F477639
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 725 | 271 | 1450 | 439 |
Family's Representative Sequence
| Representative Sequence | 3300049569|Ga0501032_0039180|Ga0501032_0039180_94_1482 |
| Length | 462 |
| Sequence | LSSRKNGCHEKSIGQKRMNQRNPGISKGIDASLIWIYLLLVTIGITAIFAATYKEGDPVIQSFLRFRTDYSKQLFYFVAAAIIGLFILLTDSKFFTATANLWYVFGIFLLLLVFPFHSSVKGTESIIRFGGIQFQPAEFCKITVCLALSKYLSLPETDFSKTKSQLIAAGIALFPAALTVLQKETGLALVYCAFFIVMYREGLPSVVLVVGFSLAALVVATLVVEKNTLAIALTIIAVIAIYIMRRQIRRNRGLLMTIILLWLVCTGIQRFGVPFVFKHVLQRHQVERIYSTIGKDVPEEYLKSGVSDDETPVRVNTADYNVKQSKIAIGSGQVFGKGLLKGTQTRYDFVPEQRTDFIFCTIGEGFGFTGSIILLGIYLLLLFRIITIAERQRSVFSRCYAYGVAAVFFFHIVINIGMTVGLAPVIGIPLPFISYGGTSLLTFTILLFILIRLDADRQMVLR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 5 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 8 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 11 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 40 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 41 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 47 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 51 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 53 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 54 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 55 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 57 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 58 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 59 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 60 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 61 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 62 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 63 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 64 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 65 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 66 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 67 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 68 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 69 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 70 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 71 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 73 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 74 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 75 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 76 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 77 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 98 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 106 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 158 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 162 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 163 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 164 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 165 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 166 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 167 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 168 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 169 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 170 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 171 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 172 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 173 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 174 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 175 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 176 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 177 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 178 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 179 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 180 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 181 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 182 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 183 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 184 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 185 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 186 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 187 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 188 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 189 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 190 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 191 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 192 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 193 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 194 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 195 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 196 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 197 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 198 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 199 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 200 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 201 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 202 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 203 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 204 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 205 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 206 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 207 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 208 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 209 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 210 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 211 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 212 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 213 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 214 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 215 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 216 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 217 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 219 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 220 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 221 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 222 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 223 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 224 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 225 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 226 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 227 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 228 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 230 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 231 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 232 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 233 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 234 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 235 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 236 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 237 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 238 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 239 | 3300049682 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_B_3_drought | Metagenome | Rhizosphere |
| 240 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 241 | 3300049703 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control | Metagenome | Rhizosphere |
| 242 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 243 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 244 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 245 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 246 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 247 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 248 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 249 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 250 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 251 | 3300050005 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought | Metagenome | Rhizosphere |
| 252 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 253 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 254 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 255 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 256 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 257 | 3300053088 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere | Metagenome | Endosphere |
| 258 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 259 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 260 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 261 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 262 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 263 | 3300053147 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere | Metagenome | Endosphere |
| 264 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 265 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 266 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 267 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 268 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 269 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 270 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 271 | 2738541278 | Niastella sp. CF465 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.86 |
| Metatranscriptomes | 0 |
| Isolates | 0.14 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 2.34 |
| Nodule | 0 |
| Rhizoplane | 0.55 |
| Rhizosphere | 94.76 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.52 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501032_0039180 | 3300049569 | Bacteria | 3224 |
| 2 | SwRhRL2b_contig_1761633 | 2162886007 | Bacteria | 195701 |
| 3 | MBSR1b_contig_4137058 | 2162886012 | Bacteria | 2283 |
| 4 | JGI24744J21845_10004161 | 3300002077 | Bacteria | 2982 |
| 5 | rootH1_10140232 | 3300003316 | Bacteria | 2831 |
| 6 | rootH2_10061197 | 3300003320 | Bacteria | 21713 |
| 7 | rootH1_10000732 | 3300003323 | Bacteria | 17056 |
| 8 | Ga0065714_10081262 | 3300005288 | Bacteria | 2387 |
| 9 | Ga0065704_10000195 | 3300005289 | Bacteria | 195830 |
| 10 | Ga0065712_10002082 | 3300005290 | Bacteria | 7247 |
| 11 | Ga0065712_10002453 | 3300005290 | Bacteria | 4925 |
| 12 | Ga0065712_10002502 | 3300005290 | Bacteria | 4434 |
| 13 | Ga0065712_10011402 | 3300005290 | Unclassified | 2017 |
| 14 | Ga0065712_10104783 | 3300005290 | Bacteria | 1953 |
| 15 | Ga0065712_10125826 | 3300005290 | Bacteria | 1577 |
| 16 | Ga0065715_10001071 | 3300005293 | Bacteria | 8866 |
| 17 | Ga0065715_10125140 | 3300005293 | Bacteria | 2138 |
| 18 | Ga0070658_10036199 | 3300005327 | Unclassified | 3978 |
| 19 | Ga0070658_10041658 | 3300005327 | Bacteria | 3705 |
| 20 | Ga0070676_10000006 | 3300005328 | Bacteria | 72739 |
| 21 | Ga0070676_10006681 | 3300005328 | Bacteria | 6179 |
| 22 | Ga0070676_10016668 | 3300005328 | Bacteria | 4062 |
| 23 | Ga0070676_10028821 | 3300005328 | Bacteria | 3154 |
| 24 | Ga0070683_100001380 | 3300005329 | Bacteria | 18626 |
| 25 | Ga0070683_100002271 | 3300005329 | Bacteria | 15218 |
| 26 | Ga0070683_100003529 | 3300005329 | Bacteria | 12728 |
| 27 | Ga0070683_100037240 | 3300005329 | Bacteria | 4452 |
| 28 | Ga0070683_100176320 | 3300005329 | Bacteria | 2029 |
| 29 | Ga0070690_100003764 | 3300005330 | Bacteria | 8356 |
| 30 | Ga0070690_100091249 | 3300005330 | Bacteria | 2007 |
| 31 | Ga0070670_100014229 | 3300005331 | Bacteria | 6825 |
| 32 | Ga0068869_100003347 | 3300005334 | Bacteria | 9782 |
| 33 | Ga0068869_100017760 | 3300005334 | Unclassified | 4832 |
| 34 | Ga0068869_100063971 | 3300005334 | Unclassified | 2705 |
| 35 | Ga0068869_100188647 | 3300005334 | Bacteria | 1620 |
| 36 | Ga0070666_10000185 | 3300005335 | Bacteria | 42683 |
| 37 | Ga0070666_10001594 | 3300005335 | Bacteria | 13796 |
| 38 | Ga0070666_10003981 | 3300005335 | Bacteria | 8963 |
| 39 | Ga0070666_10004528 | 3300005335 | Bacteria | 8471 |
| 40 | Ga0070666_10004752 | 3300005335 | Bacteria | 8298 |
| 41 | Ga0070666_10044197 | 3300005335 | Unclassified | 2983 |
| 42 | Ga0070680_100001847 | 3300005336 | Bacteria | 15529 |
| 43 | Ga0070680_100013239 | 3300005336 | Bacteria | 6422 |
| 44 | Ga0070682_100010774 | 3300005337 | Bacteria | 5198 |
| 45 | Ga0070682_100017346 | 3300005337 | Unclassified | 4196 |
| 46 | Ga0068868_100000022 | 3300005338 | Bacteria | 85904 |
| 47 | Ga0068868_100011902 | 3300005338 | Bacteria | 6344 |
| 48 | Ga0068868_100012704 | 3300005338 | Bacteria | 6159 |
| 49 | Ga0068868_100014540 | 3300005338 | Bacteria | 5803 |
| 50 | Ga0068868_100224777 | 3300005338 | Bacteria | 1573 |
| 51 | Ga0070660_100136001 | 3300005339 | Unclassified | 1969 |
| 52 | Ga0070689_100003590 | 3300005340 | Bacteria | 10340 |
| 53 | Ga0070689_100016650 | 3300005340 | Bacteria | 5381 |
| 54 | Ga0070689_100020020 | 3300005340 | Bacteria | 4959 |
| 55 | Ga0070689_100066471 | 3300005340 | Unclassified | 2809 |
| 56 | Ga0070691_10075251 | 3300005341 | Bacteria | 1644 |
| 57 | Ga0070687_100008649 | 3300005343 | Bacteria | 4322 |
| 58 | Ga0070661_100000602 | 3300005344 | Bacteria | 26870 |
| 59 | Ga0070661_100003835 | 3300005344 | Bacteria | 10347 |
| 60 | Ga0070661_100088489 | 3300005344 | Bacteria | 2292 |
| 61 | Ga0070661_100094558 | 3300005344 | Bacteria | 2215 |
| 62 | Ga0070668_100000016 | 3300005347 | Bacteria | 104092 |
| 63 | Ga0070668_100067268 | 3300005347 | Bacteria | 2783 |
| 64 | Ga0070668_100071001 | 3300005347 | Unclassified | 2712 |
| 65 | Ga0070669_100002725 | 3300005353 | Bacteria | 12748 |
| 66 | Ga0070669_100011109 | 3300005353 | Bacteria | 6391 |
| 67 | Ga0070669_100140344 | 3300005353 | Bacteria | 1862 |
| 68 | Ga0070675_100036529 | 3300005354 | Bacteria | 3998 |
| 69 | Ga0070671_100005943 | 3300005355 | Bacteria | 9725 |
| 70 | Ga0070671_100042646 | 3300005355 | Unclassified | 3771 |
| 71 | Ga0070674_100000957 | 3300005356 | Bacteria | 15072 |
| 72 | Ga0070674_100052549 | 3300005356 | Unclassified | 2811 |
| 73 | Ga0070674_100100060 | 3300005356 | Unclassified | 2110 |
| 74 | Ga0070673_100000118 | 3300005364 | Bacteria | 36664 |
| 75 | Ga0070673_100004670 | 3300005364 | Bacteria | 8696 |
| 76 | Ga0070673_100006732 | 3300005364 | Bacteria | 7497 |
| 77 | Ga0070673_100052138 | 3300005364 | Bacteria | 3209 |
| 78 | Ga0070673_100070307 | 3300005364 | Bacteria | 2808 |
| 79 | Ga0070673_100097021 | 3300005364 | Bacteria | 2420 |
| 80 | Ga0070673_100278360 | 3300005364 | Bacteria | 1467 |
| 81 | Ga0070688_100001742 | 3300005365 | Bacteria | 10862 |
| 82 | Ga0070688_100027621 | 3300005365 | Bacteria | 3380 |
| 83 | Ga0070688_100062290 | 3300005365 | Bacteria | 2361 |
| 84 | Ga0070688_100079184 | 3300005365 | Unclassified | 2122 |
| 85 | Ga0070688_100128159 | 3300005365 | Bacteria | 1708 |
| 86 | Ga0070659_100001789 | 3300005366 | Bacteria | 15467 |
| 87 | Ga0070659_100032110 | 3300005366 | Bacteria | 4070 |
| 88 | Ga0070667_100000031 | 3300005367 | Bacteria | 177447 |
| 89 | Ga0070667_100005067 | 3300005367 | Bacteria | 11026 |
| 90 | Ga0070667_100010340 | 3300005367 | Bacteria | 7706 |
| 91 | Ga0070667_100022331 | 3300005367 | Bacteria | 5248 |
| 92 | Ga0070667_100035872 | 3300005367 | Bacteria | 4156 |
| 93 | Ga0070663_100129301 | 3300005455 | Bacteria | 1916 |
| 94 | Ga0070662_100001120 | 3300005457 | Bacteria | 16366 |
| 95 | Ga0070662_100005163 | 3300005457 | Bacteria | 8327 |
| 96 | Ga0070662_100037908 | 3300005457 | Bacteria | 3420 |
| 97 | Ga0070681_10012020 | 3300005458 | Bacteria | 8584 |
| 98 | Ga0068867_100000137 | 3300005459 | Bacteria | 47177 |
| 99 | Ga0068867_100005852 | 3300005459 | Bacteria | 8721 |
| 100 | Ga0068867_100011659 | 3300005459 | Bacteria | 6207 |
| 101 | Ga0068867_100024184 | 3300005459 | Bacteria | 4352 |
| 102 | Ga0068867_100087425 | 3300005459 | Bacteria | 2360 |
| 103 | Ga0068867_100093443 | 3300005459 | Bacteria | 2286 |
| 104 | Ga0068867_100270438 | 3300005459 | Bacteria | 1389 |
| 105 | Ga0070685_10010054 | 3300005466 | Bacteria | 4908 |
| 106 | Ga0070685_10010805 | 3300005466 | Bacteria | 4756 |
| 107 | Ga0070706_100112532 | 3300005467 | Bacteria | 2534 |
| 108 | Ga0070698_100002073 | 3300005471 | Bacteria | 22283 |
| 109 | Ga0070698_100008963 | 3300005471 | Bacteria | 10765 |
| 110 | Ga0070699_100104433 | 3300005518 | Bacteria | 2485 |
| 111 | Ga0070679_100005157 | 3300005530 | Bacteria | 12088 |
| 112 | Ga0070679_100187156 | 3300005530 | Unclassified | 2040 |
| 113 | Ga0070684_100000665 | 3300005535 | Bacteria | 23736 |
| 114 | Ga0068853_100001097 | 3300005539 | Bacteria | 19161 |
| 115 | Ga0068853_100004076 | 3300005539 | Bacteria | 11252 |
| 116 | Ga0068853_100005832 | 3300005539 | Bacteria | 9700 |
| 117 | Ga0068853_100014006 | 3300005539 | Bacteria | 6562 |
| 118 | Ga0068853_100030912 | 3300005539 | Bacteria | 4526 |
| 119 | Ga0068853_100033257 | 3300005539 | Bacteria | 4373 |
| 120 | Ga0068853_100053297 | 3300005539 | Bacteria | 3484 |
| 121 | Ga0068853_100075505 | 3300005539 | Bacteria | 2941 |
| 122 | Ga0068853_100076740 | 3300005539 | Bacteria | 2918 |
| 123 | Ga0068853_100098961 | 3300005539 | Bacteria | 2576 |
| 124 | Ga0070672_100000002 | 3300005543 | Bacteria | 159809 |
| 125 | Ga0070672_100003977 | 3300005543 | Bacteria | 9636 |
| 126 | Ga0070672_100006458 | 3300005543 | Bacteria | 7882 |
| 127 | Ga0070672_100012808 | 3300005543 | Bacteria | 5905 |
| 128 | Ga0070672_100057462 | 3300005543 | Bacteria | 3054 |
| 129 | Ga0070672_100100831 | 3300005543 | Bacteria | 2342 |
| 130 | Ga0070686_100025298 | 3300005544 | Bacteria | 3571 |
| 131 | Ga0070686_100041724 | 3300005544 | Bacteria | 2869 |
| 132 | Ga0070665_100000018 | 3300005548 | Bacteria | 434118 |
| 133 | Ga0070665_100000222 | 3300005548 | Bacteria | 94961 |
| 134 | Ga0070665_100057555 | 3300005548 | Unclassified | 3897 |
| 135 | Ga0070665_100261942 | 3300005548 | Unclassified | 1730 |
| 136 | Ga0068855_100000304 | 3300005563 | Bacteria | 61250 |
| 137 | Ga0068855_100008198 | 3300005563 | Bacteria | 12629 |
| 138 | Ga0068855_100105736 | 3300005563 | Bacteria | 3236 |
| 139 | Ga0068855_100164380 | 3300005563 | Unclassified | 2517 |
| 140 | Ga0068855_100203345 | 3300005563 | Unclassified | 2229 |
| 141 | Ga0070664_100000935 | 3300005564 | Bacteria | 22818 |
| 142 | Ga0070664_100003242 | 3300005564 | Bacteria | 13149 |
| 143 | Ga0070664_100012816 | 3300005564 | Bacteria | 6820 |
| 144 | Ga0070664_100062245 | 3300005564 | Unclassified | 3181 |
| 145 | Ga0070664_100101827 | 3300005564 | Bacteria | 2498 |
| 146 | Ga0070664_100119407 | 3300005564 | Unclassified | 2307 |
| 147 | Ga0068857_100000270 | 3300005577 | Bacteria | 35248 |
| 148 | Ga0068857_100009306 | 3300005577 | Bacteria | 8526 |
| 149 | Ga0068857_100017330 | 3300005577 | Bacteria | 6309 |
| 150 | Ga0068857_100051942 | 3300005577 | Bacteria | 3638 |
| 151 | Ga0068857_100061803 | 3300005577 | Bacteria | 3328 |
| 152 | Ga0068857_100174102 | 3300005577 | Bacteria | 1957 |
| 153 | Ga0068857_100176571 | 3300005577 | Bacteria | 1943 |
| 154 | Ga0068854_100057821 | 3300005578 | Bacteria | 2798 |
| 155 | Ga0068856_100017824 | 3300005614 | Bacteria | 6887 |
| 156 | Ga0070702_100009907 | 3300005615 | Bacteria | 4680 |
| 157 | Ga0068852_100000417 | 3300005616 | Bacteria | 28355 |
| 158 | Ga0068852_100000506 | 3300005616 | Bacteria | 25661 |
| 159 | Ga0068852_100002991 | 3300005616 | Bacteria | 11743 |
| 160 | Ga0068852_100004163 | 3300005616 | Bacteria | 10191 |
| 161 | Ga0068852_100017692 | 3300005616 | Bacteria | 5598 |
| 162 | Ga0068852_100022021 | 3300005616 | Bacteria | 5101 |
| 163 | Ga0068852_100072225 | 3300005616 | Bacteria | 3032 |
| 164 | Ga0068852_100073741 | 3300005616 | Bacteria | 3003 |
| 165 | Ga0068852_100091079 | 3300005616 | Bacteria | 2728 |
| 166 | Ga0068859_100000013 | 3300005617 | Bacteria | 291126 |
| 167 | Ga0068859_100000272 | 3300005617 | Bacteria | 51348 |
| 168 | Ga0068859_100010151 | 3300005617 | Bacteria | 9483 |
| 169 | Ga0068859_100011728 | 3300005617 | Bacteria | 8806 |
| 170 | Ga0068859_100019499 | 3300005617 | Bacteria | 6813 |
| 171 | Ga0068859_100050597 | 3300005617 | Bacteria | 4174 |
| 172 | Ga0068859_100076166 | 3300005617 | Bacteria | 3395 |
| 173 | Ga0068859_100210738 | 3300005617 | Bacteria | 2029 |
| 174 | Ga0068859_100277477 | 3300005617 | Bacteria | 1768 |
| 175 | Ga0068859_100434926 | 3300005617 | Bacteria | 1408 |
| 176 | Ga0068864_100002098 | 3300005618 | Bacteria | 16469 |
| 177 | Ga0068864_100002872 | 3300005618 | Bacteria | 14238 |
| 178 | Ga0068864_100021273 | 3300005618 | Bacteria | 5435 |
| 179 | Ga0068864_100038681 | 3300005618 | Bacteria | 4074 |
| 180 | Ga0068864_100238312 | 3300005618 | Bacteria | 1685 |
| 181 | Ga0068866_10015447 | 3300005718 | Bacteria | 3392 |
| 182 | Ga0068861_100008109 | 3300005719 | Bacteria | 7226 |
| 183 | Ga0068861_100179366 | 3300005719 | Bacteria | 1762 |
| 184 | Ga0068861_100185277 | 3300005719 | Unclassified | 1736 |
| 185 | Ga0068861_100282473 | 3300005719 | Unclassified | 1430 |
| 186 | Ga0068851_10000178 | 3300005834 | Bacteria | 31537 |
| 187 | Ga0068870_10002374 | 3300005840 | Bacteria | 7830 |
| 188 | Ga0068870_10022533 | 3300005840 | Bacteria | 3096 |
| 189 | Ga0068863_100000640 | 3300005841 | Bacteria | 35467 |
| 190 | Ga0068863_100001990 | 3300005841 | Bacteria | 20307 |
| 191 | Ga0068863_100076380 | 3300005841 | Unclassified | 3169 |
| 192 | Ga0068863_100144419 | 3300005841 | Bacteria | 2275 |
| 193 | Ga0068863_100241230 | 3300005841 | Bacteria | 1744 |
| 194 | Ga0068858_100000083 | 3300005842 | Bacteria | 98991 |
| 195 | Ga0068858_100005679 | 3300005842 | Bacteria | 12195 |
| 196 | Ga0068858_100280859 | 3300005842 | Bacteria | 1585 |
| 197 | Ga0068860_100000328 | 3300005843 | Bacteria | 64568 |
| 198 | Ga0068860_100000615 | 3300005843 | Bacteria | 42122 |
| 199 | Ga0068860_100001575 | 3300005843 | Bacteria | 24583 |
| 200 | Ga0068860_100003551 | 3300005843 | Bacteria | 16040 |
| 201 | Ga0068860_100004885 | 3300005843 | Bacteria | 13661 |
| 202 | Ga0068860_100006659 | 3300005843 | Bacteria | 11601 |
| 203 | Ga0068860_100038906 | 3300005843 | Bacteria | 4550 |
| 204 | Ga0068860_100042582 | 3300005843 | Bacteria | 4335 |
| 205 | Ga0068860_100066202 | 3300005843 | Bacteria | 3432 |
| 206 | Ga0068860_100084114 | 3300005843 | Bacteria | 3027 |
| 207 | Ga0068860_100108875 | 3300005843 | Bacteria | 2648 |
| 208 | Ga0068862_100018939 | 3300005844 | Bacteria | 5736 |
| 209 | Ga0068862_100041483 | 3300005844 | Bacteria | 3916 |
| 210 | Ga0081540_1029318 | 3300005983 | Unclassified | 3068 |
| 211 | Ga0070715_10029941 | 3300006163 | Bacteria | 2196 |
| 212 | Ga0070716_100058778 | 3300006173 | Bacteria | 2214 |
| 213 | Ga0075366_10106383 | 3300006195 | Bacteria | 1686 |
| 214 | Ga0097621_100002447 | 3300006237 | Bacteria | 12715 |
| 215 | Ga0097621_100008194 | 3300006237 | Bacteria | 7517 |
| 216 | Ga0097621_100009983 | 3300006237 | Bacteria | 6919 |
| 217 | Ga0097621_100027292 | 3300006237 | Unclassified | 4488 |
| 218 | Ga0068871_100000550 | 3300006358 | Bacteria | 25578 |
| 219 | Ga0068871_100000731 | 3300006358 | Bacteria | 22276 |
| 220 | Ga0068871_100018515 | 3300006358 | Bacteria | 5294 |
| 221 | Ga0068871_100028174 | 3300006358 | Unclassified | 4401 |
| 222 | Ga0068871_100037729 | 3300006358 | Bacteria | 3855 |
| 223 | Ga0068871_100137608 | 3300006358 | Bacteria | 2075 |
| 224 | Ga0068871_100191017 | 3300006358 | Bacteria | 1764 |
| 225 | Ga0068871_100214377 | 3300006358 | Bacteria | 1666 |
| 226 | Ga0075428_100012133 | 3300006844 | Bacteria | 9587 |
| 227 | Ga0075428_100028746 | 3300006844 | Bacteria | 6151 |
| 228 | Ga0075430_100042145 | 3300006846 | Unclassified | 3860 |
| 229 | Ga0075430_100180640 | 3300006846 | Bacteria | 1755 |
| 230 | Ga0075429_100002555 | 3300006880 | Bacteria | 15332 |
| 231 | Ga0075429_100008195 | 3300006880 | Bacteria | 9083 |
| 232 | Ga0068865_100000515 | 3300006881 | Bacteria | 21613 |
| 233 | Ga0068865_100014621 | 3300006881 | Bacteria | 4991 |
| 234 | Ga0068865_100177330 | 3300006881 | Bacteria | 1639 |
| 235 | Ga0097620_100000013 | 3300006931 | Bacteria | 291126 |
| 236 | Ga0097620_100000272 | 3300006931 | Bacteria | 51348 |
| 237 | Ga0097620_100010151 | 3300006931 | Bacteria | 9483 |
| 238 | Ga0097620_100011728 | 3300006931 | Bacteria | 8806 |
| 239 | Ga0097620_100019498 | 3300006931 | Bacteria | 6813 |
| 240 | Ga0097620_100050596 | 3300006931 | Bacteria | 4174 |
| 241 | Ga0097620_100076167 | 3300006931 | Bacteria | 3395 |
| 242 | Ga0097620_100210739 | 3300006931 | Bacteria | 2029 |
| 243 | Ga0097620_100277473 | 3300006931 | Bacteria | 1768 |
| 244 | Ga0097620_100434933 | 3300006931 | Bacteria | 1408 |
| 245 | Ga0105240_10001887 | 3300009093 | Bacteria | 34847 |
| 246 | Ga0105240_10004214 | 3300009093 | Bacteria | 21995 |
| 247 | Ga0105240_10007170 | 3300009093 | Bacteria | 16233 |
| 248 | Ga0105240_10015052 | 3300009093 | Bacteria | 10529 |
| 249 | Ga0105240_10039571 | 3300009093 | Bacteria | 6037 |
| 250 | Ga0105240_10039878 | 3300009093 | Bacteria | 6010 |
| 251 | Ga0105240_10112921 | 3300009093 | Bacteria | 3284 |
| 252 | Ga0105240_10116481 | 3300009093 | Bacteria | 3223 |
| 253 | Ga0111539_10003989 | 3300009094 | Bacteria | 19391 |
| 254 | Ga0111539_10046070 | 3300009094 | Bacteria | 5218 |
| 255 | Ga0111539_10216932 | 3300009094 | Bacteria | 2228 |
| 256 | Ga0105245_10075566 | 3300009098 | Unclassified | 3068 |
| 257 | Ga0105247_10001830 | 3300009101 | Bacteria | 14909 |
| 258 | Ga0105247_10003580 | 3300009101 | Bacteria | 10091 |
| 259 | Ga0105247_10029877 | 3300009101 | Bacteria | 3304 |
| 260 | Ga0105247_10052179 | 3300009101 | Bacteria | 2521 |
| 261 | Ga0105241_10000460 | 3300009174 | Bacteria | 30681 |
| 262 | Ga0105241_10001166 | 3300009174 | Bacteria | 20001 |
| 263 | Ga0105241_10004286 | 3300009174 | Bacteria | 10549 |
| 264 | Ga0105242_10006234 | 3300009176 | Bacteria | 9189 |
| 265 | Ga0105242_10012647 | 3300009176 | Bacteria | 6499 |
| 266 | Ga0105248_10043749 | 3300009177 | Bacteria | 5022 |
| 267 | Ga0105237_10000191 | 3300009545 | Bacteria | 87065 |
| 268 | Ga0105237_10001928 | 3300009545 | Bacteria | 26472 |
| 269 | Ga0105237_10003918 | 3300009545 | Bacteria | 17436 |
| 270 | Ga0105237_10008644 | 3300009545 | Bacteria | 11004 |
| 271 | Ga0105237_10017643 | 3300009545 | Bacteria | 7396 |
| 272 | Ga0105237_10018778 | 3300009545 | Bacteria | 7150 |
| 273 | Ga0105237_10028300 | 3300009545 | Bacteria | 5710 |
| 274 | Ga0105237_10132243 | 3300009545 | Bacteria | 2489 |
| 275 | Ga0105237_10346380 | 3300009545 | Bacteria | 1490 |
| 276 | Ga0105238_10000488 | 3300009551 | Bacteria | 41712 |
| 277 | Ga0105238_10074976 | 3300009551 | Bacteria | 3375 |
| 278 | Ga0105238_10092722 | 3300009551 | Bacteria | 3008 |
| 279 | Ga0105238_10110392 | 3300009551 | Bacteria | 2731 |
| 280 | Ga0105238_10194554 | 3300009551 | Bacteria | 2004 |
| 281 | Ga0105249_10000779 | 3300009553 | Bacteria | 28576 |
| 282 | Ga0105249_10000813 | 3300009553 | Bacteria | 28112 |
| 283 | Ga0105249_10003085 | 3300009553 | Bacteria | 14378 |
| 284 | Ga0105249_10003761 | 3300009553 | Bacteria | 13093 |
| 285 | Ga0105249_10012090 | 3300009553 | Bacteria | 7599 |
| 286 | Ga0105249_10074801 | 3300009553 | Bacteria | 3136 |
| 287 | Ga0105249_10110868 | 3300009553 | Bacteria | 2594 |
| 288 | Ga0105249_10111022 | 3300009553 | Bacteria | 2592 |
| 289 | Ga0105249_10114140 | 3300009553 | Bacteria | 2557 |
| 290 | Ga0105249_10152553 | 3300009553 | Bacteria | 2225 |
| 291 | Ga0105239_10000468 | 3300010375 | Bacteria | 59019 |
| 292 | Ga0105239_10004934 | 3300010375 | Bacteria | 15748 |
| 293 | Ga0105239_10005764 | 3300010375 | Bacteria | 14448 |
| 294 | Ga0105239_10006037 | 3300010375 | Bacteria | 14096 |
| 295 | Ga0105239_10006519 | 3300010375 | Bacteria | 13526 |
| 296 | Ga0105239_10021143 | 3300010375 | Bacteria | 7178 |
| 297 | Ga0105239_10039076 | 3300010375 | Bacteria | 5199 |
| 298 | Ga0105239_10132933 | 3300010375 | Bacteria | 2769 |
| 299 | Ga0105246_10114517 | 3300011119 | Unclassified | 1987 |
| 300 | Ga0105246_10223796 | 3300011119 | Bacteria | 1476 |
| 301 | Ga0157373_10007184 | 3300013100 | Bacteria | 8310 |
| 302 | Ga0157373_10022607 | 3300013100 | Bacteria | 4561 |
| 303 | Ga0157371_10000218 | 3300013102 | Bacteria | 83919 |
| 304 | Ga0157371_10006484 | 3300013102 | Bacteria | 9647 |
| 305 | Ga0157371_10009208 | 3300013102 | Bacteria | 7794 |
| 306 | Ga0157371_10011789 | 3300013102 | Bacteria | 6714 |
| 307 | Ga0157370_10002445 | 3300013104 | Bacteria | 22405 |
| 308 | Ga0157370_10003725 | 3300013104 | Bacteria | 17816 |
| 309 | Ga0157370_10006185 | 3300013104 | Bacteria | 13273 |
| 310 | Ga0157369_10137013 | 3300013105 | Bacteria | 2591 |
| 311 | Ga0157369_10163077 | 3300013105 | Unclassified | 2352 |
| 312 | Ga0157369_10339766 | 3300013105 | Bacteria | 1560 |
| 313 | Ga0157374_10000011 | 3300013296 | Bacteria | 466749 |
| 314 | Ga0157374_10000074 | 3300013296 | Bacteria | 99947 |
| 315 | Ga0157374_10000332 | 3300013296 | Bacteria | 43569 |
| 316 | Ga0157374_10022980 | 3300013296 | Bacteria | 5569 |
| 317 | Ga0157374_10084112 | 3300013296 | Bacteria | 3024 |
| 318 | Ga0157378_10002147 | 3300013297 | Bacteria | 17507 |
| 319 | Ga0157378_10002167 | 3300013297 | Bacteria | 17431 |
| 320 | Ga0157378_10016500 | 3300013297 | Bacteria | 6469 |
| 321 | Ga0157378_10029126 | 3300013297 | Bacteria | 4874 |
| 322 | Ga0157378_10169049 | 3300013297 | Bacteria | 2049 |
| 323 | Ga0163162_10000029 | 3300013306 | Bacteria | 168510 |
| 324 | Ga0163162_10001057 | 3300013306 | Bacteria | 25608 |
| 325 | Ga0163162_10001747 | 3300013306 | Bacteria | 20369 |
| 326 | Ga0163162_10007827 | 3300013306 | Bacteria | 10417 |
| 327 | Ga0163162_10022570 | 3300013306 | Bacteria | 6204 |
| 328 | Ga0163162_10048581 | 3300013306 | Bacteria | 4251 |
| 329 | Ga0163162_10049970 | 3300013306 | Bacteria | 4193 |
| 330 | Ga0163162_10050468 | 3300013306 | Bacteria | 4172 |
| 331 | Ga0163162_10111918 | 3300013306 | Bacteria | 2828 |
| 332 | Ga0163162_10373970 | 3300013306 | Bacteria | 1558 |
| 333 | Ga0157372_10000656 | 3300013307 | Bacteria | 37971 |
| 334 | Ga0157372_10019685 | 3300013307 | Bacteria | 7274 |
| 335 | Ga0157372_10020479 | 3300013307 | Bacteria | 7136 |
| 336 | Ga0157372_10036951 | 3300013307 | Bacteria | 5385 |
| 337 | Ga0157372_10037250 | 3300013307 | Bacteria | 5363 |
| 338 | Ga0157372_10037289 | 3300013307 | Bacteria | 5361 |
| 339 | Ga0157372_10112383 | 3300013307 | Bacteria | 3121 |
| 340 | Ga0157372_10173569 | 3300013307 | Bacteria | 2494 |
| 341 | Ga0157375_10000042 | 3300013308 | Bacteria | 160008 |
| 342 | Ga0157375_10000445 | 3300013308 | Bacteria | 37477 |
| 343 | Ga0157375_10000954 | 3300013308 | Bacteria | 25069 |
| 344 | Ga0157375_10013461 | 3300013308 | Bacteria | 7282 |
| 345 | Ga0157375_10139448 | 3300013308 | Bacteria | 2551 |
| 346 | Ga0157375_10163708 | 3300013308 | Bacteria | 2368 |
| 347 | Ga0163163_10000057 | 3300014325 | Bacteria | 124939 |
| 348 | Ga0163163_10000076 | 3300014325 | Bacteria | 108784 |
| 349 | Ga0163163_10000421 | 3300014325 | Bacteria | 39252 |
| 350 | Ga0163163_10010498 | 3300014325 | Bacteria | 8331 |
| 351 | Ga0163163_10043574 | 3300014325 | Bacteria | 4400 |
| 352 | Ga0157380_10007277 | 3300014326 | Bacteria | 7853 |
| 353 | Ga0157380_10011700 | 3300014326 | Bacteria | 6344 |
| 354 | Ga0157377_10010650 | 3300014745 | Bacteria | 4557 |
| 355 | Ga0157377_10010981 | 3300014745 | Bacteria | 4503 |
| 356 | Ga0157377_10011938 | 3300014745 | Bacteria | 4353 |
| 357 | Ga0157377_10015065 | 3300014745 | Bacteria | 3945 |
| 358 | Ga0157377_10032003 | 3300014745 | Bacteria | 2861 |
| 359 | Ga0157379_10000016 | 3300014968 | Bacteria | 103230 |
| 360 | Ga0157379_10003153 | 3300014968 | Bacteria | 13946 |
| 361 | Ga0157379_10019931 | 3300014968 | Bacteria | 5925 |
| 362 | Ga0157379_10057701 | 3300014968 | Bacteria | 3469 |
| 363 | Ga0157379_10202544 | 3300014968 | Bacteria | 1795 |
| 364 | Ga0157376_10000067 | 3300014969 | Bacteria | 83894 |
| 365 | Ga0157376_10003150 | 3300014969 | Bacteria | 11327 |
| 366 | Ga0157376_10041245 | 3300014969 | Bacteria | 3778 |
| 367 | Ga0157376_10084721 | 3300014969 | Bacteria | 2730 |
| 368 | Ga0157376_10156108 | 3300014969 | Unclassified | 2064 |
| 369 | Ga0163161_10005734 | 3300017792 | Bacteria | 8603 |
| 370 | Ga0163161_10007519 | 3300017792 | Bacteria | 7529 |
| 371 | Ga0209646_1001123 | 3300025246 | Bacteria | 7879 |
| 372 | Ga0207656_10000175 | 3300025321 | Bacteria | 23238 |
| 373 | Ga0207710_10001504 | 3300025900 | Bacteria | 11546 |
| 374 | Ga0207688_10023893 | 3300025901 | Unclassified | 3351 |
| 375 | Ga0207680_10000083 | 3300025903 | Bacteria | 42904 |
| 376 | Ga0207680_10001745 | 3300025903 | Bacteria | 10253 |
| 377 | Ga0207680_10004318 | 3300025903 | Bacteria | 6738 |
| 378 | Ga0207680_10005002 | 3300025903 | Bacteria | 6313 |
| 379 | Ga0207680_10030717 | 3300025903 | Bacteria | 3034 |
| 380 | Ga0207647_10000025 | 3300025904 | Bacteria | 112150 |
| 381 | Ga0207647_10010226 | 3300025904 | Bacteria | 6629 |
| 382 | Ga0207647_10027985 | 3300025904 | Bacteria | 3669 |
| 383 | Ga0207647_10048661 | 3300025904 | Bacteria | 2632 |
| 384 | Ga0207685_10041568 | 3300025905 | Bacteria | 1721 |
| 385 | Ga0207645_10002942 | 3300025907 | Bacteria | 13166 |
| 386 | Ga0207645_10010028 | 3300025907 | Bacteria | 6522 |
| 387 | Ga0207645_10056285 | 3300025907 | Bacteria | 2511 |
| 388 | Ga0207645_10088844 | 3300025907 | Unclassified | 1987 |
| 389 | Ga0207643_10002064 | 3300025908 | Bacteria | 11082 |
| 390 | Ga0207643_10002411 | 3300025908 | Bacteria | 10115 |
| 391 | Ga0207705_10023806 | 3300025909 | Unclassified | 4369 |
| 392 | Ga0207705_10024738 | 3300025909 | Bacteria | 4285 |
| 393 | Ga0207654_10000410 | 3300025911 | Bacteria | 24779 |
| 394 | Ga0207654_10000632 | 3300025911 | Bacteria | 19858 |
| 395 | Ga0207654_10003759 | 3300025911 | Bacteria | 7651 |
| 396 | Ga0207707_10001019 | 3300025912 | Bacteria | 26895 |
| 397 | Ga0207695_10000248 | 3300025913 | Bacteria | 140288 |
| 398 | Ga0207695_10000351 | 3300025913 | Bacteria | 105891 |
| 399 | Ga0207695_10012543 | 3300025913 | Bacteria | 10160 |
| 400 | Ga0207695_10013252 | 3300025913 | Bacteria | 9838 |
| 401 | Ga0207695_10023160 | 3300025913 | Bacteria | 7026 |
| 402 | Ga0207695_10030135 | 3300025913 | Bacteria | 5977 |
| 403 | Ga0207695_10033500 | 3300025913 | Bacteria | 5601 |
| 404 | Ga0207695_10093703 | 3300025913 | Bacteria | 3012 |
| 405 | Ga0207671_10000950 | 3300025914 | Bacteria | 35986 |
| 406 | Ga0207671_10001185 | 3300025914 | Bacteria | 30947 |
| 407 | Ga0207671_10001741 | 3300025914 | Bacteria | 24461 |
| 408 | Ga0207671_10002635 | 3300025914 | Bacteria | 18872 |
| 409 | Ga0207671_10007269 | 3300025914 | Bacteria | 9634 |
| 410 | Ga0207671_10016637 | 3300025914 | Bacteria | 5710 |
| 411 | Ga0207660_10001707 | 3300025917 | Bacteria | 14723 |
| 412 | Ga0207662_10012527 | 3300025918 | Bacteria | 4724 |
| 413 | Ga0207662_10016207 | 3300025918 | Bacteria | 4203 |
| 414 | Ga0207657_10055955 | 3300025919 | Bacteria | 3405 |
| 415 | Ga0207657_10110612 | 3300025919 | Bacteria | 2269 |
| 416 | Ga0207649_10032834 | 3300025920 | Unclassified | 3097 |
| 417 | Ga0207649_10038683 | 3300025920 | Bacteria | 2889 |
| 418 | Ga0207649_10038814 | 3300025920 | Unclassified | 2885 |
| 419 | Ga0207652_10000979 | 3300025921 | Bacteria | 26459 |
| 420 | Ga0207681_10004454 | 3300025923 | Bacteria | 8621 |
| 421 | Ga0207681_10008330 | 3300025923 | Bacteria | 6341 |
| 422 | Ga0207681_10042048 | 3300025923 | Bacteria | 3050 |
| 423 | Ga0207681_10114565 | 3300025923 | Bacteria | 1967 |
| 424 | Ga0207681_10194068 | 3300025923 | Bacteria | 1555 |
| 425 | Ga0207694_10049705 | 3300025924 | Bacteria | 3246 |
| 426 | Ga0207650_10054184 | 3300025925 | Unclassified | 2974 |
| 427 | Ga0207650_10149312 | 3300025925 | Bacteria | 1843 |
| 428 | Ga0207659_10007095 | 3300025926 | Bacteria | 6879 |
| 429 | Ga0207659_10026752 | 3300025926 | Bacteria | 3896 |
| 430 | Ga0207659_10074408 | 3300025926 | Bacteria | 2489 |
| 431 | Ga0207644_10037715 | 3300025931 | Unclassified | 3402 |
| 432 | Ga0207644_10115200 | 3300025931 | Bacteria | 2038 |
| 433 | Ga0207706_10009703 | 3300025933 | Bacteria | 8835 |
| 434 | Ga0207706_10013950 | 3300025933 | Bacteria | 7285 |
| 435 | Ga0207706_10028463 | 3300025933 | Bacteria | 4991 |
| 436 | Ga0207706_10043830 | 3300025933 | Bacteria | 3964 |
| 437 | Ga0207706_10046546 | 3300025933 | Bacteria | 3840 |
| 438 | Ga0207686_10000857 | 3300025934 | Bacteria | 18495 |
| 439 | Ga0207686_10006451 | 3300025934 | Bacteria | 6314 |
| 440 | Ga0207686_10168630 | 3300025934 | Bacteria | 1542 |
| 441 | Ga0207670_10066458 | 3300025936 | Bacteria | 2477 |
| 442 | Ga0207670_10074828 | 3300025936 | Bacteria | 2352 |
| 443 | Ga0207669_10049551 | 3300025937 | Unclassified | 2504 |
| 444 | Ga0207704_10000494 | 3300025938 | Bacteria | 17580 |
| 445 | Ga0207704_10150780 | 3300025938 | Bacteria | 1640 |
| 446 | Ga0207691_10000004 | 3300025940 | Bacteria | 168729 |
| 447 | Ga0207691_10002067 | 3300025940 | Bacteria | 19592 |
| 448 | Ga0207691_10015352 | 3300025940 | Bacteria | 7286 |
| 449 | Ga0207691_10020645 | 3300025940 | Bacteria | 6228 |
| 450 | Ga0207691_10058840 | 3300025940 | Unclassified | 3495 |
| 451 | Ga0207711_10216682 | 3300025941 | Unclassified | 1750 |
| 452 | Ga0207689_10001078 | 3300025942 | Bacteria | 26309 |
| 453 | Ga0207689_10002854 | 3300025942 | Bacteria | 15942 |
| 454 | Ga0207689_10003903 | 3300025942 | Bacteria | 13579 |
| 455 | Ga0207689_10013771 | 3300025942 | Bacteria | 6892 |
| 456 | Ga0207689_10026483 | 3300025942 | Unclassified | 4856 |
| 457 | Ga0207689_10080610 | 3300025942 | Bacteria | 2675 |
| 458 | Ga0207689_10125031 | 3300025942 | Unclassified | 2116 |
| 459 | Ga0207689_10199320 | 3300025942 | Bacteria | 1652 |
| 460 | Ga0207661_10010033 | 3300025944 | Bacteria | 6804 |
| 461 | Ga0207661_10012330 | 3300025944 | Bacteria | 6210 |
| 462 | Ga0207661_10022488 | 3300025944 | Unclassified | 4751 |
| 463 | Ga0207661_10037372 | 3300025944 | Bacteria | 3797 |
| 464 | Ga0207661_10050801 | 3300025944 | Bacteria | 3306 |
| 465 | Ga0207679_10001154 | 3300025945 | Bacteria | 16832 |
| 466 | Ga0207679_10007296 | 3300025945 | Bacteria | 7006 |
| 467 | Ga0207679_10007852 | 3300025945 | Bacteria | 6781 |
| 468 | Ga0207679_10073471 | 3300025945 | Bacteria | 2587 |
| 469 | Ga0207667_10001219 | 3300025949 | Bacteria | 32210 |
| 470 | Ga0207667_10001760 | 3300025949 | Bacteria | 27253 |
| 471 | Ga0207667_10009503 | 3300025949 | Bacteria | 11446 |
| 472 | Ga0207667_10083333 | 3300025949 | Bacteria | 3311 |
| 473 | Ga0207667_10088566 | 3300025949 | Unclassified | 3201 |
| 474 | Ga0207667_10184108 | 3300025949 | Unclassified | 2144 |
| 475 | Ga0207651_10000526 | 3300025960 | Bacteria | 16106 |
| 476 | Ga0207651_10024502 | 3300025960 | Bacteria | 3734 |
| 477 | Ga0207651_10204664 | 3300025960 | Unclassified | 1584 |
| 478 | Ga0207712_10000864 | 3300025961 | Bacteria | 22096 |
| 479 | Ga0207712_10000867 | 3300025961 | Bacteria | 22041 |
| 480 | Ga0207712_10039352 | 3300025961 | Bacteria | 3239 |
| 481 | Ga0207668_10000112 | 3300025972 | Bacteria | 58202 |
| 482 | Ga0207668_10181608 | 3300025972 | Unclassified | 1660 |
| 483 | Ga0207640_10185300 | 3300025981 | Bacteria | 1564 |
| 484 | Ga0207640_10219053 | 3300025981 | Bacteria | 1456 |
| 485 | Ga0207658_10000059 | 3300025986 | Bacteria | 121530 |
| 486 | Ga0207658_10008893 | 3300025986 | Bacteria | 6812 |
| 487 | Ga0207658_10016382 | 3300025986 | Bacteria | 5098 |
| 488 | Ga0207658_10094504 | 3300025986 | Unclassified | 2327 |
| 489 | Ga0207677_10000288 | 3300026023 | Bacteria | 37751 |
| 490 | Ga0207677_10009397 | 3300026023 | Bacteria | 5503 |
| 491 | Ga0207677_10044640 | 3300026023 | Bacteria | 2954 |
| 492 | Ga0207677_10140809 | 3300026023 | Bacteria | 1846 |
| 493 | Ga0207703_10000790 | 3300026035 | Bacteria | 31144 |
| 494 | Ga0207703_10005525 | 3300026035 | Bacteria | 10151 |
| 495 | Ga0207703_10320330 | 3300026035 | Unclassified | 1420 |
| 496 | Ga0207639_10002779 | 3300026041 | Bacteria | 11753 |
| 497 | Ga0207639_10003086 | 3300026041 | Bacteria | 11196 |
| 498 | Ga0207639_10005047 | 3300026041 | Bacteria | 8891 |
| 499 | Ga0207639_10014498 | 3300026041 | Bacteria | 5546 |
| 500 | Ga0207639_10156409 | 3300026041 | Bacteria | 1915 |
| 501 | Ga0207639_10176269 | 3300026041 | Bacteria | 1815 |
| 502 | Ga0207678_10020743 | 3300026067 | Bacteria | 5760 |
| 503 | Ga0207702_10026038 | 3300026078 | Bacteria | 4856 |
| 504 | Ga0207641_10000159 | 3300026088 | Bacteria | 96072 |
| 505 | Ga0207641_10000559 | 3300026088 | Bacteria | 41628 |
| 506 | Ga0207641_10001256 | 3300026088 | Bacteria | 25238 |
| 507 | Ga0207641_10054029 | 3300026088 | Bacteria | 3406 |
| 508 | Ga0207641_10054252 | 3300026088 | Unclassified | 3400 |
| 509 | Ga0207641_10198435 | 3300026088 | Bacteria | 1849 |
| 510 | Ga0207648_10001434 | 3300026089 | Bacteria | 26245 |
| 511 | Ga0207648_10001746 | 3300026089 | Bacteria | 23793 |
| 512 | Ga0207648_10007739 | 3300026089 | Bacteria | 10502 |
| 513 | Ga0207648_10023922 | 3300026089 | Bacteria | 5460 |
| 514 | Ga0207648_10024041 | 3300026089 | Bacteria | 5446 |
| 515 | Ga0207648_10053283 | 3300026089 | Bacteria | 3536 |
| 516 | Ga0207648_10169766 | 3300026089 | Bacteria | 1928 |
| 517 | Ga0207676_10000567 | 3300026095 | Bacteria | 30636 |
| 518 | Ga0207676_10002025 | 3300026095 | Bacteria | 14725 |
| 519 | Ga0207676_10014544 | 3300026095 | Bacteria | 5664 |
| 520 | Ga0207674_10002233 | 3300026116 | Bacteria | 24521 |
| 521 | Ga0207674_10002382 | 3300026116 | Bacteria | 23767 |
| 522 | Ga0207674_10006589 | 3300026116 | Bacteria | 13651 |
| 523 | Ga0207674_10018203 | 3300026116 | Bacteria | 7644 |
| 524 | Ga0207674_10046601 | 3300026116 | Bacteria | 4450 |
| 525 | Ga0207674_10129629 | 3300026116 | Bacteria | 2486 |
| 526 | Ga0207674_10135121 | 3300026116 | Bacteria | 2428 |
| 527 | Ga0207675_100000685 | 3300026118 | Bacteria | 33367 |
| 528 | Ga0207675_100008916 | 3300026118 | Bacteria | 9412 |
| 529 | Ga0207675_100009600 | 3300026118 | Bacteria | 9053 |
| 530 | Ga0207675_100015533 | 3300026118 | Bacteria | 7101 |
| 531 | Ga0207675_100105741 | 3300026118 | Bacteria | 2653 |
| 532 | Ga0207675_100191050 | 3300026118 | Bacteria | 1964 |
| 533 | Ga0207683_10003706 | 3300026121 | Bacteria | 13267 |
| 534 | Ga0207683_10074101 | 3300026121 | Unclassified | 3012 |
| 535 | Ga0207698_10000340 | 3300026142 | Bacteria | 27673 |
| 536 | Ga0207698_10002890 | 3300026142 | Bacteria | 10282 |
| 537 | Ga0207698_10067472 | 3300026142 | Bacteria | 2821 |
| 538 | Ga0207698_10176805 | 3300026142 | Bacteria | 1886 |
| 539 | Ga0207698_10254827 | 3300026142 | Bacteria | 1608 |
| 540 | Ga0207428_10042013 | 3300027907 | Bacteria | 3699 |
| 541 | Ga0268266_10000026 | 3300028379 | Bacteria | 434485 |
| 542 | Ga0268266_10003590 | 3300028379 | Bacteria | 15351 |
| 543 | Ga0268266_10095744 | 3300028379 | Bacteria | 2608 |
| 544 | Ga0268265_10003213 | 3300028380 | Bacteria | 11865 |
| 545 | Ga0268264_10000898 | 3300028381 | Bacteria | 31351 |
| 546 | Ga0268264_10001824 | 3300028381 | Bacteria | 19489 |
| 547 | Ga0268264_10004527 | 3300028381 | Bacteria | 11845 |
| 548 | Ga0268264_10004655 | 3300028381 | Bacteria | 11661 |
| 549 | Ga0268264_10015360 | 3300028381 | Bacteria | 6279 |
| 550 | Ga0268264_10018041 | 3300028381 | Bacteria | 5771 |
| 551 | Ga0268264_10039005 | 3300028381 | Bacteria | 3923 |
| 552 | Ga0307517_10009664 | 3300028786 | Bacteria | 13641 |
| 553 | Ga0307515_10000001 | 3300028794 | Bacteria | 4259510 |
| 554 | Ga0307515_10000021 | 3300028794 | Bacteria | 406008 |
| 555 | Ga0307511_10001204 | 3300030521 | Bacteria | 27440 |
| 556 | Ga0265340_10034790 | 3300031247 | Bacteria | 2505 |
| 557 | Ga0265327_10000013 | 3300031251 | Bacteria | 519549 |
| 558 | Ga0265327_10002699 | 3300031251 | Bacteria | 18200 |
| 559 | Ga0307513_10066003 | 3300031456 | Bacteria | 3805 |
| 560 | Ga0307509_10103411 | 3300031507 | Bacteria | 2876 |
| 561 | Ga0307509_10115384 | 3300031507 | Bacteria | 2678 |
| 562 | Ga0265313_10007658 | 3300031595 | Bacteria | 7321 |
| 563 | Ga0307508_10000606 | 3300031616 | Bacteria | 42966 |
| 564 | Ga0307516_10001745 | 3300031730 | Bacteria | 29897 |
| 565 | Ga0307410_10195648 | 3300031852 | Bacteria | 1540 |
| 566 | Ga0307411_10078142 | 3300032005 | Bacteria | 2268 |
| 567 | Ga0307510_10003663 | 3300033180 | Bacteria | 17946 |
| 568 | Ga0373955_0074653 | 3300035172 | Bacteria | 1904 |
| 569 | Ga0373955_0083674 | 3300035172 | Bacteria | 1808 |
| 570 | Ga0373937_0031384 | 3300036401 | Bacteria | 4815 |
| 571 | Ga0373937_0071590 | 3300036401 | Bacteria | 3197 |
| 572 | Ga0395905_0009831 | 3300037471 | Bacteria | 9324 |
| 573 | Ga0395905_0026884 | 3300037471 | Bacteria | 5427 |
| 574 | Ga0395905_0039790 | 3300037471 | Unclassified | 4412 |
| 575 | Ga0436365_1141771 | 3300039437 | Bacteria | 2847 |
| 576 | Ga0439436_0004608 | 3300041404 | Bacteria | 4226 |
| 577 | Ga0439439_0011315 | 3300041406 | Bacteria | 2145 |
| 578 | Ga0439453_0002926 | 3300041408 | Bacteria | 2409 |
| 579 | Ga0451853_0248055 | 3300041512 | Bacteria | 3324 |
| 580 | Ga0439441_010681 | 3300042001 | Unclassified | 1545 |
| 581 | Ga0439449_0018081 | 3300042007 | Bacteria | 2646 |
| 582 | Ga0439457_000635 | 3300042014 | Bacteria | 10368 |
| 583 | Ga0439462_0000977 | 3300042015 | Bacteria | 6095 |
| 584 | Ga0439434_0010377 | 3300042435 | Bacteria | 2746 |
| 585 | Ga0451577_0089977 | 3300042876 | Unclassified | 2739 |
| 586 | Ga0466969_0000172 | 3300044656 | Bacteria | 34716 |
| 587 | Ga0466972_0000143 | 3300044658 | Bacteria | 58694 |
| 588 | Ga0466972_0000591 | 3300044658 | Bacteria | 17623 |
| 589 | Ga0466972_0004739 | 3300044658 | Bacteria | 6810 |
| 590 | Ga0466966_0000038 | 3300044684 | Bacteria | 97255 |
| 591 | Ga0466961_0022939 | 3300044693 | Bacteria | 4015 |
| 592 | Ga0466961_0087719 | 3300044693 | Unclassified | 1966 |
| 593 | Ga0453684_0017490 | 3300044712 | Bacteria | 11102 |
| 594 | Ga0453684_0018180 | 3300044712 | Bacteria | 10817 |
| 595 | Ga0453684_0075604 | 3300044712 | Unclassified | 4232 |
| 596 | Ga0453684_0374795 | 3300044712 | Bacteria | 1599 |
| 597 | Ga0466957_0005302 | 3300044842 | Bacteria | 7228 |
| 598 | Ga0466957_0015471 | 3300044842 | Bacteria | 4456 |
| 599 | Ga0466957_0059298 | 3300044842 | Bacteria | 2346 |
| 600 | Ga0466959_0000698 | 3300045049 | Bacteria | 19638 |
| 601 | Ga0495638_0071343 | 3300046460 | Bacteria | 2125 |
| 602 | Ga0495638_0084325 | 3300046460 | Bacteria | 1923 |
| 603 | Ga0495638_0117549 | 3300046460 | Bacteria | 1573 |
| 604 | Ga0495606_0004455 | 3300046507 | Bacteria | 13983 |
| 605 | Ga0495608_0168432 | 3300046511 | Bacteria | 1390 |
| 606 | Ga0495643_0026639 | 3300046522 | Bacteria | 3260 |
| 607 | Ga0495648_0001596 | 3300046524 | Bacteria | 22083 |
| 608 | Ga0495587_0086790 | 3300046536 | Unclassified | 1811 |
| 609 | Ga0495587_0087059 | 3300046536 | Bacteria | 1808 |
| 610 | Ga0495622_0044007 | 3300046557 | Bacteria | 2075 |
| 611 | Ga0495668_0000099 | 3300046616 | Bacteria | 137915 |
| 612 | Ga0495668_0004679 | 3300046616 | Bacteria | 9605 |
| 613 | Ga0495611_0000280 | 3300046648 | Bacteria | 34841 |
| 614 | Ga0495625_0026123 | 3300046660 | Bacteria | 4416 |
| 615 | Ga0495635_0062278 | 3300046663 | Unclassified | 2562 |
| 616 | Ga0495636_0001268 | 3300047318 | Bacteria | 9565 |
| 617 | Ga0495672_0012826 | 3300047320 | Bacteria | 5822 |
| 618 | Ga0495672_0055753 | 3300047320 | Bacteria | 2304 |
| 619 | Ga0495687_000058 | 3300047443 | Bacteria | 185830 |
| 620 | Ga0495684_0128653 | 3300047471 | Unclassified | 1904 |
| 621 | Ga0495686_0000005 | 3300047472 | Bacteria | 827143 |
| 622 | Ga0495686_0014430 | 3300047472 | Bacteria | 5436 |
| 623 | Ga0495686_0123818 | 3300047472 | Unclassified | 1538 |
| 624 | Ga0496100_0038706 | 3300048903 | Unclassified | 3024 |
| 625 | Ga0496109_0023045 | 3300048912 | Bacteria | 5521 |
| 626 | Ga0496114_0011076 | 3300048917 | Bacteria | 7197 |
| 627 | Ga0496114_0119919 | 3300048917 | Bacteria | 2262 |
| 628 | Ga0501298_000195 | 3300049521 | Bacteria | 7699 |
| 629 | Ga0501299_013956 | 3300049522 | Bacteria | 1391 |
| 630 | Ga0501031_0010413 | 3300049568 | Bacteria | 6055 |
| 631 | Ga0501031_0054382 | 3300049568 | Bacteria | 2609 |
| 632 | Ga0501032_0000735 | 3300049569 | Bacteria | 26625 |
| 633 | Ga0501032_0001336 | 3300049569 | Bacteria | 19664 |
| 634 | Ga0501033_0019225 | 3300049570 | Bacteria | 5164 |
| 635 | Ga0501034_0006480 | 3300049571 | Bacteria | 12600 |
| 636 | Ga0501034_0030673 | 3300049571 | Bacteria | 5463 |
| 637 | Ga0501034_0046017 | 3300049571 | Bacteria | 4409 |
| 638 | Ga0501036_0004994 | 3300049572 | Bacteria | 10732 |
| 639 | Ga0501036_0049327 | 3300049572 | Unclassified | 3565 |
| 640 | Ga0501036_0158387 | 3300049572 | Bacteria | 1909 |
| 641 | Ga0501037_0001415 | 3300049573 | Bacteria | 17601 |
| 642 | Ga0501037_0012711 | 3300049573 | Bacteria | 6201 |
| 643 | Ga0501037_0018531 | 3300049573 | Bacteria | 5131 |
| 644 | Ga0501038_0003659 | 3300049574 | Bacteria | 14324 |
| 645 | Ga0501038_0007086 | 3300049574 | Bacteria | 10354 |
| 646 | Ga0501038_0016487 | 3300049574 | Bacteria | 6695 |
| 647 | Ga0501039_0007627 | 3300049575 | Bacteria | 8263 |
| 648 | Ga0501039_0040248 | 3300049575 | Unclassified | 3608 |
| 649 | Ga0501039_0042013 | 3300049575 | Bacteria | 3532 |
| 650 | Ga0501042_0046300 | 3300049578 | Bacteria | 3101 |
| 651 | Ga0501043_0004298 | 3300049579 | Bacteria | 11595 |
| 652 | Ga0501043_0008533 | 3300049579 | Bacteria | 8073 |
| 653 | Ga0501043_0038139 | 3300049579 | Unclassified | 3779 |
| 654 | Ga0501043_0224337 | 3300049579 | Bacteria | 1453 |
| 655 | Ga0501046_0003858 | 3300049580 | Bacteria | 13711 |
| 656 | Ga0501046_0098906 | 3300049580 | Bacteria | 2240 |
| 657 | Ga0501046_0116060 | 3300049580 | Bacteria | 2041 |
| 658 | Ga0501047_0007608 | 3300049581 | Bacteria | 10196 |
| 659 | Ga0501047_0012369 | 3300049581 | Bacteria | 8079 |
| 660 | Ga0501047_0013235 | 3300049581 | Bacteria | 7814 |
| 661 | Ga0501047_0033924 | 3300049581 | Bacteria | 4927 |
| 662 | Ga0501048_0005105 | 3300049582 | Bacteria | 10003 |
| 663 | Ga0501067_0007330 | 3300049583 | Bacteria | 6127 |
| 664 | Ga0501067_0008836 | 3300049583 | Bacteria | 5581 |
| 665 | Ga0501070_0034418 | 3300049586 | Bacteria | 4236 |
| 666 | Ga0501070_0039399 | 3300049586 | Bacteria | 3942 |
| 667 | Ga0501073_0000937 | 3300049589 | Bacteria | 20953 |
| 668 | Ga0501073_0008705 | 3300049589 | Bacteria | 7513 |
| 669 | Ga0501074_0008062 | 3300049590 | Bacteria | 7629 |
| 670 | Ga0501198_000331 | 3300049649 | Bacteria | 5997 |
| 671 | Ga0501217_001669 | 3300049661 | Bacteria | 4220 |
| 672 | Ga0501223_000646 | 3300049663 | Bacteria | 8375 |
| 673 | Ga0501233_000276 | 3300049668 | Bacteria | 7856 |
| 674 | Ga0501235_010130 | 3300049669 | Bacteria | 2060 |
| 675 | Ga0501242_000091 | 3300049674 | Bacteria | 5976 |
| 676 | Ga0501242_000098 | 3300049674 | Bacteria | 5871 |
| 677 | Ga0501243_002915 | 3300049675 | Bacteria | 2518 |
| 678 | Ga0501252_000098 | 3300049682 | Bacteria | 4812 |
| 679 | Ga0501261_000450 | 3300049690 | Bacteria | 5309 |
| 680 | Ga0501219_000177 | 3300049703 | Bacteria | 11733 |
| 681 | Ga0501225_0000698 | 3300049705 | Bacteria | 10514 |
| 682 | Ga0501225_0002309 | 3300049705 | Bacteria | 5897 |
| 683 | Ga0501245_003979 | 3300049708 | Bacteria | 2020 |
| 684 | Ga0501079_0035376 | 3300049741 | Bacteria | 3844 |
| 685 | Ga0501079_0188036 | 3300049741 | Bacteria | 1612 |
| 686 | Ga0501080_0044183 | 3300049742 | Bacteria | 4148 |
| 687 | Ga0501080_0063052 | 3300049742 | Bacteria | 3449 |
| 688 | Ga0501083_0000211 | 3300049744 | Bacteria | 37931 |
| 689 | Ga0501083_0137190 | 3300049744 | Bacteria | 1602 |
| 690 | Ga0501270_006857 | 3300049767 | Bacteria | 1386 |
| 691 | Ga0501035_0011942 | 3300049822 | Bacteria | 8037 |
| 692 | Ga0501035_0032978 | 3300049822 | Unclassified | 4710 |
| 693 | Ga0501035_0068521 | 3300049822 | Bacteria | 3146 |
| 694 | Ga0501044_0002128 | 3300049823 | Bacteria | 22711 |
| 695 | Ga0501044_0002402 | 3300049823 | Bacteria | 21355 |
| 696 | Ga0501044_0009921 | 3300049823 | Bacteria | 10344 |
| 697 | Ga0501044_0162111 | 3300049823 | Unclassified | 2212 |
| 698 | Ga0501045_0069800 | 3300049824 | Bacteria | 2584 |
| 699 | Ga0501284_00051 | 3300050005 | Bacteria | 43498 |
| 700 | nmdc:mga0k408_17548_c1 | 3300050493 | Bacteria | 3990 |
| 701 | nmdc:mga0k408_8782_c1 | 3300050493 | Bacteria | 5437 |
| 702 | nmdc:mga09592_7969_c1 | 3300050508 | Bacteria | 8608 |
| 703 | nmdc:mga0qj67_134724_c1 | 3300050509 | Bacteria | 2001 |
| 704 | nmdc:mga0qj67_34138_c1 | 3300050509 | Unclassified | 3973 |
| 705 | nmdc:mga08y16_1783_c1 | 3300050511 | Bacteria | 21805 |
| 706 | Ga0500578_0000961 | 3300053086 | Bacteria | 31954 |
| 707 | Ga0500644_0001408 | 3300053088 | Bacteria | 6395 |
| 708 | Ga0500646_0002797 | 3300053090 | Unclassified | 4483 |
| 709 | Ga0500583_0000111 | 3300053092 | Bacteria | 40256 |
| 710 | Ga0500583_0000860 | 3300053092 | Bacteria | 8760 |
| 711 | Ga0500641_0009657 | 3300053096 | Bacteria | 3471 |
| 712 | Ga0500559_0006375 | 3300053136 | Bacteria | 5328 |
| 713 | Ga0500568_0001094 | 3300053139 | Bacteria | 18241 |
| 714 | Ga0500568_0004392 | 3300053139 | Bacteria | 7547 |
| 715 | Ga0500589_076341 | 3300053147 | Bacteria | 1505 |
| 716 | Ga0500604_0019055 | 3300053151 | Bacteria | 1918 |
| 717 | Ga0500616_0077844 | 3300053153 | Bacteria | 1674 |
| 718 | Ga0500622_0001238 | 3300053156 | Bacteria | 20912 |
| 719 | Ga0500611_000078 | 3300053727 | Bacteria | 36716 |
| 720 | Ga0501084_0012860 | 3300054114 | Bacteria | 6934 |
| 721 | Ga0501084_0079975 | 3300054114 | Bacteria | 2740 |
| 722 | Ga0501082_0145152 | 3300060353 | Bacteria | 2060 |
| 723 | Ga0466962_0031907 | 3300061719 | Bacteria | 2522 |
| 724 | Ga0466962_0045937 | 3300061719 | Bacteria | 2088 |
| 725 | 2738725891 | 2738541278 | Bacteria | 9755573 |
| 726 | Ga0501032_0039180 | |||
| 727 | SwRhRL2b_contig_1761633 | |||
| 728 | MBSR1b_contig_4137058 | |||
| 729 | JGI24744J21845_10004161 | |||
| 730 | rootH1_10140232 | |||
| 731 | rootH2_10061197 | |||
| 732 | rootH1_10000732 | |||
| 733 | Ga0065714_10081262 | |||
| 734 | Ga0065704_10000195 | |||
| 735 | Ga0065712_10002082 | |||
| 736 | Ga0065712_10002453 | |||
| 737 | Ga0065712_10002502 | |||
| 738 | Ga0065712_10011402 | |||
| 739 | Ga0065712_10104783 | |||
| 740 | Ga0065712_10125826 | |||
| 741 | Ga0065715_10001071 | |||
| 742 | Ga0065715_10125140 | |||
| 743 | Ga0070658_10036199 | |||
| 744 | Ga0070658_10041658 | |||
| 745 | Ga0070676_10000006 | |||
| 746 | Ga0070676_10006681 | |||
| 747 | Ga0070676_10016668 | |||
| 748 | Ga0070676_10028821 | |||
| 749 | Ga0070683_100001380 | |||
| 750 | Ga0070683_100002271 | |||
| 751 | Ga0070683_100003529 | |||
| 752 | Ga0070683_100037240 | |||
| 753 | Ga0070683_100176320 | |||
| 754 | Ga0070690_100003764 | |||
| 755 | Ga0070690_100091249 | |||
| 756 | Ga0070670_100014229 | |||
| 757 | Ga0068869_100003347 | |||
| 758 | Ga0068869_100017760 | |||
| 759 | Ga0068869_100063971 | |||
| 760 | Ga0068869_100188647 | |||
| 761 | Ga0070666_10000185 | |||
| 762 | Ga0070666_10001594 | |||
| 763 | Ga0070666_10003981 | |||
| 764 | Ga0070666_10004528 | |||
| 765 | Ga0070666_10004752 | |||
| 766 | Ga0070666_10044197 | |||
| 767 | Ga0070680_100001847 | |||
| 768 | Ga0070680_100013239 | |||
| 769 | Ga0070682_100010774 | |||
| 770 | Ga0070682_100017346 | |||
| 771 | Ga0068868_100000022 | |||
| 772 | Ga0068868_100011902 | |||
| 773 | Ga0068868_100012704 | |||
| 774 | Ga0068868_100014540 | |||
| 775 | Ga0068868_100224777 | |||
| 776 | Ga0070660_100136001 | |||
| 777 | Ga0070689_100003590 | |||
| 778 | Ga0070689_100016650 | |||
| 779 | Ga0070689_100020020 | |||
| 780 | Ga0070689_100066471 | |||
| 781 | Ga0070691_10075251 | |||
| 782 | Ga0070687_100008649 | |||
| 783 | Ga0070661_100000602 | |||
| 784 | Ga0070661_100003835 | |||
| 785 | Ga0070661_100088489 | |||
| 786 | Ga0070661_100094558 | |||
| 787 | Ga0070668_100000016 | |||
| 788 | Ga0070668_100067268 | |||
| 789 | Ga0070668_100071001 | |||
| 790 | Ga0070669_100002725 | |||
| 791 | Ga0070669_100011109 | |||
| 792 | Ga0070669_100140344 | |||
| 793 | Ga0070675_100036529 | |||
| 794 | Ga0070671_100005943 | |||
| 795 | Ga0070671_100042646 | |||
| 796 | Ga0070674_100000957 | |||
| 797 | Ga0070674_100052549 | |||
| 798 | Ga0070674_100100060 | |||
| 799 | Ga0070673_100000118 | |||
| 800 | Ga0070673_100004670 | |||
| 801 | Ga0070673_100006732 | |||
| 802 | Ga0070673_100052138 | |||
| 803 | Ga0070673_100070307 | |||
| 804 | Ga0070673_100097021 | |||
| 805 | Ga0070673_100278360 | |||
| 806 | Ga0070688_100001742 | |||
| 807 | Ga0070688_100027621 | |||
| 808 | Ga0070688_100062290 | |||
| 809 | Ga0070688_100079184 | |||
| 810 | Ga0070688_100128159 | |||
| 811 | Ga0070659_100001789 | |||
| 812 | Ga0070659_100032110 | |||
| 813 | Ga0070667_100000031 | |||
| 814 | Ga0070667_100005067 | |||
| 815 | Ga0070667_100010340 | |||
| 816 | Ga0070667_100022331 | |||
| 817 | Ga0070667_100035872 | |||
| 818 | Ga0070663_100129301 | |||
| 819 | Ga0070662_100001120 | |||
| 820 | Ga0070662_100005163 | |||
| 821 | Ga0070662_100037908 | |||
| 822 | Ga0070681_10012020 | |||
| 823 | Ga0068867_100000137 | |||
| 824 | Ga0068867_100005852 | |||
| 825 | Ga0068867_100011659 | |||
| 826 | Ga0068867_100024184 | |||
| 827 | Ga0068867_100087425 | |||
| 828 | Ga0068867_100093443 | |||
| 829 | Ga0068867_100270438 | |||
| 830 | Ga0070685_10010054 | |||
| 831 | Ga0070685_10010805 | |||
| 832 | Ga0070706_100112532 | |||
| 833 | Ga0070698_100002073 | |||
| 834 | Ga0070698_100008963 | |||
| 835 | Ga0070699_100104433 | |||
| 836 | Ga0070679_100005157 | |||
| 837 | Ga0070679_100187156 | |||
| 838 | Ga0070684_100000665 | |||
| 839 | Ga0068853_100001097 | |||
| 840 | Ga0068853_100004076 | |||
| 841 | Ga0068853_100005832 | |||
| 842 | Ga0068853_100014006 | |||
| 843 | Ga0068853_100030912 | |||
| 844 | Ga0068853_100033257 | |||
| 845 | Ga0068853_100053297 | |||
| 846 | Ga0068853_100075505 | |||
| 847 | Ga0068853_100076740 | |||
| 848 | Ga0068853_100098961 | |||
| 849 | Ga0070672_100000002 | |||
| 850 | Ga0070672_100003977 | |||
| 851 | Ga0070672_100006458 | |||
| 852 | Ga0070672_100012808 | |||
| 853 | Ga0070672_100057462 | |||
| 854 | Ga0070672_100100831 | |||
| 855 | Ga0070686_100025298 | |||
| 856 | Ga0070686_100041724 | |||
| 857 | Ga0070665_100000018 | |||
| 858 | Ga0070665_100000222 | |||
| 859 | Ga0070665_100057555 | |||
| 860 | Ga0070665_100261942 | |||
| 861 | Ga0068855_100000304 | |||
| 862 | Ga0068855_100008198 | |||
| 863 | Ga0068855_100105736 | |||
| 864 | Ga0068855_100164380 | |||
| 865 | Ga0068855_100203345 | |||
| 866 | Ga0070664_100000935 | |||
| 867 | Ga0070664_100003242 | |||
| 868 | Ga0070664_100012816 | |||
| 869 | Ga0070664_100062245 | |||
| 870 | Ga0070664_100101827 | |||
| 871 | Ga0070664_100119407 | |||
| 872 | Ga0068857_100000270 | |||
| 873 | Ga0068857_100009306 | |||
| 874 | Ga0068857_100017330 | |||
| 875 | Ga0068857_100051942 | |||
| 876 | Ga0068857_100061803 | |||
| 877 | Ga0068857_100174102 | |||
| 878 | Ga0068857_100176571 | |||
| 879 | Ga0068854_100057821 | |||
| 880 | Ga0068856_100017824 | |||
| 881 | Ga0070702_100009907 | |||
| 882 | Ga0068852_100000417 | |||
| 883 | Ga0068852_100000506 | |||
| 884 | Ga0068852_100002991 | |||
| 885 | Ga0068852_100004163 | |||
| 886 | Ga0068852_100017692 | |||
| 887 | Ga0068852_100022021 | |||
| 888 | Ga0068852_100072225 | |||
| 889 | Ga0068852_100073741 | |||
| 890 | Ga0068852_100091079 | |||
| 891 | Ga0068859_100000013 | |||
| 892 | Ga0068859_100000272 | |||
| 893 | Ga0068859_100010151 | |||
| 894 | Ga0068859_100011728 | |||
| 895 | Ga0068859_100019499 | |||
| 896 | Ga0068859_100050597 | |||
| 897 | Ga0068859_100076166 | |||
| 898 | Ga0068859_100210738 | |||
| 899 | Ga0068859_100277477 | |||
| 900 | Ga0068859_100434926 | |||
| 901 | Ga0068864_100002098 | |||
| 902 | Ga0068864_100002872 | |||
| 903 | Ga0068864_100021273 | |||
| 904 | Ga0068864_100038681 | |||
| 905 | Ga0068864_100238312 | |||
| 906 | Ga0068866_10015447 | |||
| 907 | Ga0068861_100008109 | |||
| 908 | Ga0068861_100179366 | |||
| 909 | Ga0068861_100185277 | |||
| 910 | Ga0068861_100282473 | |||
| 911 | Ga0068851_10000178 | |||
| 912 | Ga0068870_10002374 | |||
| 913 | Ga0068870_10022533 | |||
| 914 | Ga0068863_100000640 | |||
| 915 | Ga0068863_100001990 | |||
| 916 | Ga0068863_100076380 | |||
| 917 | Ga0068863_100144419 | |||
| 918 | Ga0068863_100241230 | |||
| 919 | Ga0068858_100000083 | |||
| 920 | Ga0068858_100005679 | |||
| 921 | Ga0068858_100280859 | |||
| 922 | Ga0068860_100000328 | |||
| 923 | Ga0068860_100000615 | |||
| 924 | Ga0068860_100001575 | |||
| 925 | Ga0068860_100003551 | |||
| 926 | Ga0068860_100004885 | |||
| 927 | Ga0068860_100006659 | |||
| 928 | Ga0068860_100038906 | |||
| 929 | Ga0068860_100042582 | |||
| 930 | Ga0068860_100066202 | |||
| 931 | Ga0068860_100084114 | |||
| 932 | Ga0068860_100108875 | |||
| 933 | Ga0068862_100018939 | |||
| 934 | Ga0068862_100041483 | |||
| 935 | Ga0081540_1029318 | |||
| 936 | Ga0070715_10029941 | |||
| 937 | Ga0070716_100058778 | |||
| 938 | Ga0075366_10106383 | |||
| 939 | Ga0097621_100002447 | |||
| 940 | Ga0097621_100008194 | |||
| 941 | Ga0097621_100009983 | |||
| 942 | Ga0097621_100027292 | |||
| 943 | Ga0068871_100000550 | |||
| 944 | Ga0068871_100000731 | |||
| 945 | Ga0068871_100018515 | |||
| 946 | Ga0068871_100028174 | |||
| 947 | Ga0068871_100037729 | |||
| 948 | Ga0068871_100137608 | |||
| 949 | Ga0068871_100191017 | |||
| 950 | Ga0068871_100214377 | |||
| 951 | Ga0075428_100012133 | |||
| 952 | Ga0075428_100028746 | |||
| 953 | Ga0075430_100042145 | |||
| 954 | Ga0075430_100180640 | |||
| 955 | Ga0075429_100002555 | |||
| 956 | Ga0075429_100008195 | |||
| 957 | Ga0068865_100000515 | |||
| 958 | Ga0068865_100014621 | |||
| 959 | Ga0068865_100177330 | |||
| 960 | Ga0097620_100000013 | |||
| 961 | Ga0097620_100000272 | |||
| 962 | Ga0097620_100010151 | |||
| 963 | Ga0097620_100011728 | |||
| 964 | Ga0097620_100019498 | |||
| 965 | Ga0097620_100050596 | |||
| 966 | Ga0097620_100076167 | |||
| 967 | Ga0097620_100210739 | |||
| 968 | Ga0097620_100277473 | |||
| 969 | Ga0097620_100434933 | |||
| 970 | Ga0105240_10001887 | |||
| 971 | Ga0105240_10004214 | |||
| 972 | Ga0105240_10007170 | |||
| 973 | Ga0105240_10015052 | |||
| 974 | Ga0105240_10039571 | |||
| 975 | Ga0105240_10039878 | |||
| 976 | Ga0105240_10112921 | |||
| 977 | Ga0105240_10116481 | |||
| 978 | Ga0111539_10003989 | |||
| 979 | Ga0111539_10046070 | |||
| 980 | Ga0111539_10216932 | |||
| 981 | Ga0105245_10075566 | |||
| 982 | Ga0105247_10001830 | |||
| 983 | Ga0105247_10003580 | |||
| 984 | Ga0105247_10029877 | |||
| 985 | Ga0105247_10052179 | |||
| 986 | Ga0105241_10000460 | |||
| 987 | Ga0105241_10001166 | |||
| 988 | Ga0105241_10004286 | |||
| 989 | Ga0105242_10006234 | |||
| 990 | Ga0105242_10012647 | |||
| 991 | Ga0105248_10043749 | |||
| 992 | Ga0105237_10000191 | |||
| 993 | Ga0105237_10001928 | |||
| 994 | Ga0105237_10003918 | |||
| 995 | Ga0105237_10008644 | |||
| 996 | Ga0105237_10017643 | |||
| 997 | Ga0105237_10018778 | |||
| 998 | Ga0105237_10028300 | |||
| 999 | Ga0105237_10132243 | |||
| 1000 | Ga0105237_10346380 | |||
| 1001 | Ga0105238_10000488 | |||
| 1002 | Ga0105238_10074976 | |||
| 1003 | Ga0105238_10092722 | |||
| 1004 | Ga0105238_10110392 | |||
| 1005 | Ga0105238_10194554 | |||
| 1006 | Ga0105249_10000779 | |||
| 1007 | Ga0105249_10000813 | |||
| 1008 | Ga0105249_10003085 | |||
| 1009 | Ga0105249_10003761 | |||
| 1010 | Ga0105249_10012090 | |||
| 1011 | Ga0105249_10074801 | |||
| 1012 | Ga0105249_10110868 | |||
| 1013 | Ga0105249_10111022 | |||
| 1014 | Ga0105249_10114140 | |||
| 1015 | Ga0105249_10152553 | |||
| 1016 | Ga0105239_10000468 | |||
| 1017 | Ga0105239_10004934 | |||
| 1018 | Ga0105239_10005764 | |||
| 1019 | Ga0105239_10006037 | |||
| 1020 | Ga0105239_10006519 | |||
| 1021 | Ga0105239_10021143 | |||
| 1022 | Ga0105239_10039076 | |||
| 1023 | Ga0105239_10132933 | |||
| 1024 | Ga0105246_10114517 | |||
| 1025 | Ga0105246_10223796 | |||
| 1026 | Ga0157373_10007184 | |||
| 1027 | Ga0157373_10022607 | |||
| 1028 | Ga0157371_10000218 | |||
| 1029 | Ga0157371_10006484 | |||
| 1030 | Ga0157371_10009208 | |||
| 1031 | Ga0157371_10011789 | |||
| 1032 | Ga0157370_10002445 | |||
| 1033 | Ga0157370_10003725 | |||
| 1034 | Ga0157370_10006185 | |||
| 1035 | Ga0157369_10137013 | |||
| 1036 | Ga0157369_10163077 | |||
| 1037 | Ga0157369_10339766 | |||
| 1038 | Ga0157374_10000011 | |||
| 1039 | Ga0157374_10000074 | |||
| 1040 | Ga0157374_10000332 | |||
| 1041 | Ga0157374_10022980 | |||
| 1042 | Ga0157374_10084112 | |||
| 1043 | Ga0157378_10002147 | |||
| 1044 | Ga0157378_10002167 | |||
| 1045 | Ga0157378_10016500 | |||
| 1046 | Ga0157378_10029126 | |||
| 1047 | Ga0157378_10169049 | |||
| 1048 | Ga0163162_10000029 | |||
| 1049 | Ga0163162_10001057 | |||
| 1050 | Ga0163162_10001747 | |||
| 1051 | Ga0163162_10007827 | |||
| 1052 | Ga0163162_10022570 | |||
| 1053 | Ga0163162_10048581 | |||
| 1054 | Ga0163162_10049970 | |||
| 1055 | Ga0163162_10050468 | |||
| 1056 | Ga0163162_10111918 | |||
| 1057 | Ga0163162_10373970 | |||
| 1058 | Ga0157372_10000656 | |||
| 1059 | Ga0157372_10019685 | |||
| 1060 | Ga0157372_10020479 | |||
| 1061 | Ga0157372_10036951 | |||
| 1062 | Ga0157372_10037250 | |||
| 1063 | Ga0157372_10037289 | |||
| 1064 | Ga0157372_10112383 | |||
| 1065 | Ga0157372_10173569 | |||
| 1066 | Ga0157375_10000042 | |||
| 1067 | Ga0157375_10000445 | |||
| 1068 | Ga0157375_10000954 | |||
| 1069 | Ga0157375_10013461 | |||
| 1070 | Ga0157375_10139448 | |||
| 1071 | Ga0157375_10163708 | |||
| 1072 | Ga0163163_10000057 | |||
| 1073 | Ga0163163_10000076 | |||
| 1074 | Ga0163163_10000421 | |||
| 1075 | Ga0163163_10010498 | |||
| 1076 | Ga0163163_10043574 | |||
| 1077 | Ga0157380_10007277 | |||
| 1078 | Ga0157380_10011700 | |||
| 1079 | Ga0157377_10010650 | |||
| 1080 | Ga0157377_10010981 | |||
| 1081 | Ga0157377_10011938 | |||
| 1082 | Ga0157377_10015065 | |||
| 1083 | Ga0157377_10032003 | |||
| 1084 | Ga0157379_10000016 | |||
| 1085 | Ga0157379_10003153 | |||
| 1086 | Ga0157379_10019931 | |||
| 1087 | Ga0157379_10057701 | |||
| 1088 | Ga0157379_10202544 | |||
| 1089 | Ga0157376_10000067 | |||
| 1090 | Ga0157376_10003150 | |||
| 1091 | Ga0157376_10041245 | |||
| 1092 | Ga0157376_10084721 | |||
| 1093 | Ga0157376_10156108 | |||
| 1094 | Ga0163161_10005734 | |||
| 1095 | Ga0163161_10007519 | |||
| 1096 | Ga0209646_1001123 | |||
| 1097 | Ga0207656_10000175 | |||
| 1098 | Ga0207710_10001504 | |||
| 1099 | Ga0207688_10023893 | |||
| 1100 | Ga0207680_10000083 | |||
| 1101 | Ga0207680_10001745 | |||
| 1102 | Ga0207680_10004318 | |||
| 1103 | Ga0207680_10005002 | |||
| 1104 | Ga0207680_10030717 | |||
| 1105 | Ga0207647_10000025 | |||
| 1106 | Ga0207647_10010226 | |||
| 1107 | Ga0207647_10027985 | |||
| 1108 | Ga0207647_10048661 | |||
| 1109 | Ga0207685_10041568 | |||
| 1110 | Ga0207645_10002942 | |||
| 1111 | Ga0207645_10010028 | |||
| 1112 | Ga0207645_10056285 | |||
| 1113 | Ga0207645_10088844 | |||
| 1114 | Ga0207643_10002064 | |||
| 1115 | Ga0207643_10002411 | |||
| 1116 | Ga0207705_10023806 | |||
| 1117 | Ga0207705_10024738 | |||
| 1118 | Ga0207654_10000410 | |||
| 1119 | Ga0207654_10000632 | |||
| 1120 | Ga0207654_10003759 | |||
| 1121 | Ga0207707_10001019 | |||
| 1122 | Ga0207695_10000248 | |||
| 1123 | Ga0207695_10000351 | |||
| 1124 | Ga0207695_10012543 | |||
| 1125 | Ga0207695_10013252 | |||
| 1126 | Ga0207695_10023160 | |||
| 1127 | Ga0207695_10030135 | |||
| 1128 | Ga0207695_10033500 | |||
| 1129 | Ga0207695_10093703 | |||
| 1130 | Ga0207671_10000950 | |||
| 1131 | Ga0207671_10001185 | |||
| 1132 | Ga0207671_10001741 | |||
| 1133 | Ga0207671_10002635 | |||
| 1134 | Ga0207671_10007269 | |||
| 1135 | Ga0207671_10016637 | |||
| 1136 | Ga0207660_10001707 | |||
| 1137 | Ga0207662_10012527 | |||
| 1138 | Ga0207662_10016207 | |||
| 1139 | Ga0207657_10055955 | |||
| 1140 | Ga0207657_10110612 | |||
| 1141 | Ga0207649_10032834 | |||
| 1142 | Ga0207649_10038683 | |||
| 1143 | Ga0207649_10038814 | |||
| 1144 | Ga0207652_10000979 | |||
| 1145 | Ga0207681_10004454 | |||
| 1146 | Ga0207681_10008330 | |||
| 1147 | Ga0207681_10042048 | |||
| 1148 | Ga0207681_10114565 | |||
| 1149 | Ga0207681_10194068 | |||
| 1150 | Ga0207694_10049705 | |||
| 1151 | Ga0207650_10054184 | |||
| 1152 | Ga0207650_10149312 | |||
| 1153 | Ga0207659_10007095 | |||
| 1154 | Ga0207659_10026752 | |||
| 1155 | Ga0207659_10074408 | |||
| 1156 | Ga0207644_10037715 | |||
| 1157 | Ga0207644_10115200 | |||
| 1158 | Ga0207706_10009703 | |||
| 1159 | Ga0207706_10013950 | |||
| 1160 | Ga0207706_10028463 | |||
| 1161 | Ga0207706_10043830 | |||
| 1162 | Ga0207706_10046546 | |||
| 1163 | Ga0207686_10000857 | |||
| 1164 | Ga0207686_10006451 | |||
| 1165 | Ga0207686_10168630 | |||
| 1166 | Ga0207670_10066458 | |||
| 1167 | Ga0207670_10074828 | |||
| 1168 | Ga0207669_10049551 | |||
| 1169 | Ga0207704_10000494 | |||
| 1170 | Ga0207704_10150780 | |||
| 1171 | Ga0207691_10000004 | |||
| 1172 | Ga0207691_10002067 | |||
| 1173 | Ga0207691_10015352 | |||
| 1174 | Ga0207691_10020645 | |||
| 1175 | Ga0207691_10058840 | |||
| 1176 | Ga0207711_10216682 | |||
| 1177 | Ga0207689_10001078 | |||
| 1178 | Ga0207689_10002854 | |||
| 1179 | Ga0207689_10003903 | |||
| 1180 | Ga0207689_10013771 | |||
| 1181 | Ga0207689_10026483 | |||
| 1182 | Ga0207689_10080610 | |||
| 1183 | Ga0207689_10125031 | |||
| 1184 | Ga0207689_10199320 | |||
| 1185 | Ga0207661_10010033 | |||
| 1186 | Ga0207661_10012330 | |||
| 1187 | Ga0207661_10022488 | |||
| 1188 | Ga0207661_10037372 | |||
| 1189 | Ga0207661_10050801 | |||
| 1190 | Ga0207679_10001154 | |||
| 1191 | Ga0207679_10007296 | |||
| 1192 | Ga0207679_10007852 | |||
| 1193 | Ga0207679_10073471 | |||
| 1194 | Ga0207667_10001219 | |||
| 1195 | Ga0207667_10001760 | |||
| 1196 | Ga0207667_10009503 | |||
| 1197 | Ga0207667_10083333 | |||
| 1198 | Ga0207667_10088566 | |||
| 1199 | Ga0207667_10184108 | |||
| 1200 | Ga0207651_10000526 | |||
| 1201 | Ga0207651_10024502 | |||
| 1202 | Ga0207651_10204664 | |||
| 1203 | Ga0207712_10000864 | |||
| 1204 | Ga0207712_10000867 | |||
| 1205 | Ga0207712_10039352 | |||
| 1206 | Ga0207668_10000112 | |||
| 1207 | Ga0207668_10181608 | |||
| 1208 | Ga0207640_10185300 | |||
| 1209 | Ga0207640_10219053 | |||
| 1210 | Ga0207658_10000059 | |||
| 1211 | Ga0207658_10008893 | |||
| 1212 | Ga0207658_10016382 | |||
| 1213 | Ga0207658_10094504 | |||
| 1214 | Ga0207677_10000288 | |||
| 1215 | Ga0207677_10009397 | |||
| 1216 | Ga0207677_10044640 | |||
| 1217 | Ga0207677_10140809 | |||
| 1218 | Ga0207703_10000790 | |||
| 1219 | Ga0207703_10005525 | |||
| 1220 | Ga0207703_10320330 | |||
| 1221 | Ga0207639_10002779 | |||
| 1222 | Ga0207639_10003086 | |||
| 1223 | Ga0207639_10005047 | |||
| 1224 | Ga0207639_10014498 | |||
| 1225 | Ga0207639_10156409 | |||
| 1226 | Ga0207639_10176269 | |||
| 1227 | Ga0207678_10020743 | |||
| 1228 | Ga0207702_10026038 | |||
| 1229 | Ga0207641_10000159 | |||
| 1230 | Ga0207641_10000559 | |||
| 1231 | Ga0207641_10001256 | |||
| 1232 | Ga0207641_10054029 | |||
| 1233 | Ga0207641_10054252 | |||
| 1234 | Ga0207641_10198435 | |||
| 1235 | Ga0207648_10001434 | |||
| 1236 | Ga0207648_10001746 | |||
| 1237 | Ga0207648_10007739 | |||
| 1238 | Ga0207648_10023922 | |||
| 1239 | Ga0207648_10024041 | |||
| 1240 | Ga0207648_10053283 | |||
| 1241 | Ga0207648_10169766 | |||
| 1242 | Ga0207676_10000567 | |||
| 1243 | Ga0207676_10002025 | |||
| 1244 | Ga0207676_10014544 | |||
| 1245 | Ga0207674_10002233 | |||
| 1246 | Ga0207674_10002382 | |||
| 1247 | Ga0207674_10006589 | |||
| 1248 | Ga0207674_10018203 | |||
| 1249 | Ga0207674_10046601 | |||
| 1250 | Ga0207674_10129629 | |||
| 1251 | Ga0207674_10135121 | |||
| 1252 | Ga0207675_100000685 | |||
| 1253 | Ga0207675_100008916 | |||
| 1254 | Ga0207675_100009600 | |||
| 1255 | Ga0207675_100015533 | |||
| 1256 | Ga0207675_100105741 | |||
| 1257 | Ga0207675_100191050 | |||
| 1258 | Ga0207683_10003706 | |||
| 1259 | Ga0207683_10074101 | |||
| 1260 | Ga0207698_10000340 | |||
| 1261 | Ga0207698_10002890 | |||
| 1262 | Ga0207698_10067472 | |||
| 1263 | Ga0207698_10176805 | |||
| 1264 | Ga0207698_10254827 | |||
| 1265 | Ga0207428_10042013 | |||
| 1266 | Ga0268266_10000026 | |||
| 1267 | Ga0268266_10003590 | |||
| 1268 | Ga0268266_10095744 | |||
| 1269 | Ga0268265_10003213 | |||
| 1270 | Ga0268264_10000898 | |||
| 1271 | Ga0268264_10001824 | |||
| 1272 | Ga0268264_10004527 | |||
| 1273 | Ga0268264_10004655 | |||
| 1274 | Ga0268264_10015360 | |||
| 1275 | Ga0268264_10018041 | |||
| 1276 | Ga0268264_10039005 | |||
| 1277 | Ga0307517_10009664 | |||
| 1278 | Ga0307515_10000001 | |||
| 1279 | Ga0307515_10000021 | |||
| 1280 | Ga0307511_10001204 | |||
| 1281 | Ga0265340_10034790 | |||
| 1282 | Ga0265327_10000013 | |||
| 1283 | Ga0265327_10002699 | |||
| 1284 | Ga0307513_10066003 | |||
| 1285 | Ga0307509_10103411 | |||
| 1286 | Ga0307509_10115384 | |||
| 1287 | Ga0265313_10007658 | |||
| 1288 | Ga0307508_10000606 | |||
| 1289 | Ga0307516_10001745 | |||
| 1290 | Ga0307410_10195648 | |||
| 1291 | Ga0307411_10078142 | |||
| 1292 | Ga0307510_10003663 | |||
| 1293 | Ga0373955_0074653 | |||
| 1294 | Ga0373955_0083674 | |||
| 1295 | Ga0373937_0031384 | |||
| 1296 | Ga0373937_0071590 | |||
| 1297 | Ga0395905_0009831 | |||
| 1298 | Ga0395905_0026884 | |||
| 1299 | Ga0395905_0039790 | |||
| 1300 | Ga0436365_1141771 | |||
| 1301 | Ga0439436_0004608 | |||
| 1302 | Ga0439439_0011315 | |||
| 1303 | Ga0439453_0002926 | |||
| 1304 | Ga0451853_0248055 | |||
| 1305 | Ga0439441_010681 | |||
| 1306 | Ga0439449_0018081 | |||
| 1307 | Ga0439457_000635 | |||
| 1308 | Ga0439462_0000977 | |||
| 1309 | Ga0439434_0010377 | |||
| 1310 | Ga0451577_0089977 | |||
| 1311 | Ga0466969_0000172 | |||
| 1312 | Ga0466972_0000143 | |||
| 1313 | Ga0466972_0000591 | |||
| 1314 | Ga0466972_0004739 | |||
| 1315 | Ga0466966_0000038 | |||
| 1316 | Ga0466961_0022939 | |||
| 1317 | Ga0466961_0087719 | |||
| 1318 | Ga0453684_0017490 | |||
| 1319 | Ga0453684_0018180 | |||
| 1320 | Ga0453684_0075604 | |||
| 1321 | Ga0453684_0374795 | |||
| 1322 | Ga0466957_0005302 | |||
| 1323 | Ga0466957_0015471 | |||
| 1324 | Ga0466957_0059298 | |||
| 1325 | Ga0466959_0000698 | |||
| 1326 | Ga0495638_0071343 | |||
| 1327 | Ga0495638_0084325 | |||
| 1328 | Ga0495638_0117549 | |||
| 1329 | Ga0495606_0004455 | |||
| 1330 | Ga0495608_0168432 | |||
| 1331 | Ga0495643_0026639 | |||
| 1332 | Ga0495648_0001596 | |||
| 1333 | Ga0495587_0086790 | |||
| 1334 | Ga0495587_0087059 | |||
| 1335 | Ga0495622_0044007 | |||
| 1336 | Ga0495668_0000099 | |||
| 1337 | Ga0495668_0004679 | |||
| 1338 | Ga0495611_0000280 | |||
| 1339 | Ga0495625_0026123 | |||
| 1340 | Ga0495635_0062278 | |||
| 1341 | Ga0495636_0001268 | |||
| 1342 | Ga0495672_0012826 | |||
| 1343 | Ga0495672_0055753 | |||
| 1344 | Ga0495687_000058 | |||
| 1345 | Ga0495684_0128653 | |||
| 1346 | Ga0495686_0000005 | |||
| 1347 | Ga0495686_0014430 | |||
| 1348 | Ga0495686_0123818 | |||
| 1349 | Ga0496100_0038706 | |||
| 1350 | Ga0496109_0023045 | |||
| 1351 | Ga0496114_0011076 | |||
| 1352 | Ga0496114_0119919 | |||
| 1353 | Ga0501298_000195 | |||
| 1354 | Ga0501299_013956 | |||
| 1355 | Ga0501031_0010413 | |||
| 1356 | Ga0501031_0054382 | |||
| 1357 | Ga0501032_0000735 | |||
| 1358 | Ga0501032_0001336 | |||
| 1359 | Ga0501033_0019225 | |||
| 1360 | Ga0501034_0006480 | |||
| 1361 | Ga0501034_0030673 | |||
| 1362 | Ga0501034_0046017 | |||
| 1363 | Ga0501036_0004994 | |||
| 1364 | Ga0501036_0049327 | |||
| 1365 | Ga0501036_0158387 | |||
| 1366 | Ga0501037_0001415 | |||
| 1367 | Ga0501037_0012711 | |||
| 1368 | Ga0501037_0018531 | |||
| 1369 | Ga0501038_0003659 | |||
| 1370 | Ga0501038_0007086 | |||
| 1371 | Ga0501038_0016487 | |||
| 1372 | Ga0501039_0007627 | |||
| 1373 | Ga0501039_0040248 | |||
| 1374 | Ga0501039_0042013 | |||
| 1375 | Ga0501042_0046300 | |||
| 1376 | Ga0501043_0004298 | |||
| 1377 | Ga0501043_0008533 | |||
| 1378 | Ga0501043_0038139 | |||
| 1379 | Ga0501043_0224337 | |||
| 1380 | Ga0501046_0003858 | |||
| 1381 | Ga0501046_0098906 | |||
| 1382 | Ga0501046_0116060 | |||
| 1383 | Ga0501047_0007608 | |||
| 1384 | Ga0501047_0012369 | |||
| 1385 | Ga0501047_0013235 | |||
| 1386 | Ga0501047_0033924 | |||
| 1387 | Ga0501048_0005105 | |||
| 1388 | Ga0501067_0007330 | |||
| 1389 | Ga0501067_0008836 | |||
| 1390 | Ga0501070_0034418 | |||
| 1391 | Ga0501070_0039399 | |||
| 1392 | Ga0501073_0000937 | |||
| 1393 | Ga0501073_0008705 | |||
| 1394 | Ga0501074_0008062 | |||
| 1395 | Ga0501198_000331 | |||
| 1396 | Ga0501217_001669 | |||
| 1397 | Ga0501223_000646 | |||
| 1398 | Ga0501233_000276 | |||
| 1399 | Ga0501235_010130 | |||
| 1400 | Ga0501242_000091 | |||
| 1401 | Ga0501242_000098 | |||
| 1402 | Ga0501243_002915 | |||
| 1403 | Ga0501252_000098 | |||
| 1404 | Ga0501261_000450 | |||
| 1405 | Ga0501219_000177 | |||
| 1406 | Ga0501225_0000698 | |||
| 1407 | Ga0501225_0002309 | |||
| 1408 | Ga0501245_003979 | |||
| 1409 | Ga0501079_0035376 | |||
| 1410 | Ga0501079_0188036 | |||
| 1411 | Ga0501080_0044183 | |||
| 1412 | Ga0501080_0063052 | |||
| 1413 | Ga0501083_0000211 | |||
| 1414 | Ga0501083_0137190 | |||
| 1415 | Ga0501270_006857 | |||
| 1416 | Ga0501035_0011942 | |||
| 1417 | Ga0501035_0032978 | |||
| 1418 | Ga0501035_0068521 | |||
| 1419 | Ga0501044_0002128 | |||
| 1420 | Ga0501044_0002402 | |||
| 1421 | Ga0501044_0009921 | |||
| 1422 | Ga0501044_0162111 | |||
| 1423 | Ga0501045_0069800 | |||
| 1424 | Ga0501284_00051 | |||
| 1425 | nmdc:mga0k408_17548_c1 | |||
| 1426 | nmdc:mga0k408_8782_c1 | |||
| 1427 | nmdc:mga09592_7969_c1 | |||
| 1428 | nmdc:mga0qj67_134724_c1 | |||
| 1429 | nmdc:mga0qj67_34138_c1 | |||
| 1430 | nmdc:mga08y16_1783_c1 | |||
| 1431 | Ga0500578_0000961 | |||
| 1432 | Ga0500644_0001408 | |||
| 1433 | Ga0500646_0002797 | |||
| 1434 | Ga0500583_0000111 | |||
| 1435 | Ga0500583_0000860 | |||
| 1436 | Ga0500641_0009657 | |||
| 1437 | Ga0500559_0006375 | |||
| 1438 | Ga0500568_0001094 | |||
| 1439 | Ga0500568_0004392 | |||
| 1440 | Ga0500589_076341 | |||
| 1441 | Ga0500604_0019055 | |||
| 1442 | Ga0500616_0077844 | |||
| 1443 | Ga0500622_0001238 | |||
| 1444 | Ga0500611_000078 | |||
| 1445 | Ga0501084_0012860 | |||
| 1446 | Ga0501084_0079975 | |||
| 1447 | Ga0501082_0145152 | |||
| 1448 | Ga0466962_0031907 | |||
| 1449 | Ga0466962_0045937 | |||
| 1450 | 2738725891 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6bas-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) | 0.8735 | 12 | 406 |
| 6bar-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) | 0.8722 | 12 | 406 |
| 6bas-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda d255a mutant (q5six3_thet8) | 0.8546 | 12 | 406 |
| 6bar-assembly1.cif.gz_A | crystal structure of thermus thermophilus rod shape determining protein roda (q5six3_thet8) | 0.8476 | 12 | 406 |
| 8bh1-assembly1.cif.gz_A | core divisome complex ftswiqbl from pseudomonas aeruginosa | 0.8132 | 12 | 411 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_A4ICH4_855_1005_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.3714 | 71 | 175 | 3.40.50.300 |
| af_A0A0B4JCU2_1_137_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.325 | 59 | 191 | 1.20.140.150 |
| af_C0P5E5_13_169_1.20.140.150 | Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; | 0.3061 | 72 | 170 | 1.20.140.150 |
| af_A4ICH4_855_1005_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.2902 | 71 | 175 | 3.40.50.300 |
| af_P77219_8_153_1.20.1080.10 | Mainly Alpha;Up-down Bundle;Glycerol uptake facilitator protein;Glycerol uptake facilitator protein. | 0.2699 | 49 | 191 | 1.20.1080.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7C5QD26-F1-model_v4 | Rod shape-determining protein RodA | 0.9478 | 13 | 182 |
GO:0005886
GO:0008360 GO:0015648 GO:0016740 GO:0032153 GO:0051301 |
| AF-A0A7V3M3B6-F1-model_v4 | Rod shape-determining protein RodA | 0.8942 | 6 | 183 |
GO:0005886
GO:0008360 GO:0015648 GO:0016740 GO:0032153 GO:0051301 |
| AF-A0A7C5QD26-F1-model_v4 | Rod shape-determining protein RodA | 0.8873 | 13 | 182 |
GO:0005886
GO:0008360 GO:0015648 GO:0016740 GO:0032153 GO:0051301 |
| AF-A0A2V6U3J6-F1-model_v4 | Rod shape-determining protein RodA | 0.8777 | 6 | 183 |
GO:0005886
GO:0008360 GO:0015648 GO:0016740 GO:0032153 GO:0051301 |
| AF-A0A7V3M3B6-F1-model_v4 | Rod shape-determining protein RodA | 0.8708 | 6 | 183 |
GO:0005886
GO:0008360 GO:0015648 GO:0016740 GO:0032153 GO:0051301 |