F477639

General Info

Members Datasets Scaffolds Average Seq Length
725 271 1450 439

Family's Representative Sequence

Representative Sequence 3300049569|Ga0501032_0039180|Ga0501032_0039180_94_1482
Length 462
Sequence LSSRKNGCHEKSIGQKRMNQRNPGISKGIDASLIWIYLLLVTIGITAIFAATYKEGDPVIQSFLRFRTDYSKQLFYFVAAAIIGLFILLTDSKFFTATANLWYVFGIFLLLLVFPFHSSVKGTESIIRFGGIQFQPAEFCKITVCLALSKYLSLPETDFSKTKSQLIAAGIALFPAALTVLQKETGLALVYCAFFIVMYREGLPSVVLVVGFSLAALVVATLVVEKNTLAIALTIIAVIAIYIMRRQIRRNRGLLMTIILLWLVCTGIQRFGVPFVFKHVLQRHQVERIYSTIGKDVPEEYLKSGVSDDETPVRVNTADYNVKQSKIAIGSGQVFGKGLLKGTQTRYDFVPEQRTDFIFCTIGEGFGFTGSIILLGIYLLLLFRIITIAERQRSVFSRCYAYGVAAVFFFHIVINIGMTVGLAPVIGIPLPFISYGGTSLLTFTILLFILIRLDADRQMVLR

Samples

Sample ID Description Type Environment
1 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
8 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
10 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
11 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
39 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
40 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
41 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
50 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
51 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
52 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
53 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
54 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
55 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
56 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
59 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
60 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
61 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
62 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
63 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
64 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
65 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
66 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
67 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
68 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
69 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
70 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
71 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
76 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
77 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
78 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
79 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
81 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
82 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
83 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
84 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
85 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
86 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
87 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
88 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
89 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
90 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
91 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
92 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
93 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
94 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
95 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
96 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
97 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
98 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
99 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
100 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
101 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
102 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
103 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
104 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
105 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
106 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
158 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
162 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
163 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
164 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
165 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
166 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
167 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
168 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
169 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
170 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
171 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
172 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
173 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
174 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
175 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
176 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
177 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
178 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
179 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
180 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
181 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
182 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
183 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
184 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
185 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
186 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
187 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
188 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
189 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
190 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
191 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
192 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
193 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
194 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
195 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
196 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
197 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
198 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
199 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
200 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
201 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
202 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
203 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
204 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
205 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
206 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
207 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
208 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
211 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
212 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
215 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
216 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
219 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
220 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
221 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
222 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
223 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
224 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
225 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
226 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
227 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
228 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
229 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
230 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
231 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
232 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
233 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
234 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
235 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
236 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
237 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
238 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
239 3300049682 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought Metagenome Rhizosphere
240 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
241 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
242 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
243 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
244 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
245 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
246 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
247 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
248 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
249 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
250 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
251 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
252 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
253 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
254 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
255 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
256 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
257 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
258 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
259 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
260 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
261 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
262 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
263 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
264 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
265 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
266 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
267 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
268 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
269 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
270 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
271 2738541278 Niastella sp. CF465 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 99.86
Metatranscriptomes 0
Isolates 0.14

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.34
Nodule 0
Rhizoplane 0.55
Rhizosphere 94.76
Stem 0
Stem Tuber 0
Unclassified 9.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501032_0039180 3300049569 Bacteria 3224
2 SwRhRL2b_contig_1761633 2162886007 Bacteria 195701
3 MBSR1b_contig_4137058 2162886012 Bacteria 2283
4 JGI24744J21845_10004161 3300002077 Bacteria 2982
5 rootH1_10140232 3300003316 Bacteria 2831
6 rootH2_10061197 3300003320 Bacteria 21713
7 rootH1_10000732 3300003323 Bacteria 17056
8 Ga0065714_10081262 3300005288 Bacteria 2387
9 Ga0065704_10000195 3300005289 Bacteria 195830
10 Ga0065712_10002082 3300005290 Bacteria 7247
11 Ga0065712_10002453 3300005290 Bacteria 4925
12 Ga0065712_10002502 3300005290 Bacteria 4434
13 Ga0065712_10011402 3300005290 Unclassified 2017
14 Ga0065712_10104783 3300005290 Bacteria 1953
15 Ga0065712_10125826 3300005290 Bacteria 1577
16 Ga0065715_10001071 3300005293 Bacteria 8866
17 Ga0065715_10125140 3300005293 Bacteria 2138
18 Ga0070658_10036199 3300005327 Unclassified 3978
19 Ga0070658_10041658 3300005327 Bacteria 3705
20 Ga0070676_10000006 3300005328 Bacteria 72739
21 Ga0070676_10006681 3300005328 Bacteria 6179
22 Ga0070676_10016668 3300005328 Bacteria 4062
23 Ga0070676_10028821 3300005328 Bacteria 3154
24 Ga0070683_100001380 3300005329 Bacteria 18626
25 Ga0070683_100002271 3300005329 Bacteria 15218
26 Ga0070683_100003529 3300005329 Bacteria 12728
27 Ga0070683_100037240 3300005329 Bacteria 4452
28 Ga0070683_100176320 3300005329 Bacteria 2029
29 Ga0070690_100003764 3300005330 Bacteria 8356
30 Ga0070690_100091249 3300005330 Bacteria 2007
31 Ga0070670_100014229 3300005331 Bacteria 6825
32 Ga0068869_100003347 3300005334 Bacteria 9782
33 Ga0068869_100017760 3300005334 Unclassified 4832
34 Ga0068869_100063971 3300005334 Unclassified 2705
35 Ga0068869_100188647 3300005334 Bacteria 1620
36 Ga0070666_10000185 3300005335 Bacteria 42683
37 Ga0070666_10001594 3300005335 Bacteria 13796
38 Ga0070666_10003981 3300005335 Bacteria 8963
39 Ga0070666_10004528 3300005335 Bacteria 8471
40 Ga0070666_10004752 3300005335 Bacteria 8298
41 Ga0070666_10044197 3300005335 Unclassified 2983
42 Ga0070680_100001847 3300005336 Bacteria 15529
43 Ga0070680_100013239 3300005336 Bacteria 6422
44 Ga0070682_100010774 3300005337 Bacteria 5198
45 Ga0070682_100017346 3300005337 Unclassified 4196
46 Ga0068868_100000022 3300005338 Bacteria 85904
47 Ga0068868_100011902 3300005338 Bacteria 6344
48 Ga0068868_100012704 3300005338 Bacteria 6159
49 Ga0068868_100014540 3300005338 Bacteria 5803
50 Ga0068868_100224777 3300005338 Bacteria 1573
51 Ga0070660_100136001 3300005339 Unclassified 1969
52 Ga0070689_100003590 3300005340 Bacteria 10340
53 Ga0070689_100016650 3300005340 Bacteria 5381
54 Ga0070689_100020020 3300005340 Bacteria 4959
55 Ga0070689_100066471 3300005340 Unclassified 2809
56 Ga0070691_10075251 3300005341 Bacteria 1644
57 Ga0070687_100008649 3300005343 Bacteria 4322
58 Ga0070661_100000602 3300005344 Bacteria 26870
59 Ga0070661_100003835 3300005344 Bacteria 10347
60 Ga0070661_100088489 3300005344 Bacteria 2292
61 Ga0070661_100094558 3300005344 Bacteria 2215
62 Ga0070668_100000016 3300005347 Bacteria 104092
63 Ga0070668_100067268 3300005347 Bacteria 2783
64 Ga0070668_100071001 3300005347 Unclassified 2712
65 Ga0070669_100002725 3300005353 Bacteria 12748
66 Ga0070669_100011109 3300005353 Bacteria 6391
67 Ga0070669_100140344 3300005353 Bacteria 1862
68 Ga0070675_100036529 3300005354 Bacteria 3998
69 Ga0070671_100005943 3300005355 Bacteria 9725
70 Ga0070671_100042646 3300005355 Unclassified 3771
71 Ga0070674_100000957 3300005356 Bacteria 15072
72 Ga0070674_100052549 3300005356 Unclassified 2811
73 Ga0070674_100100060 3300005356 Unclassified 2110
74 Ga0070673_100000118 3300005364 Bacteria 36664
75 Ga0070673_100004670 3300005364 Bacteria 8696
76 Ga0070673_100006732 3300005364 Bacteria 7497
77 Ga0070673_100052138 3300005364 Bacteria 3209
78 Ga0070673_100070307 3300005364 Bacteria 2808
79 Ga0070673_100097021 3300005364 Bacteria 2420
80 Ga0070673_100278360 3300005364 Bacteria 1467
81 Ga0070688_100001742 3300005365 Bacteria 10862
82 Ga0070688_100027621 3300005365 Bacteria 3380
83 Ga0070688_100062290 3300005365 Bacteria 2361
84 Ga0070688_100079184 3300005365 Unclassified 2122
85 Ga0070688_100128159 3300005365 Bacteria 1708
86 Ga0070659_100001789 3300005366 Bacteria 15467
87 Ga0070659_100032110 3300005366 Bacteria 4070
88 Ga0070667_100000031 3300005367 Bacteria 177447
89 Ga0070667_100005067 3300005367 Bacteria 11026
90 Ga0070667_100010340 3300005367 Bacteria 7706
91 Ga0070667_100022331 3300005367 Bacteria 5248
92 Ga0070667_100035872 3300005367 Bacteria 4156
93 Ga0070663_100129301 3300005455 Bacteria 1916
94 Ga0070662_100001120 3300005457 Bacteria 16366
95 Ga0070662_100005163 3300005457 Bacteria 8327
96 Ga0070662_100037908 3300005457 Bacteria 3420
97 Ga0070681_10012020 3300005458 Bacteria 8584
98 Ga0068867_100000137 3300005459 Bacteria 47177
99 Ga0068867_100005852 3300005459 Bacteria 8721
100 Ga0068867_100011659 3300005459 Bacteria 6207
101 Ga0068867_100024184 3300005459 Bacteria 4352
102 Ga0068867_100087425 3300005459 Bacteria 2360
103 Ga0068867_100093443 3300005459 Bacteria 2286
104 Ga0068867_100270438 3300005459 Bacteria 1389
105 Ga0070685_10010054 3300005466 Bacteria 4908
106 Ga0070685_10010805 3300005466 Bacteria 4756
107 Ga0070706_100112532 3300005467 Bacteria 2534
108 Ga0070698_100002073 3300005471 Bacteria 22283
109 Ga0070698_100008963 3300005471 Bacteria 10765
110 Ga0070699_100104433 3300005518 Bacteria 2485
111 Ga0070679_100005157 3300005530 Bacteria 12088
112 Ga0070679_100187156 3300005530 Unclassified 2040
113 Ga0070684_100000665 3300005535 Bacteria 23736
114 Ga0068853_100001097 3300005539 Bacteria 19161
115 Ga0068853_100004076 3300005539 Bacteria 11252
116 Ga0068853_100005832 3300005539 Bacteria 9700
117 Ga0068853_100014006 3300005539 Bacteria 6562
118 Ga0068853_100030912 3300005539 Bacteria 4526
119 Ga0068853_100033257 3300005539 Bacteria 4373
120 Ga0068853_100053297 3300005539 Bacteria 3484
121 Ga0068853_100075505 3300005539 Bacteria 2941
122 Ga0068853_100076740 3300005539 Bacteria 2918
123 Ga0068853_100098961 3300005539 Bacteria 2576
124 Ga0070672_100000002 3300005543 Bacteria 159809
125 Ga0070672_100003977 3300005543 Bacteria 9636
126 Ga0070672_100006458 3300005543 Bacteria 7882
127 Ga0070672_100012808 3300005543 Bacteria 5905
128 Ga0070672_100057462 3300005543 Bacteria 3054
129 Ga0070672_100100831 3300005543 Bacteria 2342
130 Ga0070686_100025298 3300005544 Bacteria 3571
131 Ga0070686_100041724 3300005544 Bacteria 2869
132 Ga0070665_100000018 3300005548 Bacteria 434118
133 Ga0070665_100000222 3300005548 Bacteria 94961
134 Ga0070665_100057555 3300005548 Unclassified 3897
135 Ga0070665_100261942 3300005548 Unclassified 1730
136 Ga0068855_100000304 3300005563 Bacteria 61250
137 Ga0068855_100008198 3300005563 Bacteria 12629
138 Ga0068855_100105736 3300005563 Bacteria 3236
139 Ga0068855_100164380 3300005563 Unclassified 2517
140 Ga0068855_100203345 3300005563 Unclassified 2229
141 Ga0070664_100000935 3300005564 Bacteria 22818
142 Ga0070664_100003242 3300005564 Bacteria 13149
143 Ga0070664_100012816 3300005564 Bacteria 6820
144 Ga0070664_100062245 3300005564 Unclassified 3181
145 Ga0070664_100101827 3300005564 Bacteria 2498
146 Ga0070664_100119407 3300005564 Unclassified 2307
147 Ga0068857_100000270 3300005577 Bacteria 35248
148 Ga0068857_100009306 3300005577 Bacteria 8526
149 Ga0068857_100017330 3300005577 Bacteria 6309
150 Ga0068857_100051942 3300005577 Bacteria 3638
151 Ga0068857_100061803 3300005577 Bacteria 3328
152 Ga0068857_100174102 3300005577 Bacteria 1957
153 Ga0068857_100176571 3300005577 Bacteria 1943
154 Ga0068854_100057821 3300005578 Bacteria 2798
155 Ga0068856_100017824 3300005614 Bacteria 6887
156 Ga0070702_100009907 3300005615 Bacteria 4680
157 Ga0068852_100000417 3300005616 Bacteria 28355
158 Ga0068852_100000506 3300005616 Bacteria 25661
159 Ga0068852_100002991 3300005616 Bacteria 11743
160 Ga0068852_100004163 3300005616 Bacteria 10191
161 Ga0068852_100017692 3300005616 Bacteria 5598
162 Ga0068852_100022021 3300005616 Bacteria 5101
163 Ga0068852_100072225 3300005616 Bacteria 3032
164 Ga0068852_100073741 3300005616 Bacteria 3003
165 Ga0068852_100091079 3300005616 Bacteria 2728
166 Ga0068859_100000013 3300005617 Bacteria 291126
167 Ga0068859_100000272 3300005617 Bacteria 51348
168 Ga0068859_100010151 3300005617 Bacteria 9483
169 Ga0068859_100011728 3300005617 Bacteria 8806
170 Ga0068859_100019499 3300005617 Bacteria 6813
171 Ga0068859_100050597 3300005617 Bacteria 4174
172 Ga0068859_100076166 3300005617 Bacteria 3395
173 Ga0068859_100210738 3300005617 Bacteria 2029
174 Ga0068859_100277477 3300005617 Bacteria 1768
175 Ga0068859_100434926 3300005617 Bacteria 1408
176 Ga0068864_100002098 3300005618 Bacteria 16469
177 Ga0068864_100002872 3300005618 Bacteria 14238
178 Ga0068864_100021273 3300005618 Bacteria 5435
179 Ga0068864_100038681 3300005618 Bacteria 4074
180 Ga0068864_100238312 3300005618 Bacteria 1685
181 Ga0068866_10015447 3300005718 Bacteria 3392
182 Ga0068861_100008109 3300005719 Bacteria 7226
183 Ga0068861_100179366 3300005719 Bacteria 1762
184 Ga0068861_100185277 3300005719 Unclassified 1736
185 Ga0068861_100282473 3300005719 Unclassified 1430
186 Ga0068851_10000178 3300005834 Bacteria 31537
187 Ga0068870_10002374 3300005840 Bacteria 7830
188 Ga0068870_10022533 3300005840 Bacteria 3096
189 Ga0068863_100000640 3300005841 Bacteria 35467
190 Ga0068863_100001990 3300005841 Bacteria 20307
191 Ga0068863_100076380 3300005841 Unclassified 3169
192 Ga0068863_100144419 3300005841 Bacteria 2275
193 Ga0068863_100241230 3300005841 Bacteria 1744
194 Ga0068858_100000083 3300005842 Bacteria 98991
195 Ga0068858_100005679 3300005842 Bacteria 12195
196 Ga0068858_100280859 3300005842 Bacteria 1585
197 Ga0068860_100000328 3300005843 Bacteria 64568
198 Ga0068860_100000615 3300005843 Bacteria 42122
199 Ga0068860_100001575 3300005843 Bacteria 24583
200 Ga0068860_100003551 3300005843 Bacteria 16040
201 Ga0068860_100004885 3300005843 Bacteria 13661
202 Ga0068860_100006659 3300005843 Bacteria 11601
203 Ga0068860_100038906 3300005843 Bacteria 4550
204 Ga0068860_100042582 3300005843 Bacteria 4335
205 Ga0068860_100066202 3300005843 Bacteria 3432
206 Ga0068860_100084114 3300005843 Bacteria 3027
207 Ga0068860_100108875 3300005843 Bacteria 2648
208 Ga0068862_100018939 3300005844 Bacteria 5736
209 Ga0068862_100041483 3300005844 Bacteria 3916
210 Ga0081540_1029318 3300005983 Unclassified 3068
211 Ga0070715_10029941 3300006163 Bacteria 2196
212 Ga0070716_100058778 3300006173 Bacteria 2214
213 Ga0075366_10106383 3300006195 Bacteria 1686
214 Ga0097621_100002447 3300006237 Bacteria 12715
215 Ga0097621_100008194 3300006237 Bacteria 7517
216 Ga0097621_100009983 3300006237 Bacteria 6919
217 Ga0097621_100027292 3300006237 Unclassified 4488
218 Ga0068871_100000550 3300006358 Bacteria 25578
219 Ga0068871_100000731 3300006358 Bacteria 22276
220 Ga0068871_100018515 3300006358 Bacteria 5294
221 Ga0068871_100028174 3300006358 Unclassified 4401
222 Ga0068871_100037729 3300006358 Bacteria 3855
223 Ga0068871_100137608 3300006358 Bacteria 2075
224 Ga0068871_100191017 3300006358 Bacteria 1764
225 Ga0068871_100214377 3300006358 Bacteria 1666
226 Ga0075428_100012133 3300006844 Bacteria 9587
227 Ga0075428_100028746 3300006844 Bacteria 6151
228 Ga0075430_100042145 3300006846 Unclassified 3860
229 Ga0075430_100180640 3300006846 Bacteria 1755
230 Ga0075429_100002555 3300006880 Bacteria 15332
231 Ga0075429_100008195 3300006880 Bacteria 9083
232 Ga0068865_100000515 3300006881 Bacteria 21613
233 Ga0068865_100014621 3300006881 Bacteria 4991
234 Ga0068865_100177330 3300006881 Bacteria 1639
235 Ga0097620_100000013 3300006931 Bacteria 291126
236 Ga0097620_100000272 3300006931 Bacteria 51348
237 Ga0097620_100010151 3300006931 Bacteria 9483
238 Ga0097620_100011728 3300006931 Bacteria 8806
239 Ga0097620_100019498 3300006931 Bacteria 6813
240 Ga0097620_100050596 3300006931 Bacteria 4174
241 Ga0097620_100076167 3300006931 Bacteria 3395
242 Ga0097620_100210739 3300006931 Bacteria 2029
243 Ga0097620_100277473 3300006931 Bacteria 1768
244 Ga0097620_100434933 3300006931 Bacteria 1408
245 Ga0105240_10001887 3300009093 Bacteria 34847
246 Ga0105240_10004214 3300009093 Bacteria 21995
247 Ga0105240_10007170 3300009093 Bacteria 16233
248 Ga0105240_10015052 3300009093 Bacteria 10529
249 Ga0105240_10039571 3300009093 Bacteria 6037
250 Ga0105240_10039878 3300009093 Bacteria 6010
251 Ga0105240_10112921 3300009093 Bacteria 3284
252 Ga0105240_10116481 3300009093 Bacteria 3223
253 Ga0111539_10003989 3300009094 Bacteria 19391
254 Ga0111539_10046070 3300009094 Bacteria 5218
255 Ga0111539_10216932 3300009094 Bacteria 2228
256 Ga0105245_10075566 3300009098 Unclassified 3068
257 Ga0105247_10001830 3300009101 Bacteria 14909
258 Ga0105247_10003580 3300009101 Bacteria 10091
259 Ga0105247_10029877 3300009101 Bacteria 3304
260 Ga0105247_10052179 3300009101 Bacteria 2521
261 Ga0105241_10000460 3300009174 Bacteria 30681
262 Ga0105241_10001166 3300009174 Bacteria 20001
263 Ga0105241_10004286 3300009174 Bacteria 10549
264 Ga0105242_10006234 3300009176 Bacteria 9189
265 Ga0105242_10012647 3300009176 Bacteria 6499
266 Ga0105248_10043749 3300009177 Bacteria 5022
267 Ga0105237_10000191 3300009545 Bacteria 87065
268 Ga0105237_10001928 3300009545 Bacteria 26472
269 Ga0105237_10003918 3300009545 Bacteria 17436
270 Ga0105237_10008644 3300009545 Bacteria 11004
271 Ga0105237_10017643 3300009545 Bacteria 7396
272 Ga0105237_10018778 3300009545 Bacteria 7150
273 Ga0105237_10028300 3300009545 Bacteria 5710
274 Ga0105237_10132243 3300009545 Bacteria 2489
275 Ga0105237_10346380 3300009545 Bacteria 1490
276 Ga0105238_10000488 3300009551 Bacteria 41712
277 Ga0105238_10074976 3300009551 Bacteria 3375
278 Ga0105238_10092722 3300009551 Bacteria 3008
279 Ga0105238_10110392 3300009551 Bacteria 2731
280 Ga0105238_10194554 3300009551 Bacteria 2004
281 Ga0105249_10000779 3300009553 Bacteria 28576
282 Ga0105249_10000813 3300009553 Bacteria 28112
283 Ga0105249_10003085 3300009553 Bacteria 14378
284 Ga0105249_10003761 3300009553 Bacteria 13093
285 Ga0105249_10012090 3300009553 Bacteria 7599
286 Ga0105249_10074801 3300009553 Bacteria 3136
287 Ga0105249_10110868 3300009553 Bacteria 2594
288 Ga0105249_10111022 3300009553 Bacteria 2592
289 Ga0105249_10114140 3300009553 Bacteria 2557
290 Ga0105249_10152553 3300009553 Bacteria 2225
291 Ga0105239_10000468 3300010375 Bacteria 59019
292 Ga0105239_10004934 3300010375 Bacteria 15748
293 Ga0105239_10005764 3300010375 Bacteria 14448
294 Ga0105239_10006037 3300010375 Bacteria 14096
295 Ga0105239_10006519 3300010375 Bacteria 13526
296 Ga0105239_10021143 3300010375 Bacteria 7178
297 Ga0105239_10039076 3300010375 Bacteria 5199
298 Ga0105239_10132933 3300010375 Bacteria 2769
299 Ga0105246_10114517 3300011119 Unclassified 1987
300 Ga0105246_10223796 3300011119 Bacteria 1476
301 Ga0157373_10007184 3300013100 Bacteria 8310
302 Ga0157373_10022607 3300013100 Bacteria 4561
303 Ga0157371_10000218 3300013102 Bacteria 83919
304 Ga0157371_10006484 3300013102 Bacteria 9647
305 Ga0157371_10009208 3300013102 Bacteria 7794
306 Ga0157371_10011789 3300013102 Bacteria 6714
307 Ga0157370_10002445 3300013104 Bacteria 22405
308 Ga0157370_10003725 3300013104 Bacteria 17816
309 Ga0157370_10006185 3300013104 Bacteria 13273
310 Ga0157369_10137013 3300013105 Bacteria 2591
311 Ga0157369_10163077 3300013105 Unclassified 2352
312 Ga0157369_10339766 3300013105 Bacteria 1560
313 Ga0157374_10000011 3300013296 Bacteria 466749
314 Ga0157374_10000074 3300013296 Bacteria 99947
315 Ga0157374_10000332 3300013296 Bacteria 43569
316 Ga0157374_10022980 3300013296 Bacteria 5569
317 Ga0157374_10084112 3300013296 Bacteria 3024
318 Ga0157378_10002147 3300013297 Bacteria 17507
319 Ga0157378_10002167 3300013297 Bacteria 17431
320 Ga0157378_10016500 3300013297 Bacteria 6469
321 Ga0157378_10029126 3300013297 Bacteria 4874
322 Ga0157378_10169049 3300013297 Bacteria 2049
323 Ga0163162_10000029 3300013306 Bacteria 168510
324 Ga0163162_10001057 3300013306 Bacteria 25608
325 Ga0163162_10001747 3300013306 Bacteria 20369
326 Ga0163162_10007827 3300013306 Bacteria 10417
327 Ga0163162_10022570 3300013306 Bacteria 6204
328 Ga0163162_10048581 3300013306 Bacteria 4251
329 Ga0163162_10049970 3300013306 Bacteria 4193
330 Ga0163162_10050468 3300013306 Bacteria 4172
331 Ga0163162_10111918 3300013306 Bacteria 2828
332 Ga0163162_10373970 3300013306 Bacteria 1558
333 Ga0157372_10000656 3300013307 Bacteria 37971
334 Ga0157372_10019685 3300013307 Bacteria 7274
335 Ga0157372_10020479 3300013307 Bacteria 7136
336 Ga0157372_10036951 3300013307 Bacteria 5385
337 Ga0157372_10037250 3300013307 Bacteria 5363
338 Ga0157372_10037289 3300013307 Bacteria 5361
339 Ga0157372_10112383 3300013307 Bacteria 3121
340 Ga0157372_10173569 3300013307 Bacteria 2494
341 Ga0157375_10000042 3300013308 Bacteria 160008
342 Ga0157375_10000445 3300013308 Bacteria 37477
343 Ga0157375_10000954 3300013308 Bacteria 25069
344 Ga0157375_10013461 3300013308 Bacteria 7282
345 Ga0157375_10139448 3300013308 Bacteria 2551
346 Ga0157375_10163708 3300013308 Bacteria 2368
347 Ga0163163_10000057 3300014325 Bacteria 124939
348 Ga0163163_10000076 3300014325 Bacteria 108784
349 Ga0163163_10000421 3300014325 Bacteria 39252
350 Ga0163163_10010498 3300014325 Bacteria 8331
351 Ga0163163_10043574 3300014325 Bacteria 4400
352 Ga0157380_10007277 3300014326 Bacteria 7853
353 Ga0157380_10011700 3300014326 Bacteria 6344
354 Ga0157377_10010650 3300014745 Bacteria 4557
355 Ga0157377_10010981 3300014745 Bacteria 4503
356 Ga0157377_10011938 3300014745 Bacteria 4353
357 Ga0157377_10015065 3300014745 Bacteria 3945
358 Ga0157377_10032003 3300014745 Bacteria 2861
359 Ga0157379_10000016 3300014968 Bacteria 103230
360 Ga0157379_10003153 3300014968 Bacteria 13946
361 Ga0157379_10019931 3300014968 Bacteria 5925
362 Ga0157379_10057701 3300014968 Bacteria 3469
363 Ga0157379_10202544 3300014968 Bacteria 1795
364 Ga0157376_10000067 3300014969 Bacteria 83894
365 Ga0157376_10003150 3300014969 Bacteria 11327
366 Ga0157376_10041245 3300014969 Bacteria 3778
367 Ga0157376_10084721 3300014969 Bacteria 2730
368 Ga0157376_10156108 3300014969 Unclassified 2064
369 Ga0163161_10005734 3300017792 Bacteria 8603
370 Ga0163161_10007519 3300017792 Bacteria 7529
371 Ga0209646_1001123 3300025246 Bacteria 7879
372 Ga0207656_10000175 3300025321 Bacteria 23238
373 Ga0207710_10001504 3300025900 Bacteria 11546
374 Ga0207688_10023893 3300025901 Unclassified 3351
375 Ga0207680_10000083 3300025903 Bacteria 42904
376 Ga0207680_10001745 3300025903 Bacteria 10253
377 Ga0207680_10004318 3300025903 Bacteria 6738
378 Ga0207680_10005002 3300025903 Bacteria 6313
379 Ga0207680_10030717 3300025903 Bacteria 3034
380 Ga0207647_10000025 3300025904 Bacteria 112150
381 Ga0207647_10010226 3300025904 Bacteria 6629
382 Ga0207647_10027985 3300025904 Bacteria 3669
383 Ga0207647_10048661 3300025904 Bacteria 2632
384 Ga0207685_10041568 3300025905 Bacteria 1721
385 Ga0207645_10002942 3300025907 Bacteria 13166
386 Ga0207645_10010028 3300025907 Bacteria 6522
387 Ga0207645_10056285 3300025907 Bacteria 2511
388 Ga0207645_10088844 3300025907 Unclassified 1987
389 Ga0207643_10002064 3300025908 Bacteria 11082
390 Ga0207643_10002411 3300025908 Bacteria 10115
391 Ga0207705_10023806 3300025909 Unclassified 4369
392 Ga0207705_10024738 3300025909 Bacteria 4285
393 Ga0207654_10000410 3300025911 Bacteria 24779
394 Ga0207654_10000632 3300025911 Bacteria 19858
395 Ga0207654_10003759 3300025911 Bacteria 7651
396 Ga0207707_10001019 3300025912 Bacteria 26895
397 Ga0207695_10000248 3300025913 Bacteria 140288
398 Ga0207695_10000351 3300025913 Bacteria 105891
399 Ga0207695_10012543 3300025913 Bacteria 10160
400 Ga0207695_10013252 3300025913 Bacteria 9838
401 Ga0207695_10023160 3300025913 Bacteria 7026
402 Ga0207695_10030135 3300025913 Bacteria 5977
403 Ga0207695_10033500 3300025913 Bacteria 5601
404 Ga0207695_10093703 3300025913 Bacteria 3012
405 Ga0207671_10000950 3300025914 Bacteria 35986
406 Ga0207671_10001185 3300025914 Bacteria 30947
407 Ga0207671_10001741 3300025914 Bacteria 24461
408 Ga0207671_10002635 3300025914 Bacteria 18872
409 Ga0207671_10007269 3300025914 Bacteria 9634
410 Ga0207671_10016637 3300025914 Bacteria 5710
411 Ga0207660_10001707 3300025917 Bacteria 14723
412 Ga0207662_10012527 3300025918 Bacteria 4724
413 Ga0207662_10016207 3300025918 Bacteria 4203
414 Ga0207657_10055955 3300025919 Bacteria 3405
415 Ga0207657_10110612 3300025919 Bacteria 2269
416 Ga0207649_10032834 3300025920 Unclassified 3097
417 Ga0207649_10038683 3300025920 Bacteria 2889
418 Ga0207649_10038814 3300025920 Unclassified 2885
419 Ga0207652_10000979 3300025921 Bacteria 26459
420 Ga0207681_10004454 3300025923 Bacteria 8621
421 Ga0207681_10008330 3300025923 Bacteria 6341
422 Ga0207681_10042048 3300025923 Bacteria 3050
423 Ga0207681_10114565 3300025923 Bacteria 1967
424 Ga0207681_10194068 3300025923 Bacteria 1555
425 Ga0207694_10049705 3300025924 Bacteria 3246
426 Ga0207650_10054184 3300025925 Unclassified 2974
427 Ga0207650_10149312 3300025925 Bacteria 1843
428 Ga0207659_10007095 3300025926 Bacteria 6879
429 Ga0207659_10026752 3300025926 Bacteria 3896
430 Ga0207659_10074408 3300025926 Bacteria 2489
431 Ga0207644_10037715 3300025931 Unclassified 3402
432 Ga0207644_10115200 3300025931 Bacteria 2038
433 Ga0207706_10009703 3300025933 Bacteria 8835
434 Ga0207706_10013950 3300025933 Bacteria 7285
435 Ga0207706_10028463 3300025933 Bacteria 4991
436 Ga0207706_10043830 3300025933 Bacteria 3964
437 Ga0207706_10046546 3300025933 Bacteria 3840
438 Ga0207686_10000857 3300025934 Bacteria 18495
439 Ga0207686_10006451 3300025934 Bacteria 6314
440 Ga0207686_10168630 3300025934 Bacteria 1542
441 Ga0207670_10066458 3300025936 Bacteria 2477
442 Ga0207670_10074828 3300025936 Bacteria 2352
443 Ga0207669_10049551 3300025937 Unclassified 2504
444 Ga0207704_10000494 3300025938 Bacteria 17580
445 Ga0207704_10150780 3300025938 Bacteria 1640
446 Ga0207691_10000004 3300025940 Bacteria 168729
447 Ga0207691_10002067 3300025940 Bacteria 19592
448 Ga0207691_10015352 3300025940 Bacteria 7286
449 Ga0207691_10020645 3300025940 Bacteria 6228
450 Ga0207691_10058840 3300025940 Unclassified 3495
451 Ga0207711_10216682 3300025941 Unclassified 1750
452 Ga0207689_10001078 3300025942 Bacteria 26309
453 Ga0207689_10002854 3300025942 Bacteria 15942
454 Ga0207689_10003903 3300025942 Bacteria 13579
455 Ga0207689_10013771 3300025942 Bacteria 6892
456 Ga0207689_10026483 3300025942 Unclassified 4856
457 Ga0207689_10080610 3300025942 Bacteria 2675
458 Ga0207689_10125031 3300025942 Unclassified 2116
459 Ga0207689_10199320 3300025942 Bacteria 1652
460 Ga0207661_10010033 3300025944 Bacteria 6804
461 Ga0207661_10012330 3300025944 Bacteria 6210
462 Ga0207661_10022488 3300025944 Unclassified 4751
463 Ga0207661_10037372 3300025944 Bacteria 3797
464 Ga0207661_10050801 3300025944 Bacteria 3306
465 Ga0207679_10001154 3300025945 Bacteria 16832
466 Ga0207679_10007296 3300025945 Bacteria 7006
467 Ga0207679_10007852 3300025945 Bacteria 6781
468 Ga0207679_10073471 3300025945 Bacteria 2587
469 Ga0207667_10001219 3300025949 Bacteria 32210
470 Ga0207667_10001760 3300025949 Bacteria 27253
471 Ga0207667_10009503 3300025949 Bacteria 11446
472 Ga0207667_10083333 3300025949 Bacteria 3311
473 Ga0207667_10088566 3300025949 Unclassified 3201
474 Ga0207667_10184108 3300025949 Unclassified 2144
475 Ga0207651_10000526 3300025960 Bacteria 16106
476 Ga0207651_10024502 3300025960 Bacteria 3734
477 Ga0207651_10204664 3300025960 Unclassified 1584
478 Ga0207712_10000864 3300025961 Bacteria 22096
479 Ga0207712_10000867 3300025961 Bacteria 22041
480 Ga0207712_10039352 3300025961 Bacteria 3239
481 Ga0207668_10000112 3300025972 Bacteria 58202
482 Ga0207668_10181608 3300025972 Unclassified 1660
483 Ga0207640_10185300 3300025981 Bacteria 1564
484 Ga0207640_10219053 3300025981 Bacteria 1456
485 Ga0207658_10000059 3300025986 Bacteria 121530
486 Ga0207658_10008893 3300025986 Bacteria 6812
487 Ga0207658_10016382 3300025986 Bacteria 5098
488 Ga0207658_10094504 3300025986 Unclassified 2327
489 Ga0207677_10000288 3300026023 Bacteria 37751
490 Ga0207677_10009397 3300026023 Bacteria 5503
491 Ga0207677_10044640 3300026023 Bacteria 2954
492 Ga0207677_10140809 3300026023 Bacteria 1846
493 Ga0207703_10000790 3300026035 Bacteria 31144
494 Ga0207703_10005525 3300026035 Bacteria 10151
495 Ga0207703_10320330 3300026035 Unclassified 1420
496 Ga0207639_10002779 3300026041 Bacteria 11753
497 Ga0207639_10003086 3300026041 Bacteria 11196
498 Ga0207639_10005047 3300026041 Bacteria 8891
499 Ga0207639_10014498 3300026041 Bacteria 5546
500 Ga0207639_10156409 3300026041 Bacteria 1915
501 Ga0207639_10176269 3300026041 Bacteria 1815
502 Ga0207678_10020743 3300026067 Bacteria 5760
503 Ga0207702_10026038 3300026078 Bacteria 4856
504 Ga0207641_10000159 3300026088 Bacteria 96072
505 Ga0207641_10000559 3300026088 Bacteria 41628
506 Ga0207641_10001256 3300026088 Bacteria 25238
507 Ga0207641_10054029 3300026088 Bacteria 3406
508 Ga0207641_10054252 3300026088 Unclassified 3400
509 Ga0207641_10198435 3300026088 Bacteria 1849
510 Ga0207648_10001434 3300026089 Bacteria 26245
511 Ga0207648_10001746 3300026089 Bacteria 23793
512 Ga0207648_10007739 3300026089 Bacteria 10502
513 Ga0207648_10023922 3300026089 Bacteria 5460
514 Ga0207648_10024041 3300026089 Bacteria 5446
515 Ga0207648_10053283 3300026089 Bacteria 3536
516 Ga0207648_10169766 3300026089 Bacteria 1928
517 Ga0207676_10000567 3300026095 Bacteria 30636
518 Ga0207676_10002025 3300026095 Bacteria 14725
519 Ga0207676_10014544 3300026095 Bacteria 5664
520 Ga0207674_10002233 3300026116 Bacteria 24521
521 Ga0207674_10002382 3300026116 Bacteria 23767
522 Ga0207674_10006589 3300026116 Bacteria 13651
523 Ga0207674_10018203 3300026116 Bacteria 7644
524 Ga0207674_10046601 3300026116 Bacteria 4450
525 Ga0207674_10129629 3300026116 Bacteria 2486
526 Ga0207674_10135121 3300026116 Bacteria 2428
527 Ga0207675_100000685 3300026118 Bacteria 33367
528 Ga0207675_100008916 3300026118 Bacteria 9412
529 Ga0207675_100009600 3300026118 Bacteria 9053
530 Ga0207675_100015533 3300026118 Bacteria 7101
531 Ga0207675_100105741 3300026118 Bacteria 2653
532 Ga0207675_100191050 3300026118 Bacteria 1964
533 Ga0207683_10003706 3300026121 Bacteria 13267
534 Ga0207683_10074101 3300026121 Unclassified 3012
535 Ga0207698_10000340 3300026142 Bacteria 27673
536 Ga0207698_10002890 3300026142 Bacteria 10282
537 Ga0207698_10067472 3300026142 Bacteria 2821
538 Ga0207698_10176805 3300026142 Bacteria 1886
539 Ga0207698_10254827 3300026142 Bacteria 1608
540 Ga0207428_10042013 3300027907 Bacteria 3699
541 Ga0268266_10000026 3300028379 Bacteria 434485
542 Ga0268266_10003590 3300028379 Bacteria 15351
543 Ga0268266_10095744 3300028379 Bacteria 2608
544 Ga0268265_10003213 3300028380 Bacteria 11865
545 Ga0268264_10000898 3300028381 Bacteria 31351
546 Ga0268264_10001824 3300028381 Bacteria 19489
547 Ga0268264_10004527 3300028381 Bacteria 11845
548 Ga0268264_10004655 3300028381 Bacteria 11661
549 Ga0268264_10015360 3300028381 Bacteria 6279
550 Ga0268264_10018041 3300028381 Bacteria 5771
551 Ga0268264_10039005 3300028381 Bacteria 3923
552 Ga0307517_10009664 3300028786 Bacteria 13641
553 Ga0307515_10000001 3300028794 Bacteria 4259510
554 Ga0307515_10000021 3300028794 Bacteria 406008
555 Ga0307511_10001204 3300030521 Bacteria 27440
556 Ga0265340_10034790 3300031247 Bacteria 2505
557 Ga0265327_10000013 3300031251 Bacteria 519549
558 Ga0265327_10002699 3300031251 Bacteria 18200
559 Ga0307513_10066003 3300031456 Bacteria 3805
560 Ga0307509_10103411 3300031507 Bacteria 2876
561 Ga0307509_10115384 3300031507 Bacteria 2678
562 Ga0265313_10007658 3300031595 Bacteria 7321
563 Ga0307508_10000606 3300031616 Bacteria 42966
564 Ga0307516_10001745 3300031730 Bacteria 29897
565 Ga0307410_10195648 3300031852 Bacteria 1540
566 Ga0307411_10078142 3300032005 Bacteria 2268
567 Ga0307510_10003663 3300033180 Bacteria 17946
568 Ga0373955_0074653 3300035172 Bacteria 1904
569 Ga0373955_0083674 3300035172 Bacteria 1808
570 Ga0373937_0031384 3300036401 Bacteria 4815
571 Ga0373937_0071590 3300036401 Bacteria 3197
572 Ga0395905_0009831 3300037471 Bacteria 9324
573 Ga0395905_0026884 3300037471 Bacteria 5427
574 Ga0395905_0039790 3300037471 Unclassified 4412
575 Ga0436365_1141771 3300039437 Bacteria 2847
576 Ga0439436_0004608 3300041404 Bacteria 4226
577 Ga0439439_0011315 3300041406 Bacteria 2145
578 Ga0439453_0002926 3300041408 Bacteria 2409
579 Ga0451853_0248055 3300041512 Bacteria 3324
580 Ga0439441_010681 3300042001 Unclassified 1545
581 Ga0439449_0018081 3300042007 Bacteria 2646
582 Ga0439457_000635 3300042014 Bacteria 10368
583 Ga0439462_0000977 3300042015 Bacteria 6095
584 Ga0439434_0010377 3300042435 Bacteria 2746
585 Ga0451577_0089977 3300042876 Unclassified 2739
586 Ga0466969_0000172 3300044656 Bacteria 34716
587 Ga0466972_0000143 3300044658 Bacteria 58694
588 Ga0466972_0000591 3300044658 Bacteria 17623
589 Ga0466972_0004739 3300044658 Bacteria 6810
590 Ga0466966_0000038 3300044684 Bacteria 97255
591 Ga0466961_0022939 3300044693 Bacteria 4015
592 Ga0466961_0087719 3300044693 Unclassified 1966
593 Ga0453684_0017490 3300044712 Bacteria 11102
594 Ga0453684_0018180 3300044712 Bacteria 10817
595 Ga0453684_0075604 3300044712 Unclassified 4232
596 Ga0453684_0374795 3300044712 Bacteria 1599
597 Ga0466957_0005302 3300044842 Bacteria 7228
598 Ga0466957_0015471 3300044842 Bacteria 4456
599 Ga0466957_0059298 3300044842 Bacteria 2346
600 Ga0466959_0000698 3300045049 Bacteria 19638
601 Ga0495638_0071343 3300046460 Bacteria 2125
602 Ga0495638_0084325 3300046460 Bacteria 1923
603 Ga0495638_0117549 3300046460 Bacteria 1573
604 Ga0495606_0004455 3300046507 Bacteria 13983
605 Ga0495608_0168432 3300046511 Bacteria 1390
606 Ga0495643_0026639 3300046522 Bacteria 3260
607 Ga0495648_0001596 3300046524 Bacteria 22083
608 Ga0495587_0086790 3300046536 Unclassified 1811
609 Ga0495587_0087059 3300046536 Bacteria 1808
610 Ga0495622_0044007 3300046557 Bacteria 2075
611 Ga0495668_0000099 3300046616 Bacteria 137915
612 Ga0495668_0004679 3300046616 Bacteria 9605
613 Ga0495611_0000280 3300046648 Bacteria 34841
614 Ga0495625_0026123 3300046660 Bacteria 4416
615 Ga0495635_0062278 3300046663 Unclassified 2562
616 Ga0495636_0001268 3300047318 Bacteria 9565
617 Ga0495672_0012826 3300047320 Bacteria 5822
618 Ga0495672_0055753 3300047320 Bacteria 2304
619 Ga0495687_000058 3300047443 Bacteria 185830
620 Ga0495684_0128653 3300047471 Unclassified 1904
621 Ga0495686_0000005 3300047472 Bacteria 827143
622 Ga0495686_0014430 3300047472 Bacteria 5436
623 Ga0495686_0123818 3300047472 Unclassified 1538
624 Ga0496100_0038706 3300048903 Unclassified 3024
625 Ga0496109_0023045 3300048912 Bacteria 5521
626 Ga0496114_0011076 3300048917 Bacteria 7197
627 Ga0496114_0119919 3300048917 Bacteria 2262
628 Ga0501298_000195 3300049521 Bacteria 7699
629 Ga0501299_013956 3300049522 Bacteria 1391
630 Ga0501031_0010413 3300049568 Bacteria 6055
631 Ga0501031_0054382 3300049568 Bacteria 2609
632 Ga0501032_0000735 3300049569 Bacteria 26625
633 Ga0501032_0001336 3300049569 Bacteria 19664
634 Ga0501033_0019225 3300049570 Bacteria 5164
635 Ga0501034_0006480 3300049571 Bacteria 12600
636 Ga0501034_0030673 3300049571 Bacteria 5463
637 Ga0501034_0046017 3300049571 Bacteria 4409
638 Ga0501036_0004994 3300049572 Bacteria 10732
639 Ga0501036_0049327 3300049572 Unclassified 3565
640 Ga0501036_0158387 3300049572 Bacteria 1909
641 Ga0501037_0001415 3300049573 Bacteria 17601
642 Ga0501037_0012711 3300049573 Bacteria 6201
643 Ga0501037_0018531 3300049573 Bacteria 5131
644 Ga0501038_0003659 3300049574 Bacteria 14324
645 Ga0501038_0007086 3300049574 Bacteria 10354
646 Ga0501038_0016487 3300049574 Bacteria 6695
647 Ga0501039_0007627 3300049575 Bacteria 8263
648 Ga0501039_0040248 3300049575 Unclassified 3608
649 Ga0501039_0042013 3300049575 Bacteria 3532
650 Ga0501042_0046300 3300049578 Bacteria 3101
651 Ga0501043_0004298 3300049579 Bacteria 11595
652 Ga0501043_0008533 3300049579 Bacteria 8073
653 Ga0501043_0038139 3300049579 Unclassified 3779
654 Ga0501043_0224337 3300049579 Bacteria 1453
655 Ga0501046_0003858 3300049580 Bacteria 13711
656 Ga0501046_0098906 3300049580 Bacteria 2240
657 Ga0501046_0116060 3300049580 Bacteria 2041
658 Ga0501047_0007608 3300049581 Bacteria 10196
659 Ga0501047_0012369 3300049581 Bacteria 8079
660 Ga0501047_0013235 3300049581 Bacteria 7814
661 Ga0501047_0033924 3300049581 Bacteria 4927
662 Ga0501048_0005105 3300049582 Bacteria 10003
663 Ga0501067_0007330 3300049583 Bacteria 6127
664 Ga0501067_0008836 3300049583 Bacteria 5581
665 Ga0501070_0034418 3300049586 Bacteria 4236
666 Ga0501070_0039399 3300049586 Bacteria 3942
667 Ga0501073_0000937 3300049589 Bacteria 20953
668 Ga0501073_0008705 3300049589 Bacteria 7513
669 Ga0501074_0008062 3300049590 Bacteria 7629
670 Ga0501198_000331 3300049649 Bacteria 5997
671 Ga0501217_001669 3300049661 Bacteria 4220
672 Ga0501223_000646 3300049663 Bacteria 8375
673 Ga0501233_000276 3300049668 Bacteria 7856
674 Ga0501235_010130 3300049669 Bacteria 2060
675 Ga0501242_000091 3300049674 Bacteria 5976
676 Ga0501242_000098 3300049674 Bacteria 5871
677 Ga0501243_002915 3300049675 Bacteria 2518
678 Ga0501252_000098 3300049682 Bacteria 4812
679 Ga0501261_000450 3300049690 Bacteria 5309
680 Ga0501219_000177 3300049703 Bacteria 11733
681 Ga0501225_0000698 3300049705 Bacteria 10514
682 Ga0501225_0002309 3300049705 Bacteria 5897
683 Ga0501245_003979 3300049708 Bacteria 2020
684 Ga0501079_0035376 3300049741 Bacteria 3844
685 Ga0501079_0188036 3300049741 Bacteria 1612
686 Ga0501080_0044183 3300049742 Bacteria 4148
687 Ga0501080_0063052 3300049742 Bacteria 3449
688 Ga0501083_0000211 3300049744 Bacteria 37931
689 Ga0501083_0137190 3300049744 Bacteria 1602
690 Ga0501270_006857 3300049767 Bacteria 1386
691 Ga0501035_0011942 3300049822 Bacteria 8037
692 Ga0501035_0032978 3300049822 Unclassified 4710
693 Ga0501035_0068521 3300049822 Bacteria 3146
694 Ga0501044_0002128 3300049823 Bacteria 22711
695 Ga0501044_0002402 3300049823 Bacteria 21355
696 Ga0501044_0009921 3300049823 Bacteria 10344
697 Ga0501044_0162111 3300049823 Unclassified 2212
698 Ga0501045_0069800 3300049824 Bacteria 2584
699 Ga0501284_00051 3300050005 Bacteria 43498
700 nmdc:mga0k408_17548_c1 3300050493 Bacteria 3990
701 nmdc:mga0k408_8782_c1 3300050493 Bacteria 5437
702 nmdc:mga09592_7969_c1 3300050508 Bacteria 8608
703 nmdc:mga0qj67_134724_c1 3300050509 Bacteria 2001
704 nmdc:mga0qj67_34138_c1 3300050509 Unclassified 3973
705 nmdc:mga08y16_1783_c1 3300050511 Bacteria 21805
706 Ga0500578_0000961 3300053086 Bacteria 31954
707 Ga0500644_0001408 3300053088 Bacteria 6395
708 Ga0500646_0002797 3300053090 Unclassified 4483
709 Ga0500583_0000111 3300053092 Bacteria 40256
710 Ga0500583_0000860 3300053092 Bacteria 8760
711 Ga0500641_0009657 3300053096 Bacteria 3471
712 Ga0500559_0006375 3300053136 Bacteria 5328
713 Ga0500568_0001094 3300053139 Bacteria 18241
714 Ga0500568_0004392 3300053139 Bacteria 7547
715 Ga0500589_076341 3300053147 Bacteria 1505
716 Ga0500604_0019055 3300053151 Bacteria 1918
717 Ga0500616_0077844 3300053153 Bacteria 1674
718 Ga0500622_0001238 3300053156 Bacteria 20912
719 Ga0500611_000078 3300053727 Bacteria 36716
720 Ga0501084_0012860 3300054114 Bacteria 6934
721 Ga0501084_0079975 3300054114 Bacteria 2740
722 Ga0501082_0145152 3300060353 Bacteria 2060
723 Ga0466962_0031907 3300061719 Bacteria 2522
724 Ga0466962_0045937 3300061719 Bacteria 2088
725 2738725891 2738541278 Bacteria 9755573
726 Ga0501032_0039180
727 SwRhRL2b_contig_1761633
728 MBSR1b_contig_4137058
729 JGI24744J21845_10004161
730 rootH1_10140232
731 rootH2_10061197
732 rootH1_10000732
733 Ga0065714_10081262
734 Ga0065704_10000195
735 Ga0065712_10002082
736 Ga0065712_10002453
737 Ga0065712_10002502
738 Ga0065712_10011402
739 Ga0065712_10104783
740 Ga0065712_10125826
741 Ga0065715_10001071
742 Ga0065715_10125140
743 Ga0070658_10036199
744 Ga0070658_10041658
745 Ga0070676_10000006
746 Ga0070676_10006681
747 Ga0070676_10016668
748 Ga0070676_10028821
749 Ga0070683_100001380
750 Ga0070683_100002271
751 Ga0070683_100003529
752 Ga0070683_100037240
753 Ga0070683_100176320
754 Ga0070690_100003764
755 Ga0070690_100091249
756 Ga0070670_100014229
757 Ga0068869_100003347
758 Ga0068869_100017760
759 Ga0068869_100063971
760 Ga0068869_100188647
761 Ga0070666_10000185
762 Ga0070666_10001594
763 Ga0070666_10003981
764 Ga0070666_10004528
765 Ga0070666_10004752
766 Ga0070666_10044197
767 Ga0070680_100001847
768 Ga0070680_100013239
769 Ga0070682_100010774
770 Ga0070682_100017346
771 Ga0068868_100000022
772 Ga0068868_100011902
773 Ga0068868_100012704
774 Ga0068868_100014540
775 Ga0068868_100224777
776 Ga0070660_100136001
777 Ga0070689_100003590
778 Ga0070689_100016650
779 Ga0070689_100020020
780 Ga0070689_100066471
781 Ga0070691_10075251
782 Ga0070687_100008649
783 Ga0070661_100000602
784 Ga0070661_100003835
785 Ga0070661_100088489
786 Ga0070661_100094558
787 Ga0070668_100000016
788 Ga0070668_100067268
789 Ga0070668_100071001
790 Ga0070669_100002725
791 Ga0070669_100011109
792 Ga0070669_100140344
793 Ga0070675_100036529
794 Ga0070671_100005943
795 Ga0070671_100042646
796 Ga0070674_100000957
797 Ga0070674_100052549
798 Ga0070674_100100060
799 Ga0070673_100000118
800 Ga0070673_100004670
801 Ga0070673_100006732
802 Ga0070673_100052138
803 Ga0070673_100070307
804 Ga0070673_100097021
805 Ga0070673_100278360
806 Ga0070688_100001742
807 Ga0070688_100027621
808 Ga0070688_100062290
809 Ga0070688_100079184
810 Ga0070688_100128159
811 Ga0070659_100001789
812 Ga0070659_100032110
813 Ga0070667_100000031
814 Ga0070667_100005067
815 Ga0070667_100010340
816 Ga0070667_100022331
817 Ga0070667_100035872
818 Ga0070663_100129301
819 Ga0070662_100001120
820 Ga0070662_100005163
821 Ga0070662_100037908
822 Ga0070681_10012020
823 Ga0068867_100000137
824 Ga0068867_100005852
825 Ga0068867_100011659
826 Ga0068867_100024184
827 Ga0068867_100087425
828 Ga0068867_100093443
829 Ga0068867_100270438
830 Ga0070685_10010054
831 Ga0070685_10010805
832 Ga0070706_100112532
833 Ga0070698_100002073
834 Ga0070698_100008963
835 Ga0070699_100104433
836 Ga0070679_100005157
837 Ga0070679_100187156
838 Ga0070684_100000665
839 Ga0068853_100001097
840 Ga0068853_100004076
841 Ga0068853_100005832
842 Ga0068853_100014006
843 Ga0068853_100030912
844 Ga0068853_100033257
845 Ga0068853_100053297
846 Ga0068853_100075505
847 Ga0068853_100076740
848 Ga0068853_100098961
849 Ga0070672_100000002
850 Ga0070672_100003977
851 Ga0070672_100006458
852 Ga0070672_100012808
853 Ga0070672_100057462
854 Ga0070672_100100831
855 Ga0070686_100025298
856 Ga0070686_100041724
857 Ga0070665_100000018
858 Ga0070665_100000222
859 Ga0070665_100057555
860 Ga0070665_100261942
861 Ga0068855_100000304
862 Ga0068855_100008198
863 Ga0068855_100105736
864 Ga0068855_100164380
865 Ga0068855_100203345
866 Ga0070664_100000935
867 Ga0070664_100003242
868 Ga0070664_100012816
869 Ga0070664_100062245
870 Ga0070664_100101827
871 Ga0070664_100119407
872 Ga0068857_100000270
873 Ga0068857_100009306
874 Ga0068857_100017330
875 Ga0068857_100051942
876 Ga0068857_100061803
877 Ga0068857_100174102
878 Ga0068857_100176571
879 Ga0068854_100057821
880 Ga0068856_100017824
881 Ga0070702_100009907
882 Ga0068852_100000417
883 Ga0068852_100000506
884 Ga0068852_100002991
885 Ga0068852_100004163
886 Ga0068852_100017692
887 Ga0068852_100022021
888 Ga0068852_100072225
889 Ga0068852_100073741
890 Ga0068852_100091079
891 Ga0068859_100000013
892 Ga0068859_100000272
893 Ga0068859_100010151
894 Ga0068859_100011728
895 Ga0068859_100019499
896 Ga0068859_100050597
897 Ga0068859_100076166
898 Ga0068859_100210738
899 Ga0068859_100277477
900 Ga0068859_100434926
901 Ga0068864_100002098
902 Ga0068864_100002872
903 Ga0068864_100021273
904 Ga0068864_100038681
905 Ga0068864_100238312
906 Ga0068866_10015447
907 Ga0068861_100008109
908 Ga0068861_100179366
909 Ga0068861_100185277
910 Ga0068861_100282473
911 Ga0068851_10000178
912 Ga0068870_10002374
913 Ga0068870_10022533
914 Ga0068863_100000640
915 Ga0068863_100001990
916 Ga0068863_100076380
917 Ga0068863_100144419
918 Ga0068863_100241230
919 Ga0068858_100000083
920 Ga0068858_100005679
921 Ga0068858_100280859
922 Ga0068860_100000328
923 Ga0068860_100000615
924 Ga0068860_100001575
925 Ga0068860_100003551
926 Ga0068860_100004885
927 Ga0068860_100006659
928 Ga0068860_100038906
929 Ga0068860_100042582
930 Ga0068860_100066202
931 Ga0068860_100084114
932 Ga0068860_100108875
933 Ga0068862_100018939
934 Ga0068862_100041483
935 Ga0081540_1029318
936 Ga0070715_10029941
937 Ga0070716_100058778
938 Ga0075366_10106383
939 Ga0097621_100002447
940 Ga0097621_100008194
941 Ga0097621_100009983
942 Ga0097621_100027292
943 Ga0068871_100000550
944 Ga0068871_100000731
945 Ga0068871_100018515
946 Ga0068871_100028174
947 Ga0068871_100037729
948 Ga0068871_100137608
949 Ga0068871_100191017
950 Ga0068871_100214377
951 Ga0075428_100012133
952 Ga0075428_100028746
953 Ga0075430_100042145
954 Ga0075430_100180640
955 Ga0075429_100002555
956 Ga0075429_100008195
957 Ga0068865_100000515
958 Ga0068865_100014621
959 Ga0068865_100177330
960 Ga0097620_100000013
961 Ga0097620_100000272
962 Ga0097620_100010151
963 Ga0097620_100011728
964 Ga0097620_100019498
965 Ga0097620_100050596
966 Ga0097620_100076167
967 Ga0097620_100210739
968 Ga0097620_100277473
969 Ga0097620_100434933
970 Ga0105240_10001887
971 Ga0105240_10004214
972 Ga0105240_10007170
973 Ga0105240_10015052
974 Ga0105240_10039571
975 Ga0105240_10039878
976 Ga0105240_10112921
977 Ga0105240_10116481
978 Ga0111539_10003989
979 Ga0111539_10046070
980 Ga0111539_10216932
981 Ga0105245_10075566
982 Ga0105247_10001830
983 Ga0105247_10003580
984 Ga0105247_10029877
985 Ga0105247_10052179
986 Ga0105241_10000460
987 Ga0105241_10001166
988 Ga0105241_10004286
989 Ga0105242_10006234
990 Ga0105242_10012647
991 Ga0105248_10043749
992 Ga0105237_10000191
993 Ga0105237_10001928
994 Ga0105237_10003918
995 Ga0105237_10008644
996 Ga0105237_10017643
997 Ga0105237_10018778
998 Ga0105237_10028300
999 Ga0105237_10132243
1000 Ga0105237_10346380
1001 Ga0105238_10000488
1002 Ga0105238_10074976
1003 Ga0105238_10092722
1004 Ga0105238_10110392
1005 Ga0105238_10194554
1006 Ga0105249_10000779
1007 Ga0105249_10000813
1008 Ga0105249_10003085
1009 Ga0105249_10003761
1010 Ga0105249_10012090
1011 Ga0105249_10074801
1012 Ga0105249_10110868
1013 Ga0105249_10111022
1014 Ga0105249_10114140
1015 Ga0105249_10152553
1016 Ga0105239_10000468
1017 Ga0105239_10004934
1018 Ga0105239_10005764
1019 Ga0105239_10006037
1020 Ga0105239_10006519
1021 Ga0105239_10021143
1022 Ga0105239_10039076
1023 Ga0105239_10132933
1024 Ga0105246_10114517
1025 Ga0105246_10223796
1026 Ga0157373_10007184
1027 Ga0157373_10022607
1028 Ga0157371_10000218
1029 Ga0157371_10006484
1030 Ga0157371_10009208
1031 Ga0157371_10011789
1032 Ga0157370_10002445
1033 Ga0157370_10003725
1034 Ga0157370_10006185
1035 Ga0157369_10137013
1036 Ga0157369_10163077
1037 Ga0157369_10339766
1038 Ga0157374_10000011
1039 Ga0157374_10000074
1040 Ga0157374_10000332
1041 Ga0157374_10022980
1042 Ga0157374_10084112
1043 Ga0157378_10002147
1044 Ga0157378_10002167
1045 Ga0157378_10016500
1046 Ga0157378_10029126
1047 Ga0157378_10169049
1048 Ga0163162_10000029
1049 Ga0163162_10001057
1050 Ga0163162_10001747
1051 Ga0163162_10007827
1052 Ga0163162_10022570
1053 Ga0163162_10048581
1054 Ga0163162_10049970
1055 Ga0163162_10050468
1056 Ga0163162_10111918
1057 Ga0163162_10373970
1058 Ga0157372_10000656
1059 Ga0157372_10019685
1060 Ga0157372_10020479
1061 Ga0157372_10036951
1062 Ga0157372_10037250
1063 Ga0157372_10037289
1064 Ga0157372_10112383
1065 Ga0157372_10173569
1066 Ga0157375_10000042
1067 Ga0157375_10000445
1068 Ga0157375_10000954
1069 Ga0157375_10013461
1070 Ga0157375_10139448
1071 Ga0157375_10163708
1072 Ga0163163_10000057
1073 Ga0163163_10000076
1074 Ga0163163_10000421
1075 Ga0163163_10010498
1076 Ga0163163_10043574
1077 Ga0157380_10007277
1078 Ga0157380_10011700
1079 Ga0157377_10010650
1080 Ga0157377_10010981
1081 Ga0157377_10011938
1082 Ga0157377_10015065
1083 Ga0157377_10032003
1084 Ga0157379_10000016
1085 Ga0157379_10003153
1086 Ga0157379_10019931
1087 Ga0157379_10057701
1088 Ga0157379_10202544
1089 Ga0157376_10000067
1090 Ga0157376_10003150
1091 Ga0157376_10041245
1092 Ga0157376_10084721
1093 Ga0157376_10156108
1094 Ga0163161_10005734
1095 Ga0163161_10007519
1096 Ga0209646_1001123
1097 Ga0207656_10000175
1098 Ga0207710_10001504
1099 Ga0207688_10023893
1100 Ga0207680_10000083
1101 Ga0207680_10001745
1102 Ga0207680_10004318
1103 Ga0207680_10005002
1104 Ga0207680_10030717
1105 Ga0207647_10000025
1106 Ga0207647_10010226
1107 Ga0207647_10027985
1108 Ga0207647_10048661
1109 Ga0207685_10041568
1110 Ga0207645_10002942
1111 Ga0207645_10010028
1112 Ga0207645_10056285
1113 Ga0207645_10088844
1114 Ga0207643_10002064
1115 Ga0207643_10002411
1116 Ga0207705_10023806
1117 Ga0207705_10024738
1118 Ga0207654_10000410
1119 Ga0207654_10000632
1120 Ga0207654_10003759
1121 Ga0207707_10001019
1122 Ga0207695_10000248
1123 Ga0207695_10000351
1124 Ga0207695_10012543
1125 Ga0207695_10013252
1126 Ga0207695_10023160
1127 Ga0207695_10030135
1128 Ga0207695_10033500
1129 Ga0207695_10093703
1130 Ga0207671_10000950
1131 Ga0207671_10001185
1132 Ga0207671_10001741
1133 Ga0207671_10002635
1134 Ga0207671_10007269
1135 Ga0207671_10016637
1136 Ga0207660_10001707
1137 Ga0207662_10012527
1138 Ga0207662_10016207
1139 Ga0207657_10055955
1140 Ga0207657_10110612
1141 Ga0207649_10032834
1142 Ga0207649_10038683
1143 Ga0207649_10038814
1144 Ga0207652_10000979
1145 Ga0207681_10004454
1146 Ga0207681_10008330
1147 Ga0207681_10042048
1148 Ga0207681_10114565
1149 Ga0207681_10194068
1150 Ga0207694_10049705
1151 Ga0207650_10054184
1152 Ga0207650_10149312
1153 Ga0207659_10007095
1154 Ga0207659_10026752
1155 Ga0207659_10074408
1156 Ga0207644_10037715
1157 Ga0207644_10115200
1158 Ga0207706_10009703
1159 Ga0207706_10013950
1160 Ga0207706_10028463
1161 Ga0207706_10043830
1162 Ga0207706_10046546
1163 Ga0207686_10000857
1164 Ga0207686_10006451
1165 Ga0207686_10168630
1166 Ga0207670_10066458
1167 Ga0207670_10074828
1168 Ga0207669_10049551
1169 Ga0207704_10000494
1170 Ga0207704_10150780
1171 Ga0207691_10000004
1172 Ga0207691_10002067
1173 Ga0207691_10015352
1174 Ga0207691_10020645
1175 Ga0207691_10058840
1176 Ga0207711_10216682
1177 Ga0207689_10001078
1178 Ga0207689_10002854
1179 Ga0207689_10003903
1180 Ga0207689_10013771
1181 Ga0207689_10026483
1182 Ga0207689_10080610
1183 Ga0207689_10125031
1184 Ga0207689_10199320
1185 Ga0207661_10010033
1186 Ga0207661_10012330
1187 Ga0207661_10022488
1188 Ga0207661_10037372
1189 Ga0207661_10050801
1190 Ga0207679_10001154
1191 Ga0207679_10007296
1192 Ga0207679_10007852
1193 Ga0207679_10073471
1194 Ga0207667_10001219
1195 Ga0207667_10001760
1196 Ga0207667_10009503
1197 Ga0207667_10083333
1198 Ga0207667_10088566
1199 Ga0207667_10184108
1200 Ga0207651_10000526
1201 Ga0207651_10024502
1202 Ga0207651_10204664
1203 Ga0207712_10000864
1204 Ga0207712_10000867
1205 Ga0207712_10039352
1206 Ga0207668_10000112
1207 Ga0207668_10181608
1208 Ga0207640_10185300
1209 Ga0207640_10219053
1210 Ga0207658_10000059
1211 Ga0207658_10008893
1212 Ga0207658_10016382
1213 Ga0207658_10094504
1214 Ga0207677_10000288
1215 Ga0207677_10009397
1216 Ga0207677_10044640
1217 Ga0207677_10140809
1218 Ga0207703_10000790
1219 Ga0207703_10005525
1220 Ga0207703_10320330
1221 Ga0207639_10002779
1222 Ga0207639_10003086
1223 Ga0207639_10005047
1224 Ga0207639_10014498
1225 Ga0207639_10156409
1226 Ga0207639_10176269
1227 Ga0207678_10020743
1228 Ga0207702_10026038
1229 Ga0207641_10000159
1230 Ga0207641_10000559
1231 Ga0207641_10001256
1232 Ga0207641_10054029
1233 Ga0207641_10054252
1234 Ga0207641_10198435
1235 Ga0207648_10001434
1236 Ga0207648_10001746
1237 Ga0207648_10007739
1238 Ga0207648_10023922
1239 Ga0207648_10024041
1240 Ga0207648_10053283
1241 Ga0207648_10169766
1242 Ga0207676_10000567
1243 Ga0207676_10002025
1244 Ga0207676_10014544
1245 Ga0207674_10002233
1246 Ga0207674_10002382
1247 Ga0207674_10006589
1248 Ga0207674_10018203
1249 Ga0207674_10046601
1250 Ga0207674_10129629
1251 Ga0207674_10135121
1252 Ga0207675_100000685
1253 Ga0207675_100008916
1254 Ga0207675_100009600
1255 Ga0207675_100015533
1256 Ga0207675_100105741
1257 Ga0207675_100191050
1258 Ga0207683_10003706
1259 Ga0207683_10074101
1260 Ga0207698_10000340
1261 Ga0207698_10002890
1262 Ga0207698_10067472
1263 Ga0207698_10176805
1264 Ga0207698_10254827
1265 Ga0207428_10042013
1266 Ga0268266_10000026
1267 Ga0268266_10003590
1268 Ga0268266_10095744
1269 Ga0268265_10003213
1270 Ga0268264_10000898
1271 Ga0268264_10001824
1272 Ga0268264_10004527
1273 Ga0268264_10004655
1274 Ga0268264_10015360
1275 Ga0268264_10018041
1276 Ga0268264_10039005
1277 Ga0307517_10009664
1278 Ga0307515_10000001
1279 Ga0307515_10000021
1280 Ga0307511_10001204
1281 Ga0265340_10034790
1282 Ga0265327_10000013
1283 Ga0265327_10002699
1284 Ga0307513_10066003
1285 Ga0307509_10103411
1286 Ga0307509_10115384
1287 Ga0265313_10007658
1288 Ga0307508_10000606
1289 Ga0307516_10001745
1290 Ga0307410_10195648
1291 Ga0307411_10078142
1292 Ga0307510_10003663
1293 Ga0373955_0074653
1294 Ga0373955_0083674
1295 Ga0373937_0031384
1296 Ga0373937_0071590
1297 Ga0395905_0009831
1298 Ga0395905_0026884
1299 Ga0395905_0039790
1300 Ga0436365_1141771
1301 Ga0439436_0004608
1302 Ga0439439_0011315
1303 Ga0439453_0002926
1304 Ga0451853_0248055
1305 Ga0439441_010681
1306 Ga0439449_0018081
1307 Ga0439457_000635
1308 Ga0439462_0000977
1309 Ga0439434_0010377
1310 Ga0451577_0089977
1311 Ga0466969_0000172
1312 Ga0466972_0000143
1313 Ga0466972_0000591
1314 Ga0466972_0004739
1315 Ga0466966_0000038
1316 Ga0466961_0022939
1317 Ga0466961_0087719
1318 Ga0453684_0017490
1319 Ga0453684_0018180
1320 Ga0453684_0075604
1321 Ga0453684_0374795
1322 Ga0466957_0005302
1323 Ga0466957_0015471
1324 Ga0466957_0059298
1325 Ga0466959_0000698
1326 Ga0495638_0071343
1327 Ga0495638_0084325
1328 Ga0495638_0117549
1329 Ga0495606_0004455
1330 Ga0495608_0168432
1331 Ga0495643_0026639
1332 Ga0495648_0001596
1333 Ga0495587_0086790
1334 Ga0495587_0087059
1335 Ga0495622_0044007
1336 Ga0495668_0000099
1337 Ga0495668_0004679
1338 Ga0495611_0000280
1339 Ga0495625_0026123
1340 Ga0495635_0062278
1341 Ga0495636_0001268
1342 Ga0495672_0012826
1343 Ga0495672_0055753
1344 Ga0495687_000058
1345 Ga0495684_0128653
1346 Ga0495686_0000005
1347 Ga0495686_0014430
1348 Ga0495686_0123818
1349 Ga0496100_0038706
1350 Ga0496109_0023045
1351 Ga0496114_0011076
1352 Ga0496114_0119919
1353 Ga0501298_000195
1354 Ga0501299_013956
1355 Ga0501031_0010413
1356 Ga0501031_0054382
1357 Ga0501032_0000735
1358 Ga0501032_0001336
1359 Ga0501033_0019225
1360 Ga0501034_0006480
1361 Ga0501034_0030673
1362 Ga0501034_0046017
1363 Ga0501036_0004994
1364 Ga0501036_0049327
1365 Ga0501036_0158387
1366 Ga0501037_0001415
1367 Ga0501037_0012711
1368 Ga0501037_0018531
1369 Ga0501038_0003659
1370 Ga0501038_0007086
1371 Ga0501038_0016487
1372 Ga0501039_0007627
1373 Ga0501039_0040248
1374 Ga0501039_0042013
1375 Ga0501042_0046300
1376 Ga0501043_0004298
1377 Ga0501043_0008533
1378 Ga0501043_0038139
1379 Ga0501043_0224337
1380 Ga0501046_0003858
1381 Ga0501046_0098906
1382 Ga0501046_0116060
1383 Ga0501047_0007608
1384 Ga0501047_0012369
1385 Ga0501047_0013235
1386 Ga0501047_0033924
1387 Ga0501048_0005105
1388 Ga0501067_0007330
1389 Ga0501067_0008836
1390 Ga0501070_0034418
1391 Ga0501070_0039399
1392 Ga0501073_0000937
1393 Ga0501073_0008705
1394 Ga0501074_0008062
1395 Ga0501198_000331
1396 Ga0501217_001669
1397 Ga0501223_000646
1398 Ga0501233_000276
1399 Ga0501235_010130
1400 Ga0501242_000091
1401 Ga0501242_000098
1402 Ga0501243_002915
1403 Ga0501252_000098
1404 Ga0501261_000450
1405 Ga0501219_000177
1406 Ga0501225_0000698
1407 Ga0501225_0002309
1408 Ga0501245_003979
1409 Ga0501079_0035376
1410 Ga0501079_0188036
1411 Ga0501080_0044183
1412 Ga0501080_0063052
1413 Ga0501083_0000211
1414 Ga0501083_0137190
1415 Ga0501270_006857
1416 Ga0501035_0011942
1417 Ga0501035_0032978
1418 Ga0501035_0068521
1419 Ga0501044_0002128
1420 Ga0501044_0002402
1421 Ga0501044_0009921
1422 Ga0501044_0162111
1423 Ga0501045_0069800
1424 Ga0501284_00051
1425 nmdc:mga0k408_17548_c1
1426 nmdc:mga0k408_8782_c1
1427 nmdc:mga09592_7969_c1
1428 nmdc:mga0qj67_134724_c1
1429 nmdc:mga0qj67_34138_c1
1430 nmdc:mga08y16_1783_c1
1431 Ga0500578_0000961
1432 Ga0500644_0001408
1433 Ga0500646_0002797
1434 Ga0500583_0000111
1435 Ga0500583_0000860
1436 Ga0500641_0009657
1437 Ga0500559_0006375
1438 Ga0500568_0001094
1439 Ga0500568_0004392
1440 Ga0500589_076341
1441 Ga0500604_0019055
1442 Ga0500616_0077844
1443 Ga0500622_0001238
1444 Ga0500611_000078
1445 Ga0501084_0012860
1446 Ga0501084_0079975
1447 Ga0501082_0145152
1448 Ga0466962_0031907
1449 Ga0466962_0045937
1450 2738725891

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

224

459

0.81

PF01098

FTSW_RODA_SPOVE

Cell cycle protein

30

256

0.76

Structural Annotation

Top 5 Hits

ID Description Score Start End
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.8735 12 406
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.8722 12 406
6bas-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) 0.8546 12 406
6bar-assembly1.cif.gz_A crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) 0.8476 12 406
8bh1-assembly1.cif.gz_A core divisome complex ftswiqbl from pseudomonas aeruginosa 0.8132 12 411
ID Description Score Start End Superfamily
af_A4ICH4_855_1005_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.3714 71 175 3.40.50.300
af_A0A0B4JCU2_1_137_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.325 59 191 1.20.140.150
af_C0P5E5_13_169_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.3061 72 170 1.20.140.150
af_A4ICH4_855_1005_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.2902 71 175 3.40.50.300
af_P77219_8_153_1.20.1080.10 Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. 0.2699 49 191 1.20.1080.10
ID Description Score Start End GO Terms
AF-A0A7C5QD26-F1-model_v4 Rod shape-determining protein RodA 0.9478 13 182 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A7V3M3B6-F1-model_v4 Rod shape-determining protein RodA 0.8942 6 183 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A7C5QD26-F1-model_v4 Rod shape-determining protein RodA 0.8873 13 182 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A2V6U3J6-F1-model_v4 Rod shape-determining protein RodA 0.8777 6 183 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301
AF-A0A7V3M3B6-F1-model_v4 Rod shape-determining protein RodA 0.8708 6 183 GO:0005886
GO:0008360
GO:0015648
GO:0016740
GO:0032153
GO:0051301

Map