426 3300049581 Bacteria 2373
617 Ga0501048_0060057 3300049582 Bacteria 2694
618 Ga0501067_0024542 3300049583 Bacteria 3344
619 Ga0501067_0116812 3300049583 Bacteria 1484
620 Ga0501068_0008051 3300049584 Bacteria 5846
621 Ga0501068_0037007 3300049584 Unclassified 2921
622 Ga0501069_0003501 3300049585 Bacteria 8088
623 Ga0501069_0495836 3300049585 Unclassified 728
624 Ga0501070_0010606 3300049586 Bacteria 7788
625 Ga0501070_0501563 3300049586 Bacteria 975
626 Ga0501070_1001590 3300049586 Unclassified 648
627 Ga0501071_0819505 3300049587 Bacteria 718
628 Ga0501072_0001569 3300049588 Bacteria 17055
629 Ga0501072_0006341 3300049588 Bacteria 9009
630 Ga0501072_0607530 3300049588 Bacteria 862
631 Ga0501073_0002650 3300049589 Bacteria 13415
632 Ga0501073_0098802 3300049589 Unclassified 2027
633 Ga0501073_0246229 3300049589 Bacteria 1234
634 Ga0501073_0399485 3300049589 Bacteria 949
635 Ga0501074_0010548 3300049590 Bacteria 6704
636 Ga0501074_1034824 3300049590 Unclassified 577
637 Ga0501074_1106282 3300049590 Bacteria 556
638 Ga0501075_0132178 3300049591 Unclassified 1901
639 Ga0501076_0028221 3300049592 Bacteria 4356
640 Ga0501076_1557364 3300049592 Bacteria 542
641 Ga0501077_0081625 3300049593 Bacteria 2048
642 Ga0501216_124749 3300049660 Bacteria 591
643 Ga0501257_263004 3300049686 Unclassified 515
644 Ga0501079_0008874 3300049741 Bacteria 7612
645 Ga0501079_1078003 3300049741 Bacteria 633
646 Ga0501080_0003901 3300049742 Bacteria 13206
647 Ga0501080_0138516 3300049742 Bacteria 2251
648 Ga0501080_1497867 3300049742 Bacteria 573
649 Ga0501081_0027789 3300049743 Bacteria 3815
650 Ga0501081_0927679 3300049743 Bacteria 657
651 Ga0501083_0008421 3300049744 Bacteria 7290
652 Ga0501035_0525039 3300049822 Bacteria 972
653 Ga0501044_0006953 3300049823 Bacteria 12450
654 Ga0501044_0769176 3300049823 Unclassified 844
655 Ga0501044_1175147 3300049823 Bacteria 635
656 Ga0501045_0149361 3300049824 Unclassified 1738
657 nmdc:mga0yw44_456155_c1 3300050492 Bacteria 866
658 nmdc:mga05p37_198258_c1 3300050507 Unclassified 2433
659 nmdc:mga05p37_226677_c1 3300050507 Bacteria 2253
660 nmdc:mga05p37_264182_c1 3300050507 Bacteria 2058
661 nmdc:mga05p37_339_c1 3300050507 Bacteria 50117
662 nmdc:mga05p37_54843_c1 3300050507 Bacteria 4903
663 nmdc:mga05p37_593335_c1 3300050507 Bacteria 1252
664 nmdc:mga05p37_652900_c1 3300050507 Bacteria 1178
665 nmdc:mga05p37_8282_c1 3300050507 Bacteria 12293
666 nmdc:mga05p37_9101_c1 3300050507 Bacteria 11737
667 nmdc:mga09592_124168_c1 3300050508 Bacteria 2219
668 nmdc:mga09592_718684_c1 3300050508 Bacteria 849
669 nmdc:mga09592_933880_c1 3300050508 Unclassified 728
670 nmdc:mga0qj67_119715_c1 3300050509 Unclassified 2129
671 nmdc:mga0qj67_64700_c1 3300050509 Bacteria 2910
672 nmdc:mga0qj67_902222_c1 3300050509 Bacteria 696
673 nmdc:mga06r32_100499_c1 3300050510 Bacteria 2838
674 nmdc:mga06r32_1503005_c1 3300050510 Unclassified 614
675 nmdc:mga06r32_40549_c1 3300050510 Bacteria 4421
676 nmdc:mga06r32_520504_c1 3300050510 Bacteria 1165
677 nmdc:mga06r32_5481_c1 3300050510 Bacteria 11424
678 nmdc:mga08y16_115266_c1 3300050511 Bacteria 2797
679 nmdc:mga08y16_168874_c1 3300050511 Bacteria 2272
680 nmdc:mga08y16_182348_c1 3300050511 Bacteria 2180
681 nmdc:mga08y16_1931168_c1 3300050511 Unclassified 541
682 nmdc:mga08y16_23060_c1 3300050511 Bacteria 6571
683 nmdc:mga08y16_231106_c1 3300050511 Bacteria 1913
684 nmdc:mga08y16_36527_c1 3300050511 Bacteria 5160
685 nmdc:mga08y16_385660_c1 3300050511 Bacteria 1436
686 nmdc:mga08y16_69292_c1 3300050511 Bacteria 3677
687 nmdc:mga08y16_78833_c1 3300050511 Bacteria 3434
688 nmdc:mga08y16_866678_c1 3300050511 Unclassified 891
689 nmdc:mga0n895_119730_c1 3300050512 Bacteria 2654
690 nmdc:mga0n895_226293_c1 3300050512 Bacteria 1899
691 nmdc:mga0n895_247556_c1 3300050512 Bacteria 1809
692 nmdc:mga0n895_2654_c1 3300050512 Bacteria 14111
693 nmdc:mga0n895_31875_c1 3300050512 Bacteria 5053
694 nmdc:mga0n895_50974_c1 3300050512 Bacteria 4060
695 nmdc:mga0n895_62220_c1 3300050512 Bacteria 3688
696 nmdc:mga0n895_629060_c1 3300050512 Bacteria 1074
697 nmdc:mga0n895_6965_c1 3300050512 Bacteria 9650
698 nmdc:mga0n895_704752_c1 3300050512 Bacteria 1005
699 nmdc:mga0rr50_131547_c1 3300050513 Bacteria 2004
700 nmdc:mga0rr50_141987_c1 3300050513 Bacteria 1933
701 nmdc:mga0rr50_260253_c1 3300050513 Bacteria 1443
702 nmdc:mga0rr50_290772_c1 3300050513 Bacteria 1365
703 nmdc:mga0rr50_33479_c1 3300050513 Bacteria 3671
704 nmdc:mga0rr50_46250_c1 3300050513 Bacteria 3204
705 nmdc:mga0rr50_480433_c1 3300050513 Bacteria 1055
706 nmdc:mga0rr50_838567_c1 3300050513 Bacteria 784
707 nmdc:mga0a205_1140473_c1 3300050515 Bacteria 627
708 nmdc:mga0a205_144098_c1 3300050515 Bacteria 2282
709 nmdc:mga0a205_148061_c1 3300050515 Bacteria 2248
710 nmdc:mga0a205_150462_c1 3300050515 Bacteria 2227
711 nmdc:mga0a205_152452_c1 3300050515 Bacteria 2210
712 nmdc:mga0a205_224158_c1 3300050515 Bacteria 1765
713 nmdc:mga0a205_225741_c1 3300050515 Unclassified 1757
714 nmdc:mga0a205_24061_c1 3300050515 Bacteria 5784
715 nmdc:mga0a205_250558_c1 3300050515 Bacteria 1650
716 nmdc:mga0a205_336623_c1 3300050515 Bacteria 1378
717 nmdc:mga0a205_3825_c1 3300050515 Bacteria 13483
718 nmdc:mga0a205_407170_c1 3300050515 Bacteria 1224
719 Ga0495595_0375163 3300053084 Bacteria 719
720 Ga0495619_0648635 3300053085 Unclassified 720
721 Ga0500646_0372345 3300053090 Bacteria 524
722 Ga0501084_0618168 3300054114 Bacteria 915
723 Ga0501082_0019631 3300060353 Bacteria 5827
724 Ga0501082_0109756 3300060353 Bacteria 2388
725 Ga0501082_0232162 3300060353 Bacteria 1606
726 Ga0530510_0003696 3300061734 Bacteria 10526
727 Ga0530510_0702340 3300061734 Bacteria 771
728 Ga0070690_100100755
729 ARcpr5oldR_c016755
730 ARcpr5yngRDRAFT_c010194
731 JGI24746J21847_1036827
732 JGI25406J46586_10001685
733 JGI25406J46586_10007182
734 JGI25406J46586_10084439
735 Ga0065714_10447631
736 Ga0065712_10104073
737 Ga0065712_10106096
738 Ga0065715_10142108
739 Ga0065715_10308767
740 Ga0065707_10289001
741 Ga0065707_10317748
742 Ga0065707_10475139
743 Ga0070676_10053591
744 Ga0070676_10068470
745 Ga0070676_11307221
746 Ga0070683_100074962
747 Ga0070690_100334420
748 Ga0070670_100059914
749 Ga0070670_100144311
750 Ga0070670_100170891
751 Ga0070677_10010851
752 Ga0068869_100169343
753 Ga0068869_100601371
754 Ga0068869_101363639
755 Ga0070680_100082279
756 Ga0070680_100197679
757 Ga0070682_100058507
758 Ga0070660_100121243
759 Ga0070689_100039851
760 Ga0070689_101029407
761 Ga0070691_10121257
762 Ga0070687_100741233
763 Ga0070661_100021331
764 Ga0070692_10207740
765 Ga0070692_10813806
766 Ga0070668_100471032
767 Ga0070668_100504840
768 Ga0070668_101021293
769 Ga0070669_100066919
770 Ga0070669_100089043
771 Ga0070669_100109669
772 Ga0070669_100142442
773 Ga0070669_101207923
774 Ga0070675_100027961
775 Ga0070675_100211755
776 Ga0070675_101932502
777 Ga0070671_101049544
778 Ga0070671_101502580
779 Ga0070674_100010510
780 Ga0070674_101646785
781 Ga0070673_100184464
782 Ga0070673_100432627
783 Ga0070688_100932791
784 Ga0070659_100071481
785 Ga0070659_101701350
786 Ga0070667_100057497
787 Ga0070667_100598026
788 Ga0070703_10244788
789 Ga0070701_10021433
790 Ga0070701_10104261
791 Ga0070705_100000037
792 Ga0070705_100011227
793 Ga0070705_100021237
794 Ga0070705_100658578
795 Ga0070700_100168704
796 Ga0070700_100185795
797 Ga0070694_100005053
798 Ga0070694_100095082
799 Ga0070694_100109420
800 Ga0070694_100180764
801 Ga0070694_100235998
802 Ga0070708_100269900
803 Ga0070708_100337448
804 Ga0070708_100426303
805 Ga0070708_100448438
806 Ga0070708_101424932
807 Ga0070663_100058640
808 Ga0070663_101347267
809 Ga0070662_100286816
810 Ga0070662_101018058
811 Ga0070662_101099618
812 Ga0070681_10011610
813 Ga0070681_10044262
814 Ga0070681_11280591
815 Ga0068867_100213924
816 Ga0068867_100664276
817 Ga0070685_10327640
818 Ga0070685_10693254
819 Ga0070706_100071489
820 Ga0070707_100220660
821 Ga0070707_100347338
822 Ga0070707_100845741
823 Ga0070698_100007050
824 Ga0070698_100235713
825 Ga0070698_101058591
826 Ga0070699_100079181
827 Ga0070699_100228291
828 Ga0070699_101360166
829 Ga0070679_100072512
830 Ga0070684_101538990
831 Ga0070697_100044046
832 Ga0070697_100056194
833 Ga0070697_100094038
834 Ga0070672_100100472
835 Ga0070672_100404958
836 Ga0070686_100060614
837 Ga0070686_100130150
838 Ga0070686_100212608
839 Ga0070695_100000076
840 Ga0070695_100037025
841 Ga0070695_100626948
842 Ga0070695_100862372
843 Ga0070696_100009758
844 Ga0070696_100013743
845 Ga0070696_100037644
846 Ga0070696_100081219
847 Ga0070696_100307045
848 Ga0070696_100770167
849 Ga0070665_100048599
850 Ga0070665_100075321
851 Ga0070665_101693797
852 Ga0070665_102092736
853 Ga0070704_100021281
854 Ga0070704_100059347
855 Ga0070704_100293434
856 Ga0070704_100813418
857 Ga0070704_101418948
858 Ga0068855_100110356
859 Ga0068855_101607964
860 Ga0070664_100020709
861 Ga0070664_100044727
862 Ga0070664_101228910
863 Ga0068857_100533565
864 Ga0068857_100727635
865 Ga0068857_101472116
866 Ga0068854_100171409
867 Ga0070702_100044043
868 Ga0070702_100237631
869 Ga0070702_100262321
870 Ga0068852_100915582
871 Ga0068859_100014683
872 Ga0068859_100021645
873 Ga0068859_100039242
874 Ga0068859_100174446
875 Ga0068859_100417000
876 Ga0068859_101472743
877 Ga0068864_100012931
878 Ga0068864_100039223
879 Ga0068864_100335862
880 Ga0068864_102523372
881 Ga0068866_10160834
882 Ga0068866_10250741
883 Ga0068866_10697458
884 Ga0068866_11187115
885 Ga0068861_100084680
886 Ga0068861_100586614
887 Ga0068861_100770819
888 Ga0068861_101117252
889 Ga0068861_101280025
890 Ga0068870_10019179
891 Ga0068870_10341055
892 Ga0068863_100040996
893 Ga0068863_100559157
894 Ga0068863_100641674
895 Ga0068858_100921687
896 Ga0068860_100066929
897 Ga0068860_100154486
898 Ga0068860_100601362
899 Ga0068860_100710508
900 Ga0068862_100064541
901 Ga0068862_100090196
902 Ga0068862_100250456
903 Ga0068862_100503154
904 Ga0068862_100512582
905 Ga0068862_101697236
906 Ga0081455_10001477
907 Ga0081455_10048002
908 Ga0081455_10083574
909 Ga0081455_10175218
910 Ga0081455_10224765
911 Ga0081540_1004427
912 Ga0081539_10000047
913 Ga0081539_10000175
914 Ga0081539_10001454
915 Ga0075432_10025887
916 Ga0075432_10074489
917 Ga0070715_10567446
918 Ga0070712_100469711
919 Ga0070712_101716483
920 Ga0075367_10277845
921 Ga0075366_10099188
922 Ga0097621_100444859
923 Ga0097621_100456169
924 Ga0097621_101130324
925 Ga0097621_101688745
926 Ga0068871_101809210
927 Ga0068871_102066656
928 Ga0075428_100032369
929 Ga0075428_100064232
930 Ga0075428_100115185
931 Ga0075428_100117800
932 Ga0075428_100168834
933 Ga0075428_100309607
934 Ga0075428_100760850
935 Ga0075428_100939370
936 Ga0075428_101089851
937 Ga0075430_100107648
938 Ga0075430_100320360
939 Ga0075430_100414699
940 Ga0075430_100808781
941 Ga0075431_100008620
942 Ga0075431_100051164
943 Ga0075431_101301129
944 Ga0075433_10001352
945 Ga0075433_10019342
946 Ga0075433_10063361
947 Ga0075433_10071530
948 Ga0075433_10240348
949 Ga0075433_10252232
950 Ga0075433_10354385
951 Ga0075433_10453731
952 Ga0075433_10489690
953 Ga0075433_10772767
954 Ga0075433_11247041
955 Ga0075434_100000398
956 Ga0075434_100015445
957 Ga0075434_100038481
958 Ga0075434_100050561
959 Ga0075434_100078375
960 Ga0075434_100093484
961 Ga0075434_100126521
962 Ga0075434_100136677
963 Ga0075434_100243710
964 Ga0075434_100470560
965 Ga0075434_101536489
966 Ga0075434_101791804
967 Ga0075429_100055097
968 Ga0075429_100102930
969 Ga0075429_100145960
970 Ga0075429_100482195
971 Ga0068865_100646319
972 Ga0075436_100155694
973 Ga0097620_100014683
974 Ga0097620_100021645
975 Ga0097620_100039242
976 Ga0097620_100174451
977 Ga0097620_100417035
978 Ga0097620_101473247
979 Ga0075435_100014668
980 Ga0075435_100041438
981 Ga0075435_100069157
982 Ga0075435_100070111
983 Ga0075435_100149636
984 Ga0075435_100776321
985 Ga0075435_100989692
986 Ga0075435_101465149
987 Ga0075435_101569001
988 Ga0105250_10218505
989 Ga0105240_10257179
990 Ga0111539_10000850
991 Ga0111539_10006221
992 Ga0111539_10009881
993 Ga0111539_10022997
994 Ga0111539_10034389
995 Ga0111539_10115471
996 Ga0111539_10559455
997 Ga0111539_10668280
998 Ga0111539_10697152
999 Ga0111539_11006281
1000 Ga0105247_11432670
1001 Ga0114129_10000921
1002 Ga0114129_10004390
1003 Ga0114129_10007287
1004 Ga0114129_10075368
1005 Ga0114129_10116105
1006 Ga0114129_10150803
1007 Ga0114129_10572094
1008 Ga0114129_10584286
1009 Ga0114129_10721406
1010 Ga0114129_10738614
1011 Ga0114129_11266999
1012 Ga0114129_11298831
1013 Ga0114129_12292597
1014 Ga0105243_11767060
1015 Ga0105243_12070215
1016 Ga0105241_10394388
1017 Ga0105242_10853977
1018 Ga0105248_10240364
1019 Ga0105248_12409082
1020 Ga0105249_10079824
1021 Ga0105249_10169893
1022 Ga0105249_11396326
1023 Ga0105239_10829723
1024 Ga0105239_11310069
1025 Ga0105246_10907350
1026 Ga0157338_1026667
1027 Ga0157370_11093057
1028 Ga0157374_10393610
1029 Ga0157374_12037919
1030 Ga0157378_10096636
1031 Ga0157378_10144791
1032 Ga0157378_10264253
1033 Ga0163162_10041449
1034 Ga0163162_12234087
1035 Ga0157375_10007885
1036 Ga0163163_10012339
1037 Ga0163163_10033227
1038 Ga0157380_10371675
1039 Ga0157380_10611861
1040 Ga0157380_10629006
1041 Ga0157380_10977670
1042 Ga0163161_10644437
1043 Ga0163161_11142259
1044 Ga0207697_10022760
1045 Ga0207653_10118312
1046 Ga0207682_10013538
1047 Ga0207642_10688374
1048 Ga0207710_10632075
1049 Ga0207647_10056716
1050 Ga0207699_10109175
1051 Ga0207645_10051243
1052 Ga0207645_10165786
1053 Ga0207645_10886403
1054 Ga0207643_10003473
1055 Ga0207684_10210452
1056 Ga0207684_11653081
1057 Ga0207707_10004115
1058 Ga0207695_10316128
1059 Ga0207660_10090084
1060 Ga0207660_10093455
1061 Ga0207660_10670146
1062 Ga0207662_10545476
1063 Ga0207657_10095551
1064 Ga0207652_10330502
1065 Ga0207646_10326275
1066 Ga0207646_10347762
1067 Ga0207646_11191621
1068 Ga0207646_11798843
1069 Ga0207681_10206412
1070 Ga0207681_10371568
1071 Ga0207681_10876061
1072 Ga0207694_11689889
1073 Ga0207650_10041763
1074 Ga0207650_10057008
1075 Ga0207659_10197584
1076 Ga0207659_10427817
1077 Ga0207644_10059303
1078 Ga0207644_10267399
1079 Ga0207644_10600146
1080 Ga0207644_11013743
1081 Ga0207644_11250079
1082 Ga0207690_10052173
1083 Ga0207690_11125486
1084 Ga0207706_10019750
1085 Ga0207706_10254294
1086 Ga0207686_10090406
1087 Ga0207686_11165597
1088 Ga0207709_10390703
1089 Ga0207670_10054435
1090 Ga0207669_10938007
1091 Ga0207669_11079712
1092 Ga0207704_10010877
1093 Ga0207665_10505602
1094 Ga0207691_10002008
1095 Ga0207691_10225173
1096 Ga0207691_10458489
1097 Ga0207711_10144924
1098 Ga0207711_10192095
1099 Ga0207689_10143420
1100 Ga0207689_10221320
1101 Ga0207661_10324679
1102 Ga0207661_11065788
1103 Ga0207679_10043848
1104 Ga0207667_11480315
1105 Ga0207651_10362997
1106 Ga0207651_11344962
1107 Ga0207712_10015294
1108 Ga0207712_10164018
1109 Ga0207712_10203329
1110 Ga0207712_11287853
1111 Ga0207712_11828421
1112 Ga0207668_10454739
1113 Ga0207668_10925251
1114 Ga0207640_10301792
1115 Ga0207640_10390386
1116 Ga0207658_10072306
1117 Ga0207658_10870870
1118 Ga0207658_11142061
1119 Ga0207677_10244128
1120 Ga0207703_10447846
1121 Ga0207703_10769482
1122 Ga0207678_10755639
1123 Ga0207708_10049587
1124 Ga0207708_10106690
1125 Ga0207708_10168939
1126 Ga0207641_10030813
1127 Ga0207641_10593354
1128 Ga0207641_11015333
1129 Ga0207648_10079942
1130 Ga0207648_10097149
1131 Ga0207648_10384802
1132 Ga0207676_10018981
1133 Ga0207674_10063174
1134 Ga0207674_10419985
1135 Ga0207674_10610902
1136 Ga0207674_10913688
1137 Ga0207674_11179372
1138 Ga0207675_100010116
1139 Ga0207675_100045338
1140 Ga0207675_100464742
1141 Ga0207675_100651544
1142 Ga0207675_101022199
1143 Ga0207698_11698897
1144 Ga0209983_1058503
1145 Ga0209966_1014832
1146 Ga0209974_10317044
1147 Ga0207428_10000870
1148 Ga0207428_10012848
1149 Ga0207428_10019280
1150 Ga0207428_10074854
1151 Ga0207428_10094069
1152 Ga0207428_10218271
1153 Ga0207428_10248190
1154 Ga0207428_10322235
1155 Ga0207428_10464666
1156 Ga0207428_10510257
1157 Ga0207428_11262377
1158 Ga0268266_10003524
1159 Ga0268265_10154940
1160 Ga0268265_10185597
1161 Ga0268265_10275784
1162 Ga0268265_10628339
1163 Ga0268265_10779607
1164 Ga0268265_10792447
1165 Ga0268265_12432343
1166 Ga0268264_10388586
1167 Ga0268264_10530304
1168 Ga0268264_10672443
1169 Ga0268264_11345965
1170 Ga0268264_11384559
1171 Ga0268264_11487284
1172 Ga0268264_12317091
1173 Ga0265325_10405524
1174 Ga0265327_10039288
1175 Ga0307408_100663203
1176 Ga0307408_101267508
1177 Ga0307405_10651614
1178 Ga0307416_102033352
1179 Ga0373934_0002188
1180 Ga0373934_0282756
1181 Ga0373944_0020211
1182 Ga0373951_0113486
1183 Ga0373923_0705335
1184 Ga0373932_0195768
1185 Ga0373932_0443068
1186 Ga0373936_0021315
1187 Ga0373939_0066398
1188 Ga0373939_0109727
1189 Ga0373939_0195606
1190 Ga0373939_0519566
1191 Ga0373945_0317121
1192 Ga0373953_0101989
1193 Ga0373954_0151838
1194 Ga0373956_0022659
1195 Ga0373957_0114261
1196 Ga0373943_0113039
1197 Ga0373955_0002206
1198 Ga0373955_0137319
1199 Ga0373955_0203943
1200 Ga0373955_0546566
1201 Ga0373942_0055989
1202 Ga0373961_0420791
1203 Ga0373962_0075073
1204 Ga0373962_0098389
1205 Ga0373924_0492097
1206 Ga0373931_0037196
1207 Ga0373931_0137235
1208 Ga0373931_0199716
1209 Ga0373935_0005403
1210 Ga0373935_0616691
1211 Ga0373935_0684510
1212 Ga0373927_0031574
1213 Ga0373933_0000282
1214 Ga0373933_0012495
1215 Ga0373933_0451148
1216 Ga0373947_0005595
1217 Ga0373947_0102610
1218 Ga0373947_0908579
1219 Ga0373937_0000272
1220 Ga0373937_0037348
1221 Ga0373937_0098182
1222 Ga0373937_0303160
1223 Ga0373937_0513821
1224 Ga0373937_1617252
1225 Ga0373937_1957693
1226 Ga0373925_0033625
1227 Ga0373925_0129576
1228 Ga0373925_0575896
1229 Ga0450923_193360
1230 Ga0439434_0047283
1231 Ga0439435_0036339
1232 Ga0439444_0023861
1233 Ga0451577_0001787
1234 Ga0453683_0145109
1235 Ga0453683_0403920
1236 Ga0453684_0000221
1237 Ga0453684_0218831
1238 Ga0451576_0021043
1239 Ga0451576_0027681
1240 Ga0451576_0060712
1241 Ga0451576_0082926
1242 Ga0451576_0111366
1243 Ga0451576_0178142
1244 Ga0451576_0371533
1245 Ga0451576_2710352
1246 Ga0466967_1292066
1247 Ga0495603_0010168
1248 Ga0495603_0132651
1249 Ga0495590_0234488
1250 Ga0495629_0247612
1251 Ga0495651_0125516
1252 Ga0495580_0059404
1253 Ga0495639_0220342
1254 Ga0495584_0173569
1255 Ga0495585_0353238
1256 Ga0495594_0691109
1257 Ga0495583_0269664
1258 Ga0495608_0447783
1259 Ga0495628_0009103
1260 Ga0495628_0752602
1261 Ga0495630_0141755
1262 Ga0495644_0224350
1263 Ga0495663_0316513
1264 Ga0495642_0012435
1265 Ga0495642_0242450
1266 Ga0495586_0286438
1267 Ga0495609_0355838
1268 Ga0495621_0230749
1269 Ga0495597_0168020
1270 Ga0495667_0077646
1271 Ga0495656_0158292
1272 Ga0495656_0326568
1273 Ga0495656_0385887
1274 Ga0495659_0024223
1275 Ga0495659_0032128
1276 Ga0495659_0115327
1277 Ga0495659_0247308
1278 Ga0495659_0249078
1279 Ga0495659_0390424
1280 Ga0495661_0630696
1281 Ga0495588_0005306
1282 Ga0495588_0519191
1283 Ga0495669_0141084
1284 Ga0495669_0219260
1285 Ga0495670_0263293
1286 Ga0495589_0483062
1287 Ga0495636_0142641
1288 Ga0495636_0615775
1289 Ga0495674_0586907
1290 Ga0495672_0419614
1291 Ga0495680_0356918
1292 Ga0495677_0256085
1293 Ga0495677_0325058
1294 Ga0495685_119041
1295 Ga0495685_250075
1296 Ga0496100_0416600
1297 Ga0496100_1067236
1298 Ga0496100_1488473
1299 Ga0496101_0355754
1300 Ga0496102_1049419
1301 Ga0496102_1138012
1302 Ga0496104_0156873
1303 Ga0496104_0279841
1304 Ga0496104_0501176
1305 Ga0496104_0974848
1306 Ga0496104_1015821
1307 Ga0496104_1781714
1308 Ga0496105_0512516
1309 Ga0496105_1316829
1310 Ga0496106_0389022
1311 Ga0496106_1295540
1312 Ga0496107_0371690
1313 Ga0496107_0847726
1314 Ga0496108_0331186
1315 Ga0496108_0818483
1316 Ga0496109_0182068
1317 Ga0496110_0767545
1318 Ga0496112_0160668
1319 Ga0496112_0255701
1320 Ga0496113_1158877
1321 Ga0496114_0187574
1322 Ga0496115_0363062
1323 Ga0501031_0020428
1324 Ga0501032_0444543
1325 Ga0501034_0009078
1326 Ga0501034_0180852
1327 Ga0501036_0020044
1328 Ga0501036_0039453
1329 Ga0501036_1209724
1330 Ga0501037_0183103
1331 Ga0501037_0270502
1332 Ga0501038_0006069
1333 Ga0501038_0064005
1334 Ga0501039_0524576
1335 Ga0501039_1089116
1336 Ga0501040_0096719
1337 Ga0501041_0333045
1338 Ga0501042_0024714
1339 Ga0501043_0109025
1340 Ga0501043_0673952
1341 Ga0501046_0010580
1342 Ga0501047_0003391
1343 Ga0501047_0132426
1344 Ga0501048_0060057
1345 Ga0501067_0024542
1346 Ga0501067_0116812
1347 Ga0501068_0008051
1348 Ga0501068_0037007
1349 Ga0501069_0003501
1350 Ga0501069_0495836
1351 Ga0501070_0010606
1352 Ga0501070_0501563
1353 Ga0501070_1001590
1354 Ga0501071_0819505
1355 Ga0501072_0001569
1356 Ga0501072_0006341
1357 Ga0501072_0607530
1358 Ga0501073_0002650
1359 Ga0501073_0098802
1360 Ga0501073_0246229
1361 Ga0501073_0399485
1362 Ga0501074_0010548
1363 Ga0501074_1034824
1364 Ga0501074_1106282
1365 Ga0501075_0132178
1366 Ga0501076_0028221
1367 Ga0501076_1557364
1368 Ga0501077_0081625
1369 Ga0501216_124749
1370 Ga0501257_263004
1371 Ga0501079_0008874
1372 Ga0501079_1078003
1373 Ga0501080_0003901
1374 Ga0501080_0138516
1375 Ga0501080_1497867
1376 Ga0501081_0027789
1377 Ga0501081_0927679
1378 Ga0501083_0008421
1379 Ga0501035_0525039
1380 Ga0501044_0006953
1381 Ga0501044_0769176
1382 Ga0501044_1175147
1383 Ga0501045_0149361
1384 nmdc:mga0yw44_456155_c1
1385 nmdc:mga05p37_198258_c1
1386 nmdc:mga05p37_226677_c1
1387 nmdc:mga05p37_264182_c1
1388 nmdc:mga05p37_339_c1
1389 nmdc:mga05p37_54843_c1
1390 nmdc:mga05p37_593335_c1
1391 nmdc:mga05p37_652900_c1
1392 nmdc:mga05p37_8282_c1
1393 nmdc:mga05p37_9101_c1
1394 nmdc:mga09592_124168_c1
1395 nmdc:mga09592_718684_c1
1396 nmdc:mga09592_933880_c1
1397 nmdc:mga0qj67_119715_c1
1398 nmdc:mga0qj67_64700_c1
1399 nmdc:mga0qj67_902222_c1
1400 nmdc:mga06r32_100499_c1
1401 nmdc:mga06r32_1503005_c1
1402 nmdc:mga06r32_40549_c1
1403 nmdc:mga06r32_520504_c1
1404 nmdc:mga06r32_5481_c1
1405 nmdc:mga08y16_115266_c1
1406 nmdc:mga08y16_168874_c1
1407 nmdc:mga08y16_182348_c1
1408 nmdc:mga08y16_1931168_c1
1409 nmdc:mga08y16_23060_c1
1410 nmdc:mga08y16_231106_c1
1411 nmdc:mga08y16_36527_c1
1412 nmdc:mga08y16_385660_c1
1413 nmdc:mga08y16_69292_c1
1414 nmdc:mga08y16_78833_c1
1415 nmdc:mga08y16_866678_c1
1416 nmdc:mga0n895_119730_c1
1417 nmdc:mga0n895_226293_c1
1418 nmdc:mga0n895_247556_c1
1419 nmdc:mga0n895_2654_c1
1420 nmdc:mga0n895_31875_c1
1421 nmdc:mga0n895_50974_c1
1422 nmdc:mga0n895_62220_c1
1423 nmdc:mga0n895_629060_c1
1424 nmdc:mga0n895_6965_c1
1425 nmdc:mga0n895_704752_c1
1426 nmdc:mga0rr50_131547_c1
1427 nmdc:mga0rr50_141987_c1
1428 nmdc:mga0rr50_260253_c1
1429 nmdc:mga0rr50_290772_c1
1430 nmdc:mga0rr50_33479_c1
1431 nmdc:mga0rr50_46250_c1
1432 nmdc:mga0rr50_480433_c1
1433 nmdc:mga0rr50_838567_c1
1434 nmdc:mga0a205_1140473_c1
1435 nmdc:mga0a205_144098_c1
1436 nmdc:mga0a205_148061_c1
1437 nmdc:mga0a205_150462_c1
1438 nmdc:mga0a205_152452_c1
1439 nmdc:mga0a205_224158_c1
1440 nmdc:mga0a205_225741_c1
1441 nmdc:mga0a205_24061_c1
1442 nmdc:mga0a205_250558_c1
1443 nmdc:mga0a205_336623_c1
1444 nmdc:mga0a205_3825_c1
1445 nmdc:mga0a205_407170_c1
1446 Ga0495595_0375163
1447 Ga0495619_0648635
1448 Ga0500646_0372345
1449 Ga0501084_0618168
1450 Ga0501082_0019631
1451 Ga0501082_0109756
1452 Ga0501082_0232162
1453 Ga0530510_0003696
1454 Ga0530510_0702340

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01906

YbjQ_1

Putative heavy-metal-binding

25

126

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
1vr4-assembly1.cif.gz_B crystal structure of mcsg target apc22750 from bacillus cereus 0.9481 1 106
1vr4-assembly1.cif.gz_B crystal structure of mcsg target apc22750 from bacillus cereus 0.9258 1 106
1vr4-assembly1.cif.gz_E crystal structure of mcsg target apc22750 from bacillus cereus 0.8458 7 106
1y2i-assembly1.cif.gz_C crystal structure of mcsg target apc27401 from shigella flexneri 0.84 6 111
2gtc-assembly1.cif.gz_E crystal structure of the hypthetical protein from bacillus cereus (atcc 14579). northeast structural genomics target bcr11 0.8242 1 106
ID Description Score Start End Superfamily
af_Q58808_5_102_3.30.110.70 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.8635 7 110 3.30.110.70
af_Q58808_5_102_3.30.110.70 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.8472 7 110 3.30.110.70
1y2iA00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.8068 7 111 3.30.110.70
1ybbE00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.7938 1 106 3.30.110.70
1y2iA00 Alpha Beta;2-Layer Sandwich;Translation Initiation Factor IF3;Hypothetical protein apc22750. Chain B 0.7927 7 111 3.30.110.70
ID Description Score Start End GO Terms
AF-A0A139AJ07-F1-model_v4 DUF74-domain-containing protein 0.9832 2 111
AF-A0A4P6K3A9-F1-model_v4 UPF0145 protein EPA93_44955 0.9774 5 111
AF-A0A2V7FIU5-F1-model_v4 UPF0145 protein DMD85_11910 0.977 2 112
AF-A0A091BYT9-F1-model_v4 UPF0145 protein P873_10225 0.9758 1 110
AF-A4JJE1-F1-model_v4 UPF0145 protein Bcep1808_3406 0.9743 2 111

Map